F402979
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 315 | 192 | 310 | 154 |
Family's Representative Sequence
| Representative Sequence | 3300005289|Ga0065704_10398445|Ga0065704_103984451 |
| Length | 178 |
| Sequence | MYLASKKMHKYPVDREFVTIADHMHVALVEPEIPPNTGNIARLCAATGTPLHIVGVTGFRMDDRTLKRAGLDYWSEVELYRHIDLSDLYKSLPGSRFIYLTTKVRGFYSSWKYTPNDCLVFGPETRGLPQEVLEANADRCLTIPMPNNNVRSLNLATCVGIVLYEALRQTGFTIQENR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 2 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 3 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 4 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 5 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 6 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 56 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 57 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 58 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 83 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 84 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 120 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 123 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 124 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 125 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 126 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 127 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 128 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 129 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 130 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 131 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 132 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 133 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 134 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 135 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 136 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 137 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 138 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 139 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 140 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 141 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 142 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 143 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 144 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 145 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 146 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 147 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 148 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 149 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 150 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 151 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 152 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 153 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 154 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 155 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 156 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 157 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 158 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 159 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 160 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 161 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 171 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 179 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 180 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 181 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 184 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 191 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 192 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.41 |
| Metatranscriptomes | 0 |
| Isolates | 1.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.95 |
| Nodule | 0 |
| Rhizoplane | 0.95 |
| Rhizosphere | 95.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1000081 | 3300000549 | Bacteria | 16080 |
| 2 | rootH1_10052682 | 3300003316 | Bacteria | 3194 |
| 3 | rootL2_10000075 | 3300003322 | Bacteria | 6881 |
| 4 | rootL2_10219636 | 3300003322 | Bacteria | 1924 |
| 5 | Ga0065704_10137623 | 3300005289 | Bacteria | 1544 |
| 6 | Ga0065704_10139039 | 3300005289 | Bacteria | 1537 |
| 7 | Ga0065704_10398445 | 3300005289 | Unclassified | 754 |
| 8 | Ga0065715_10019424 | 3300005293 | Bacteria | 1985 |
| 9 | Ga0065715_10440386 | 3300005293 | Bacteria | 837 |
| 10 | Ga0065707_10018495 | 3300005295 | Bacteria | 1315 |
| 11 | Ga0065707_10232004 | 3300005295 | Bacteria | 1185 |
| 12 | Ga0065707_10361003 | 3300005295 | Bacteria | 870 |
| 13 | Ga0070676_10066668 | 3300005328 | Unclassified | 2151 |
| 14 | Ga0070690_100665264 | 3300005330 | Bacteria | 797 |
| 15 | Ga0070670_100405245 | 3300005331 | Bacteria | 1204 |
| 16 | Ga0070677_10011733 | 3300005333 | Bacteria | 3028 |
| 17 | Ga0068869_100016660 | 3300005334 | Bacteria | 4958 |
| 18 | Ga0070680_100679342 | 3300005336 | Bacteria | 886 |
| 19 | Ga0070661_100152097 | 3300005344 | Bacteria | 1750 |
| 20 | Ga0070692_10095735 | 3300005345 | Bacteria | 1621 |
| 21 | Ga0070675_100351640 | 3300005354 | Bacteria | 1307 |
| 22 | Ga0070673_100246422 | 3300005364 | Unclassified | 1556 |
| 23 | Ga0070659_100748656 | 3300005366 | Bacteria | 847 |
| 24 | Ga0070667_100107512 | 3300005367 | Bacteria | 2416 |
| 25 | Ga0070667_100391697 | 3300005367 | Unclassified | 1263 |
| 26 | Ga0070703_10174519 | 3300005406 | Bacteria | 826 |
| 27 | Ga0070701_10454061 | 3300005438 | Unclassified | 823 |
| 28 | Ga0070705_101273168 | 3300005440 | Unclassified | 608 |
| 29 | Ga0070705_101359805 | 3300005440 | Bacteria | 591 |
| 30 | Ga0070694_100053067 | 3300005444 | Bacteria | 2742 |
| 31 | Ga0070694_100054838 | 3300005444 | Bacteria | 2701 |
| 32 | Ga0070694_100775326 | 3300005444 | Bacteria | 785 |
| 33 | Ga0070708_101249570 | 3300005445 | Unclassified | 694 |
| 34 | Ga0070678_100078727 | 3300005456 | Unclassified | 2491 |
| 35 | Ga0070662_100000341 | 3300005457 | Bacteria | 27976 |
| 36 | Ga0070662_100071339 | 3300005457 | Bacteria | 2561 |
| 37 | Ga0068867_100141777 | 3300005459 | Bacteria | 1879 |
| 38 | Ga0068867_100165380 | 3300005459 | Bacteria | 1748 |
| 39 | Ga0070685_10002668 | 3300005466 | Bacteria | 9131 |
| 40 | Ga0070707_100302686 | 3300005468 | Bacteria | 1554 |
| 41 | Ga0070698_100060155 | 3300005471 | Bacteria | 3834 |
| 42 | Ga0070699_100549220 | 3300005518 | Bacteria | 1051 |
| 43 | Ga0070699_100697317 | 3300005518 | Bacteria | 928 |
| 44 | Ga0070697_100000143 | 3300005536 | Bacteria | 57751 |
| 45 | Ga0070697_100267382 | 3300005536 | Bacteria | 1465 |
| 46 | Ga0068853_100054364 | 3300005539 | Bacteria | 3450 |
| 47 | Ga0068853_101852365 | 3300005539 | Unclassified | 585 |
| 48 | Ga0068853_102394736 | 3300005539 | Bacteria | 511 |
| 49 | Ga0070686_100000044 | 3300005544 | Bacteria | 102470 |
| 50 | Ga0070686_101054935 | 3300005544 | Bacteria | 669 |
| 51 | Ga0070695_100046262 | 3300005545 | Bacteria | 2776 |
| 52 | Ga0070695_100068821 | 3300005545 | Bacteria | 2313 |
| 53 | Ga0070695_100383928 | 3300005545 | Bacteria | 1061 |
| 54 | Ga0070696_100042127 | 3300005546 | Bacteria | 3156 |
| 55 | Ga0070696_100150573 | 3300005546 | Bacteria | 1707 |
| 56 | Ga0070696_100218424 | 3300005546 | Bacteria | 1429 |
| 57 | Ga0070696_100525728 | 3300005546 | Bacteria | 944 |
| 58 | Ga0070696_100904132 | 3300005546 | Bacteria | 732 |
| 59 | Ga0070693_100177283 | 3300005547 | Bacteria | 1369 |
| 60 | Ga0070693_100190957 | 3300005547 | Bacteria | 1324 |
| 61 | Ga0070704_100154212 | 3300005549 | Bacteria | 1809 |
| 62 | Ga0070704_100183741 | 3300005549 | Bacteria | 1675 |
| 63 | Ga0070704_100321079 | 3300005549 | Bacteria | 1297 |
| 64 | Ga0070704_100355736 | 3300005549 | Bacteria | 1237 |
| 65 | Ga0068855_100451906 | 3300005563 | Bacteria | 1402 |
| 66 | Ga0070664_100015318 | 3300005564 | Bacteria | 6270 |
| 67 | Ga0068854_100111314 | 3300005578 | Unclassified | 2066 |
| 68 | Ga0068854_100422299 | 3300005578 | Unclassified | 1108 |
| 69 | Ga0068852_101681304 | 3300005616 | Bacteria | 657 |
| 70 | Ga0068859_100045901 | 3300005617 | Bacteria | 4388 |
| 71 | Ga0068859_100142267 | 3300005617 | Bacteria | 2472 |
| 72 | Ga0068859_100171267 | 3300005617 | Bacteria | 2252 |
| 73 | Ga0068859_100284511 | 3300005617 | Bacteria | 1746 |
| 74 | Ga0068859_100405357 | 3300005617 | Bacteria | 1459 |
| 75 | Ga0068859_101550013 | 3300005617 | Bacteria | 732 |
| 76 | Ga0068864_100017436 | 3300005618 | Bacteria | 5987 |
| 77 | Ga0068864_100080933 | 3300005618 | Bacteria | 2847 |
| 78 | Ga0068864_100742377 | 3300005618 | Bacteria | 961 |
| 79 | Ga0068863_100053840 | 3300005841 | Bacteria | 3814 |
| 80 | Ga0068863_101075462 | 3300005841 | Bacteria | 808 |
| 81 | Ga0068858_100274288 | 3300005842 | Bacteria | 1605 |
| 82 | Ga0068860_100056786 | 3300005843 | Bacteria | 3720 |
| 83 | Ga0068860_100518732 | 3300005843 | Bacteria | 1191 |
| 84 | Ga0068862_100179436 | 3300005844 | Bacteria | 1899 |
| 85 | Ga0068862_102731353 | 3300005844 | Unclassified | 505 |
| 86 | Ga0097621_100098532 | 3300006237 | Bacteria | 2456 |
| 87 | Ga0097621_100393594 | 3300006237 | Bacteria | 1239 |
| 88 | Ga0097621_102166939 | 3300006237 | Bacteria | 532 |
| 89 | Ga0068871_100356908 | 3300006358 | Bacteria | 1294 |
| 90 | Ga0068871_101219644 | 3300006358 | Bacteria | 706 |
| 91 | Ga0075428_100015551 | 3300006844 | Bacteria | 8435 |
| 92 | Ga0075431_101369171 | 3300006847 | Bacteria | 668 |
| 93 | Ga0075433_10036844 | 3300006852 | Bacteria | 4216 |
| 94 | Ga0075434_100128936 | 3300006871 | Bacteria | 2547 |
| 95 | Ga0075434_101050022 | 3300006871 | Unclassified | 828 |
| 96 | Ga0075429_100498954 | 3300006880 | Bacteria | 1066 |
| 97 | Ga0068865_100414893 | 3300006881 | Bacteria | 1105 |
| 98 | Ga0097620_100045902 | 3300006931 | Bacteria | 4388 |
| 99 | Ga0097620_100142264 | 3300006931 | Bacteria | 2472 |
| 100 | Ga0097620_100171265 | 3300006931 | Bacteria | 2252 |
| 101 | Ga0097620_100284481 | 3300006931 | Bacteria | 1746 |
| 102 | Ga0097620_100405382 | 3300006931 | Bacteria | 1459 |
| 103 | Ga0097620_101550012 | 3300006931 | Bacteria | 732 |
| 104 | Ga0105240_10437407 | 3300009093 | Bacteria | 1466 |
| 105 | Ga0105240_10972791 | 3300009093 | Bacteria | 909 |
| 106 | Ga0111539_10254759 | 3300009094 | Bacteria | 2044 |
| 107 | Ga0105245_10742456 | 3300009098 | Bacteria | 1017 |
| 108 | Ga0105245_10943004 | 3300009098 | Bacteria | 906 |
| 109 | Ga0105247_11114785 | 3300009101 | Unclassified | 623 |
| 110 | Ga0105247_11512988 | 3300009101 | Unclassified | 548 |
| 111 | Ga0105243_10258848 | 3300009148 | Bacteria | 1557 |
| 112 | Ga0105243_11000575 | 3300009148 | Bacteria | 839 |
| 113 | Ga0105243_11230610 | 3300009148 | Bacteria | 763 |
| 114 | Ga0105241_10359144 | 3300009174 | Bacteria | 1267 |
| 115 | Ga0105242_10052343 | 3300009176 | Bacteria | 3331 |
| 116 | Ga0105242_10140965 | 3300009176 | Bacteria | 2092 |
| 117 | Ga0105242_11285525 | 3300009176 | Bacteria | 755 |
| 118 | Ga0105248_10199216 | 3300009177 | Bacteria | 2256 |
| 119 | Ga0105248_10526343 | 3300009177 | Bacteria | 1333 |
| 120 | Ga0105238_10000007 | 3300009551 | Bacteria | 309725 |
| 121 | Ga0105249_10086795 | 3300009553 | Bacteria | 2918 |
| 122 | Ga0105249_11325134 | 3300009553 | Bacteria | 792 |
| 123 | Ga0099796_10186923 | 3300010159 | Bacteria | 834 |
| 124 | Ga0105239_10163820 | 3300010375 | Bacteria | 2486 |
| 125 | Ga0105239_11980062 | 3300010375 | Bacteria | 676 |
| 126 | Ga0157373_10789663 | 3300013100 | Bacteria | 700 |
| 127 | Ga0157378_10019029 | 3300013297 | Bacteria | 6035 |
| 128 | Ga0157378_10265472 | 3300013297 | Bacteria | 1649 |
| 129 | Ga0157378_11413238 | 3300013297 | Bacteria | 739 |
| 130 | Ga0163162_10069947 | 3300013306 | Bacteria | 3562 |
| 131 | Ga0163162_10429363 | 3300013306 | Bacteria | 1453 |
| 132 | Ga0163162_11276903 | 3300013306 | Bacteria | 834 |
| 133 | Ga0157372_10012169 | 3300013307 | Bacteria | 9166 |
| 134 | Ga0157372_10057214 | 3300013307 | Bacteria | 4358 |
| 135 | Ga0157372_10158339 | 3300013307 | Unclassified | 2616 |
| 136 | Ga0157372_11382111 | 3300013307 | Unclassified | 812 |
| 137 | Ga0157375_10158731 | 3300013308 | Bacteria | 2402 |
| 138 | Ga0163163_10153815 | 3300014325 | Bacteria | 2344 |
| 139 | Ga0163163_10167719 | 3300014325 | Bacteria | 2242 |
| 140 | Ga0163163_10494760 | 3300014325 | Bacteria | 1284 |
| 141 | Ga0157380_10030237 | 3300014326 | Bacteria | 4147 |
| 142 | Ga0157376_11106110 | 3300014969 | Bacteria | 818 |
| 143 | Ga0163161_10854172 | 3300017792 | Unclassified | 768 |
| 144 | Ga0163161_10887294 | 3300017792 | Bacteria | 755 |
| 145 | Ga0213872_10010297 | 3300021361 | Bacteria | 4453 |
| 146 | Ga0213872_10082241 | 3300021361 | Bacteria | 1446 |
| 147 | Ga0213875_10129190 | 3300021388 | Bacteria | 1181 |
| 148 | Ga0207656_10331122 | 3300025321 | Unclassified | 758 |
| 149 | Ga0207682_10014058 | 3300025893 | Bacteria | 3119 |
| 150 | Ga0207645_10098751 | 3300025907 | Unclassified | 1883 |
| 151 | Ga0207684_10020887 | 3300025910 | Bacteria | 5594 |
| 152 | Ga0207684_10055007 | 3300025910 | Bacteria | 3377 |
| 153 | Ga0207707_10011347 | 3300025912 | Bacteria | 7757 |
| 154 | Ga0207671_10536377 | 3300025914 | Bacteria | 933 |
| 155 | Ga0207649_10019417 | 3300025920 | Bacteria | 3884 |
| 156 | Ga0207646_10501886 | 3300025922 | Bacteria | 1093 |
| 157 | Ga0207694_10000007 | 3300025924 | Bacteria | 595422 |
| 158 | Ga0207650_10185864 | 3300025925 | Unclassified | 1658 |
| 159 | Ga0207650_10599761 | 3300025925 | Bacteria | 926 |
| 160 | Ga0207650_10630014 | 3300025925 | Unclassified | 903 |
| 161 | Ga0207690_10473264 | 3300025932 | Bacteria | 1010 |
| 162 | Ga0207706_10000604 | 3300025933 | Bacteria | 38186 |
| 163 | Ga0207706_10029891 | 3300025933 | Bacteria | 4863 |
| 164 | Ga0207686_10201291 | 3300025934 | Bacteria | 1426 |
| 165 | Ga0207686_10202707 | 3300025934 | Bacteria | 1422 |
| 166 | Ga0207686_10225146 | 3300025934 | Bacteria | 1356 |
| 167 | Ga0207709_10310672 | 3300025935 | Bacteria | 1176 |
| 168 | Ga0207709_10411922 | 3300025935 | Bacteria | 1036 |
| 169 | Ga0207670_10359926 | 3300025936 | Bacteria | 1154 |
| 170 | Ga0207704_10231904 | 3300025938 | Bacteria | 1373 |
| 171 | Ga0207711_10630329 | 3300025941 | Bacteria | 1000 |
| 172 | Ga0207689_10106780 | 3300025942 | Bacteria | 2300 |
| 173 | Ga0207689_10893228 | 3300025942 | Bacteria | 750 |
| 174 | Ga0207661_10605622 | 3300025944 | Bacteria | 1006 |
| 175 | Ga0207679_10006976 | 3300025945 | Bacteria | 7159 |
| 176 | Ga0207667_10531336 | 3300025949 | Bacteria | 1191 |
| 177 | Ga0207651_10054648 | 3300025960 | Unclassified | 2738 |
| 178 | Ga0207651_10884365 | 3300025960 | Unclassified | 795 |
| 179 | Ga0207712_10534402 | 3300025961 | Bacteria | 1007 |
| 180 | Ga0207668_10126258 | 3300025972 | Bacteria | 1946 |
| 181 | Ga0207668_10295115 | 3300025972 | Bacteria | 1335 |
| 182 | Ga0207640_10396036 | 3300025981 | Unclassified | 1123 |
| 183 | Ga0207640_11024108 | 3300025981 | Bacteria | 727 |
| 184 | Ga0207658_10255652 | 3300025986 | Bacteria | 1490 |
| 185 | Ga0207703_10128064 | 3300026035 | Bacteria | 2188 |
| 186 | Ga0207703_10404884 | 3300026035 | Bacteria | 1266 |
| 187 | Ga0207703_10560304 | 3300026035 | Bacteria | 1078 |
| 188 | Ga0207639_10008200 | 3300026041 | Bacteria | 7151 |
| 189 | Ga0207641_10251314 | 3300026088 | Bacteria | 1651 |
| 190 | Ga0207641_10638706 | 3300026088 | Bacteria | 1045 |
| 191 | Ga0207648_10548790 | 3300026089 | Unclassified | 1061 |
| 192 | Ga0207648_10605921 | 3300026089 | Bacteria | 1010 |
| 193 | Ga0207648_10748266 | 3300026089 | Bacteria | 908 |
| 194 | Ga0207676_10020421 | 3300026095 | Bacteria | 4847 |
| 195 | Ga0207676_10145370 | 3300026095 | Bacteria | 2036 |
| 196 | Ga0207676_10395047 | 3300026095 | Bacteria | 1291 |
| 197 | Ga0207676_11768965 | 3300026095 | Bacteria | 616 |
| 198 | Ga0207674_10318479 | 3300026116 | Bacteria | 1505 |
| 199 | Ga0207674_10347070 | 3300026116 | Bacteria | 1435 |
| 200 | Ga0209983_1007159 | 3300027665 | Bacteria | 2290 |
| 201 | Ga0209998_10007388 | 3300027717 | Unclassified | 2281 |
| 202 | Ga0209974_10001290 | 3300027876 | Bacteria | 9026 |
| 203 | Ga0207428_10127388 | 3300027907 | Bacteria | 1949 |
| 204 | Ga0268265_10052575 | 3300028380 | Bacteria | 3082 |
| 205 | Ga0268265_10161100 | 3300028380 | Bacteria | 1906 |
| 206 | Ga0268264_10179469 | 3300028381 | Bacteria | 1922 |
| 207 | Ga0268264_10428180 | 3300028381 | Bacteria | 1277 |
| 208 | Ga0265336_10000908 | 3300028666 | Bacteria | 15044 |
| 209 | Ga0265324_10025743 | 3300029957 | Bacteria | 2084 |
| 210 | Ga0265316_10025834 | 3300031344 | Bacteria | 4894 |
| 211 | Ga0307513_10453197 | 3300031456 | Bacteria | 1007 |
| 212 | Ga0307408_100041469 | 3300031548 | Bacteria | 3264 |
| 213 | Ga0307408_100382548 | 3300031548 | Bacteria | 1203 |
| 214 | Ga0307408_100701820 | 3300031548 | Bacteria | 909 |
| 215 | Ga0316576_10177639 | 3300031727 | Bacteria | 1606 |
| 216 | Ga0316578_10015311 | 3300031728 | Bacteria | 4121 |
| 217 | Ga0307405_10003682 | 3300031731 | Bacteria | 7106 |
| 218 | Ga0307405_10088030 | 3300031731 | Unclassified | 2048 |
| 219 | Ga0307413_10060201 | 3300031824 | Bacteria | 2337 |
| 220 | Ga0307413_10597108 | 3300031824 | Bacteria | 903 |
| 221 | Ga0307413_10649508 | 3300031824 | Unclassified | 870 |
| 222 | Ga0307410_10000696 | 3300031852 | Bacteria | 13999 |
| 223 | Ga0307410_10130335 | 3300031852 | Bacteria | 1847 |
| 224 | Ga0307410_10142524 | 3300031852 | Unclassified | 1775 |
| 225 | Ga0307410_10419610 | 3300031852 | Unclassified | 1085 |
| 226 | Ga0307410_10783588 | 3300031852 | Bacteria | 810 |
| 227 | Ga0307406_10002943 | 3300031901 | Bacteria | 9277 |
| 228 | Ga0307406_10013428 | 3300031901 | Bacteria | 4692 |
| 229 | Ga0307406_10540615 | 3300031901 | Bacteria | 952 |
| 230 | Ga0307406_11570328 | 3300031901 | Unclassified | 581 |
| 231 | Ga0307407_10027444 | 3300031903 | Bacteria | 3030 |
| 232 | Ga0307407_10129977 | 3300031903 | Bacteria | 1610 |
| 233 | Ga0307409_100104322 | 3300031995 | Unclassified | 2361 |
| 234 | Ga0307409_100232907 | 3300031995 | Bacteria | 1671 |
| 235 | Ga0307409_100786065 | 3300031995 | Bacteria | 958 |
| 236 | Ga0307409_101065261 | 3300031995 | Bacteria | 829 |
| 237 | Ga0307409_101258578 | 3300031995 | Unclassified | 764 |
| 238 | Ga0307416_100006183 | 3300032002 | Bacteria | 7470 |
| 239 | Ga0307416_100587591 | 3300032002 | Bacteria | 1192 |
| 240 | Ga0307416_100877650 | 3300032002 | Unclassified | 996 |
| 241 | Ga0307416_101233017 | 3300032002 | Bacteria | 854 |
| 242 | Ga0307414_10071839 | 3300032004 | Bacteria | 2498 |
| 243 | Ga0307411_10019316 | 3300032005 | Bacteria | 3934 |
| 244 | Ga0307411_10665802 | 3300032005 | Bacteria | 903 |
| 245 | Ga0307415_100144736 | 3300032126 | Unclassified | 1820 |
| 246 | Ga0373961_0042502 | 3300035241 | Bacteria | 1318 |
| 247 | Ga0316574_0550497 | 3300035398 | Bacteria | 716 |
| 248 | Ga0373947_1050056 | 3300035725 | Unclassified | 556 |
| 249 | Ga0316584_0008166 | 3300036712 | Bacteria | 7198 |
| 250 | Ga0395899_0419645 | 3300037312 | Bacteria | 882 |
| 251 | Ga0395900_0263248 | 3300037418 | Bacteria | 1721 |
| 252 | Ga0395898_0106635 | 3300037466 | Bacteria | 2687 |
| 253 | Ga0436364_0853394 | 3300037853 | Bacteria | 7405 |
| 254 | Ga0395901_0248684 | 3300038443 | Bacteria | 1853 |
| 255 | Ga0436361_0161679 | 3300039447 | Bacteria | 21881 |
| 256 | Ga0436361_0289296 | 3300039447 | Bacteria | 1544 |
| 257 | Ga0436361_0352670 | 3300039447 | Bacteria | 8275 |
| 258 | Ga0436361_0425085 | 3300039447 | Bacteria | 709 |
| 259 | Ga0436361_0535318 | 3300039447 | Bacteria | 823 |
| 260 | Ga0436361_1198231 | 3300039447 | Bacteria | 1680 |
| 261 | Ga0439436_0038858 | 3300041404 | Bacteria | 1367 |
| 262 | Ga0439447_001279 | 3300041407 | Bacteria | 9154 |
| 263 | Ga0439447_100675 | 3300041407 | Bacteria | 663 |
| 264 | Ga0439453_0021455 | 3300041408 | Bacteria | 1165 |
| 265 | Ga0451791_0767263 | 3300041451 | Bacteria | 1303 |
| 266 | Ga0451837_0368369 | 3300041494 | Bacteria | 1653 |
| 267 | Ga0451853_2061972 | 3300041512 | Bacteria | 2215 |
| 268 | Ga0439441_076785 | 3300042001 | Bacteria | 723 |
| 269 | Ga0451577_0038791 | 3300042876 | Bacteria | 4283 |
| 270 | Ga0453683_0000275 | 3300044673 | Bacteria | 67591 |
| 271 | Ga0466965_0222070 | 3300044683 | Bacteria | 1007 |
| 272 | Ga0466961_0005164 | 3300044693 | Bacteria | 8217 |
| 273 | Ga0451576_0388005 | 3300045051 | Bacteria | 1464 |
| 274 | Ga0451576_0778051 | 3300045051 | Bacteria | 1005 |
| 275 | Ga0495650_0202588 | 3300046471 | Bacteria | 689 |
| 276 | Ga0495582_0103565 | 3300046473 | Unclassified | 1595 |
| 277 | Ga0495643_0001137 | 3300046522 | Bacteria | 26122 |
| 278 | Ga0495668_0000660 | 3300046616 | Bacteria | 41444 |
| 279 | Ga0495668_0085255 | 3300046616 | Bacteria | 1733 |
| 280 | Ga0495589_0346474 | 3300046794 | Unclassified | 685 |
| 281 | Ga0495636_0266659 | 3300047318 | Bacteria | 795 |
| 282 | Ga0495672_0006995 | 3300047320 | Bacteria | 8574 |
| 283 | Ga0495672_0341246 | 3300047320 | Unclassified | 698 |
| 284 | Ga0495686_0146170 | 3300047472 | Bacteria | 1391 |
| 285 | Ga0496109_1181739 | 3300048912 | Bacteria | 702 |
| 286 | Ga0496112_1155980 | 3300048915 | Bacteria | 691 |
| 287 | Ga0501031_0006303 | 3300049568 | Bacteria | 7733 |
| 288 | Ga0501032_0218773 | 3300049569 | Bacteria | 1240 |
| 289 | Ga0501034_0001142 | 3300049571 | Bacteria | 36925 |
| 290 | Ga0501034_0216763 | 3300049571 | Bacteria | 1868 |
| 291 | Ga0501034_0256733 | 3300049571 | Bacteria | 1691 |
| 292 | Ga0501038_0002732 | 3300049574 | Bacteria | 16442 |
| 293 | Ga0501040_0522407 | 3300049576 | Bacteria | 856 |
| 294 | Ga0501047_0636166 | 3300049581 | Bacteria | 887 |
| 295 | Ga0501072_0030104 | 3300049588 | Bacteria | 4243 |
| 296 | Ga0501235_048584 | 3300049669 | Unclassified | 980 |
| 297 | Ga0501257_110446 | 3300049686 | Unclassified | 728 |
| 298 | Ga0501265_045449 | 3300049762 | Unclassified | 676 |
| 299 | Ga0501035_0943227 | 3300049822 | Bacteria | 681 |
| 300 | Ga0501044_0787448 | 3300049823 | Bacteria | 831 |
| 301 | nmdc:mga04h51_518968_c1 | 3300050495 | Unclassified | 511 |
| 302 | nmdc:mga09592_1015315_c1 | 3300050508 | Unclassified | 693 |
| 303 | nmdc:mga0qj67_598318_c1 | 3300050509 | Bacteria | 882 |
| 304 | nmdc:mga06r32_1087394_c1 | 3300050510 | Bacteria | 749 |
| 305 | nmdc:mga08y16_1121626_c1 | 3300050511 | Bacteria | 761 |
| 306 | nmdc:mga08y16_77577_c1 | 3300050511 | Bacteria | 3464 |
| 307 | nmdc:mga0n895_1268238_c1 | 3300050512 | Unclassified | 709 |
| 308 | nmdc:mga0a205_59537_c1 | 3300050515 | Bacteria | 3689 |
| 309 | Ga0500583_0173198 | 3300053092 | Bacteria | 1075 |
| 310 | Ga0500622_0002617 | 3300053156 | Bacteria | 12802 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031727 | Ga0316576_10177639 | Ga0316576_101776391 | 139 |
| 2 | 3300031728 | Ga0316578_10015311 | Ga0316578_100153114 | 139 |
| 3 | 3300036712 | Ga0316584_0008166 | Ga0316584_0008166_6559_7035 | 139 |
| 4 | 3300021361 | Ga0213872_10010297 | Ga0213872_100102972 | 142 |
| 5 | 3300021361 | Ga0213872_10082241 | Ga0213872_100822412 | 142 |
| 6 | 3300039447 | Ga0436361_0161679 | Ga0436361_0161679_645_1112 | 142 |
| 7 | 3300039447 | Ga0436361_0535318 | Ga0436361_0535318_241_708 | 142 |
| 8 | 3300039447 | Ga0436361_1198231 | Ga0436361_1198231_241_708 | 142 |
| 9 | 3300039447 | Ga0436361_0289296 | Ga0436361_0289296_176_643 | 144 |
| 10 | 3300035725 | Ga0373947_1050056 | Ga0373947_1050056_59_502 | 147 |
| 11 | 3300005539 | Ga0068853_102394736 | Ga0068853_1023947361 | 148 |
| 12 | 3300006237 | Ga0097621_102166939 | Ga0097621_1021669391 | 148 |
| 13 | 3300013307 | Ga0157372_11382111 | Ga0157372_113821111 | 148 |
| 14 | 3300017792 | Ga0163161_10854172 | Ga0163161_108541721 | 148 |
| 15 | 3300025321 | Ga0207656_10331122 | Ga0207656_103311221 | 148 |
| 16 | 3300025907 | Ga0207645_10098751 | Ga0207645_100987512 | 148 |
| 17 | 3300025925 | Ga0207650_10630014 | Ga0207650_106300141 | 148 |
| 18 | iso_pu_bacteria | 8056120720 | 8056125541 | 148 |
| 19 | 3300003322 | rootL2_10219636 | rootL2_102196361 | 149 |
| 20 | 3300005334 | Ga0068869_100016660 | Ga0068869_1000166603 | 149 |
| 21 | 3300005367 | Ga0070667_100107512 | Ga0070667_1001075122 | 149 |
| 22 | 3300005367 | Ga0070667_100391697 | Ga0070667_1003916972 | 149 |
| 23 | 3300005459 | Ga0068867_100165380 | Ga0068867_1001653801 | 149 |
| 24 | 3300005539 | Ga0068853_101852365 | Ga0068853_1018523651 | 149 |
| 25 | 3300005544 | Ga0070686_100000044 | Ga0070686_100000044107 | 149 |
| 26 | 3300005578 | Ga0068854_100422299 | Ga0068854_1004222992 | 149 |
| 27 | 3300005617 | Ga0068859_100045901 | Ga0068859_1000459015 | 149 |
| 28 | 3300005618 | Ga0068864_100017436 | Ga0068864_1000174364 | 149 |
| 29 | 3300005618 | Ga0068864_100080933 | Ga0068864_1000809333 | 149 |
| 30 | 3300005842 | Ga0068858_100274288 | Ga0068858_1002742882 | 149 |
| 31 | 3300005843 | Ga0068860_100056786 | Ga0068860_1000567865 | 149 |
| 32 | 3300005844 | Ga0068862_100179436 | Ga0068862_1001794362 | 149 |
| 33 | 3300006237 | Ga0097621_100098532 | Ga0097621_1000985322 | 149 |
| 34 | 3300006358 | Ga0068871_101219644 | Ga0068871_1012196441 | 149 |
| 35 | 3300006931 | Ga0097620_100045902 | Ga0097620_1000459023 | 149 |
| 36 | 3300009101 | Ga0105247_11512988 | Ga0105247_115129881 | 149 |
| 37 | 3300009176 | Ga0105242_10140965 | Ga0105242_101409653 | 149 |
| 38 | 3300009177 | Ga0105248_10199216 | Ga0105248_101992162 | 149 |
| 39 | 3300009553 | Ga0105249_10086795 | Ga0105249_100867954 | 149 |
| 40 | 3300013306 | Ga0163162_10069947 | Ga0163162_100699474 | 149 |
| 41 | 3300013308 | Ga0157375_10158731 | Ga0157375_101587314 | 149 |
| 42 | 3300014325 | Ga0163163_10153815 | Ga0163163_101538152 | 149 |
| 43 | 3300025925 | Ga0207650_10599761 | Ga0207650_105997611 | 149 |
| 44 | 3300025934 | Ga0207686_10225146 | Ga0207686_102251461 | 149 |
| 45 | 3300025941 | Ga0207711_10630329 | Ga0207711_106303292 | 149 |
| 46 | 3300025942 | Ga0207689_10106780 | Ga0207689_101067803 | 149 |
| 47 | 3300025981 | Ga0207640_10396036 | Ga0207640_103960362 | 149 |
| 48 | 3300025986 | Ga0207658_10255652 | Ga0207658_102556521 | 149 |
| 49 | 3300026035 | Ga0207703_10404884 | Ga0207703_104048842 | 149 |
| 50 | 3300026095 | Ga0207676_10020421 | Ga0207676_100204215 | 149 |
| 51 | 3300028380 | Ga0268265_10161100 | Ga0268265_101611002 | 149 |
| 52 | 3300028381 | Ga0268264_10428180 | Ga0268264_104281802 | 149 |
| 53 | 3300047320 | Ga0495672_0341246 | Ga0495672_0341246_103_552 | 149 |
| 54 | iso_pu_bacteria | 2547132103 | 2547374766 | 149 |
| 55 | iso_pu_bacteria | 2843690924 | 2843691137 | 149 |
| 56 | 3300005328 | Ga0070676_10066668 | Ga0070676_100666682 | 150 |
| 57 | 3300005331 | Ga0070670_100405245 | Ga0070670_1004052451 | 150 |
| 58 | 3300005333 | Ga0070677_10011733 | Ga0070677_100117333 | 150 |
| 59 | 3300005336 | Ga0070680_100679342 | Ga0070680_1006793421 | 150 |
| 60 | 3300005354 | Ga0070675_100351640 | Ga0070675_1003516401 | 150 |
| 61 | 3300005456 | Ga0070678_100078727 | Ga0070678_1000787272 | 150 |
| 62 | 3300005466 | Ga0070685_10002668 | Ga0070685_100026683 | 150 |
| 63 | 3300005578 | Ga0068854_100111314 | Ga0068854_1001113142 | 150 |
| 64 | 3300006358 | Ga0068871_100356908 | Ga0068871_1003569082 | 150 |
| 65 | 3300006844 | Ga0075428_100015551 | Ga0075428_1000155514 | 150 |
| 66 | 3300009177 | Ga0105248_10526343 | Ga0105248_105263432 | 150 |
| 67 | 3300009551 | Ga0105238_10000007 | Ga0105238_10000007258 | 150 |
| 68 | 3300013307 | Ga0157372_10158339 | Ga0157372_101583393 | 150 |
| 69 | 3300014326 | Ga0157380_10030237 | Ga0157380_100302373 | 150 |
| 70 | 3300014969 | Ga0157376_11106110 | Ga0157376_111061102 | 150 |
| 71 | 3300021388 | Ga0213875_10129190 | Ga0213875_101291902 | 150 |
| 72 | 3300025893 | Ga0207682_10014058 | Ga0207682_100140582 | 150 |
| 73 | 3300025925 | Ga0207650_10185864 | Ga0207650_101858642 | 150 |
| 74 | 3300026089 | Ga0207648_10548790 | Ga0207648_105487902 | 150 |
| 75 | 3300031824 | Ga0307413_10597108 | Ga0307413_105971082 | 150 |
| 76 | 3300031824 | Ga0307413_10649508 | Ga0307413_106495081 | 150 |
| 77 | 3300031852 | Ga0307410_10130335 | Ga0307410_101303352 | 150 |
| 78 | 3300031852 | Ga0307410_10783588 | Ga0307410_107835882 | 150 |
| 79 | 3300031901 | Ga0307406_10540615 | Ga0307406_105406152 | 150 |
| 80 | 3300031995 | Ga0307409_100786065 | Ga0307409_1007860652 | 150 |
| 81 | 3300031995 | Ga0307409_101065261 | Ga0307409_1010652611 | 150 |
| 82 | 3300032002 | Ga0307416_100587591 | Ga0307416_1005875912 | 150 |
| 83 | 3300032002 | Ga0307416_100877650 | Ga0307416_1008776501 | 150 |
| 84 | 3300032004 | Ga0307414_10071839 | Ga0307414_100718391 | 150 |
| 85 | 3300032005 | Ga0307411_10665802 | Ga0307411_106658022 | 150 |
| 86 | 3300035398 | Ga0316574_0550497 | Ga0316574_0550497_99_551 | 150 |
| 87 | 3300037853 | Ga0436364_0853394 | Ga0436364_0853394_5181_5660 | 150 |
| 88 | 3300042001 | Ga0439441_076785 | Ga0439441_076785_54_506 | 150 |
| 89 | 3300044673 | Ga0453683_0000275 | Ga0453683_0000275_16111_16563 | 150 |
| 90 | 3300044693 | Ga0466961_0005164 | Ga0466961_0005164_3951_4421 | 150 |
| 91 | 3300049571 | Ga0501034_0216763 | Ga0501034_0216763_744_1199 | 150 |
| 92 | 3300050509 | nmdc:mga0qj67_598318_c1 | nmdc:mga0qj67_598318_c1_107_562 | 150 |
| 93 | 3300050510 | nmdc:mga06r32_1087394_c1 | nmdc:mga06r32_1087394_c1_23_493 | 150 |
| 94 | 3300050511 | nmdc:mga08y16_1121626_c1 | nmdc:mga08y16_1121626_c1_95_547 | 150 |
| 95 | 3300005345 | Ga0070692_10095735 | Ga0070692_100957352 | 151 |
| 96 | 3300005406 | Ga0070703_10174519 | Ga0070703_101745191 | 151 |
| 97 | 3300005444 | Ga0070694_100053067 | Ga0070694_1000530672 | 151 |
| 98 | 3300005536 | Ga0070697_100267382 | Ga0070697_1002673822 | 151 |
| 99 | 3300005545 | Ga0070695_100046262 | Ga0070695_1000462622 | 151 |
| 100 | 3300005545 | Ga0070695_100068821 | Ga0070695_1000688214 | 151 |
| 101 | 3300005546 | Ga0070696_100042127 | Ga0070696_1000421272 | 151 |
| 102 | 3300005547 | Ga0070693_100177283 | Ga0070693_1001772831 | 151 |
| 103 | 3300005547 | Ga0070693_100190957 | Ga0070693_1001909571 | 151 |
| 104 | 3300005549 | Ga0070704_100183741 | Ga0070704_1001837411 | 151 |
| 105 | 3300005617 | Ga0068859_100171267 | Ga0068859_1001712672 | 151 |
| 106 | 3300005617 | Ga0068859_100284511 | Ga0068859_1002845113 | 151 |
| 107 | 3300005617 | Ga0068859_101550013 | Ga0068859_1015500132 | 151 |
| 108 | 3300006852 | Ga0075433_10036844 | Ga0075433_100368442 | 151 |
| 109 | 3300006871 | Ga0075434_100128936 | Ga0075434_1001289361 | 151 |
| 110 | 3300006931 | Ga0097620_100171265 | Ga0097620_1001712652 | 151 |
| 111 | 3300006931 | Ga0097620_100284481 | Ga0097620_1002844813 | 151 |
| 112 | 3300006931 | Ga0097620_101550012 | Ga0097620_1015500121 | 151 |
| 113 | 3300009093 | Ga0105240_10972791 | Ga0105240_109727912 | 151 |
| 114 | 3300009094 | Ga0111539_10254759 | Ga0111539_102547594 | 151 |
| 115 | 3300009098 | Ga0105245_10742456 | Ga0105245_107424562 | 151 |
| 116 | 3300009148 | Ga0105243_10258848 | Ga0105243_102588483 | 151 |
| 117 | 3300010159 | Ga0099796_10186923 | Ga0099796_101869232 | 151 |
| 118 | 3300010375 | Ga0105239_10163820 | Ga0105239_101638204 | 151 |
| 119 | 3300013297 | Ga0157378_10265472 | Ga0157378_102654722 | 151 |
| 120 | 3300025910 | Ga0207684_10055007 | Ga0207684_100550072 | 151 |
| 121 | 3300025912 | Ga0207707_10011347 | Ga0207707_100113477 | 151 |
| 122 | 3300025914 | Ga0207671_10536377 | Ga0207671_105363772 | 151 |
| 123 | 3300025935 | Ga0207709_10411922 | Ga0207709_104119222 | 151 |
| 124 | 3300026088 | Ga0207641_10638706 | Ga0207641_106387062 | 151 |
| 125 | 3300027717 | Ga0209998_10007388 | Ga0209998_100073883 | 151 |
| 126 | 3300027876 | Ga0209974_10001290 | Ga0209974_100012907 | 151 |
| 127 | 3300031824 | Ga0307413_10060201 | Ga0307413_100602012 | 151 |
| 128 | 3300035241 | Ga0373961_0042502 | Ga0373961_0042502_848_1303 | 151 |
| 129 | 3300037312 | Ga0395899_0419645 | Ga0395899_0419645_326_781 | 151 |
| 130 | 3300037418 | Ga0395900_0263248 | Ga0395900_0263248_605_1060 | 151 |
| 131 | 3300037466 | Ga0395898_0106635 | Ga0395898_0106635_809_1264 | 151 |
| 132 | 3300038443 | Ga0395901_0248684 | Ga0395901_0248684_953_1408 | 151 |
| 133 | 3300044683 | Ga0466965_0222070 | Ga0466965_0222070_48_524 | 151 |
| 134 | 3300045051 | Ga0451576_0388005 | Ga0451576_0388005_150_605 | 151 |
| 135 | 3300046473 | Ga0495582_0103565 | Ga0495582_0103565_863_1321 | 151 |
| 136 | 3300048915 | Ga0496112_1155980 | Ga0496112_1155980_19_474 | 151 |
| 137 | 3300050508 | nmdc:mga09592_1015315_c1 | nmdc:mga09592_1015315_c1_214_669 | 151 |
| 138 | 3300050515 | nmdc:mga0a205_59537_c1 | nmdc:mga0a205_59537_c1_638_1093 | 151 |
| 139 | 3300005289 | Ga0065704_10139039 | Ga0065704_101390393 | 152 |
| 140 | 3300005293 | Ga0065715_10019424 | Ga0065715_100194241 | 152 |
| 141 | 3300005293 | Ga0065715_10440386 | Ga0065715_104403861 | 152 |
| 142 | 3300005295 | Ga0065707_10232004 | Ga0065707_102320042 | 152 |
| 143 | 3300005444 | Ga0070694_100775326 | Ga0070694_1007753262 | 152 |
| 144 | 3300005445 | Ga0070708_101249570 | Ga0070708_1012495701 | 152 |
| 145 | 3300005457 | Ga0070662_100000341 | Ga0070662_1000003412 | 152 |
| 146 | 3300005459 | Ga0068867_100141777 | Ga0068867_1001417772 | 152 |
| 147 | 3300005518 | Ga0070699_100697317 | Ga0070699_1006973171 | 152 |
| 148 | 3300005549 | Ga0070704_100321079 | Ga0070704_1003210791 | 152 |
| 149 | 3300005616 | Ga0068852_101681304 | Ga0068852_1016813041 | 152 |
| 150 | 3300005617 | Ga0068859_100142267 | Ga0068859_1001422672 | 152 |
| 151 | 3300005618 | Ga0068864_100742377 | Ga0068864_1007423772 | 152 |
| 152 | 3300005841 | Ga0068863_101075462 | Ga0068863_1010754621 | 152 |
| 153 | 3300006237 | Ga0097621_100393594 | Ga0097621_1003935942 | 152 |
| 154 | 3300006847 | Ga0075431_101369171 | Ga0075431_1013691711 | 152 |
| 155 | 3300006880 | Ga0075429_100498954 | Ga0075429_1004989542 | 152 |
| 156 | 3300006881 | Ga0068865_100414893 | Ga0068865_1004148931 | 152 |
| 157 | 3300006931 | Ga0097620_100142264 | Ga0097620_1001422642 | 152 |
| 158 | 3300009093 | Ga0105240_10437407 | Ga0105240_104374071 | 152 |
| 159 | 3300009098 | Ga0105245_10943004 | Ga0105245_109430042 | 152 |
| 160 | 3300009101 | Ga0105247_11114785 | Ga0105247_111147851 | 152 |
| 161 | 3300009174 | Ga0105241_10359144 | Ga0105241_103591442 | 152 |
| 162 | 3300009176 | Ga0105242_10052343 | Ga0105242_100523432 | 152 |
| 163 | 3300009553 | Ga0105249_11325134 | Ga0105249_113251342 | 152 |
| 164 | 3300010375 | Ga0105239_11980062 | Ga0105239_119800622 | 152 |
| 165 | 3300013297 | Ga0157378_11413238 | Ga0157378_114132382 | 152 |
| 166 | 3300013306 | Ga0163162_11276903 | Ga0163162_112769031 | 152 |
| 167 | 3300025933 | Ga0207706_10000604 | Ga0207706_100006046 | 152 |
| 168 | 3300025934 | Ga0207686_10201291 | Ga0207686_102012912 | 152 |
| 169 | 3300025938 | Ga0207704_10231904 | Ga0207704_102319042 | 152 |
| 170 | 3300025942 | Ga0207689_10893228 | Ga0207689_108932281 | 152 |
| 171 | 3300026116 | Ga0207674_10318479 | Ga0207674_103184792 | 152 |
| 172 | 3300026116 | Ga0207674_10347070 | Ga0207674_103470702 | 152 |
| 173 | 3300027665 | Ga0209983_1007159 | Ga0209983_10071592 | 152 |
| 174 | 3300032002 | Ga0307416_101233017 | Ga0307416_1012330172 | 152 |
| 175 | 3300041408 | Ga0439453_0021455 | Ga0439453_0021455_311_769 | 152 |
| 176 | 3300048912 | Ga0496109_1181739 | Ga0496109_1181739_228_686 | 152 |
| 177 | 3300053156 | Ga0500622_0002617 | Ga0500622_0002617_10684_11145 | 152 |
| 178 | 3300003316 | rootH1_10052682 | rootH1_100526822 | 153 |
| 179 | 3300003322 | rootL2_10000075 | rootL2_100000757 | 153 |
| 180 | 3300005289 | Ga0065704_10137623 | Ga0065704_101376231 | 153 |
| 181 | 3300005295 | Ga0065707_10018495 | Ga0065707_100184952 | 153 |
| 182 | 3300005295 | Ga0065707_10361003 | Ga0065707_103610031 | 153 |
| 183 | 3300005364 | Ga0070673_100246422 | Ga0070673_1002464223 | 153 |
| 184 | 3300005438 | Ga0070701_10454061 | Ga0070701_104540611 | 153 |
| 185 | 3300005440 | Ga0070705_101273168 | Ga0070705_1012731681 | 153 |
| 186 | 3300005440 | Ga0070705_101359805 | Ga0070705_1013598051 | 153 |
| 187 | 3300005444 | Ga0070694_100054838 | Ga0070694_1000548382 | 153 |
| 188 | 3300005468 | Ga0070707_100302686 | Ga0070707_1003026862 | 153 |
| 189 | 3300005471 | Ga0070698_100060155 | Ga0070698_1000601552 | 153 |
| 190 | 3300005518 | Ga0070699_100549220 | Ga0070699_1005492201 | 153 |
| 191 | 3300005536 | Ga0070697_100000143 | Ga0070697_10000014349 | 153 |
| 192 | 3300005544 | Ga0070686_101054935 | Ga0070686_1010549351 | 153 |
| 193 | 3300005545 | Ga0070695_100383928 | Ga0070695_1003839281 | 153 |
| 194 | 3300005546 | Ga0070696_100150573 | Ga0070696_1001505731 | 153 |
| 195 | 3300005546 | Ga0070696_100218424 | Ga0070696_1002184242 | 153 |
| 196 | 3300005546 | Ga0070696_100525728 | Ga0070696_1005257282 | 153 |
| 197 | 3300005549 | Ga0070704_100154212 | Ga0070704_1001542122 | 153 |
| 198 | 3300005549 | Ga0070704_100355736 | Ga0070704_1003557362 | 153 |
| 199 | 3300005844 | Ga0068862_102731353 | Ga0068862_1027313531 | 153 |
| 200 | 3300006871 | Ga0075434_101050022 | Ga0075434_1010500222 | 153 |
| 201 | 3300009148 | Ga0105243_11000575 | Ga0105243_110005751 | 153 |
| 202 | 3300009148 | Ga0105243_11230610 | Ga0105243_112306102 | 153 |
| 203 | 3300009176 | Ga0105242_11285525 | Ga0105242_112855251 | 153 |
| 204 | 3300013100 | Ga0157373_10789663 | Ga0157373_107896632 | 153 |
| 205 | 3300013307 | Ga0157372_10057214 | Ga0157372_100572143 | 153 |
| 206 | 3300014325 | Ga0163163_10494760 | Ga0163163_104947602 | 153 |
| 207 | 3300017792 | Ga0163161_10887294 | Ga0163161_108872942 | 153 |
| 208 | 3300025910 | Ga0207684_10020887 | Ga0207684_100208874 | 153 |
| 209 | 3300025922 | Ga0207646_10501886 | Ga0207646_105018862 | 153 |
| 210 | 3300025924 | Ga0207694_10000007 | Ga0207694_10000007258 | 153 |
| 211 | 3300025934 | Ga0207686_10202707 | Ga0207686_102027071 | 153 |
| 212 | 3300025935 | Ga0207709_10310672 | Ga0207709_103106723 | 153 |
| 213 | 3300025936 | Ga0207670_10359926 | Ga0207670_103599262 | 153 |
| 214 | 3300025944 | Ga0207661_10605622 | Ga0207661_106056222 | 153 |
| 215 | 3300025960 | Ga0207651_10054648 | Ga0207651_100546482 | 153 |
| 216 | 3300025960 | Ga0207651_10884365 | Ga0207651_108843652 | 153 |
| 217 | 3300025981 | Ga0207640_11024108 | Ga0207640_110241082 | 153 |
| 218 | 3300026035 | Ga0207703_10560304 | Ga0207703_105603042 | 153 |
| 219 | 3300026088 | Ga0207641_10251314 | Ga0207641_102513143 | 153 |
| 220 | 3300026089 | Ga0207648_10748266 | Ga0207648_107482662 | 153 |
| 221 | 3300026095 | Ga0207676_10145370 | Ga0207676_101453702 | 153 |
| 222 | 3300026095 | Ga0207676_10395047 | Ga0207676_103950472 | 153 |
| 223 | 3300026095 | Ga0207676_11768965 | Ga0207676_117689651 | 153 |
| 224 | 3300028380 | Ga0268265_10052575 | Ga0268265_100525751 | 153 |
| 225 | 3300028666 | Ga0265336_10000908 | Ga0265336_1000090811 | 153 |
| 226 | 3300029957 | Ga0265324_10025743 | Ga0265324_100257433 | 153 |
| 227 | 3300031344 | Ga0265316_10025834 | Ga0265316_100258347 | 153 |
| 228 | 3300031456 | Ga0307513_10453197 | Ga0307513_104531972 | 153 |
| 229 | 3300031548 | Ga0307408_100041469 | Ga0307408_1000414692 | 153 |
| 230 | 3300031548 | Ga0307408_100382548 | Ga0307408_1003825482 | 153 |
| 231 | 3300031548 | Ga0307408_100701820 | Ga0307408_1007018202 | 153 |
| 232 | 3300031731 | Ga0307405_10003682 | Ga0307405_100036827 | 153 |
| 233 | 3300031731 | Ga0307405_10088030 | Ga0307405_100880302 | 153 |
| 234 | 3300031852 | Ga0307410_10000696 | Ga0307410_1000069615 | 153 |
| 235 | 3300031852 | Ga0307410_10142524 | Ga0307410_101425241 | 153 |
| 236 | 3300031852 | Ga0307410_10419610 | Ga0307410_104196102 | 153 |
| 237 | 3300031901 | Ga0307406_10002943 | Ga0307406_100029435 | 153 |
| 238 | 3300031901 | Ga0307406_10013428 | Ga0307406_100134283 | 153 |
| 239 | 3300031901 | Ga0307406_11570328 | Ga0307406_115703281 | 153 |
| 240 | 3300031903 | Ga0307407_10027444 | Ga0307407_100274443 | 153 |
| 241 | 3300031903 | Ga0307407_10129977 | Ga0307407_101299772 | 153 |
| 242 | 3300031995 | Ga0307409_100104322 | Ga0307409_1001043223 | 153 |
| 243 | 3300031995 | Ga0307409_100232907 | Ga0307409_1002329071 | 153 |
| 244 | 3300031995 | Ga0307409_101258578 | Ga0307409_1012585782 | 153 |
| 245 | 3300032002 | Ga0307416_100006183 | Ga0307416_1000061836 | 153 |
| 246 | 3300032005 | Ga0307411_10019316 | Ga0307411_100193163 | 153 |
| 247 | 3300032126 | Ga0307415_100144736 | Ga0307415_1001447362 | 153 |
| 248 | 3300039447 | Ga0436361_0352670 | Ga0436361_0352670_4901_5365 | 153 |
| 249 | 3300039447 | Ga0436361_0425085 | Ga0436361_0425085_173_637 | 153 |
| 250 | 3300041404 | Ga0439436_0038858 | Ga0439436_0038858_756_1262 | 153 |
| 251 | 3300041407 | Ga0439447_001279 | Ga0439447_001279_8164_8643 | 153 |
| 252 | 3300041407 | Ga0439447_100675 | Ga0439447_100675_179_643 | 153 |
| 253 | 3300041494 | Ga0451837_0368369 | Ga0451837_0368369_763_1227 | 153 |
| 254 | 3300041512 | Ga0451853_2061972 | Ga0451853_2061972_1586_2050 | 153 |
| 255 | 3300042876 | Ga0451577_0038791 | Ga0451577_0038791_701_1171 | 153 |
| 256 | 3300045051 | Ga0451576_0778051 | Ga0451576_0778051_106_567 | 153 |
| 257 | 3300046471 | Ga0495650_0202588 | Ga0495650_0202588_160_633 | 153 |
| 258 | 3300046522 | Ga0495643_0001137 | Ga0495643_0001137_8863_9336 | 153 |
| 259 | 3300046616 | Ga0495668_0000660 | Ga0495668_0000660_40377_40856 | 153 |
| 260 | 3300046616 | Ga0495668_0085255 | Ga0495668_0085255_328_807 | 153 |
| 261 | 3300046794 | Ga0495589_0346474 | Ga0495589_0346474_151_612 | 153 |
| 262 | 3300047318 | Ga0495636_0266659 | Ga0495636_0266659_35_496 | 153 |
| 263 | 3300047320 | Ga0495672_0006995 | Ga0495672_0006995_2582_3043 | 153 |
| 264 | 3300047472 | Ga0495686_0146170 | Ga0495686_0146170_392_865 | 153 |
| 265 | 3300049568 | Ga0501031_0006303 | Ga0501031_0006303_6797_7261 | 153 |
| 266 | 3300049569 | Ga0501032_0218773 | Ga0501032_0218773_306_770 | 153 |
| 267 | 3300049571 | Ga0501034_0001142 | Ga0501034_0001142_28056_28523 | 153 |
| 268 | 3300049571 | Ga0501034_0256733 | Ga0501034_0256733_894_1361 | 153 |
| 269 | 3300049574 | Ga0501038_0002732 | Ga0501038_0002732_3610_4074 | 153 |
| 270 | 3300049576 | Ga0501040_0522407 | Ga0501040_0522407_172_636 | 153 |
| 271 | 3300049581 | Ga0501047_0636166 | Ga0501047_0636166_67_531 | 153 |
| 272 | 3300049588 | Ga0501072_0030104 | Ga0501072_0030104_639_1106 | 153 |
| 273 | 3300049669 | Ga0501235_048584 | Ga0501235_048584_27_491 | 153 |
| 274 | 3300049686 | Ga0501257_110446 | Ga0501257_110446_166_630 | 153 |
| 275 | 3300049762 | Ga0501265_045449 | Ga0501265_045449_200_664 | 153 |
| 276 | 3300049822 | Ga0501035_0943227 | Ga0501035_0943227_51_515 | 153 |
| 277 | 3300049823 | Ga0501044_0787448 | Ga0501044_0787448_201_665 | 153 |
| 278 | 3300050495 | nmdc:mga04h51_518968_c1 | nmdc:mga04h51_518968_c1_17_493 | 153 |
| 279 | 3300050512 | nmdc:mga0n895_1268238_c1 | nmdc:mga0n895_1268238_c1_208_669 | 153 |
| 280 | 3300053092 | Ga0500583_0173198 | Ga0500583_0173198_325_804 | 153 |
| 281 | iso_pu_bacteria | 2846033681 | 2846034136 | 153 |
| 282 | iso_pu_bacteria | 2846037992 | 2846039247 | 153 |
| 283 | 3300000549 | LJQas_1000081 | LJQas_10000818 | 154 |
| 284 | 3300005289 | Ga0065704_10398445 | Ga0065704_103984451 | 154 |
| 285 | 3300005330 | Ga0070690_100665264 | Ga0070690_1006652642 | 154 |
| 286 | 3300005344 | Ga0070661_100152097 | Ga0070661_1001520971 | 154 |
| 287 | 3300005366 | Ga0070659_100748656 | Ga0070659_1007486562 | 154 |
| 288 | 3300005457 | Ga0070662_100071339 | Ga0070662_1000713392 | 154 |
| 289 | 3300005539 | Ga0068853_100054364 | Ga0068853_1000543642 | 154 |
| 290 | 3300005546 | Ga0070696_100904132 | Ga0070696_1009041321 | 154 |
| 291 | 3300005563 | Ga0068855_100451906 | Ga0068855_1004519061 | 154 |
| 292 | 3300005564 | Ga0070664_100015318 | Ga0070664_1000153185 | 154 |
| 293 | 3300005617 | Ga0068859_100405357 | Ga0068859_1004053572 | 154 |
| 294 | 3300005841 | Ga0068863_100053840 | Ga0068863_1000538402 | 154 |
| 295 | 3300005843 | Ga0068860_100518732 | Ga0068860_1005187321 | 154 |
| 296 | 3300006931 | Ga0097620_100405382 | Ga0097620_1004053822 | 154 |
| 297 | 3300013297 | Ga0157378_10019029 | Ga0157378_100190294 | 154 |
| 298 | 3300013306 | Ga0163162_10429363 | Ga0163162_104293631 | 154 |
| 299 | 3300013307 | Ga0157372_10012169 | Ga0157372_100121698 | 154 |
| 300 | 3300014325 | Ga0163163_10167719 | Ga0163163_101677192 | 154 |
| 301 | 3300025920 | Ga0207649_10019417 | Ga0207649_100194175 | 154 |
| 302 | 3300025932 | Ga0207690_10473264 | Ga0207690_104732642 | 154 |
| 303 | 3300025933 | Ga0207706_10029891 | Ga0207706_100298915 | 154 |
| 304 | 3300025945 | Ga0207679_10006976 | Ga0207679_100069764 | 154 |
| 305 | 3300025949 | Ga0207667_10531336 | Ga0207667_105313362 | 154 |
| 306 | 3300025961 | Ga0207712_10534402 | Ga0207712_105344022 | 154 |
| 307 | 3300025972 | Ga0207668_10126258 | Ga0207668_101262582 | 154 |
| 308 | 3300025972 | Ga0207668_10295115 | Ga0207668_102951152 | 154 |
| 309 | 3300026035 | Ga0207703_10128064 | Ga0207703_101280643 | 154 |
| 310 | 3300026041 | Ga0207639_10008200 | Ga0207639_100082005 | 154 |
| 311 | 3300026089 | Ga0207648_10605921 | Ga0207648_106059212 | 154 |
| 312 | 3300027907 | Ga0207428_10127388 | Ga0207428_101273883 | 154 |
| 313 | 3300028381 | Ga0268264_10179469 | Ga0268264_101794691 | 154 |
| 314 | 3300041451 | Ga0451791_0767263 | Ga0451791_0767263_321_791 | 154 |
| 315 | 3300050511 | nmdc:mga08y16_77577_c1 | nmdc:mga08y16_77577_c1_2315_2779 | 154 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5co4-assembly1.cif.gz_A | structural insights into the 2-oh methylation of c/u34 on trna | 0.9647 | 1 | 147 |
| 6qkv-assembly1.cif.gz_B | structure of yibk from p. aeruginosa | 0.952 | 1 | 149 |
| 5co4-assembly1.cif.gz_B | structural insights into the 2-oh methylation of c/u34 on trna | 0.9474 | 1 | 147 |
| 6qh8-assembly2.cif.gz_B | structure of knotted yibk from p. aeruginosa | 0.9397 | 1 | 149 |
| 6qkv-assembly1.cif.gz_A | structure of yibk from p. aeruginosa | 0.9343 | 1 | 149 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5co4A00 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9647 | 1 | 147 | 3.40.1280.10 |
| af_C6TCU8_69_240_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9337 | 2 | 147 | 3.40.1280.10 |
| 4pzkB00 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9239 | 1 | 147 | 3.40.1280.10 |
| af_O50394_1_154_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9234 | 1 | 147 | 3.40.1280.10 |
| 3l8uA00 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9217 | 1 | 147 | 3.40.1280.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0B6WT02-F1-model_v4 | Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) | 0.9915 | 1 | 149 |
GO:0002130
GO:0003723 GO:0005737 GO:0141098 GO:0141102 |
| AF-A0A2D9TGL7-F1-model_v4 | Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) | 0.9889 | 2 | 149 |
GO:0002130
GO:0003723 GO:0005737 GO:0141098 GO:0141102 |
| AF-A0A838U4N0-F1-model_v4 | Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) | 0.9886 | 1 | 147 |
GO:0002130
GO:0003723 GO:0005737 GO:0008175 GO:0008757 |
| AF-A0A3M2D5C6-F1-model_v4 | Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) | 0.9866 | 1 | 149 |
GO:0002130
GO:0003723 GO:0005737 GO:0141098 GO:0141102 |
| AF-A0A833CAW1-F1-model_v4 | Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) | 0.9837 | 3 | 147 |
GO:0002130
GO:0003723 GO:0005737 GO:0008175 GO:0008757 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar