F414756

General Info

Members Datasets Scaffolds Average Seq Length
341 237 333 146

Family's Representative Sequence

Representative Sequence 3300014745|Ga0157377_10974626|Ga0157377_109746261
Length 170
Sequence VTLADFPHHSSIPTRWADNDIYGHVNNVEYYAFFDTVINAFLVRSGGLDIHDGPVIGLCAESHCSFTGPLAFPETVTAGLRVAHLGRSSVRYEIGLFAEDGSEAASGWFVHVFVDRASRRPAHHDHGRRAAQGPPVAQVGPGRGPVERRSAGSATLPIRGVHGRPPAGPR

Samples

Sample ID Description Type Environment
1 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
2 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
3 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
4 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
5 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
6 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
7 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
8 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
76 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
117 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
139 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
140 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
141 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
142 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
143 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
144 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
145 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
146 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
147 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
148 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
149 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
150 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
151 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
154 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
171 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
172 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
200 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
210 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
214 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
215 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
216 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
225 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
226 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
227 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
228 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
229 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
230 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
231 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
232 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
233 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
234 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
235 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.65
Metatranscriptomes 0
Isolates 2.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.2
Nodule 0.29
Rhizoplane 7.92
Rhizosphere 74.78
Stem 0
Stem Tuber 0
Unclassified 3.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10045918 3300003203 Bacteria 1500
2 rootH2_10044109 3300003320 Bacteria 5480
3 Ga0055535_1000702 3300003761 Bacteria 25845
4 Ga0055529_1000340 3300003763 Bacteria 52215
5 Ga0065165_1000313 3300005262 Bacteria 79494
6 Ga0070677_10006047 3300005333 Bacteria 4011
7 Ga0068869_100070484 3300005334 Bacteria 2586
8 Ga0070682_100242189 3300005337 Bacteria 1295
9 Ga0070689_100006967 3300005340 Bacteria 7873
10 Ga0070689_100165876 3300005340 Bacteria 1787
11 Ga0070691_10706383 3300005341 Bacteria 606
12 Ga0070661_100280256 3300005344 Bacteria 1293
13 Ga0070668_100722355 3300005347 Bacteria 880
14 Ga0070669_100655972 3300005353 Bacteria 883
15 Ga0070674_101202539 3300005356 Bacteria 673
16 Ga0070673_100007995 3300005364 Bacteria 7005
17 Ga0070688_100242440 3300005365 Bacteria 1280
18 Ga0070688_100668342 3300005365 Bacteria 801
19 Ga0070659_100605957 3300005366 Bacteria 941
20 Ga0070659_101196867 3300005366 Bacteria 672
21 Ga0070667_100374366 3300005367 Bacteria 1293
22 Ga0070700_100665918 3300005441 Bacteria 823
23 Ga0070663_100001001 3300005455 Bacteria 15402
24 Ga0070663_101002074 3300005455 Bacteria 726
25 Ga0070678_100072547 3300005456 Bacteria 2581
26 Ga0070678_100210676 3300005456 Bacteria 1610
27 Ga0070678_100952755 3300005456 Bacteria 787
28 Ga0070681_10002355 3300005458 Bacteria 17258
29 Ga0068867_100004450 3300005459 Bacteria 9853
30 Ga0068867_100640264 3300005459 Bacteria 931
31 Ga0070706_100050147 3300005467 Bacteria 3852
32 Ga0070684_100159246 3300005535 Bacteria 2047
33 Ga0068853_100971881 3300005539 Bacteria 817
34 Ga0070672_100064867 3300005543 Bacteria 2887
35 Ga0070672_101221175 3300005543 Bacteria 670
36 Ga0070672_101676803 3300005543 Bacteria 571
37 Ga0070686_100308543 3300005544 Bacteria 1176
38 Ga0070693_100274917 3300005547 Bacteria 1126
39 Ga0070693_100393494 3300005547 Bacteria 959
40 Ga0070665_100670612 3300005548 Bacteria 1050
41 Ga0068855_100345120 3300005563 Bacteria 1641
42 Ga0070664_100348339 3300005564 Bacteria 1347
43 Ga0068857_100031411 3300005577 Bacteria 4693
44 Ga0068857_100874225 3300005577 Bacteria 861
45 Ga0070702_100132618 3300005615 Bacteria 1576
46 Ga0068852_100210416 3300005616 Bacteria 1844
47 Ga0068864_102241272 3300005618 Bacteria 553
48 Ga0068870_10004655 3300005840 Bacteria 5920
49 Ga0068863_100581284 3300005841 Bacteria 1108
50 Ga0068860_101474022 3300005843 Bacteria 702
51 Ga0081538_10015174 3300005981 Bacteria 5980
52 Ga0075365_10187806 3300006038 Bacteria 1446
53 Ga0075368_10003440 3300006042 Bacteria 5283
54 Ga0075368_10178397 3300006042 Bacteria 895
55 Ga0075363_100740106 3300006048 Bacteria 595
56 Ga0075364_10624490 3300006051 Bacteria 736
57 Ga0075362_10015917 3300006177 Bacteria 3069
58 Ga0075366_10000472 3300006195 Bacteria 18720
59 Ga0075366_10024456 3300006195 Bacteria 3523
60 Ga0075366_10088099 3300006195 Bacteria 1858
61 Ga0075429_100501044 3300006880 Bacteria 1064
62 Ga0105240_10875572 3300009093 Bacteria 968
63 Ga0111539_10014657 3300009094 Bacteria 9781
64 Ga0105245_10197184 3300009098 Bacteria 1932
65 Ga0105245_10571946 3300009098 Bacteria 1154
66 Ga0105245_11934071 3300009098 Bacteria 643
67 Ga0105247_10002790 3300009101 Bacteria 11697
68 Ga0105243_10289402 3300009148 Bacteria 1479
69 Ga0105241_10014373 3300009174 Bacteria 5797
70 Ga0105248_10000537 3300009177 Bacteria 43166
71 Ga0105237_10086101 3300009545 Bacteria 3132
72 Ga0105239_10040295 3300010375 Bacteria 5118
73 Ga0105239_10838732 3300010375 Bacteria 1054
74 Ga0105239_11166772 3300010375 Bacteria 887
75 Ga0105239_11229920 3300010375 Bacteria 863
76 Ga0105246_10928436 3300011119 Bacteria 783
77 Ga0105246_11038215 3300011119 Bacteria 744
78 Ga0157378_10238763 3300013297 Bacteria 1735
79 Ga0157378_10256308 3300013297 Bacteria 1677
80 Ga0163162_11098545 3300013306 Bacteria 901
81 Ga0157372_10539617 3300013307 Bacteria 1360
82 Ga0157372_10933320 3300013307 Bacteria 1006
83 Ga0157375_10273210 3300013308 Bacteria 1852
84 Ga0163163_10757469 3300014325 Bacteria 1034
85 Ga0163163_11123989 3300014325 Bacteria 848
86 Ga0182008_10504304 3300014497 Unclassified 666
87 Ga0157377_10053692 3300014745 Bacteria 2279
88 Ga0157377_10877143 3300014745 Bacteria 669
89 Ga0157377_10974626 3300014745 Bacteria 640
90 Ga0157377_10987237 3300014745 Bacteria 636
91 Ga0163161_10133682 3300017792 Bacteria 1873
92 Ga0163161_10572829 3300017792 Bacteria 928
93 Ga0209258_100060 3300025242 Bacteria 319881
94 Ga0209759_1000663 3300025256 Bacteria 31934
95 Ga0209455_1000093 3300025272 Bacteria 220487
96 Ga0209130_1000209 3300025284 Bacteria 78300
97 Ga0209025_1001817 3300025294 Bacteria 25120
98 Ga0207426_1005834 3300025302 Bacteria 5502
99 Ga0207642_10361247 3300025899 Bacteria 859
100 Ga0207710_10098921 3300025900 Bacteria 1374
101 Ga0207645_10002560 3300025907 Bacteria 14212
102 Ga0207643_10108862 3300025908 Bacteria 1631
103 Ga0207684_10379671 3300025910 Bacteria 1215
104 Ga0207707_10116225 3300025912 Bacteria 2338
105 Ga0207671_10060731 3300025914 Bacteria 2804
106 Ga0207671_10650866 3300025914 Bacteria 839
107 Ga0207662_10290553 3300025918 Bacteria 1084
108 Ga0207650_10123308 3300025925 Bacteria 2019
109 Ga0207687_10182549 3300025927 Bacteria 1627
110 Ga0207687_10744206 3300025927 Bacteria 834
111 Ga0207690_10069256 3300025932 Bacteria 2427
112 Ga0207690_10192893 3300025932 Bacteria 1542
113 Ga0207709_10168870 3300025935 Bacteria 1533
114 Ga0207709_10378192 3300025935 Bacteria 1077
115 Ga0207670_10001587 3300025936 Bacteria 11884
116 Ga0207670_10201201 3300025936 Bacteria 1513
117 Ga0207669_10045868 3300025937 Bacteria 2579
118 Ga0207669_10401067 3300025937 Bacteria 1074
119 Ga0207691_10097277 3300025940 Bacteria 2631
120 Ga0207711_10058734 3300025941 Bacteria 3311
121 Ga0207689_10024229 3300025942 Bacteria 5092
122 Ga0207661_10151752 3300025944 Bacteria 2003
123 Ga0207661_10579890 3300025944 Bacteria 1029
124 Ga0207679_10221946 3300025945 Bacteria 1590
125 Ga0207712_10347572 3300025961 Bacteria 1232
126 Ga0207640_11931927 3300025981 Bacteria 534
127 Ga0207677_10651757 3300026023 Bacteria 929
128 Ga0207703_10975545 3300026035 Bacteria 813
129 Ga0207678_10001091 3300026067 Bacteria 24903
130 Ga0207678_10930076 3300026067 Bacteria 769
131 Ga0207641_10770848 3300026088 Bacteria 950
132 Ga0207648_10003711 3300026089 Bacteria 15983
133 Ga0207648_10049006 3300026089 Bacteria 3698
134 Ga0207648_10247332 3300026089 Bacteria 1589
135 Ga0207676_10335686 3300026095 Bacteria 1392
136 Ga0207674_10070695 3300026116 Bacteria 3509
137 Ga0207674_11421199 3300026116 Bacteria 663
138 Ga0207675_100700743 3300026118 Bacteria 1021
139 Ga0207683_10452529 3300026121 Bacteria 1184
140 Ga0209971_1020716 3300027682 Bacteria 1564
141 Ga0209813_10009308 3300027866 Bacteria 2509
142 Ga0209813_10140483 3300027866 Bacteria 857
143 Ga0207428_10251036 3300027907 Bacteria 1319
144 Ga0268266_11112897 3300028379 Bacteria 764
145 Ga0265336_10000012 3300028666 Bacteria 261478
146 Ga0265338_10000281 3300028800 Bacteria 91847
147 Ga0265324_10005244 3300029957 Bacteria 5636
148 Ga0265324_10061137 3300029957 Bacteria 1287
149 Ga0316182_1151116 3300030745 Bacteria 623
150 Ga0307513_10060193 3300031456 Bacteria 4026
151 Ga0307513_10580448 3300031456 Bacteria 831
152 Ga0307509_10126952 3300031507 Bacteria 2515
153 Ga0307408_100216877 3300031548 Bacteria 1559
154 Ga0307408_101802511 3300031548 Bacteria 585
155 Ga0307508_10000061 3300031616 Bacteria 124749
156 Ga0307405_10119172 3300031731 Bacteria 1803
157 Ga0307413_10094684 3300031824 Bacteria 1956
158 Ga0307410_10142419 3300031852 Bacteria 1775
159 Ga0307406_10180297 3300031901 Bacteria 1537
160 Ga0307412_10068321 3300031911 Bacteria 2416
161 Ga0307412_10792866 3300031911 Bacteria 822
162 Ga0307409_100198254 3300031995 Bacteria 1793
163 Ga0307409_101170906 3300031995 Bacteria 791
164 Ga0307409_101343593 3300031995 Bacteria 740
165 Ga0307409_102328577 3300031995 Bacteria 565
166 Ga0307416_100245443 3300032002 Bacteria 1739
167 Ga0307416_100354338 3300032002 Bacteria 1487
168 Ga0307416_101219650 3300032002 Bacteria 858
169 Ga0307416_102004094 3300032002 Bacteria 682
170 Ga0307414_10274349 3300032004 Bacteria 1414
171 Ga0307411_10344762 3300032005 Bacteria 1212
172 Ga0307415_100143200 3300032126 Bacteria 1829
173 Ga0307415_100413225 3300032126 Bacteria 1155
174 Ga0307415_100453838 3300032126 Bacteria 1109
175 Ga0373927_0206787 3300035695 Bacteria 1289
176 Ga0395899_0413730 3300037312 Bacteria 890
177 Ga0395900_0143323 3300037418 Bacteria 2445
178 Ga0395900_0575385 3300037418 Bacteria 1069
179 Ga0395898_1484300 3300037466 Bacteria 604
180 Ga0395905_0038612 3300037471 Bacteria 4480
181 Ga0395905_0099467 3300037471 Bacteria 2731
182 Ga0395901_0060366 3300038443 Bacteria 3946
183 Ga0395901_0094900 3300038443 Bacteria 3125
184 Ga0395901_0243980 3300038443 Bacteria 1873
185 Ga0395901_0347576 3300038443 Bacteria 1531
186 Ga0395901_0579635 3300038443 Bacteria 1134
187 Ga0395901_0646172 3300038443 Bacteria 1062
188 Ga0436361_0852708 3300039447 Bacteria 3227
189 Ga0436361_1189311 3300039447 Bacteria 1162
190 Ga0439461_0017414 3300041410 Bacteria 1396
191 Ga0439465_0135326 3300041413 Bacteria 872
192 Ga0451791_0051133 3300041451 Bacteria 1471
193 Ga0451802_1962513 3300041460 Bacteria 644
194 Ga0439431_0061772 3300041997 Bacteria 987
195 Ga0439431_0071105 3300041997 Bacteria 927
196 Ga0439457_023143 3300042014 Bacteria 1375
197 Ga0439462_0096774 3300042015 Bacteria 812
198 Ga0450919_024583 3300042121 Bacteria 683
199 Ga0450897_026724 3300042128 Bacteria 640
200 Ga0450898_002957 3300042134 Bacteria 2400
201 Ga0439446_0126736 3300042156 Bacteria 825
202 Ga0450909_043163 3300042185 Bacteria 696
203 Ga0439434_0013907 3300042435 Bacteria 2392
204 Ga0439434_0349269 3300042435 Bacteria 516
205 Ga0451577_0007345 3300042876 Bacteria 10838
206 Ga0451577_0019623 3300042876 Bacteria 6214
207 Ga0451577_0316198 3300042876 Bacteria 1415
208 Ga0451577_0438712 3300042876 Bacteria 1186
209 Ga0466972_0504579 3300044658 Bacteria 569
210 Ga0466965_0001116 3300044683 Bacteria 10487
211 Ga0466966_0527125 3300044684 Bacteria 711
212 Ga0466961_0162164 3300044693 Bacteria 1393
213 Ga0466964_0815031 3300044706 Bacteria 528
214 Ga0453684_0091544 3300044712 Bacteria 3753
215 Ga0466968_0016340 3300044735 Bacteria 2953
216 Ga0466968_0495440 3300044735 Bacteria 608
217 Ga0466957_0070686 3300044842 Bacteria 2157
218 Ga0466957_0416454 3300044842 Bacteria 921
219 Ga0466957_0435766 3300044842 Bacteria 901
220 Ga0466960_0000077 3300044901 Bacteria 32161
221 Ga0466960_0024029 3300044901 Bacteria 2745
222 Ga0466960_0055959 3300044901 Bacteria 1919
223 Ga0466960_0278712 3300044901 Bacteria 936
224 Ga0466959_0002226 3300045049 Bacteria 12357
225 Ga0451576_0001940 3300045051 Bacteria 33033
226 Ga0466958_0056068 3300045836 Bacteria 2393
227 Ga0466967_0184532 3300045976 Bacteria 1969
228 Ga0466967_0203424 3300045976 Bacteria 1876
229 Ga0466967_1127141 3300045976 Bacteria 782
230 Ga0466967_2051574 3300045976 Bacteria 568
231 Ga0495653_0211031 3300046463 Bacteria 1311
232 Ga0495650_0003768 3300046471 Bacteria 10817
233 Ga0495580_0381173 3300046472 Bacteria 952
234 Ga0495594_0416628 3300046499 Bacteria 764
235 Ga0495596_0327539 3300046500 Bacteria 596
236 Ga0495666_0048757 3300046526 Bacteria 2039
237 Ga0495633_0000662 3300046558 Bacteria 31801
238 Ga0495604_0122083 3300047317 Bacteria 1884
239 Ga0495675_0045116 3300047444 Bacteria 2807
240 Ga0495686_0006292 3300047472 Bacteria 9129
241 Ga0495602_0041938 3300048088 Bacteria 4174
242 Ga0496102_0356346 3300048905 Bacteria 1377
243 Ga0496102_0536568 3300048905 Bacteria 1092
244 Ga0496103_0383958 3300048906 Bacteria 902
245 Ga0496104_0197396 3300048907 Bacteria 1924
246 Ga0496105_0127569 3300048908 Bacteria 2097
247 Ga0496105_0330080 3300048908 Bacteria 1221
248 Ga0496105_0342234 3300048908 Bacteria 1196
249 Ga0496105_0779399 3300048908 Bacteria 728
250 Ga0496106_0160870 3300048909 Bacteria 1775
251 Ga0496106_1215890 3300048909 Bacteria 587
252 Ga0496107_0183620 3300048910 Bacteria 1553
253 Ga0496108_0177085 3300048911 Bacteria 1846
254 Ga0496108_0649766 3300048911 Bacteria 917
255 Ga0496109_0129621 3300048912 Bacteria 2353
256 Ga0496109_0267530 3300048912 Bacteria 1610
257 Ga0496109_0821336 3300048912 Bacteria 867
258 Ga0496110_0196740 3300048913 Bacteria 1831
259 Ga0496110_0217019 3300048913 Bacteria 1739
260 Ga0496110_1757131 3300048913 Bacteria 530
261 Ga0496112_0011998 3300048915 Bacteria 7945
262 Ga0496112_0713312 3300048915 Bacteria 930
263 Ga0496112_0931131 3300048915 Bacteria 790
264 Ga0496113_0364478 3300048916 Bacteria 1159
265 Ga0496113_0905387 3300048916 Bacteria 697
266 Ga0496114_0364047 3300048917 Bacteria 1279
267 Ga0496120_0188707 3300048923 Bacteria 1007
268 Ga0501034_0070491 3300049571 Bacteria 3506
269 Ga0501036_0018732 3300049572 Bacteria 5806
270 Ga0501037_0076091 3300049573 Bacteria 2437
271 Ga0501038_0182488 3300049574 Bacteria 1692
272 Ga0501039_0016603 3300049575 Bacteria 5640
273 Ga0501040_0400489 3300049576 Bacteria 986
274 Ga0501040_0403099 3300049576 Bacteria 982
275 Ga0501040_0975866 3300049576 Bacteria 614
276 Ga0501042_0327365 3300049578 Bacteria 1107
277 Ga0501042_0643093 3300049578 Bacteria 771
278 Ga0501042_0919408 3300049578 Bacteria 637
279 Ga0501042_1078911 3300049578 Bacteria 585
280 Ga0501046_0009931 3300049580 Bacteria 8200
281 Ga0501048_0064126 3300049582 Bacteria 2598
282 Ga0501068_0279125 3300049584 Bacteria 1067
283 Ga0501069_0025201 3300049585 Bacteria 3249
284 Ga0501069_0446070 3300049585 Bacteria 769
285 Ga0501070_0669786 3300049586 Bacteria 822
286 Ga0501071_0701061 3300049587 Bacteria 779
287 Ga0501073_0066848 3300049589 Bacteria 2505
288 Ga0501074_0235993 3300049590 Bacteria 1301
289 Ga0501257_039820 3300049686 Bacteria 1151
290 Ga0501079_0066671 3300049741 Bacteria 2778
291 Ga0501080_0014629 3300049742 Bacteria 7227
292 Ga0501081_0335397 3300049743 Bacteria 1113
293 Ga0501081_1121798 3300049743 Bacteria 595
294 Ga0501263_016867 3300049760 Bacteria 954
295 Ga0501267_018244 3300049764 Bacteria 759
296 Ga0501035_0033047 3300049822 Bacteria 4704
297 Ga0501045_0401500 3300049824 Bacteria 1020
298 nmdc:mga03683_302011_c1 3300050489 Bacteria 751
299 nmdc:mga03n38_190760_c1 3300050490 Bacteria 1055
300 nmdc:mga0k408_115084_c1 3300050493 Bacteria 1591
301 nmdc:mga0k408_2415_c1 3300050493 Bacteria 9936
302 nmdc:mga0k408_27434_c1 3300050493 Bacteria 3234
303 nmdc:mga0k408_330_c1 3300050493 Bacteria 25941
304 nmdc:mga0k408_3970_c1 3300050493 Bacteria 7844
305 nmdc:mga0k408_40182_c1 3300050493 Bacteria 2690
306 nmdc:mga0k408_63566_c1 3300050493 Bacteria 1239
307 nmdc:mga04h51_134084_c1 3300050495 Bacteria 934
308 nmdc:mga04h51_48970_c1 3300050495 Bacteria 1410
309 nmdc:mga09592_634689_c1 3300050508 Bacteria 913
310 nmdc:mga0qj67_240108_c1 3300050509 Bacteria 1470
311 nmdc:mga06r32_610220_c1 3300050510 Bacteria 1061
312 nmdc:mga08y16_173046_c1 3300050511 Bacteria 2242
313 nmdc:mga08y16_20564_c1 3300050511 Bacteria 6967
314 nmdc:mga0n895_2142609_c1 3300050512 Bacteria 515
315 nmdc:mga0rr50_460566_c1 3300050513 Bacteria 1078
316 nmdc:mga0a205_723312_c1 3300050515 Bacteria 845
317 Ga0500578_0002292 3300053086 Bacteria 16416
318 Ga0500651_0273318 3300053093 Bacteria 976
319 Ga0500618_006014 3300053125 Bacteria 3607
320 Ga0500623_052629 3300053127 Bacteria 2041
321 Ga0500628_000932 3300053129 Bacteria 5136
322 Ga0500628_001449 3300053129 Bacteria 4060
323 Ga0500652_000494 3300053131 Bacteria 13850
324 Ga0500577_0412884 3300053142 Bacteria 590
325 Ga0500579_144927 3300053143 Bacteria 1058
326 Ga0500588_0024790 3300053146 Bacteria 1660
327 Ga0500604_0003993 3300053151 Bacteria 3938
328 Ga0500604_0043007 3300053151 Bacteria 1371
329 Ga0500616_0026777 3300053153 Bacteria 3188
330 Ga0500622_0001042 3300053156 Bacteria 23143
331 Ga0500622_0200838 3300053156 Bacteria 907
332 Ga0501084_0026561 3300054114 Bacteria 4833
333 Ga0501082_0018411 3300060353 Bacteria 6015

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300027682 Ga0209971_1020716 Ga0209971_10207161 125
2 3300039447 Ga0436361_1189311 Ga0436361_1189311_15_539 128
3 3300037418 Ga0395900_0143323 Ga0395900_0143323_835_1281 129
4 3300038443 Ga0395901_0094900 Ga0395901_0094900_1410_1856 129
5 3300042435 Ga0439434_0349269 Ga0439434_0349269_20_454 129
6 3300006042 Ga0075368_10003440 Ga0075368_100034402 132
7 3300027866 Ga0209813_10009308 Ga0209813_100093083 133
8 3300050493 nmdc:mga0k408_2415_c1 nmdc:mga0k408_2415_c1_8200_8670 133
9 3300050495 nmdc:mga04h51_48970_c1 nmdc:mga04h51_48970_c1_866_1354 133
10 3300005333 Ga0070677_10006047 Ga0070677_100060473 134
11 3300005334 Ga0068869_100070484 Ga0068869_1000704842 134
12 3300005356 Ga0070674_101202539 Ga0070674_1012025392 134
13 3300005364 Ga0070673_100007995 Ga0070673_1000079953 134
14 3300005366 Ga0070659_101196867 Ga0070659_1011968671 134
15 3300005455 Ga0070663_100001001 Ga0070663_1000010019 134
16 3300005456 Ga0070678_100210676 Ga0070678_1002106762 134
17 3300005459 Ga0068867_100004450 Ga0068867_1000044509 134
18 3300005467 Ga0070706_100050147 Ga0070706_1000501474 134
19 3300005543 Ga0070672_100064867 Ga0070672_1000648672 134
20 3300005577 Ga0068857_100874225 Ga0068857_1008742251 134
21 3300005840 Ga0068870_10004655 Ga0068870_100046554 134
22 3300005841 Ga0068863_100581284 Ga0068863_1005812842 134
23 3300006048 Ga0075363_100740106 Ga0075363_1007401061 134
24 3300006195 Ga0075366_10000472 Ga0075366_100004725 134
25 3300006195 Ga0075366_10088099 Ga0075366_100880992 134
26 3300006880 Ga0075429_100501044 Ga0075429_1005010442 134
27 3300009098 Ga0105245_10197184 Ga0105245_101971843 134
28 3300009148 Ga0105243_10289402 Ga0105243_102894023 134
29 3300009177 Ga0105248_10000537 Ga0105248_1000053724 134
30 3300010375 Ga0105239_10838732 Ga0105239_108387322 134
31 3300010375 Ga0105239_11229920 Ga0105239_112299202 134
32 3300013297 Ga0157378_10256308 Ga0157378_102563082 134
33 3300013307 Ga0157372_10539617 Ga0157372_105396173 134
34 3300013308 Ga0157375_10273210 Ga0157375_102732102 134
35 3300014745 Ga0157377_10053692 Ga0157377_100536922 134
36 3300017792 Ga0163161_10133682 Ga0163161_101336822 134
37 3300025907 Ga0207645_10002560 Ga0207645_1000256013 134
38 3300025908 Ga0207643_10108862 Ga0207643_101088622 134
39 3300025910 Ga0207684_10379671 Ga0207684_103796712 134
40 3300025925 Ga0207650_10123308 Ga0207650_101233082 134
41 3300025927 Ga0207687_10744206 Ga0207687_107442062 134
42 3300025935 Ga0207709_10378192 Ga0207709_103781922 134
43 3300025937 Ga0207669_10401067 Ga0207669_104010672 134
44 3300025940 Ga0207691_10097277 Ga0207691_100972772 134
45 3300025941 Ga0207711_10058734 Ga0207711_100587344 134
46 3300025942 Ga0207689_10024229 Ga0207689_100242297 134
47 3300025944 Ga0207661_10579890 Ga0207661_105798902 134
48 3300026023 Ga0207677_10651757 Ga0207677_106517572 134
49 3300026067 Ga0207678_10001091 Ga0207678_1000109121 134
50 3300026088 Ga0207641_10770848 Ga0207641_107708482 134
51 3300026089 Ga0207648_10003711 Ga0207648_1000371114 134
52 3300026116 Ga0207674_11421199 Ga0207674_114211991 134
53 3300031507 Ga0307509_10126952 Ga0307509_101269523 134
54 3300031548 Ga0307408_100216877 Ga0307408_1002168772 134
55 3300031548 Ga0307408_101802511 Ga0307408_1018025112 134
56 3300031731 Ga0307405_10119172 Ga0307405_101191722 134
57 3300031824 Ga0307413_10094684 Ga0307413_100946843 134
58 3300031852 Ga0307410_10142419 Ga0307410_101424192 134
59 3300031995 Ga0307409_100198254 Ga0307409_1001982542 134
60 3300032004 Ga0307414_10274349 Ga0307414_102743492 134
61 3300032005 Ga0307411_10344762 Ga0307411_103447622 134
62 3300032126 Ga0307415_100413225 Ga0307415_1004132252 134
63 3300037312 Ga0395899_0413730 Ga0395899_0413730_126_542 134
64 3300037466 Ga0395898_1484300 Ga0395898_1484300_171_587 134
65 3300038443 Ga0395901_0243980 Ga0395901_0243980_1328_1744 134
66 3300038443 Ga0395901_0347576 Ga0395901_0347576_213_629 134
67 3300038443 Ga0395901_0579635 Ga0395901_0579635_34_450 134
68 3300041410 Ga0439461_0017414 Ga0439461_0017414_203_649 134
69 3300041997 Ga0439431_0061772 Ga0439431_0061772_238_684 134
70 3300042014 Ga0439457_023143 Ga0439457_023143_821_1267 134
71 3300042015 Ga0439462_0096774 Ga0439462_0096774_316_762 134
72 3300042121 Ga0450919_024583 Ga0450919_024583_54_500 134
73 3300042128 Ga0450897_026724 Ga0450897_026724_94_540 134
74 3300042134 Ga0450898_002957 Ga0450898_002957_606_1052 134
75 3300042156 Ga0439446_0126736 Ga0439446_0126736_281_727 134
76 3300042185 Ga0450909_043163 Ga0450909_043163_213_659 134
77 3300042435 Ga0439434_0013907 Ga0439434_0013907_45_491 134
78 3300044658 Ga0466972_0504579 Ga0466972_0504579_96_542 134
79 3300044693 Ga0466961_0162164 Ga0466961_0162164_248_691 134
80 3300044735 Ga0466968_0495440 Ga0466968_0495440_14_460 134
81 3300044842 Ga0466957_0416454 Ga0466957_0416454_431_874 134
82 3300044901 Ga0466960_0278712 Ga0466960_0278712_462_908 134
83 3300045976 Ga0466967_2051574 Ga0466967_2051574_33_479 134
84 3300048905 Ga0496102_0356346 Ga0496102_0356346_308_751 134
85 3300048906 Ga0496103_0383958 Ga0496103_0383958_173_616 134
86 3300048907 Ga0496104_0197396 Ga0496104_0197396_1096_1539 134
87 3300048908 Ga0496105_0330080 Ga0496105_0330080_451_894 134
88 3300048912 Ga0496109_0267530 Ga0496109_0267530_740_1183 134
89 3300048913 Ga0496110_1757131 Ga0496110_1757131_49_492 134
90 3300048915 Ga0496112_0011998 Ga0496112_0011998_4940_5383 134
91 3300048916 Ga0496113_0364478 Ga0496113_0364478_96_539 134
92 3300049572 Ga0501036_0018732 Ga0501036_0018732_1511_1924 134
93 3300049573 Ga0501037_0076091 Ga0501037_0076091_1516_1929 134
94 3300049574 Ga0501038_0182488 Ga0501038_0182488_880_1293 134
95 3300049575 Ga0501039_0016603 Ga0501039_0016603_16_429 134
96 3300049576 Ga0501040_0403099 Ga0501040_0403099_320_757 134
97 3300049578 Ga0501042_0327365 Ga0501042_0327365_186_599 134
98 3300049578 Ga0501042_0919408 Ga0501042_0919408_33_470 134
99 3300049580 Ga0501046_0009931 Ga0501046_0009931_4639_5052 134
100 3300049582 Ga0501048_0064126 Ga0501048_0064126_844_1257 134
101 3300049584 Ga0501068_0279125 Ga0501068_0279125_286_699 134
102 3300049585 Ga0501069_0025201 Ga0501069_0025201_2210_2623 134
103 3300049586 Ga0501070_0669786 Ga0501070_0669786_135_548 134
104 3300049587 Ga0501071_0701061 Ga0501071_0701061_78_491 134
105 3300049589 Ga0501073_0066848 Ga0501073_0066848_1524_1937 134
106 3300049590 Ga0501074_0235993 Ga0501074_0235993_388_801 134
107 3300049741 Ga0501079_0066671 Ga0501079_0066671_1934_2347 134
108 3300049742 Ga0501080_0014629 Ga0501080_0014629_6602_7015 134
109 3300049760 Ga0501263_016867 Ga0501263_016867_313_756 134
110 3300049822 Ga0501035_0033047 Ga0501035_0033047_3703_4116 134
111 3300049824 Ga0501045_0401500 Ga0501045_0401500_261_698 134
112 3300050493 nmdc:mga0k408_115084_c1 nmdc:mga0k408_115084_c1_191_637 134
113 3300050493 nmdc:mga0k408_27434_c1 nmdc:mga0k408_27434_c1_2176_2613 134
114 3300050493 nmdc:mga0k408_330_c1 nmdc:mga0k408_330_c1_13567_14001 134
115 3300050493 nmdc:mga0k408_40182_c1 nmdc:mga0k408_40182_c1_915_1364 134
116 3300050508 nmdc:mga09592_634689_c1 nmdc:mga09592_634689_c1_450_884 134
117 3300053129 Ga0500628_001449 Ga0500628_001449_95_526 134
118 3300053153 Ga0500616_0026777 Ga0500616_0026777_2508_2933 134
119 3300054114 Ga0501084_0026561 Ga0501084_0026561_3149_3562 134
120 3300060353 Ga0501082_0018411 Ga0501082_0018411_264_677 134
121 iso_pu_bacteria 2643221654 2644301969 134
122 3300005365 Ga0070688_100242440 Ga0070688_1002424402 135
123 3300005459 Ga0068867_100640264 Ga0068867_1006402641 135
124 3300025914 Ga0207671_10650866 Ga0207671_106508662 135
125 3300025927 Ga0207687_10182549 Ga0207687_101825492 135
126 3300026035 Ga0207703_10975545 Ga0207703_109755452 135
127 3300026089 Ga0207648_10049006 Ga0207648_100490062 135
128 3300031616 Ga0307508_10000061 Ga0307508_1000006147 135
129 3300031995 Ga0307409_101170906 Ga0307409_1011709062 135
130 3300031995 Ga0307409_101343593 Ga0307409_1013435932 135
131 3300031995 Ga0307409_102328577 Ga0307409_1023285771 135
132 3300032126 Ga0307415_100143200 Ga0307415_1001432002 135
133 3300041451 Ga0451791_0051133 Ga0451791_0051133_274_756 135
134 3300042876 Ga0451577_0007345 Ga0451577_0007345_8379_8816 135
135 3300042876 Ga0451577_0019623 Ga0451577_0019623_4357_4803 135
136 3300042876 Ga0451577_0316198 Ga0451577_0316198_31_471 135
137 3300042876 Ga0451577_0438712 Ga0451577_0438712_385_825 135
138 3300044683 Ga0466965_0001116 Ga0466965_0001116_518_949 135
139 3300044712 Ga0453684_0091544 Ga0453684_0091544_1538_1978 135
140 3300044735 Ga0466968_0016340 Ga0466968_0016340_2318_2749 135
141 3300045051 Ga0451576_0001940 Ga0451576_0001940_15359_15796 135
142 3300046471 Ga0495650_0003768 Ga0495650_0003768_2213_2647 135
143 3300046558 Ga0495633_0000662 Ga0495633_0000662_27655_28119 135
144 3300048911 Ga0496108_0649766 Ga0496108_0649766_313_732 135
145 3300048913 Ga0496110_0196740 Ga0496110_0196740_1249_1680 135
146 3300049578 Ga0501042_0643093 Ga0501042_0643093_168_608 135
147 3300049578 Ga0501042_1078911 Ga0501042_1078911_63_494 135
148 3300049743 Ga0501081_0335397 Ga0501081_0335397_269_709 135
149 3300053086 Ga0500578_0002292 Ga0500578_0002292_3449_3898 135
150 3300053093 Ga0500651_0273318 Ga0500651_0273318_424_897 135
151 3300053127 Ga0500623_052629 Ga0500623_052629_1506_1979 135
152 3300053129 Ga0500628_000932 Ga0500628_000932_526_999 135
153 3300053131 Ga0500652_000494 Ga0500652_000494_11072_11554 135
154 3300053142 Ga0500577_0412884 Ga0500577_0412884_31_480 135
155 3300053143 Ga0500579_144927 Ga0500579_144927_11_493 135
156 3300053146 Ga0500588_0024790 Ga0500588_0024790_698_1171 135
157 3300053151 Ga0500604_0003993 Ga0500604_0003993_3217_3699 135
158 3300053151 Ga0500604_0043007 Ga0500604_0043007_462_911 135
159 3300053156 Ga0500622_0001042 Ga0500622_0001042_21274_21747 135
160 3300053156 Ga0500622_0200838 Ga0500622_0200838_251_724 135
161 iso_pu_bacteria 2585428057 2587730296 135
162 iso_pu_bacteria 2643221592 2643969157 135
163 iso_pu_bacteria 2643221625 2644138667 135
164 iso_pu_bacteria 2643221648 2644275449 135
165 3300005262 Ga0065165_1000313 Ga0065165_100031317 136
166 3300005337 Ga0070682_100242189 Ga0070682_1002421893 136
167 3300005347 Ga0070668_100722355 Ga0070668_1007223551 136
168 3300005366 Ga0070659_100605957 Ga0070659_1006059572 136
169 3300005367 Ga0070667_100374366 Ga0070667_1003743661 136
170 3300005455 Ga0070663_101002074 Ga0070663_1010020742 136
171 3300005458 Ga0070681_10002355 Ga0070681_100023552 136
172 3300005543 Ga0070672_101676803 Ga0070672_1016768031 136
173 3300005548 Ga0070665_100670612 Ga0070665_1006706122 136
174 3300005563 Ga0068855_100345120 Ga0068855_1003451203 136
175 3300005577 Ga0068857_100031411 Ga0068857_1000314113 136
176 3300005843 Ga0068860_101474022 Ga0068860_1014740222 136
177 3300006051 Ga0075364_10624490 Ga0075364_106244902 136
178 3300009098 Ga0105245_11934071 Ga0105245_119340712 136
179 3300009174 Ga0105241_10014373 Ga0105241_100143733 136
180 3300009545 Ga0105237_10086101 Ga0105237_100861013 136
181 3300010375 Ga0105239_10040295 Ga0105239_100402954 136
182 3300011119 Ga0105246_11038215 Ga0105246_110382152 136
183 3300013297 Ga0157378_10238763 Ga0157378_102387632 136
184 3300013306 Ga0163162_11098545 Ga0163162_110985451 136
185 3300013307 Ga0157372_10933320 Ga0157372_109333202 136
186 3300014497 Ga0182008_10504304 Ga0182008_105043041 136
187 3300014745 Ga0157377_10877143 Ga0157377_108771432 136
188 3300025284 Ga0209130_1000209 Ga0209130_100020956 136
189 3300025294 Ga0209025_1001817 Ga0209025_100181720 136
190 3300025302 Ga0207426_1005834 Ga0207426_10058346 136
191 3300025899 Ga0207642_10361247 Ga0207642_103612471 136
192 3300025912 Ga0207707_10116225 Ga0207707_101162253 136
193 3300025914 Ga0207671_10060731 Ga0207671_100607313 136
194 3300025932 Ga0207690_10069256 Ga0207690_100692562 136
195 3300025937 Ga0207669_10045868 Ga0207669_100458682 136
196 3300025961 Ga0207712_10347572 Ga0207712_103475722 136
197 3300025981 Ga0207640_11931927 Ga0207640_119319271 136
198 3300026067 Ga0207678_10930076 Ga0207678_109300762 136
199 3300026089 Ga0207648_10247332 Ga0207648_102473322 136
200 3300026116 Ga0207674_10070695 Ga0207674_100706952 136
201 3300026118 Ga0207675_100700743 Ga0207675_1007007431 136
202 3300028379 Ga0268266_11112897 Ga0268266_111128972 136
203 3300031456 Ga0307513_10060193 Ga0307513_100601934 136
204 3300031456 Ga0307513_10580448 Ga0307513_105804482 136
205 3300031911 Ga0307412_10068321 Ga0307412_100683212 136
206 3300031911 Ga0307412_10792866 Ga0307412_107928662 136
207 3300032126 Ga0307415_100453838 Ga0307415_1004538381 136
208 3300035695 Ga0373927_0206787 Ga0373927_0206787_153_593 136
209 3300039447 Ga0436361_0852708 Ga0436361_0852708_2384_2824 136
210 3300041460 Ga0451802_1962513 Ga0451802_1962513_141_578 136
211 3300041997 Ga0439431_0071105 Ga0439431_0071105_101_541 136
212 3300044842 Ga0466957_0435766 Ga0466957_0435766_341_781 136
213 3300044901 Ga0466960_0055959 Ga0466960_0055959_347_787 136
214 3300048909 Ga0496106_1215890 Ga0496106_1215890_24_464 136
215 3300048913 Ga0496110_0217019 Ga0496110_0217019_1006_1437 136
216 3300049576 Ga0501040_0400489 Ga0501040_0400489_353_790 136
217 3300049576 Ga0501040_0975866 Ga0501040_0975866_59_496 136
218 3300049743 Ga0501081_1121798 Ga0501081_1121798_138_575 136
219 3300049764 Ga0501267_018244 Ga0501267_018244_109_546 136
220 3300050509 nmdc:mga0qj67_240108_c1 nmdc:mga0qj67_240108_c1_615_1052 136
221 iso_pu_bacteria 2515154189 2516023987 136
222 iso_pu_bacteria 2883087390 2883093211 136
223 3300005340 Ga0070689_100165876 Ga0070689_1001658762 137
224 3300005344 Ga0070661_100280256 Ga0070661_1002802562 137
225 3300005353 Ga0070669_100655972 Ga0070669_1006559722 137
226 3300005365 Ga0070688_100668342 Ga0070688_1006683421 137
227 3300005441 Ga0070700_100665918 Ga0070700_1006659181 137
228 3300005456 Ga0070678_100072547 Ga0070678_1000725472 137
229 3300005456 Ga0070678_100952755 Ga0070678_1009527551 137
230 3300005535 Ga0070684_100159246 Ga0070684_1001592462 137
231 3300005547 Ga0070693_100393494 Ga0070693_1003934942 137
232 3300006042 Ga0075368_10178397 Ga0075368_101783972 137
233 3300006177 Ga0075362_10015917 Ga0075362_100159174 137
234 3300006195 Ga0075366_10024456 Ga0075366_100244562 137
235 3300009098 Ga0105245_10571946 Ga0105245_105719462 137
236 3300010375 Ga0105239_11166772 Ga0105239_111667722 137
237 3300011119 Ga0105246_10928436 Ga0105246_109284361 137
238 3300014325 Ga0163163_10757469 Ga0163163_107574692 137
239 3300014325 Ga0163163_11123989 Ga0163163_111239891 137
240 3300014745 Ga0157377_10987237 Ga0157377_109872372 137
241 3300025935 Ga0207709_10168870 Ga0207709_101688702 137
242 3300025936 Ga0207670_10201201 Ga0207670_102012012 137
243 3300025944 Ga0207661_10151752 Ga0207661_101517522 137
244 3300025945 Ga0207679_10221946 Ga0207679_102219462 137
245 3300026095 Ga0207676_10335686 Ga0207676_103356861 137
246 3300026121 Ga0207683_10452529 Ga0207683_104525292 137
247 3300027866 Ga0209813_10140483 Ga0209813_101404832 137
248 3300029957 Ga0265324_10061137 Ga0265324_100611372 137
249 3300030745 Ga0316182_1151116 Ga0316182_11511161 137
250 3300044706 Ga0466964_0815031 Ga0466964_0815031_57_494 137
251 3300044901 Ga0466960_0000077 Ga0466960_0000077_18979_19398 137
252 3300044901 Ga0466960_0024029 Ga0466960_0024029_1928_2365 137
253 3300045976 Ga0466967_0184532 Ga0466967_0184532_540_977 137
254 3300048905 Ga0496102_0536568 Ga0496102_0536568_455_889 137
255 3300048908 Ga0496105_0127569 Ga0496105_0127569_813_1247 137
256 3300048909 Ga0496106_0160870 Ga0496106_0160870_1196_1630 137
257 3300048910 Ga0496107_0183620 Ga0496107_0183620_1080_1514 137
258 3300048911 Ga0496108_0177085 Ga0496108_0177085_101_535 137
259 3300048912 Ga0496109_0129621 Ga0496109_0129621_1580_2014 137
260 3300048912 Ga0496109_0821336 Ga0496109_0821336_215_640 137
261 3300048915 Ga0496112_0713312 Ga0496112_0713312_249_683 137
262 3300048915 Ga0496112_0931131 Ga0496112_0931131_38_463 137
263 3300048916 Ga0496113_0905387 Ga0496113_0905387_10_444 137
264 3300048917 Ga0496114_0364047 Ga0496114_0364047_485_919 137
265 3300049585 Ga0501069_0446070 Ga0501069_0446070_104_553 137
266 3300050489 nmdc:mga03683_302011_c1 nmdc:mga03683_302011_c1_45_488 137
267 3300050490 nmdc:mga03n38_190760_c1 nmdc:mga03n38_190760_c1_483_917 137
268 3300050493 nmdc:mga0k408_3970_c1 nmdc:mga0k408_3970_c1_2461_2904 137
269 3300050493 nmdc:mga0k408_63566_c1 nmdc:mga0k408_63566_c1_281_724 137
270 3300050495 nmdc:mga04h51_134084_c1 nmdc:mga04h51_134084_c1_110_553 137
271 3300050510 nmdc:mga06r32_610220_c1 nmdc:mga06r32_610220_c1_471_920 137
272 3300050511 nmdc:mga08y16_173046_c1 nmdc:mga08y16_173046_c1_191_625 137
273 3300050513 nmdc:mga0rr50_460566_c1 nmdc:mga0rr50_460566_c1_126_560 137
274 3300053125 Ga0500618_006014 Ga0500618_006014_2520_3026 137
275 3300005341 Ga0070691_10706383 Ga0070691_107063831 138
276 3300005539 Ga0068853_100971881 Ga0068853_1009718811 138
277 3300005543 Ga0070672_101221175 Ga0070672_1012211751 138
278 3300025918 Ga0207662_10290553 Ga0207662_102905532 138
279 3300025932 Ga0207690_10192893 Ga0207690_101928933 138
280 3300045976 Ga0466967_0203424 Ga0466967_0203424_1168_1617 138
281 3300046463 Ga0495653_0211031 Ga0495653_0211031_293_736 138
282 3300046499 Ga0495594_0416628 Ga0495594_0416628_115_540 138
283 3300046500 Ga0495596_0327539 Ga0495596_0327539_58_501 138
284 3300047444 Ga0495675_0045116 Ga0495675_0045116_2231_2674 138
285 3300048088 Ga0495602_0041938 Ga0495602_0041938_2284_2727 138
286 3300048908 Ga0496105_0342234 Ga0496105_0342234_570_998 138
287 3300048923 Ga0496120_0188707 Ga0496120_0188707_243_671 138
288 3300049571 Ga0501034_0070491 Ga0501034_0070491_2386_2808 138
289 3300050515 nmdc:mga0a205_723312_c1 nmdc:mga0a205_723312_c1_341_787 138
290 3300037471 Ga0395905_0099467 Ga0395905_0099467_1156_1599 139
291 3300038443 Ga0395901_0646172 Ga0395901_0646172_11_454 139
292 3300045049 Ga0466959_0002226 Ga0466959_0002226_9955_10419 139
293 3300005547 Ga0070693_100274917 Ga0070693_1002749172 140
294 3300005981 Ga0081538_10015174 Ga0081538_100151743 140
295 3300009093 Ga0105240_10875572 Ga0105240_108755722 140
296 3300009101 Ga0105247_10002790 Ga0105247_100027906 140
297 3300025900 Ga0207710_10098921 Ga0207710_100989213 140
298 3300032002 Ga0307416_102004094 Ga0307416_1020040941 140
299 3300037418 Ga0395900_0575385 Ga0395900_0575385_117_545 140
300 3300037471 Ga0395905_0038612 Ga0395905_0038612_543_992 140
301 3300038443 Ga0395901_0060366 Ga0395901_0060366_1074_1523 140
302 3300044684 Ga0466966_0527125 Ga0466966_0527125_250_699 140
303 3300045836 Ga0466958_0056068 Ga0466958_0056068_1865_2314 140
304 3300049686 Ga0501257_039820 Ga0501257_039820_428_877 140
305 3300003320 rootH2_10044109 rootH2_100441094 141
306 3300005616 Ga0068852_100210416 Ga0068852_1002104163 141
307 3300006038 Ga0075365_10187806 Ga0075365_101878063 141
308 3300009094 Ga0111539_10014657 Ga0111539_100146578 141
309 3300027907 Ga0207428_10251036 Ga0207428_102510362 141
310 3300031901 Ga0307406_10180297 Ga0307406_101802972 141
311 3300032002 Ga0307416_100245443 Ga0307416_1002454432 141
312 3300032002 Ga0307416_100354338 Ga0307416_1003543381 141
313 3300041413 Ga0439465_0135326 Ga0439465_0135326_321_773 141
314 3300044842 Ga0466957_0070686 Ga0466957_0070686_112_594 141
315 3300048908 Ga0496105_0779399 Ga0496105_0779399_119_613 141
316 3300050511 nmdc:mga08y16_20564_c1 nmdc:mga08y16_20564_c1_217_654 141
317 iso_pu_bacteria 2508501125 2509128465 141
318 3300003203 JGI25406J46586_10045918 JGI25406J46586_100459182 142
319 3300003761 Ga0055535_1000702 Ga0055535_10007026 142
320 3300003763 Ga0055529_1000340 Ga0055529_100034022 142
321 3300005340 Ga0070689_100006967 Ga0070689_1000069672 142
322 3300005544 Ga0070686_100308543 Ga0070686_1003085432 142
323 3300005564 Ga0070664_100348339 Ga0070664_1003483392 142
324 3300005615 Ga0070702_100132618 Ga0070702_1001326182 142
325 3300005618 Ga0068864_102241272 Ga0068864_1022412721 142
326 3300014745 Ga0157377_10974626 Ga0157377_109746261 142
327 3300017792 Ga0163161_10572829 Ga0163161_105728292 142
328 3300025242 Ga0209258_100060 Ga0209258_100060112 142
329 3300025256 Ga0209759_1000663 Ga0209759_10006633 142
330 3300025272 Ga0209455_1000093 Ga0209455_1000093126 142
331 3300025936 Ga0207670_10001587 Ga0207670_100015876 142
332 3300028666 Ga0265336_10000012 Ga0265336_10000012234 142
333 3300028800 Ga0265338_10000281 Ga0265338_1000028129 142
334 3300029957 Ga0265324_10005244 Ga0265324_100052442 142
335 3300032002 Ga0307416_101219650 Ga0307416_1012196501 142
336 3300045976 Ga0466967_1127141 Ga0466967_1127141_206_646 142
337 3300046472 Ga0495580_0381173 Ga0495580_0381173_294_746 142
338 3300046526 Ga0495666_0048757 Ga0495666_0048757_980_1432 142
339 3300047317 Ga0495604_0122083 Ga0495604_0122083_266_718 142
340 3300047472 Ga0495686_0006292 Ga0495686_0006292_1925_2404 142
341 3300050512 nmdc:mga0n895_2142609_c1 nmdc:mga0n895_2142609_c1_14_448 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

22

105

0.97

PF13279

4HBT_2

Thioesterase-like superfamily

14

138

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o6t-assembly3.cif.gz_K crystal structure of the pa5185 protein from pseudomonas aeruginosa strain pao1- orthorhombic form (p2221). 0.9678 2 138
5v10-assembly1.cif.gz_B-2 crystal structure of the putative tol-pal system-associated acyl-coa thioesterase from pseudomonas aeruginosa pao1 0.9394 5 130
5kl9-assembly1.cif.gz_B crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with coa 0.9377 6 128
3qy3-assembly1.cif.gz_A pa2801 protein, a putative thioesterase from pseudomonas aeruginosa 0.9282 4 130
2o6t-assembly3.cif.gz_K crystal structure of the pa5185 protein from pseudomonas aeruginosa strain pao1- orthorhombic form (p2221). 0.928 2 138
ID Description Score Start End Superfamily
af_O07408_6_147_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9619 2 132 3.10.129.10
2av9A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9519 2 137 3.10.129.10
5v10B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9394 5 130 3.10.129.10
af_Q9DCP4_49_221_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.933 1 135 3.10.129.10
5eo2D01 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9235 7 108 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A7W1S0Y7-F1-model_v4 deleted 0.9902 2 134
AF-A0A2E2R1B6-F1-model_v4 Acyl-CoA thioesterase 0.9891 2 135 GO:0047617
AF-A0A0M8PKB6-F1-model_v4 Uncharacterized protein 0.9859 3 135 GO:0047617
AF-A0A5P2HFP9-F1-model_v4 Acyl-CoA thioesterase 0.9858 2 135 GO:0047617
AF-A0A4U0GL81-F1-model_v4 Acyl-CoA thioesterase 0.9857 2 138 GO:0047617

Feature Viewer

pLDDT pTM Quality
94.01 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map