F403075

General Info

Members Datasets Scaffolds Average Seq Length
315 208 630 213

Family's Representative Sequence

Representative Sequence 3300005545|Ga0070695_100686727|Ga0070695_1006867271
Length 230
Sequence VTGKRSPRTGVVFVLSAPSGTGKTTLSRRLARRVSGLRFSVSYTTRPRRPGERGGVDYHFVTREAFQKLRRRKALLEWARVDGELYGTSRNQVSRALARGQDLLLEIDTQGAEQVRRRLRGAVLIFILPPGPMDLRRRLVRRGAEPAVLARRLALARREVPQYRLYDYLVLNDRLEKAYRDLEAIVRAERCRVQRQSGRGRRIVRQFKTGGMIPANPRASSPTMRKELTG

Samples

Sample ID Description Type Environment
1 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
128 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
129 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
130 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
131 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
132 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
141 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
142 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
143 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
151 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
189 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
200 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
201 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
202 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
205 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
206 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.9
Nodule 0
Rhizoplane 1.9
Rhizosphere 96.19
Stem 0
Stem Tuber 0
Unclassified 16.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070695_100686727 3300005545 Bacteria 811
2 MRS1b_contig_2156510 2162886011 Unclassified 841
3 JGI25405J52794_10001396 3300003911 Unclassified 3955
4 Ga0065714_10097098 3300005288 Bacteria 1744
5 Ga0065712_10000426 3300005290 Bacteria 11563
6 Ga0065712_10067853 3300005290 Bacteria 25415
7 Ga0065715_10000216 3300005293 Bacteria 28002
8 Ga0065715_10527054 3300005293 Unclassified 759
9 Ga0065707_10001360 3300005295 Bacteria 7116
10 Ga0065707_10005360 3300005295 Bacteria 7550
11 Ga0065707_10148849 3300005295 Bacteria 1681
12 Ga0070690_100011970 3300005330 Bacteria 5090
13 Ga0070670_100000365 3300005331 Bacteria 37708
14 Ga0068869_100146721 3300005334 Bacteria 1826
15 Ga0070666_10044975 3300005335 Bacteria 2959
16 Ga0070680_100015039 3300005336 Bacteria 6057
17 Ga0070680_100317731 3300005336 Bacteria 1322
18 Ga0070680_100382153 3300005336 Bacteria 1199
19 Ga0070660_100008877 3300005339 Bacteria 7048
20 Ga0070689_100022369 3300005340 Bacteria 4720
21 Ga0070687_100113847 3300005343 Bacteria 1536
22 Ga0070669_100340390 3300005353 Unclassified 1215
23 Ga0070669_100640010 3300005353 Bacteria 894
24 Ga0070671_100222647 3300005355 Unclassified 1600
25 Ga0070674_100035077 3300005356 Bacteria 3357
26 Ga0070673_100325506 3300005364 Unclassified 1358
27 Ga0070659_100022772 3300005366 Unclassified 4786
28 Ga0070659_100040829 3300005366 Bacteria 3626
29 Ga0070667_100660545 3300005367 Unclassified 965
30 Ga0070709_10127475 3300005434 Unclassified 1733
31 Ga0070709_10164326 3300005434 Bacteria 1546
32 Ga0070705_100008601 3300005440 Bacteria 5056
33 Ga0070694_100022234 3300005444 Bacteria 4061
34 Ga0070663_100200978 3300005455 Unclassified 1555
35 Ga0070678_100040671 3300005456 Bacteria 3290
36 Ga0070681_10029246 3300005458 Bacteria 5532
37 Ga0070681_10029715 3300005458 Bacteria 5487
38 Ga0070681_10125103 3300005458 Bacteria 2503
39 Ga0068867_100255479 3300005459 Unclassified 1427
40 Ga0070707_101235528 3300005468 Bacteria 713
41 Ga0070698_100134589 3300005471 Bacteria 2426
42 Ga0070698_100353943 3300005471 Bacteria 1400
43 Ga0070699_100591913 3300005518 Bacteria 1011
44 Ga0070679_100007269 3300005530 Bacteria 10342
45 Ga0070679_100007367 3300005530 Bacteria 10280
46 Ga0070679_100253784 3300005530 Bacteria 1714
47 Ga0068853_100388909 3300005539 Bacteria 1304
48 Ga0070672_100019133 3300005543 Bacteria 4964
49 Ga0070686_100007213 3300005544 Bacteria 6193
50 Ga0070686_100652392 3300005544 Unclassified 834
51 Ga0070695_100479161 3300005545 Unclassified 959
52 Ga0068855_100367047 3300005563 Bacteria 1583
53 Ga0070664_100003342 3300005564 Bacteria 12965
54 Ga0068854_100030881 3300005578 Bacteria 3720
55 Ga0068854_100938919 3300005578 Unclassified 762
56 Ga0068856_100009864 3300005614 Bacteria 9273
57 Ga0070702_100263426 3300005615 Unclassified 1175
58 Ga0068864_100489240 3300005618 Bacteria 1182
59 Ga0068858_100046309 3300005842 Bacteria 4032
60 Ga0068860_100173687 3300005843 Bacteria 2082
61 Ga0081455_10000562 3300005937 Bacteria 48394
62 Ga0081455_10006505 3300005937 Bacteria 12511
63 Ga0081455_10058931 3300005937 Bacteria 3245
64 Ga0081538_10000900 3300005981 Bacteria 32171
65 Ga0081538_10004976 3300005981 Bacteria 12104
66 Ga0081538_10008285 3300005981 Bacteria 8855
67 Ga0081538_10010487 3300005981 Bacteria 7598
68 Ga0081538_10015438 3300005981 Bacteria 5909
69 Ga0081538_10025954 3300005981 Bacteria 4114
70 Ga0081540_1003564 3300005983 Bacteria 12244
71 Ga0081540_1020178 3300005983 Bacteria 4018
72 Ga0081539_10038536 3300005985 Bacteria 2832
73 Ga0075364_10001889 3300006051 Bacteria 11626
74 Ga0097621_100221805 3300006237 Unclassified 1648
75 Ga0068871_100069000 3300006358 Bacteria 2903
76 Ga0075428_100001617 3300006844 Bacteria 24081
77 Ga0075428_100201054 3300006844 Bacteria 2154
78 Ga0075428_100457294 3300006844 Bacteria 1367
79 Ga0075430_100181296 3300006846 Unclassified 1752
80 Ga0075430_100186626 3300006846 Bacteria 1724
81 Ga0075430_100523716 3300006846 Unclassified 978
82 Ga0075430_100612552 3300006846 Unclassified 898
83 Ga0075431_100169642 3300006847 Bacteria 2243
84 Ga0075431_100170711 3300006847 Bacteria 2235
85 Ga0075431_100208949 3300006847 Bacteria 1995
86 Ga0075433_10056005 3300006852 Unclassified 3443
87 Ga0075433_10061968 3300006852 Bacteria 3276
88 Ga0075433_10116939 3300006852 Bacteria 2366
89 Ga0075433_10168249 3300006852 Bacteria 1951
90 Ga0075434_100016462 3300006871 Bacteria 7108
91 Ga0075434_100025656 3300006871 Bacteria 5768
92 Ga0075434_100411568 3300006871 Bacteria 1373
93 Ga0075434_100795483 3300006871 Bacteria 962
94 Ga0075429_100104951 3300006880 Bacteria 2468
95 Ga0075429_100155257 3300006880 Bacteria 2004
96 Ga0068865_100033503 3300006881 Bacteria 3440
97 Ga0068865_100432725 3300006881 Bacteria 1084
98 Ga0075436_100014126 3300006914 Bacteria 5468
99 Ga0075436_100048216 3300006914 Bacteria 2939
100 Ga0075435_100011883 3300007076 Bacteria 6429
101 Ga0075435_100038566 3300007076 Bacteria 3809
102 Ga0075435_100040559 3300007076 Bacteria 3718
103 Ga0075435_100579288 3300007076 Bacteria 973
104 Ga0099794_10004089 3300007265 Bacteria 5676
105 Ga0105240_10015912 3300009093 Bacteria 10204
106 Ga0105240_10091483 3300009093 Bacteria 3717
107 Ga0105240_10191002 3300009093 Bacteria 2408
108 Ga0111539_10053470 3300009094 Bacteria 4806
109 Ga0111539_10057909 3300009094 Bacteria 4599
110 Ga0111539_10098305 3300009094 Bacteria 3438
111 Ga0105245_10014888 3300009098 Bacteria 6775
112 Ga0114129_10001654 3300009147 Bacteria 30326
113 Ga0114129_10035810 3300009147 Bacteria 7010
114 Ga0114129_10038770 3300009147 Bacteria 6718
115 Ga0114129_10088352 3300009147 Bacteria 4297
116 Ga0114129_10097846 3300009147 Bacteria 4062
117 Ga0114129_10129066 3300009147 Bacteria 3474
118 Ga0114129_10211819 3300009147 Bacteria 2619
119 Ga0114129_10224261 3300009147 Bacteria 2534
120 Ga0114129_10268505 3300009147 Bacteria 2283
121 Ga0114129_10524805 3300009147 Bacteria 1543
122 Ga0105243_10328881 3300009148 Bacteria 1395
123 Ga0105241_10030656 3300009174 Unclassified 4022
124 Ga0105242_10022634 3300009176 Bacteria 4946
125 Ga0105242_10103961 3300009176 Bacteria 2410
126 Ga0105237_10550857 3300009545 Unclassified 1160
127 Ga0105249_10276784 3300009553 Bacteria 1674
128 Ga0105249_10679452 3300009553 Bacteria 1089
129 Ga0105239_10006946 3300010375 Bacteria 13053
130 Ga0105239_10321649 3300010375 Bacteria 1744
131 Ga0105246_10002190 3300011119 Bacteria 11783
132 Ga0105246_10451161 3300011119 Bacteria 1081
133 Ga0157316_1002512 3300012510 Bacteria 1250
134 Ga0157373_10047512 3300013100 Bacteria 3061
135 Ga0157371_10019167 3300013102 Bacteria 5049
136 Ga0157374_10007310 3300013296 Bacteria 9415
137 Ga0157378_10001771 3300013297 Bacteria 19391
138 Ga0163162_10082334 3300013306 Bacteria 3290
139 Ga0163162_10184738 3300013306 Bacteria 2211
140 Ga0157372_10049647 3300013307 Bacteria 4666
141 Ga0157375_10203210 3300013308 Bacteria 2137
142 Ga0157379_10024290 3300014968 Bacteria 5382
143 Ga0157379_11133540 3300014968 Unclassified 750
144 Ga0157376_10006735 3300014969 Bacteria 8134
145 Ga0163161_10400647 3300017792 Unclassified 1100
146 Ga0213871_10100447 3300021441 Bacteria 846
147 Ga0207688_10082326 3300025901 Bacteria 1839
148 Ga0207645_10001412 3300025907 Bacteria 19674
149 Ga0207654_10305701 3300025911 Unclassified 1083
150 Ga0207707_10004523 3300025912 Bacteria 12226
151 Ga0207707_10214919 3300025912 Bacteria 1674
152 Ga0207695_10011176 3300025913 Bacteria 10892
153 Ga0207695_10111879 3300025913 Bacteria 2709
154 Ga0207671_10245425 3300025914 Unclassified 1407
155 Ga0207660_10004727 3300025917 Bacteria 8865
156 Ga0207660_10257421 3300025917 Bacteria 1379
157 Ga0207662_10185533 3300025918 Unclassified 1340
158 Ga0207657_10002048 3300025919 Bacteria 21816
159 Ga0207652_10017209 3300025921 Bacteria 5913
160 Ga0207652_10283288 3300025921 Unclassified 1495
161 Ga0207646_10689799 3300025922 Bacteria 913
162 Ga0207681_10160175 3300025923 Bacteria 1695
163 Ga0207650_10004378 3300025925 Bacteria 9647
164 Ga0207687_10209314 3300025927 Bacteria 1529
165 Ga0207644_10526893 3300025931 Unclassified 976
166 Ga0207690_10024905 3300025932 Bacteria 3752
167 Ga0207706_10046129 3300025933 Bacteria 3859
168 Ga0207686_10241654 3300025934 Unclassified 1314
169 Ga0207670_10437349 3300025936 Unclassified 1052
170 Ga0207669_10097805 3300025937 Bacteria 1931
171 Ga0207704_10033126 3300025938 Bacteria 2934
172 Ga0207691_10003422 3300025940 Bacteria 15433
173 Ga0207689_10131446 3300025942 Bacteria 2060
174 Ga0207679_10006217 3300025945 Bacteria 7540
175 Ga0207679_10047340 3300025945 Bacteria 3123
176 Ga0207712_10161247 3300025961 Bacteria 1743
177 Ga0207712_10489982 3300025961 Bacteria 1049
178 Ga0207668_10239192 3300025972 Bacteria 1468
179 Ga0207640_10126249 3300025981 Bacteria 1842
180 Ga0207658_10159510 3300025986 Bacteria 1847
181 Ga0207703_10061088 3300026035 Bacteria 3084
182 Ga0207639_10691786 3300026041 Unclassified 946
183 Ga0207678_10010398 3300026067 Bacteria 8167
184 Ga0207641_10419929 3300026088 Bacteria 1288
185 Ga0207675_100109181 3300026118 Bacteria 2610
186 Ga0207683_10001389 3300026121 Bacteria 21826
187 Ga0209971_1061308 3300027682 Unclassified 911
188 Ga0209974_10003762 3300027876 Bacteria 5433
189 Ga0207428_10071370 3300027907 Bacteria 2727
190 Ga0265760_10034156 3300031090 Bacteria 1504
191 Ga0265316_10143291 3300031344 Bacteria 1794
192 Ga0307405_10021601 3300031731 Bacteria 3621
193 Ga0307406_10287796 3300031901 Bacteria 1256
194 Ga0307412_10233721 3300031911 Bacteria 1417
195 Ga0307416_100018333 3300032002 Bacteria 4928
196 Ga0307416_100478425 3300032002 Bacteria 1305
197 Ga0373930_0069095 3300034816 Bacteria 800
198 Ga0373926_0019848 3300035083 Bacteria 2319
199 Ga0373940_0137555 3300035088 Bacteria 770
200 Ga0373932_0011727 3300035112 Bacteria 2147
201 Ga0373945_0006694 3300035116 Bacteria 3724
202 Ga0373956_0123232 3300035119 Bacteria 1211
203 Ga0373943_0034121 3300035170 Bacteria 2427
204 Ga0373946_0106647 3300035171 Unclassified 1263
205 Ga0373931_0061833 3300035691 Bacteria 2020
206 Ga0373935_0082585 3300035692 Bacteria 2090
207 Ga0373937_0169460 3300036401 Bacteria 2049
208 Ga0373937_0198044 3300036401 Bacteria 1888
209 Ga0373925_0012115 3300037068 Bacteria 6241
210 Ga0436361_0550873 3300039447 Unclassified 859
211 Ga0439441_006272 3300042001 Bacteria 1880
212 Ga0439450_107702 3300042008 Bacteria 711
213 Ga0439458_0056149 3300042157 Unclassified 978
214 Ga0439464_0133827 3300042439 Unclassified 769
215 Ga0451577_0000444 3300042876 Bacteria 72637
216 Ga0453683_0000988 3300044673 Bacteria 26801
217 Ga0453683_0387093 3300044673 Unclassified 900
218 Ga0453684_0386373 3300044712 Bacteria 1571
219 Ga0451576_1138239 3300045051 Bacteria 816
220 Ga0495580_0123485 3300046472 Bacteria 1797
221 Ga0495580_0144164 3300046472 Bacteria 1651
222 Ga0495640_0293307 3300046533 Bacteria 1011
223 Ga0495633_0105391 3300046558 Bacteria 1308
224 Ga0495659_0074521 3300046664 Bacteria 1277
225 Ga0495657_0123177 3300046675 Bacteria 1631
226 Ga0495647_0019802 3300046681 Bacteria 2410
227 Ga0495669_0019135 3300046684 Bacteria 2954
228 Ga0495604_0224848 3300047317 Bacteria 1290
229 Ga0495674_0446982 3300047319 Unclassified 1039
230 Ga0495675_0150990 3300047444 Bacteria 1435
231 Ga0495602_0015422 3300048088 Bacteria 7712
232 Ga0496100_0554864 3300048903 Unclassified 889
233 Ga0496101_0144990 3300048904 Unclassified 1813
234 Ga0496102_0207803 3300048905 Unclassified 1846
235 Ga0496104_0320842 3300048907 Bacteria 1462
236 Ga0496108_0761899 3300048911 Unclassified 837
237 Ga0496112_0001274 3300048915 Bacteria 19122
238 Ga0501031_0008581 3300049568 Bacteria 6649
239 Ga0501032_0008194 3300049569 Bacteria 7616
240 Ga0501033_0005638 3300049570 Bacteria 9890
241 Ga0501037_0106503 3300049573 Bacteria 2020
242 Ga0501039_0143087 3300049575 Bacteria 1879
243 Ga0501040_0138331 3300049576 Bacteria 1715
244 Ga0501040_0269571 3300049576 Bacteria 1215
245 Ga0501041_0032524 3300049577 Bacteria 3152
246 Ga0501041_0041321 3300049577 Bacteria 2801
247 Ga0501042_0114628 3300049578 Unclassified 1940
248 Ga0501042_0542623 3300049578 Bacteria 845
249 Ga0501043_0080023 3300049579 Bacteria 2567
250 Ga0501043_0371683 3300049579 Bacteria 1084
251 Ga0501047_0173297 3300049581 Bacteria 2026
252 Ga0501048_0134227 3300049582 Bacteria 1749
253 Ga0501048_0596907 3300049582 Bacteria 792
254 Ga0501068_0003212 3300049584 Bacteria 8753
255 Ga0501069_0020863 3300049585 Bacteria 3552
256 Ga0501070_0044396 3300049586 Bacteria 3698
257 Ga0501072_0095487 3300049588 Bacteria 2363
258 Ga0501073_0014340 3300049589 Bacteria 5757
259 Ga0501073_0492871 3300049589 Unclassified 847
260 Ga0501075_0009627 3300049591 Bacteria 6766
261 Ga0501075_0671076 3300049591 Bacteria 790
262 Ga0501076_0101446 3300049592 Bacteria 2319
263 Ga0501076_0586090 3300049592 Bacteria 920
264 Ga0501077_0140799 3300049593 Bacteria 1530
265 Ga0501079_0123515 3300049741 Bacteria 2013
266 Ga0501083_0017330 3300049744 Bacteria 5021
267 Ga0501035_0032645 3300049822 Bacteria 4735
268 Ga0501044_1015872 3300049823 Bacteria 701
269 nmdc:mga03683_25_c1 3300050489 Bacteria 78364
270 nmdc:mga00v17_171_c1 3300050491 Bacteria 37943
271 nmdc:mga05p37_103977_c1 3300050507 Bacteria 3495
272 nmdc:mga05p37_156643_c1 3300050507 Bacteria 2783
273 nmdc:mga05p37_242821_c1 3300050507 Bacteria 2164
274 nmdc:mga05p37_27345_c1 3300050507 Bacteria 6944
275 nmdc:mga05p37_427946_c1 3300050507 Bacteria 1538
276 nmdc:mga05p37_48775_c2 3300050507 Bacteria 4219
277 nmdc:mga05p37_70557_c1 3300050507 Bacteria 4297
278 nmdc:mga09592_157089_c1 3300050508 Bacteria 1963
279 nmdc:mga09592_511431_c1 3300050508 Bacteria 1033
280 nmdc:mga09592_56988_c1 3300050508 Bacteria 3302
281 nmdc:mga0qj67_36308_c1 3300050509 Bacteria 3855
282 nmdc:mga0qj67_744578_c1 3300050509 Unclassified 778
283 nmdc:mga06r32_1029439_c1 3300050510 Bacteria 775
284 nmdc:mga06r32_124699_c1 3300050510 Bacteria 2543
285 nmdc:mga06r32_181618_c1 3300050510 Bacteria 2090
286 nmdc:mga06r32_243722_c1 3300050510 Bacteria 1785
287 nmdc:mga06r32_37117_c1 3300050510 Bacteria 4609
288 nmdc:mga08y16_1354347_c1 3300050511 Unclassified 676
289 nmdc:mga08y16_27692_c1 3300050511 Bacteria 5971
290 nmdc:mga08y16_37020_c1 3300050511 Bacteria 5124
291 nmdc:mga0n895_50461_c1 3300050512 Bacteria 4079
292 nmdc:mga0n895_53000_c1 3300050512 Bacteria 3984
293 nmdc:mga0n895_809817_c1 3300050512 Bacteria 927
294 nmdc:mga0rr50_120569_c1 3300050513 Unclassified 2087
295 nmdc:mga0rr50_150671_c1 3300050513 Bacteria 1879
296 nmdc:mga0rr50_43730_c1 3300050513 Bacteria 3281
297 nmdc:mga0rr50_85682_c1 3300050513 Bacteria 2442
298 nmdc:mga08x19_11068_c1 3300050514 Bacteria 5429
299 nmdc:mga0a205_134626_c1 3300050515 Bacteria 2372
300 nmdc:mga0a205_225419_c1 3300050515 Bacteria 1759
301 nmdc:mga0a205_335848_c1 3300050515 Bacteria 1380
302 nmdc:mga0a205_35548_c1 3300050515 Bacteria 3472
303 nmdc:mga0a205_6429_c2 3300050515 Bacteria 8267
304 Ga0495612_0043853 3300053078 Bacteria 1829
305 Ga0500647_0115703 3300053091 Unclassified 1272
306 Ga0500595_000009 3300053119 Bacteria 278382
307 Ga0500585_036757 3300053144 Unclassified 1712
308 Ga0501084_0739510 3300054114 Bacteria 829
309 Ga0501084_0922539 3300054114 Bacteria 734
310 Ga0501084_1463478 3300054114 Unclassified 572
311 Ga0590071_010443 3300059421 Bacteria 2175
312 Ga0590074_025216 3300059423 Bacteria 1036
313 Ga0590077_001151 3300059426 Bacteria 6444
314 Ga0501082_0524869 3300060353 Bacteria 1035
315 Ga0530510_0459164 3300061734 Unclassified 963
316 Ga0070695_100686727
317 MRS1b_contig_2156510
318 JGI25405J52794_10001396
319 Ga0065714_10097098
320 Ga0065712_10000426
321 Ga0065712_10067853
322 Ga0065715_10000216
323 Ga0065715_10527054
324 Ga0065707_10001360
325 Ga0065707_10005360
326 Ga0065707_10148849
327 Ga0070690_100011970
328 Ga0070670_100000365
329 Ga0068869_100146721
330 Ga0070666_10044975
331 Ga0070680_100015039
332 Ga0070680_100317731
333 Ga0070680_100382153
334 Ga0070660_100008877
335 Ga0070689_100022369
336 Ga0070687_100113847
337 Ga0070669_100340390
338 Ga0070669_100640010
339 Ga0070671_100222647
340 Ga0070674_100035077
341 Ga0070673_100325506
342 Ga0070659_100022772
343 Ga0070659_100040829
344 Ga0070667_100660545
345 Ga0070709_10127475
346 Ga0070709_10164326
347 Ga0070705_100008601
348 Ga0070694_100022234
349 Ga0070663_100200978
350 Ga0070678_100040671
351 Ga0070681_10029246
352 Ga0070681_10029715
353 Ga0070681_10125103
354 Ga0068867_100255479
355 Ga0070707_101235528
356 Ga0070698_100134589
357 Ga0070698_100353943
358 Ga0070699_100591913
359 Ga0070679_100007269
360 Ga0070679_100007367
361 Ga0070679_100253784
362 Ga0068853_100388909
363 Ga0070672_100019133
364 Ga0070686_100007213
365 Ga0070686_100652392
366 Ga0070695_100479161
367 Ga0068855_100367047
368 Ga0070664_100003342
369 Ga0068854_100030881
370 Ga0068854_100938919
371 Ga0068856_100009864
372 Ga0070702_100263426
373 Ga0068864_100489240
374 Ga0068858_100046309
375 Ga0068860_100173687
376 Ga0081455_10000562
377 Ga0081455_10006505
378 Ga0081455_10058931
379 Ga0081538_10000900
380 Ga0081538_10004976
381 Ga0081538_10008285
382 Ga0081538_10010487
383 Ga0081538_10015438
384 Ga0081538_10025954
385 Ga0081540_1003564
386 Ga0081540_1020178
387 Ga0081539_10038536
388 Ga0075364_10001889
389 Ga0097621_100221805
390 Ga0068871_100069000
391 Ga0075428_100001617
392 Ga0075428_100201054
393 Ga0075428_100457294
394 Ga0075430_100181296
395 Ga0075430_100186626
396 Ga0075430_100523716
397 Ga0075430_100612552
398 Ga0075431_100169642
399 Ga0075431_100170711
400 Ga0075431_100208949
401 Ga0075433_10056005
402 Ga0075433_10061968
403 Ga0075433_10116939
404 Ga0075433_10168249
405 Ga0075434_100016462
406 Ga0075434_100025656
407 Ga0075434_100411568
408 Ga0075434_100795483
409 Ga0075429_100104951
410 Ga0075429_100155257
411 Ga0068865_100033503
412 Ga0068865_100432725
413 Ga0075436_100014126
414 Ga0075436_100048216
415 Ga0075435_100011883
416 Ga0075435_100038566
417 Ga0075435_100040559
418 Ga0075435_100579288
419 Ga0099794_10004089
420 Ga0105240_10015912
421 Ga0105240_10091483
422 Ga0105240_10191002
423 Ga0111539_10053470
424 Ga0111539_10057909
425 Ga0111539_10098305
426 Ga0105245_10014888
427 Ga0114129_10001654
428 Ga0114129_10035810
429 Ga0114129_10038770
430 Ga0114129_10088352
431 Ga0114129_10097846
432 Ga0114129_10129066
433 Ga0114129_10211819
434 Ga0114129_10224261
435 Ga0114129_10268505
436 Ga0114129_10524805
437 Ga0105243_10328881
438 Ga0105241_10030656
439 Ga0105242_10022634
440 Ga0105242_10103961
441 Ga0105237_10550857
442 Ga0105249_10276784
443 Ga0105249_10679452
444 Ga0105239_10006946
445 Ga0105239_10321649
446 Ga0105246_10002190
447 Ga0105246_10451161
448 Ga0157316_1002512
449 Ga0157373_10047512
450 Ga0157371_10019167
451 Ga0157374_10007310
452 Ga0157378_10001771
453 Ga0163162_10082334
454 Ga0163162_10184738
455 Ga0157372_10049647
456 Ga0157375_10203210
457 Ga0157379_10024290
458 Ga0157379_11133540
459 Ga0157376_10006735
460 Ga0163161_10400647
461 Ga0213871_10100447
462 Ga0207688_10082326
463 Ga0207645_10001412
464 Ga0207654_10305701
465 Ga0207707_10004523
466 Ga0207707_10214919
467 Ga0207695_10011176
468 Ga0207695_10111879
469 Ga0207671_10245425
470 Ga0207660_10004727
471 Ga0207660_10257421
472 Ga0207662_10185533
473 Ga0207657_10002048
474 Ga0207652_10017209
475 Ga0207652_10283288
476 Ga0207646_10689799
477 Ga0207681_10160175
478 Ga0207650_10004378
479 Ga0207687_10209314
480 Ga0207644_10526893
481 Ga0207690_10024905
482 Ga0207706_10046129
483 Ga0207686_10241654
484 Ga0207670_10437349
485 Ga0207669_10097805
486 Ga0207704_10033126
487 Ga0207691_10003422
488 Ga0207689_10131446
489 Ga0207679_10006217
490 Ga0207679_10047340
491 Ga0207712_10161247
492 Ga0207712_10489982
493 Ga0207668_10239192
494 Ga0207640_10126249
495 Ga0207658_10159510
496 Ga0207703_10061088
497 Ga0207639_10691786
498 Ga0207678_10010398
499 Ga0207641_10419929
500 Ga0207675_100109181
501 Ga0207683_10001389
502 Ga0209971_1061308
503 Ga0209974_10003762
504 Ga0207428_10071370
505 Ga0265760_10034156
506 Ga0265316_10143291
507 Ga0307405_10021601
508 Ga0307406_10287796
509 Ga0307412_10233721
510 Ga0307416_100018333
511 Ga0307416_100478425
512 Ga0373930_0069095
513 Ga0373926_0019848
514 Ga0373940_0137555
515 Ga0373932_0011727
516 Ga0373945_0006694
517 Ga0373956_0123232
518 Ga0373943_0034121
519 Ga0373946_0106647
520 Ga0373931_0061833
521 Ga0373935_0082585
522 Ga0373937_0169460
523 Ga0373937_0198044
524 Ga0373925_0012115
525 Ga0436361_0550873
526 Ga0439441_006272
527 Ga0439450_107702
528 Ga0439458_0056149
529 Ga0439464_0133827
530 Ga0451577_0000444
531 Ga0453683_0000988
532 Ga0453683_0387093
533 Ga0453684_0386373
534 Ga0451576_1138239
535 Ga0495580_0123485
536 Ga0495580_0144164
537 Ga0495640_0293307
538 Ga0495633_0105391
539 Ga0495659_0074521
540 Ga0495657_0123177
541 Ga0495647_0019802
542 Ga0495669_0019135
543 Ga0495604_0224848
544 Ga0495674_0446982
545 Ga0495675_0150990
546 Ga0495602_0015422
547 Ga0496100_0554864
548 Ga0496101_0144990
549 Ga0496102_0207803
550 Ga0496104_0320842
551 Ga0496108_0761899
552 Ga0496112_0001274
553 Ga0501031_0008581
554 Ga0501032_0008194
555 Ga0501033_0005638
556 Ga0501037_0106503
557 Ga0501039_0143087
558 Ga0501040_0138331
559 Ga0501040_0269571
560 Ga0501041_0032524
561 Ga0501041_0041321
562 Ga0501042_0114628
563 Ga0501042_0542623
564 Ga0501043_0080023
565 Ga0501043_0371683
566 Ga0501047_0173297
567 Ga0501048_0134227
568 Ga0501048_0596907
569 Ga0501068_0003212
570 Ga0501069_0020863
571 Ga0501070_0044396
572 Ga0501072_0095487
573 Ga0501073_0014340
574 Ga0501073_0492871
575 Ga0501075_0009627
576 Ga0501075_0671076
577 Ga0501076_0101446
578 Ga0501076_0586090
579 Ga0501077_0140799
580 Ga0501079_0123515
581 Ga0501083_0017330
582 Ga0501035_0032645
583 Ga0501044_1015872
584 nmdc:mga03683_25_c1
585 nmdc:mga00v17_171_c1
586 nmdc:mga05p37_103977_c1
587 nmdc:mga05p37_156643_c1
588 nmdc:mga05p37_242821_c1
589 nmdc:mga05p37_27345_c1
590 nmdc:mga05p37_427946_c1
591 nmdc:mga05p37_48775_c2
592 nmdc:mga05p37_70557_c1
593 nmdc:mga09592_157089_c1
594 nmdc:mga09592_511431_c1
595 nmdc:mga09592_56988_c1
596 nmdc:mga0qj67_36308_c1
597 nmdc:mga0qj67_744578_c1
598 nmdc:mga06r32_1029439_c1
599 nmdc:mga06r32_124699_c1
600 nmdc:mga06r32_181618_c1
601 nmdc:mga06r32_243722_c1
602 nmdc:mga06r32_37117_c1
603 nmdc:mga08y16_1354347_c1
604 nmdc:mga08y16_27692_c1
605 nmdc:mga08y16_37020_c1
606 nmdc:mga0n895_50461_c1
607 nmdc:mga0n895_53000_c1
608 nmdc:mga0n895_809817_c1
609 nmdc:mga0rr50_120569_c1
610 nmdc:mga0rr50_150671_c1
611 nmdc:mga0rr50_43730_c1
612 nmdc:mga0rr50_85682_c1
613 nmdc:mga08x19_11068_c1
614 nmdc:mga0a205_134626_c1
615 nmdc:mga0a205_225419_c1
616 nmdc:mga0a205_335848_c1
617 nmdc:mga0a205_35548_c1
618 nmdc:mga0a205_6429_c2
619 Ga0495612_0043853
620 Ga0500647_0115703
621 Ga0500595_000009
622 Ga0500585_036757
623 Ga0501084_0739510
624 Ga0501084_0922539
625 Ga0501084_1463478
626 Ga0590071_010443
627 Ga0590074_025216
628 Ga0590077_001151
629 Ga0501082_0524869
630 Ga0530510_0459164

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00625

Guanylate_kin

Guanylate kinase

9

189

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yki-assembly1.cif.gz_A crystal structure of magi2 pdz0-gk domain in complex with phospho-sapap1 gbr3 peptide 0.9719 43 92
7luy-assembly3.cif.gz_C crystal structure of guanylate kinase from bartonella henselae str. houston-1 0.9373 11 200
6wct-assembly1.cif.gz_C crystal structure of a guanylate kinase from stenotrophomonas maltophilia k279a bound to guanosine-5'-monophosphate 0.9314 12 198
2f3t-assembly1.cif.gz_B crystal structure of e.coli guanylate kinase in complex with ganciclovir monophosphate 0.9297 12 199
7u5f-assembly1.cif.gz_C crystal structure of guanylate kinase from pseudomonas aeruginosa pao1 in complex with gmp 0.9294 13 198
ID Description Score Start End Superfamily
af_Q94JM2_119_167_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 1.005 44 92 3.30.63.10
af_Q2QPW1_160_210_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9885 44 92 3.30.63.10
af_Q94JM2_119_167_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9848 44 92 3.30.63.10
3neyE02 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9797 43 98 3.30.63.10
3tr0A02 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9642 44 103 3.30.63.10
ID Description Score Start End GO Terms
AF-A0A7Y3GJY2-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9844 12 194 GO:0004385
GO:0005524
GO:0005829
AF-A0A1F6PPM8-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9808 11 196 GO:0004385
GO:0005524
GO:0005829
AF-A0A2E2QWS3-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9795 9 201 GO:0004385
GO:0005524
GO:0005829
AF-A0A1Q3MVY4-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9795 19 198 GO:0004385
GO:0005524
GO:0005829
AF-A0A833LH29-F1-model_v4 Guanylate kinase 0.9769 10 123 GO:0004385
GO:0005829

Map