F418567

General Info

Members Datasets Scaffolds Average Seq Length
351 218 351 148

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100622609|Ga0068859_1006226092
Length 156
Sequence MNDQGGLRDLYQEVILDHNRRPRNFGALPSANHQAEGYNPLCGDKVTVFLDLQDGRIQDVAFQGAGCAISTASASLMTEALKGKTVEEVREIFQGFHDLVTTGEGEGSEELGKLAVFSGVREFPMRVKCATLAWHTLLAALDEKSLDEQGQPVSTE

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
85 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
124 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
143 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
146 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
147 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
148 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
151 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
159 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
160 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
161 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
162 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
163 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
164 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
165 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
166 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
167 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
168 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
175 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
201 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.73
Metatranscriptomes 6.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.28
Rhizosphere 96.01
Stem 0
Stem Tuber 0
Unclassified 1.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10207417 3300001989 Bacteria 575
2 JGI24737J22298_10055385 3300001990 Bacteria 1199
3 Ga0058859_11459940 3300004798 Bacteria 1283
4 Ga0058863_10038424 3300004799 Bacteria 2009
5 Ga0058863_10601381 3300004799 Unclassified 603
6 Ga0058861_11282542 3300004800 Bacteria 1000
7 Ga0058861_11452431 3300004800 Bacteria 845
8 Ga0058862_12185742 3300004803 Bacteria 1181
9 Ga0065704_10569639 3300005289 Bacteria 624
10 Ga0065707_10178878 3300005295 Bacteria 1431
11 Ga0065707_10293235 3300005295 Bacteria 1020
12 Ga0065707_10326629 3300005295 Bacteria 957
13 Ga0070658_10199858 3300005327 Bacteria 1686
14 Ga0070658_10381874 3300005327 Bacteria 1209
15 Ga0070658_10408353 3300005327 Bacteria 1167
16 Ga0070683_100267913 3300005329 Bacteria 1625
17 Ga0070683_100298336 3300005329 Bacteria 1533
18 Ga0070690_100076021 3300005330 Bacteria 2190
19 Ga0070670_100766539 3300005331 Bacteria 870
20 Ga0070666_10006143 3300005335 Bacteria 7385
21 Ga0070666_10545784 3300005335 Bacteria 843
22 Ga0070680_100481100 3300005336 Bacteria 1061
23 Ga0070680_100757718 3300005336 Bacteria 836
24 Ga0070660_100039367 3300005339 Bacteria 3593
25 Ga0070660_100043277 3300005339 Bacteria 3441
26 Ga0070689_100815687 3300005340 Bacteria 821
27 Ga0070691_10142597 3300005341 Bacteria 1222
28 Ga0070691_10323163 3300005341 Bacteria 849
29 Ga0070661_100107556 3300005344 Bacteria 2080
30 Ga0070692_10015610 3300005345 Bacteria 3595
31 Ga0070688_100400904 3300005365 Bacteria 1015
32 Ga0070659_100094082 3300005366 Bacteria 2406
33 Ga0070659_101141216 3300005366 Bacteria 688
34 Ga0070709_10000021 3300005434 Bacteria 135637
35 Ga0070713_101245882 3300005436 Bacteria 720
36 Ga0070711_100000544 3300005439 Bacteria 19677
37 Ga0070700_100833491 3300005441 Bacteria 745
38 Ga0070694_100007785 3300005444 Bacteria 6537
39 Ga0070694_100285129 3300005444 Bacteria 1260
40 Ga0070708_100004873 3300005445 Bacteria 10600
41 Ga0070708_100127791 3300005445 Bacteria 2351
42 Ga0070708_100161974 3300005445 Bacteria 2085
43 Ga0070708_100237741 3300005445 Unclassified 1710
44 Ga0070663_100135685 3300005455 Unclassified 1873
45 Ga0070663_100628350 3300005455 Bacteria 906
46 Ga0070681_10182199 3300005458 Bacteria 2022
47 Ga0070681_10378112 3300005458 Bacteria 1327
48 Ga0070685_10001485 3300005466 Bacteria 12349
49 Ga0070706_100000656 3300005467 Bacteria 39553
50 Ga0070706_100176954 3300005467 Bacteria 1992
51 Ga0070706_100682980 3300005467 Bacteria 953
52 Ga0070706_101364367 3300005467 Bacteria 649
53 Ga0070707_100006739 3300005468 Bacteria 10645
54 Ga0070698_100143629 3300005471 Bacteria 2337
55 Ga0070698_100624582 3300005471 Bacteria 1018
56 Ga0070698_101002850 3300005471 Bacteria 782
57 Ga0070699_100009667 3300005518 Bacteria 8350
58 Ga0070699_100087833 3300005518 Bacteria 2715
59 Ga0070699_100478894 3300005518 Unclassified 1130
60 Ga0070679_100145934 3300005530 Bacteria 2344
61 Ga0070679_101342009 3300005530 Bacteria 661
62 Ga0070684_100567767 3300005535 Bacteria 1054
63 Ga0070697_100015008 3300005536 Bacteria 6080
64 Ga0070697_101788424 3300005536 Bacteria 550
65 Ga0068853_100014052 3300005539 Bacteria 6552
66 Ga0070695_100000401 3300005545 Bacteria 22435
67 Ga0070696_100003482 3300005546 Bacteria 10462
68 Ga0070696_100100505 3300005546 Bacteria 2072
69 Ga0070696_100226746 3300005546 Bacteria 1404
70 Ga0070696_100287665 3300005546 Bacteria 1255
71 Ga0070696_100590377 3300005546 Unclassified 894
72 Ga0070665_100000855 3300005548 Bacteria 39623
73 Ga0070665_100104014 3300005548 Bacteria 2842
74 Ga0070704_100043933 3300005549 Bacteria 3101
75 Ga0070704_100541827 3300005549 Bacteria 1016
76 Ga0068855_100011235 3300005563 Bacteria 10813
77 Ga0068855_100580407 3300005563 Bacteria 1211
78 Ga0068855_102403795 3300005563 Bacteria 526
79 Ga0070664_100112037 3300005564 Bacteria 2382
80 Ga0068857_100448316 3300005577 Unclassified 1206
81 Ga0068856_100035352 3300005614 Bacteria 4896
82 Ga0068856_100112524 3300005614 Bacteria 2720
83 Ga0068856_100117787 3300005614 Bacteria 2657
84 Ga0068859_100622609 3300005617 Bacteria 1172
85 Ga0068860_100010689 3300005843 Bacteria 9067
86 Ga0068862_100119883 3300005844 Bacteria 2318
87 Ga0081455_10023574 3300005937 Bacteria 5725
88 Ga0081538_10004248 3300005981 Bacteria 13285
89 Ga0081538_10020920 3300005981 Bacteria 4799
90 Ga0081538_10192529 3300005981 Bacteria 853
91 Ga0081538_10361385 3300005981 Bacteria 525
92 Ga0070717_10048383 3300006028 Bacteria 3487
93 Ga0075432_10121492 3300006058 Bacteria 981
94 Ga0070715_10102927 3300006163 Bacteria 1335
95 Ga0070716_101560949 3300006173 Bacteria 541
96 Ga0070712_100461823 3300006175 Bacteria 1059
97 Ga0097621_100092187 3300006237 Bacteria 2537
98 Ga0068871_100242230 3300006358 Bacteria 1568
99 Ga0075428_100017519 3300006844 Bacteria 7914
100 Ga0075428_100179196 3300006844 Bacteria 2294
101 Ga0075428_100356320 3300006844 Bacteria 1570
102 Ga0075430_100022639 3300006846 Bacteria 5347
103 Ga0075430_100368323 3300006846 Bacteria 1186
104 Ga0075430_101412456 3300006846 Bacteria 572
105 Ga0075430_101794704 3300006846 Bacteria 503
106 Ga0075431_100570386 3300006847 Bacteria 1118
107 Ga0075433_10035491 3300006852 Bacteria 4288
108 Ga0075433_10141884 3300006852 Bacteria 2135
109 Ga0075433_10572024 3300006852 Bacteria 993
110 Ga0075434_100103084 3300006871 Bacteria 2861
111 Ga0075434_100110700 3300006871 Bacteria 2757
112 Ga0075434_100575654 3300006871 Bacteria 1145
113 Ga0075434_100669011 3300006871 Bacteria 1056
114 Ga0075436_100006192 3300006914 Bacteria 8205
115 Ga0075436_100079322 3300006914 Bacteria 2274
116 Ga0075436_100138898 3300006914 Bacteria 1707
117 Ga0075436_100174155 3300006914 Bacteria 1519
118 Ga0097620_100622670 3300006931 Bacteria 1172
119 Ga0099794_10000007 3300007265 Bacteria 128667
120 Ga0105240_10552833 3300009093 Bacteria 1273
121 Ga0105240_12340324 3300009093 Bacteria 553
122 Ga0114129_10037452 3300009147 Bacteria 6847
123 Ga0114129_10101834 3300009147 Bacteria 3973
124 Ga0114129_10136329 3300009147 Bacteria 3368
125 Ga0114129_10269629 3300009147 Bacteria 2278
126 Ga0105241_10145448 3300009174 Bacteria 1934
127 Ga0105242_10190224 3300009176 Bacteria 1817
128 Ga0105239_10591083 3300010375 Bacteria 1266
129 Ga0157373_10215280 3300013100 Bacteria 1355
130 Ga0157371_10035036 3300013102 Bacteria 3598
131 Ga0157370_10139477 3300013104 Bacteria 2259
132 Ga0157370_10480522 3300013104 Bacteria 1142
133 Ga0157369_10029349 3300013105 Bacteria 6078
134 Ga0157369_10034440 3300013105 Bacteria 5558
135 Ga0157369_10269316 3300013105 Bacteria 1775
136 Ga0157369_10295948 3300013105 Bacteria 1684
137 Ga0157369_10552234 3300013105 Bacteria 1190
138 Ga0157374_10001458 3300013296 Bacteria 20000
139 Ga0157374_10272238 3300013296 Bacteria 1670
140 Ga0157372_10053279 3300013307 Bacteria 4509
141 Ga0157372_10327976 3300013307 Bacteria 1782
142 Ga0157372_10456802 3300013307 Bacteria 1489
143 Ga0157372_11970942 3300013307 Bacteria 671
144 Ga0157380_10847526 3300014326 Bacteria 935
145 Ga0157376_10968119 3300014969 Bacteria 872
146 Ga0184600_134857 3300019190 Bacteria 992
147 Ga0197907_11164194 3300020069 Bacteria 5719
148 Ga0206356_10111299 3300020070 Unclassified 1804
149 Ga0206356_11204744 3300020070 Bacteria 1404
150 Ga0206349_1000753 3300020075 Bacteria 2251
151 Ga0206349_1762819 3300020075 Bacteria 1436
152 Ga0206355_1299208 3300020076 Bacteria 1958
153 Ga0206355_1575501 3300020076 Bacteria 1124
154 Ga0206351_10893502 3300020077 Unclassified 962
155 Ga0206350_10978468 3300020080 Bacteria 978
156 Ga0206350_11090472 3300020080 Bacteria 5442
157 Ga0206354_10534867 3300020081 Bacteria 1625
158 Ga0213872_10017050 3300021361 Bacteria 3364
159 Ga0213876_10299344 3300021384 Bacteria 855
160 Ga0224712_10001025 3300022467 Bacteria 6117
161 Ga0224712_10001073 3300022467 Bacteria 6022
162 Ga0207680_10027039 3300025903 Bacteria 3188
163 Ga0207680_10605408 3300025903 Bacteria 784
164 Ga0207647_10116924 3300025904 Bacteria 1574
165 Ga0207699_10000005 3300025906 Bacteria 534560
166 Ga0207705_10436964 3300025909 Unclassified 1014
167 Ga0207705_10767485 3300025909 Bacteria 749
168 Ga0207684_10005196 3300025910 Bacteria 12109
169 Ga0207684_10144973 3300025910 Bacteria 2042
170 Ga0207684_10963781 3300025910 Bacteria 715
171 Ga0207654_10099862 3300025911 Bacteria 1786
172 Ga0207707_10452044 3300025912 Bacteria 1099
173 Ga0207663_10000009 3300025916 Bacteria 196493
174 Ga0207660_10208580 3300025917 Bacteria 1529
175 Ga0207660_10407225 3300025917 Bacteria 1096
176 Ga0207657_10041011 3300025919 Bacteria 4096
177 Ga0207649_10108388 3300025920 Bacteria 1851
178 Ga0207652_10631756 3300025921 Bacteria 958
179 Ga0207652_10952665 3300025921 Bacteria 756
180 Ga0207646_10002828 3300025922 Bacteria 20191
181 Ga0207646_10915870 3300025922 Bacteria 777
182 Ga0207700_10814318 3300025928 Bacteria 835
183 Ga0207690_10050943 3300025932 Bacteria 2766
184 Ga0207706_10095688 3300025933 Bacteria 2612
185 Ga0207686_10854189 3300025934 Bacteria 732
186 Ga0207665_10144858 3300025939 Bacteria 1697
187 Ga0207661_10050017 3300025944 Bacteria 3329
188 Ga0207679_10213348 3300025945 Bacteria 1620
189 Ga0207667_10131410 3300025949 Bacteria 2579
190 Ga0207667_11339220 3300025949 Bacteria 691
191 Ga0207667_11726158 3300025949 Bacteria 592
192 Ga0207640_10926743 3300025981 Bacteria 762
193 Ga0207639_10034438 3300026041 Bacteria 3743
194 Ga0207678_10146462 3300026067 Unclassified 2016
195 Ga0207678_10696009 3300026067 Bacteria 894
196 Ga0207708_10994848 3300026075 Bacteria 728
197 Ga0207702_10019223 3300026078 Bacteria 5651
198 Ga0207702_10022725 3300026078 Bacteria 5201
199 Ga0207702_10157853 3300026078 Bacteria 2069
200 Ga0209588_1040197 3300027671 Bacteria 1509
201 Ga0268266_10000427 3300028379 Bacteria 63335
202 Ga0268265_10427649 3300028380 Bacteria 1231
203 Ga0268264_10002291 3300028381 Bacteria 16954
204 Ga0265336_10000485 3300028666 Bacteria 23524
205 Ga0265338_10158924 3300028800 Unclassified 1748
206 Ga0265324_10000034 3300029957 Bacteria 124255
207 Ga0265324_10234346 3300029957 Bacteria 623
208 Ga0265328_10088414 3300031239 Bacteria 1144
209 Ga0265325_10000663 3300031241 Bacteria 25141
210 Ga0265325_10003316 3300031241 Bacteria 10584
211 Ga0265339_10002558 3300031249 Bacteria 12972
212 Ga0265331_10029215 3300031250 Bacteria 2753
213 Ga0265327_10002419 3300031251 Bacteria 19729
214 Ga0265316_10349404 3300031344 Bacteria 1071
215 Ga0307408_100064163 3300031548 Bacteria 2689
216 Ga0307408_100455369 3300031548 Bacteria 1111
217 Ga0265313_10018191 3300031595 Bacteria 3956
218 Ga0265314_10046954 3300031711 Bacteria 3043
219 Ga0316576_10121148 3300031727 Bacteria 1964
220 Ga0307413_10006166 3300031824 Bacteria 5445
221 Ga0307410_10053363 3300031852 Bacteria 2735
222 Ga0307406_11407432 3300031901 Unclassified 611
223 Ga0307407_10039264 3300031903 Bacteria 2631
224 Ga0307409_100235459 3300031995 Bacteria 1663
225 Ga0307409_100465950 3300031995 Bacteria 1223
226 Ga0307416_100700190 3300032002 Bacteria 1102
227 Ga0307414_10167509 3300032004 Bacteria 1753
228 Ga0307411_10260758 3300032005 Bacteria 1368
229 Ga0316583_10001942 3300032133 Bacteria 7068
230 Ga0316593_10000497 3300032168 Bacteria 7307
231 Ga0316592_1000173 3300033524 Bacteria 7563
232 Ga0373939_0047459 3300035114 Bacteria 1319
233 Ga0373960_0020484 3300035121 Bacteria 1749
234 Ga0373942_0069399 3300035207 Bacteria 1026
235 Ga0373962_0082899 3300035242 Unclassified 976
236 Ga0373931_0164577 3300035691 Bacteria 1302
237 Ga0373931_0318490 3300035691 Bacteria 965
238 Ga0316582_0222662 3300036647 Unclassified 1290
239 Ga0316584_0027884 3300036712 Bacteria 4159
240 Ga0395900_0020640 3300037418 Bacteria 6731
241 Ga0395898_0036494 3300037466 Bacteria 4880
242 Ga0395898_0070137 3300037466 Bacteria 3389
243 Ga0395898_1535655 3300037466 Bacteria 591
244 Ga0395905_0009947 3300037471 Bacteria 9267
245 Ga0436364_0304948 3300037853 Bacteria 1177
246 Ga0436364_0333719 3300037853 Bacteria 2405
247 Ga0395901_0102096 3300038443 Bacteria 3009
248 Ga0395901_1625368 3300038443 Bacteria 599
249 Ga0395901_2027107 3300038443 Bacteria 521
250 Ga0436365_1410085 3300039437 Bacteria 2300
251 Ga0436361_0675473 3300039447 Bacteria 17719
252 Ga0436361_1147859 3300039447 Bacteria 2419
253 Ga0436362_0499978 3300039453 Bacteria 1014
254 Ga0436362_0718366 3300039453 Bacteria 634
255 Ga0439436_0190555 3300041404 Unclassified 585
256 Ga0439439_0039311 3300041406 Bacteria 1222
257 Ga0451800_0169472 3300041459 Bacteria 732
258 Ga0451807_0902585 3300041486 Bacteria 866
259 Ga0451851_0852902 3300041507 Bacteria 646
260 Ga0439446_0014306 3300042156 Bacteria 2189
261 Ga0451577_0270326 3300042876 Bacteria 1539
262 Ga0451577_0552390 3300042876 Bacteria 1045
263 Ga0466969_0007697 3300044656 Bacteria 5729
264 Ga0466969_0178056 3300044656 Bacteria 973
265 Ga0453683_0253955 3300044673 Bacteria 1121
266 Ga0453683_0669779 3300044673 Bacteria 679
267 Ga0466961_0000106 3300044693 Bacteria 54734
268 Ga0453684_0200418 3300044712 Bacteria 2327
269 Ga0453684_0903524 3300044712 Bacteria 946
270 Ga0466959_0003720 3300045049 Bacteria 10073
271 Ga0466959_0068528 3300045049 Bacteria 2571
272 Ga0451576_0976420 3300045051 Bacteria 888
273 Ga0451576_1048245 3300045051 Bacteria 854
274 Ga0495586_0114777 3300046535 Bacteria 1501
275 Ga0495656_0069040 3300046615 Bacteria 1564
276 Ga0495659_0269290 3300046664 Unclassified 713
277 Ga0495658_0049381 3300046683 Bacteria 2376
278 Ga0495669_0205312 3300046684 Bacteria 943
279 Ga0495670_0247297 3300046691 Bacteria 950
280 Ga0496103_0153401 3300048906 Bacteria 1476
281 Ga0496104_0670630 3300048907 Bacteria 945
282 Ga0496105_0713437 3300048908 Bacteria 769
283 Ga0496106_1023150 3300048909 Bacteria 649
284 Ga0496112_0080542 3300048915 Bacteria 3220
285 Ga0496115_0008012 3300048918 Bacteria 7796
286 Ga0501031_0064504 3300049568 Bacteria 2386
287 Ga0501033_0171359 3300049570 Bacteria 1559
288 Ga0501034_0000209 3300049571 Bacteria 111455
289 Ga0501036_0094654 3300049572 Bacteria 2525
290 Ga0501036_0106081 3300049572 Bacteria 2376
291 Ga0501039_1032946 3300049575 Bacteria 638
292 Ga0501039_1523019 3300049575 Unclassified 514
293 Ga0501040_0009868 3300049576 Bacteria 6235
294 Ga0501040_0223494 3300049576 Bacteria 1340
295 Ga0501042_0080255 3300049578 Bacteria 2337
296 Ga0501042_0259239 3300049578 Bacteria 1255
297 Ga0501046_0060945 3300049580 Bacteria 2952
298 Ga0501046_0100857 3300049580 Bacteria 2215
299 Ga0501048_0044930 3300049582 Bacteria 3156
300 Ga0501071_0073582 3300049587 Bacteria 2493
301 Ga0501072_0111613 3300049588 Bacteria 2176
302 Ga0501072_0408935 3300049588 Bacteria 1076
303 Ga0501074_0053338 3300049590 Bacteria 2917
304 Ga0501075_0004754 3300049591 Bacteria 9232
305 Ga0501075_0186053 3300049591 Bacteria 1584
306 Ga0501075_0657554 3300049591 Bacteria 799
307 Ga0501076_0200393 3300049592 Bacteria 1630
308 Ga0501076_0208561 3300049592 Bacteria 1596
309 Ga0501076_0231799 3300049592 Bacteria 1509
310 Ga0501077_0061913 3300049593 Bacteria 2375
311 Ga0501077_0146928 3300049593 Bacteria 1495
312 Ga0501261_103032 3300049690 Unclassified 545
313 Ga0501225_0298820 3300049705 Unclassified 544
314 Ga0501079_0108697 3300049741 Bacteria 2153
315 Ga0501080_0215463 3300049742 Bacteria 1759
316 Ga0501080_0340952 3300049742 Bacteria 1354
317 Ga0501081_0024797 3300049743 Bacteria 4029
318 Ga0501081_0376079 3300049743 Bacteria 1049
319 Ga0501081_0719789 3300049743 Bacteria 750
320 Ga0501083_0093548 3300049744 Bacteria 1985
321 Ga0501035_1142035 3300049822 Bacteria 607
322 Ga0501045_0584495 3300049824 Bacteria 827
323 Ga0501045_0935918 3300049824 Bacteria 636
324 Ga0501045_1209562 3300049824 Unclassified 551
325 nmdc:mga05p37_106193_c1 3300050507 Bacteria 3454
326 nmdc:mga05p37_132283_c1 3300050507 Bacteria 3061
327 nmdc:mga0qj67_1169894_c1 3300050509 Bacteria 599
328 nmdc:mga0qj67_13853_c1 3300050509 Bacteria 6087
329 nmdc:mga0qj67_1417420_c1 3300050509 Bacteria 536
330 nmdc:mga06r32_137363_c1 3300050510 Bacteria 2419
331 nmdc:mga06r32_559361_c1 3300050510 Bacteria 1117
332 nmdc:mga0n895_234225_c1 3300050512 Bacteria 1864
333 nmdc:mga0n895_73500_c1 3300050512 Bacteria 3394
334 nmdc:mga0n895_819399_c1 3300050512 Bacteria 920
335 nmdc:mga0n895_889369_c1 3300050512 Bacteria 877
336 nmdc:mga0n895_937734_c1 3300050512 Bacteria 850
337 nmdc:mga0rr50_152180_c1 3300050513 Bacteria 1870
338 nmdc:mga0rr50_303161_c1 3300050513 Bacteria 1337
339 nmdc:mga08x19_1138314_c1 3300050514 Bacteria 554
340 nmdc:mga08x19_24299_c1 3300050514 Bacteria 3765
341 nmdc:mga08x19_7_c1 3300050514 Bacteria 437351
342 nmdc:mga0a205_159190_c1 3300050515 Bacteria 2155
343 nmdc:mga0a205_35440_c1 3300050515 Bacteria 4792
344 nmdc:mga0a205_560066_c1 3300050515 Bacteria 998
345 Ga0495601_0593452 3300053077 Unclassified 711
346 Ga0501084_0134383 3300054114 Bacteria 2082
347 Ga0501082_0472693 3300060353 Bacteria 1095
348 Ga0501082_1131403 3300060353 Bacteria 684
349 Ga0530510_0002937 3300061734 Bacteria 11691
350 Ga0530510_0090143 3300061734 Bacteria 2236
351 Ga0530510_0478443 3300061734 Bacteria 943

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041404 Ga0439436_0190555 Ga0439436_0190555_186_557 118
2 3300005441 Ga0070700_100833491 Ga0070700_1008334911 119
3 3300026075 Ga0207708_10994848 Ga0207708_109948482 119
4 3300046664 Ga0495659_0269290 Ga0495659_0269290_36_410 121
5 3300049575 Ga0501039_1523019 Ga0501039_1523019_40_414 121
6 3300005445 Ga0070708_100237741 Ga0070708_1002377412 122
7 3300005471 Ga0070698_100624582 Ga0070698_1006245822 122
8 3300005518 Ga0070699_100478894 Ga0070699_1004788942 122
9 3300005546 Ga0070696_100003482 Ga0070696_1000034823 122
10 3300049824 Ga0501045_0935918 Ga0501045_0935918_78_467 122
11 3300037466 Ga0395898_1535655 Ga0395898_1535655_21_404 123
12 3300049822 Ga0501035_1142035 Ga0501035_1142035_119_580 137
13 3300035691 Ga0373931_0318490 Ga0373931_0318490_199_630 138
14 3300049571 Ga0501034_0000209 Ga0501034_0000209_38391_38858 139
15 3300049572 Ga0501036_0106081 Ga0501036_0106081_1009_1476 139
16 3300005981 Ga0081538_10020920 Ga0081538_100209207 140
17 3300049588 Ga0501072_0408935 Ga0501072_0408935_298_732 141
18 3300060353 Ga0501082_1131403 Ga0501082_1131403_153_587 141
19 3300005445 Ga0070708_100004873 Ga0070708_10000487310 142
20 3300005445 Ga0070708_100161974 Ga0070708_1001619742 142
21 3300005468 Ga0070707_100006739 Ga0070707_1000067397 142
22 3300005518 Ga0070699_100009667 Ga0070699_1000096674 142
23 3300005518 Ga0070699_100087833 Ga0070699_1000878333 142
24 3300005536 Ga0070697_100015008 Ga0070697_1000150083 142
25 3300005546 Ga0070696_100100505 Ga0070696_1001005051 142
26 3300006058 Ga0075432_10121492 Ga0075432_101214922 142
27 3300006852 Ga0075433_10035491 Ga0075433_100354915 142
28 3300006871 Ga0075434_100575654 Ga0075434_1005756542 142
29 3300006914 Ga0075436_100138898 Ga0075436_1001388983 142
30 3300007265 Ga0099794_10000007 Ga0099794_1000000751 142
31 3300009147 Ga0114129_10136329 Ga0114129_101363292 142
32 3300009147 Ga0114129_10269629 Ga0114129_102696292 142
33 3300025910 Ga0207684_10005196 Ga0207684_100051968 142
34 3300025922 Ga0207646_10002828 Ga0207646_1000282820 142
35 3300027671 Ga0209588_1040197 Ga0209588_10401972 142
36 3300028800 Ga0265338_10158924 Ga0265338_101589242 142
37 3300031548 Ga0307408_100064163 Ga0307408_1000641632 142
38 3300031548 Ga0307408_100455369 Ga0307408_1004553692 142
39 3300031824 Ga0307413_10006166 Ga0307413_100061664 142
40 3300031852 Ga0307410_10053363 Ga0307410_100533635 142
41 3300031903 Ga0307407_10039264 Ga0307407_100392646 142
42 3300031995 Ga0307409_100235459 Ga0307409_1002354592 142
43 3300031995 Ga0307409_100465950 Ga0307409_1004659502 142
44 3300032002 Ga0307416_100700190 Ga0307416_1007001902 142
45 3300032004 Ga0307414_10167509 Ga0307414_101675092 142
46 3300032005 Ga0307411_10260758 Ga0307411_102607582 142
47 3300037418 Ga0395900_0020640 Ga0395900_0020640_1613_2056 142
48 3300037466 Ga0395898_0036494 Ga0395898_0036494_1334_1777 142
49 3300038443 Ga0395901_0102096 Ga0395901_0102096_2381_2824 142
50 3300038443 Ga0395901_2027107 Ga0395901_2027107_51_494 142
51 3300041406 Ga0439439_0039311 Ga0439439_0039311_122_565 142
52 3300042156 Ga0439446_0014306 Ga0439446_0014306_1255_1698 142
53 3300046615 Ga0495656_0069040 Ga0495656_0069040_832_1275 142
54 3300046684 Ga0495669_0205312 Ga0495669_0205312_358_801 142
55 3300046691 Ga0495670_0247297 Ga0495670_0247297_419_862 142
56 3300049572 Ga0501036_0094654 Ga0501036_0094654_129_572 142
57 3300049575 Ga0501039_1032946 Ga0501039_1032946_102_545 142
58 3300049576 Ga0501040_0223494 Ga0501040_0223494_824_1267 142
59 3300049578 Ga0501042_0259239 Ga0501042_0259239_226_669 142
60 3300049580 Ga0501046_0060945 Ga0501046_0060945_457_900 142
61 3300049587 Ga0501071_0073582 Ga0501071_0073582_1138_1581 142
62 3300049588 Ga0501072_0111613 Ga0501072_0111613_610_1053 142
63 3300049590 Ga0501074_0053338 Ga0501074_0053338_582_1025 142
64 3300049591 Ga0501075_0004754 Ga0501075_0004754_1426_1869 142
65 3300049592 Ga0501076_0208561 Ga0501076_0208561_767_1210 142
66 3300049593 Ga0501077_0146928 Ga0501077_0146928_403_846 142
67 3300049741 Ga0501079_0108697 Ga0501079_0108697_302_745 142
68 3300049742 Ga0501080_0215463 Ga0501080_0215463_317_760 142
69 3300049743 Ga0501081_0024797 Ga0501081_0024797_2816_3259 142
70 3300049744 Ga0501083_0093548 Ga0501083_0093548_525_968 142
71 3300050507 nmdc:mga05p37_106193_c1 nmdc:mga05p37_106193_c1_2929_3372 142
72 3300050507 nmdc:mga05p37_132283_c1 nmdc:mga05p37_132283_c1_2487_2930 142
73 3300050512 nmdc:mga0n895_889369_c1 nmdc:mga0n895_889369_c1_154_597 142
74 3300050512 nmdc:mga0n895_937734_c1 nmdc:mga0n895_937734_c1_154_597 142
75 3300050513 nmdc:mga0rr50_303161_c1 nmdc:mga0rr50_303161_c1_230_673 142
76 3300050515 nmdc:mga0a205_35440_c1 nmdc:mga0a205_35440_c1_734_1177 142
77 3300054114 Ga0501084_0134383 Ga0501084_0134383_295_738 142
78 3300060353 Ga0501082_0472693 Ga0501082_0472693_429_872 142
79 3300061734 Ga0530510_0090143 Ga0530510_0090143_610_1053 142
80 3300005289 Ga0065704_10569639 Ga0065704_105696391 144
81 3300005295 Ga0065707_10178878 Ga0065707_101788782 144
82 3300025933 Ga0207706_10095688 Ga0207706_100956883 144
83 3300031241 Ga0265325_10003316 Ga0265325_100033167 144
84 3300031249 Ga0265339_10002558 Ga0265339_100025589 144
85 3300031250 Ga0265331_10029215 Ga0265331_100292154 144
86 3300031344 Ga0265316_10349404 Ga0265316_103494042 144
87 3300031595 Ga0265313_10018191 Ga0265313_100181914 144
88 3300006871 Ga0075434_100110700 Ga0075434_1001107002 145
89 3300009147 Ga0114129_10101834 Ga0114129_101018343 145
90 3300031239 Ga0265328_10088414 Ga0265328_100884143 145
91 3300044656 Ga0466969_0178056 Ga0466969_0178056_125_583 145
92 3300045049 Ga0466959_0068528 Ga0466959_0068528_151_609 145
93 3300004798 Ga0058859_11459940 Ga0058859_114599402 146
94 3300005295 Ga0065707_10293235 Ga0065707_102932352 146
95 3300005295 Ga0065707_10326629 Ga0065707_103266291 146
96 3300005327 Ga0070658_10381874 Ga0070658_103818742 146
97 3300005330 Ga0070690_100076021 Ga0070690_1000760213 146
98 3300005331 Ga0070670_100766539 Ga0070670_1007665392 146
99 3300005335 Ga0070666_10006143 Ga0070666_100061438 146
100 3300005335 Ga0070666_10545784 Ga0070666_105457842 146
101 3300005340 Ga0070689_100815687 Ga0070689_1008156871 146
102 3300005341 Ga0070691_10142597 Ga0070691_101425972 146
103 3300005341 Ga0070691_10323163 Ga0070691_103231631 146
104 3300005444 Ga0070694_100007785 Ga0070694_1000077851 146
105 3300005466 Ga0070685_10001485 Ga0070685_1000148510 146
106 3300005471 Ga0070698_101002850 Ga0070698_1010028502 146
107 3300005545 Ga0070695_100000401 Ga0070695_1000004019 146
108 3300005548 Ga0070665_100000855 Ga0070665_10000085518 146
109 3300005617 Ga0068859_100622609 Ga0068859_1006226092 146
110 3300006844 Ga0075428_100179196 Ga0075428_1001791962 146
111 3300006852 Ga0075433_10572024 Ga0075433_105720241 146
112 3300006871 Ga0075434_100103084 Ga0075434_1001030843 146
113 3300006914 Ga0075436_100079322 Ga0075436_1000793222 146
114 3300006931 Ga0097620_100622670 Ga0097620_1006226702 146
115 3300009176 Ga0105242_10190224 Ga0105242_101902244 146
116 3300014326 Ga0157380_10847526 Ga0157380_108475262 146
117 3300019190 Ga0184600_134857 Ga0184600_1348572 146
118 3300025903 Ga0207680_10027039 Ga0207680_100270393 146
119 3300025903 Ga0207680_10605408 Ga0207680_106054082 146
120 3300025934 Ga0207686_10854189 Ga0207686_108541892 146
121 3300028379 Ga0268266_10000427 Ga0268266_1000042757 146
122 3300028666 Ga0265336_10000485 Ga0265336_1000048516 146
123 3300029957 Ga0265324_10000034 Ga0265324_1000003489 146
124 3300029957 Ga0265324_10234346 Ga0265324_102343461 146
125 3300031241 Ga0265325_10000663 Ga0265325_1000066321 146
126 3300031251 Ga0265327_10002419 Ga0265327_1000241913 146
127 3300031711 Ga0265314_10046954 Ga0265314_100469543 146
128 3300031727 Ga0316576_10121148 Ga0316576_101211483 146
129 3300032168 Ga0316593_10000497 Ga0316593_100004974 146
130 3300033524 Ga0316592_1000173 Ga0316592_10001736 146
131 3300035114 Ga0373939_0047459 Ga0373939_0047459_330_776 146
132 3300035121 Ga0373960_0020484 Ga0373960_0020484_1186_1638 146
133 3300035207 Ga0373942_0069399 Ga0373942_0069399_362_814 146
134 3300035242 Ga0373962_0082899 Ga0373962_0082899_435_887 146
135 3300035691 Ga0373931_0164577 Ga0373931_0164577_139_591 146
136 3300036647 Ga0316582_0222662 Ga0316582_0222662_484_927 146
137 3300036712 Ga0316584_0027884 Ga0316584_0027884_3255_3698 146
138 3300041459 Ga0451800_0169472 Ga0451800_0169472_150_596 146
139 3300042876 Ga0451577_0270326 Ga0451577_0270326_560_1000 146
140 3300042876 Ga0451577_0552390 Ga0451577_0552390_226_666 146
141 3300044656 Ga0466969_0007697 Ga0466969_0007697_1049_1510 146
142 3300044693 Ga0466961_0000106 Ga0466961_0000106_5328_5789 146
143 3300044712 Ga0453684_0200418 Ga0453684_0200418_947_1387 146
144 3300044712 Ga0453684_0903524 Ga0453684_0903524_367_807 146
145 3300045049 Ga0466959_0003720 Ga0466959_0003720_6205_6666 146
146 3300045051 Ga0451576_1048245 Ga0451576_1048245_233_673 146
147 3300046535 Ga0495586_0114777 Ga0495586_0114777_708_1160 146
148 3300046683 Ga0495658_0049381 Ga0495658_0049381_740_1192 146
149 3300049570 Ga0501033_0171359 Ga0501033_0171359_583_1029 146
150 3300049576 Ga0501040_0009868 Ga0501040_0009868_5607_6053 146
151 3300049578 Ga0501042_0080255 Ga0501042_0080255_958_1404 146
152 3300049580 Ga0501046_0100857 Ga0501046_0100857_423_869 146
153 3300049582 Ga0501048_0044930 Ga0501048_0044930_1754_2200 146
154 3300049591 Ga0501075_0186053 Ga0501075_0186053_187_633 146
155 3300049592 Ga0501076_0231799 Ga0501076_0231799_47_493 146
156 3300049593 Ga0501077_0061913 Ga0501077_0061913_197_643 146
157 3300049742 Ga0501080_0340952 Ga0501080_0340952_679_1125 146
158 3300049743 Ga0501081_0376079 Ga0501081_0376079_379_825 146
159 3300049824 Ga0501045_0584495 Ga0501045_0584495_190_636 146
160 3300050512 nmdc:mga0n895_234225_c1 nmdc:mga0n895_234225_c1_796_1242 146
161 3300050512 nmdc:mga0n895_73500_c1 nmdc:mga0n895_73500_c1_1306_1758 146
162 3300050513 nmdc:mga0rr50_152180_c1 nmdc:mga0rr50_152180_c1_1407_1853 146
163 3300050514 nmdc:mga08x19_1138314_c1 nmdc:mga08x19_1138314_c1_57_503 146
164 3300050515 nmdc:mga0a205_560066_c1 nmdc:mga0a205_560066_c1_179_625 146
165 3300061734 Ga0530510_0002937 Ga0530510_0002937_826_1272 146
166 3300004799 Ga0058863_10038424 Ga0058863_100384245 147
167 3300004799 Ga0058863_10601381 Ga0058863_106013811 147
168 3300004800 Ga0058861_11282542 Ga0058861_112825422 147
169 3300004800 Ga0058861_11452431 Ga0058861_114524312 147
170 3300004803 Ga0058862_12185742 Ga0058862_121857422 147
171 3300005327 Ga0070658_10199858 Ga0070658_101998582 147
172 3300005329 Ga0070683_100267913 Ga0070683_1002679134 147
173 3300005329 Ga0070683_100298336 Ga0070683_1002983361 147
174 3300005336 Ga0070680_100481100 Ga0070680_1004811003 147
175 3300005336 Ga0070680_100757718 Ga0070680_1007577182 147
176 3300005365 Ga0070688_100400904 Ga0070688_1004009042 147
177 3300005366 Ga0070659_101141216 Ga0070659_1011412161 147
178 3300005439 Ga0070711_100000544 Ga0070711_1000005445 147
179 3300005445 Ga0070708_100127791 Ga0070708_1001277912 147
180 3300005455 Ga0070663_100135685 Ga0070663_1001356852 147
181 3300005455 Ga0070663_100628350 Ga0070663_1006283502 147
182 3300005458 Ga0070681_10182199 Ga0070681_101821993 147
183 3300005467 Ga0070706_100176954 Ga0070706_1001769542 147
184 3300005467 Ga0070706_100682980 Ga0070706_1006829802 147
185 3300005467 Ga0070706_101364367 Ga0070706_1013643672 147
186 3300005530 Ga0070679_100145934 Ga0070679_1001459341 147
187 3300005530 Ga0070679_101342009 Ga0070679_1013420092 147
188 3300005535 Ga0070684_100567767 Ga0070684_1005677672 147
189 3300005536 Ga0070697_101788424 Ga0070697_1017884241 147
190 3300005546 Ga0070696_100226746 Ga0070696_1002267462 147
191 3300005546 Ga0070696_100590377 Ga0070696_1005903772 147
192 3300005577 Ga0068857_100448316 Ga0068857_1004483161 147
193 3300005614 Ga0068856_100112524 Ga0068856_1001125242 147
194 3300005843 Ga0068860_100010689 Ga0068860_1000106894 147
195 3300005844 Ga0068862_100119883 Ga0068862_1001198831 147
196 3300005937 Ga0081455_10023574 Ga0081455_100235746 147
197 3300005981 Ga0081538_10004248 Ga0081538_100042486 147
198 3300005981 Ga0081538_10192529 Ga0081538_101925292 147
199 3300005981 Ga0081538_10361385 Ga0081538_103613851 147
200 3300006175 Ga0070712_100461823 Ga0070712_1004618232 147
201 3300006844 Ga0075428_100017519 Ga0075428_1000175194 147
202 3300006844 Ga0075428_100356320 Ga0075428_1003563202 147
203 3300006846 Ga0075430_100022639 Ga0075430_1000226393 147
204 3300006846 Ga0075430_100368323 Ga0075430_1003683231 147
205 3300006846 Ga0075430_101412456 Ga0075430_1014124561 147
206 3300006846 Ga0075430_101794704 Ga0075430_1017947041 147
207 3300006847 Ga0075431_100570386 Ga0075431_1005703863 147
208 3300006852 Ga0075433_10141884 Ga0075433_101418844 147
209 3300006871 Ga0075434_100669011 Ga0075434_1006690112 147
210 3300006914 Ga0075436_100006192 Ga0075436_1000061926 147
211 3300006914 Ga0075436_100174155 Ga0075436_1001741552 147
212 3300009093 Ga0105240_10552833 Ga0105240_105528332 147
213 3300009093 Ga0105240_12340324 Ga0105240_123403242 147
214 3300013104 Ga0157370_10139477 Ga0157370_101394772 147
215 3300013104 Ga0157370_10480522 Ga0157370_104805221 147
216 3300013105 Ga0157369_10269316 Ga0157369_102693164 147
217 3300013105 Ga0157369_10295948 Ga0157369_102959483 147
218 3300013105 Ga0157369_10552234 Ga0157369_105522342 147
219 3300020069 Ga0197907_11164194 Ga0197907_111641943 147
220 3300020070 Ga0206356_10111299 Ga0206356_101112992 147
221 3300020070 Ga0206356_11204744 Ga0206356_112047442 147
222 3300020075 Ga0206349_1000753 Ga0206349_10007532 147
223 3300020075 Ga0206349_1762819 Ga0206349_17628192 147
224 3300020076 Ga0206355_1299208 Ga0206355_12992082 147
225 3300020076 Ga0206355_1575501 Ga0206355_15755012 147
226 3300020077 Ga0206351_10893502 Ga0206351_108935022 147
227 3300020080 Ga0206350_10978468 Ga0206350_109784682 147
228 3300020080 Ga0206350_11090472 Ga0206350_110904725 147
229 3300020081 Ga0206354_10534867 Ga0206354_105348672 147
230 3300021361 Ga0213872_10017050 Ga0213872_100170503 147
231 3300021384 Ga0213876_10299344 Ga0213876_102993442 147
232 3300022467 Ga0224712_10001025 Ga0224712_100010255 147
233 3300022467 Ga0224712_10001073 Ga0224712_100010733 147
234 3300025904 Ga0207647_10116924 Ga0207647_101169242 147
235 3300025909 Ga0207705_10436964 Ga0207705_104369641 147
236 3300025910 Ga0207684_10144973 Ga0207684_101449732 147
237 3300025910 Ga0207684_10963781 Ga0207684_109637811 147
238 3300025912 Ga0207707_10452044 Ga0207707_104520441 147
239 3300025916 Ga0207663_10000009 Ga0207663_10000009154 147
240 3300025917 Ga0207660_10208580 Ga0207660_102085803 147
241 3300025917 Ga0207660_10407225 Ga0207660_104072252 147
242 3300025921 Ga0207652_10631756 Ga0207652_106317563 147
243 3300025921 Ga0207652_10952665 Ga0207652_109526652 147
244 3300025944 Ga0207661_10050017 Ga0207661_100500174 147
245 3300025981 Ga0207640_10926743 Ga0207640_109267431 147
246 3300026067 Ga0207678_10146462 Ga0207678_101464624 147
247 3300026067 Ga0207678_10696009 Ga0207678_106960092 147
248 3300026078 Ga0207702_10157853 Ga0207702_101578532 147
249 3300028380 Ga0268265_10427649 Ga0268265_104276492 147
250 3300028381 Ga0268264_10002291 Ga0268264_100022915 147
251 3300031901 Ga0307406_11407432 Ga0307406_114074321 147
252 3300032133 Ga0316583_10001942 Ga0316583_100019425 147
253 3300037466 Ga0395898_0070137 Ga0395898_0070137_1976_2419 147
254 3300037471 Ga0395905_0009947 Ga0395905_0009947_6415_6858 147
255 3300037853 Ga0436364_0304948 Ga0436364_0304948_663_1106 147
256 3300037853 Ga0436364_0333719 Ga0436364_0333719_676_1119 147
257 3300038443 Ga0395901_1625368 Ga0395901_1625368_133_576 147
258 3300039437 Ga0436365_1410085 Ga0436365_1410085_1627_2070 147
259 3300039447 Ga0436361_0675473 Ga0436361_0675473_1066_1509 147
260 3300039447 Ga0436361_1147859 Ga0436361_1147859_1273_1716 147
261 3300039453 Ga0436362_0499978 Ga0436362_0499978_414_857 147
262 3300039453 Ga0436362_0718366 Ga0436362_0718366_17_460 147
263 3300041486 Ga0451807_0902585 Ga0451807_0902585_101_565 147
264 3300041507 Ga0451851_0852902 Ga0451851_0852902_100_567 147
265 3300044673 Ga0453683_0253955 Ga0453683_0253955_396_848 147
266 3300045051 Ga0451576_0976420 Ga0451576_0976420_275_724 147
267 3300049568 Ga0501031_0064504 Ga0501031_0064504_996_1445 147
268 3300049591 Ga0501075_0657554 Ga0501075_0657554_149_598 147
269 3300049592 Ga0501076_0200393 Ga0501076_0200393_99_548 147
270 3300049690 Ga0501261_103032 Ga0501261_103032_71_523 147
271 3300049705 Ga0501225_0298820 Ga0501225_0298820_81_533 147
272 3300049743 Ga0501081_0719789 Ga0501081_0719789_77_526 147
273 3300049824 Ga0501045_1209562 Ga0501045_1209562_24_473 147
274 3300050509 nmdc:mga0qj67_1169894_c1 nmdc:mga0qj67_1169894_c1_17_469 147
275 3300050509 nmdc:mga0qj67_13853_c1 nmdc:mga0qj67_13853_c1_4420_4872 147
276 3300050509 nmdc:mga0qj67_1417420_c1 nmdc:mga0qj67_1417420_c1_48_500 147
277 3300050510 nmdc:mga06r32_137363_c1 nmdc:mga06r32_137363_c1_654_1106 147
278 3300050510 nmdc:mga06r32_559361_c1 nmdc:mga06r32_559361_c1_72_524 147
279 3300050512 nmdc:mga0n895_819399_c1 nmdc:mga0n895_819399_c1_247_696 147
280 3300050514 nmdc:mga08x19_24299_c1 nmdc:mga08x19_24299_c1_996_1445 147
281 3300050514 nmdc:mga08x19_7_c1 nmdc:mga08x19_7_c1_243994_244443 147
282 3300050515 nmdc:mga0a205_159190_c1 nmdc:mga0a205_159190_c1_1191_1640 147
283 3300053077 Ga0495601_0593452 Ga0495601_0593452_33_476 147
284 3300061734 Ga0530510_0478443 Ga0530510_0478443_162_614 147
285 3300001989 JGI24739J22299_10207417 JGI24739J22299_102074172 148
286 3300001990 JGI24737J22298_10055385 JGI24737J22298_100553852 148
287 3300005327 Ga0070658_10408353 Ga0070658_104083532 148
288 3300005339 Ga0070660_100039367 Ga0070660_1000393671 148
289 3300005339 Ga0070660_100043277 Ga0070660_1000432774 148
290 3300005344 Ga0070661_100107556 Ga0070661_1001075563 148
291 3300005345 Ga0070692_10015610 Ga0070692_100156103 148
292 3300005366 Ga0070659_100094082 Ga0070659_1000940822 148
293 3300005434 Ga0070709_10000021 Ga0070709_1000002168 148
294 3300005436 Ga0070713_101245882 Ga0070713_1012458822 148
295 3300005444 Ga0070694_100285129 Ga0070694_1002851292 148
296 3300005458 Ga0070681_10378112 Ga0070681_103781123 148
297 3300005467 Ga0070706_100000656 Ga0070706_1000006568 148
298 3300005471 Ga0070698_100143629 Ga0070698_1001436292 148
299 3300005539 Ga0068853_100014052 Ga0068853_1000140526 148
300 3300005546 Ga0070696_100287665 Ga0070696_1002876652 148
301 3300005548 Ga0070665_100104014 Ga0070665_1001040143 148
302 3300005549 Ga0070704_100043933 Ga0070704_1000439333 148
303 3300005549 Ga0070704_100541827 Ga0070704_1005418272 148
304 3300005563 Ga0068855_100011235 Ga0068855_10001123512 148
305 3300005563 Ga0068855_100580407 Ga0068855_1005804072 148
306 3300005563 Ga0068855_102403795 Ga0068855_1024037951 148
307 3300005564 Ga0070664_100112037 Ga0070664_1001120373 148
308 3300005614 Ga0068856_100035352 Ga0068856_1000353524 148
309 3300005614 Ga0068856_100117787 Ga0068856_1001177874 148
310 3300006028 Ga0070717_10048383 Ga0070717_100483832 148
311 3300006163 Ga0070715_10102927 Ga0070715_101029272 148
312 3300006173 Ga0070716_101560949 Ga0070716_1015609491 148
313 3300006237 Ga0097621_100092187 Ga0097621_1000921874 148
314 3300006358 Ga0068871_100242230 Ga0068871_1002422303 148
315 3300009147 Ga0114129_10037452 Ga0114129_100374525 148
316 3300009174 Ga0105241_10145448 Ga0105241_101454483 148
317 3300010375 Ga0105239_10591083 Ga0105239_105910833 148
318 3300013100 Ga0157373_10215280 Ga0157373_102152802 148
319 3300013102 Ga0157371_10035036 Ga0157371_100350364 148
320 3300013105 Ga0157369_10029349 Ga0157369_100293495 148
321 3300013105 Ga0157369_10034440 Ga0157369_100344404 148
322 3300013296 Ga0157374_10001458 Ga0157374_100014587 148
323 3300013296 Ga0157374_10272238 Ga0157374_102722382 148
324 3300013307 Ga0157372_10053279 Ga0157372_100532796 148
325 3300013307 Ga0157372_10327976 Ga0157372_103279762 148
326 3300013307 Ga0157372_10456802 Ga0157372_104568022 148
327 3300013307 Ga0157372_11970942 Ga0157372_119709421 148
328 3300014969 Ga0157376_10968119 Ga0157376_109681191 148
329 3300025906 Ga0207699_10000005 Ga0207699_10000005139 148
330 3300025909 Ga0207705_10767485 Ga0207705_107674852 148
331 3300025911 Ga0207654_10099862 Ga0207654_100998622 148
332 3300025919 Ga0207657_10041011 Ga0207657_100410113 148
333 3300025920 Ga0207649_10108388 Ga0207649_101083882 148
334 3300025922 Ga0207646_10915870 Ga0207646_109158702 148
335 3300025928 Ga0207700_10814318 Ga0207700_108143182 148
336 3300025932 Ga0207690_10050943 Ga0207690_100509432 148
337 3300025939 Ga0207665_10144858 Ga0207665_101448583 148
338 3300025945 Ga0207679_10213348 Ga0207679_102133482 148
339 3300025949 Ga0207667_10131410 Ga0207667_101314104 148
340 3300025949 Ga0207667_11339220 Ga0207667_113392202 148
341 3300025949 Ga0207667_11726158 Ga0207667_117261581 148
342 3300026041 Ga0207639_10034438 Ga0207639_100344383 148
343 3300026078 Ga0207702_10019223 Ga0207702_100192234 148
344 3300026078 Ga0207702_10022725 Ga0207702_100227254 148
345 3300044673 Ga0453683_0669779 Ga0453683_0669779_71_526 148
346 3300048906 Ga0496103_0153401 Ga0496103_0153401_462_908 148
347 3300048907 Ga0496104_0670630 Ga0496104_0670630_322_768 148
348 3300048908 Ga0496105_0713437 Ga0496105_0713437_205_651 148
349 3300048909 Ga0496106_1023150 Ga0496106_1023150_10_456 148
350 3300048915 Ga0496112_0080542 Ga0496112_0080542_2099_2545 148
351 3300048918 Ga0496115_0008012 Ga0496115_0008012_863_1309 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01592

NifU_N

NifU-like N terminal domain

10

142

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qq4-assembly2.cif.gz_D crystal structure of iron-sulfur cluster biosynthesis protein iscu (ttha1736) from thermus thermophilus hb8 0.964 5 139
6jzv-assembly4.cif.gz_D crystal structure of sufu from bacillus subtilis 0.9561 5 139
6jzw-assembly4.cif.gz_D crystal structure of sufu from bacillus subtilis with cys persulfurated 0.9484 2 138
2qq4-assembly2.cif.gz_D crystal structure of iron-sulfur cluster biosynthesis protein iscu (ttha1736) from thermus thermophilus hb8 0.9436 5 139
6jzw-assembly2.cif.gz_B crystal structure of sufu from bacillus subtilis with cys persulfurated 0.9377 2 138
ID Description Score Start End Superfamily
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9785 5 139 3.90.1010.10
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9575 5 139 3.90.1010.10
af_O53156_2_157_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9528 5 139 3.90.1010.10
5xt5C00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9111 4 137 3.90.1010.10
5xt5C00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8982 4 137 3.90.1010.10
ID Description Score Start End GO Terms
AF-A0A349K914-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.9905 4 89 GO:0005506
GO:0016226
GO:0051536
AF-A0A7W1K4Z9-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.9832 4 89 GO:0005506
GO:0016226
GO:0051536
AF-A0A5J6SVW0-F1-model_v4 deleted 0.9814 4 140
AF-A0A0K1J7V8-F1-model_v4 deleted 0.9779 5 148
AF-A0A7Y9AVG4-F1-model_v4 Nitrogen fixation NifU-like protein 0.9774 7 139 GO:0005506
GO:0016226
GO:0051536

Feature Viewer

pLDDT pTM Quality
90.9 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map