F402979

General Info

Members Datasets Scaffolds Average Seq Length
315 192 310 154

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10398445|Ga0065704_103984451
Length 178
Sequence MYLASKKMHKYPVDREFVTIADHMHVALVEPEIPPNTGNIARLCAATGTPLHIVGVTGFRMDDRTLKRAGLDYWSEVELYRHIDLSDLYKSLPGSRFIYLTTKVRGFYSSWKYTPNDCLVFGPETRGLPQEVLEANADRCLTIPMPNNNVRSLNLATCVGIVLYEALRQTGFTIQENR

Samples

Sample ID Description Type Environment
1 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
2 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
3 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
4 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
5 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
123 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
128 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
140 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
149 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
150 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
151 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
152 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
153 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
158 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
166 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
179 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
180 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
191 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
192 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.41
Metatranscriptomes 0
Isolates 1.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.95
Nodule 0
Rhizoplane 0.95
Rhizosphere 95.56
Stem 0
Stem Tuber 0
Unclassified 2.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000081 3300000549 Bacteria 16080
2 rootH1_10052682 3300003316 Bacteria 3194
3 rootL2_10000075 3300003322 Bacteria 6881
4 rootL2_10219636 3300003322 Bacteria 1924
5 Ga0065704_10137623 3300005289 Bacteria 1544
6 Ga0065704_10139039 3300005289 Bacteria 1537
7 Ga0065704_10398445 3300005289 Unclassified 754
8 Ga0065715_10019424 3300005293 Bacteria 1985
9 Ga0065715_10440386 3300005293 Bacteria 837
10 Ga0065707_10018495 3300005295 Bacteria 1315
11 Ga0065707_10232004 3300005295 Bacteria 1185
12 Ga0065707_10361003 3300005295 Bacteria 870
13 Ga0070676_10066668 3300005328 Unclassified 2151
14 Ga0070690_100665264 3300005330 Bacteria 797
15 Ga0070670_100405245 3300005331 Bacteria 1204
16 Ga0070677_10011733 3300005333 Bacteria 3028
17 Ga0068869_100016660 3300005334 Bacteria 4958
18 Ga0070680_100679342 3300005336 Bacteria 886
19 Ga0070661_100152097 3300005344 Bacteria 1750
20 Ga0070692_10095735 3300005345 Bacteria 1621
21 Ga0070675_100351640 3300005354 Bacteria 1307
22 Ga0070673_100246422 3300005364 Unclassified 1556
23 Ga0070659_100748656 3300005366 Bacteria 847
24 Ga0070667_100107512 3300005367 Bacteria 2416
25 Ga0070667_100391697 3300005367 Unclassified 1263
26 Ga0070703_10174519 3300005406 Bacteria 826
27 Ga0070701_10454061 3300005438 Unclassified 823
28 Ga0070705_101273168 3300005440 Unclassified 608
29 Ga0070705_101359805 3300005440 Bacteria 591
30 Ga0070694_100053067 3300005444 Bacteria 2742
31 Ga0070694_100054838 3300005444 Bacteria 2701
32 Ga0070694_100775326 3300005444 Bacteria 785
33 Ga0070708_101249570 3300005445 Unclassified 694
34 Ga0070678_100078727 3300005456 Unclassified 2491
35 Ga0070662_100000341 3300005457 Bacteria 27976
36 Ga0070662_100071339 3300005457 Bacteria 2561
37 Ga0068867_100141777 3300005459 Bacteria 1879
38 Ga0068867_100165380 3300005459 Bacteria 1748
39 Ga0070685_10002668 3300005466 Bacteria 9131
40 Ga0070707_100302686 3300005468 Bacteria 1554
41 Ga0070698_100060155 3300005471 Bacteria 3834
42 Ga0070699_100549220 3300005518 Bacteria 1051
43 Ga0070699_100697317 3300005518 Bacteria 928
44 Ga0070697_100000143 3300005536 Bacteria 57751
45 Ga0070697_100267382 3300005536 Bacteria 1465
46 Ga0068853_100054364 3300005539 Bacteria 3450
47 Ga0068853_101852365 3300005539 Unclassified 585
48 Ga0068853_102394736 3300005539 Bacteria 511
49 Ga0070686_100000044 3300005544 Bacteria 102470
50 Ga0070686_101054935 3300005544 Bacteria 669
51 Ga0070695_100046262 3300005545 Bacteria 2776
52 Ga0070695_100068821 3300005545 Bacteria 2313
53 Ga0070695_100383928 3300005545 Bacteria 1061
54 Ga0070696_100042127 3300005546 Bacteria 3156
55 Ga0070696_100150573 3300005546 Bacteria 1707
56 Ga0070696_100218424 3300005546 Bacteria 1429
57 Ga0070696_100525728 3300005546 Bacteria 944
58 Ga0070696_100904132 3300005546 Bacteria 732
59 Ga0070693_100177283 3300005547 Bacteria 1369
60 Ga0070693_100190957 3300005547 Bacteria 1324
61 Ga0070704_100154212 3300005549 Bacteria 1809
62 Ga0070704_100183741 3300005549 Bacteria 1675
63 Ga0070704_100321079 3300005549 Bacteria 1297
64 Ga0070704_100355736 3300005549 Bacteria 1237
65 Ga0068855_100451906 3300005563 Bacteria 1402
66 Ga0070664_100015318 3300005564 Bacteria 6270
67 Ga0068854_100111314 3300005578 Unclassified 2066
68 Ga0068854_100422299 3300005578 Unclassified 1108
69 Ga0068852_101681304 3300005616 Bacteria 657
70 Ga0068859_100045901 3300005617 Bacteria 4388
71 Ga0068859_100142267 3300005617 Bacteria 2472
72 Ga0068859_100171267 3300005617 Bacteria 2252
73 Ga0068859_100284511 3300005617 Bacteria 1746
74 Ga0068859_100405357 3300005617 Bacteria 1459
75 Ga0068859_101550013 3300005617 Bacteria 732
76 Ga0068864_100017436 3300005618 Bacteria 5987
77 Ga0068864_100080933 3300005618 Bacteria 2847
78 Ga0068864_100742377 3300005618 Bacteria 961
79 Ga0068863_100053840 3300005841 Bacteria 3814
80 Ga0068863_101075462 3300005841 Bacteria 808
81 Ga0068858_100274288 3300005842 Bacteria 1605
82 Ga0068860_100056786 3300005843 Bacteria 3720
83 Ga0068860_100518732 3300005843 Bacteria 1191
84 Ga0068862_100179436 3300005844 Bacteria 1899
85 Ga0068862_102731353 3300005844 Unclassified 505
86 Ga0097621_100098532 3300006237 Bacteria 2456
87 Ga0097621_100393594 3300006237 Bacteria 1239
88 Ga0097621_102166939 3300006237 Bacteria 532
89 Ga0068871_100356908 3300006358 Bacteria 1294
90 Ga0068871_101219644 3300006358 Bacteria 706
91 Ga0075428_100015551 3300006844 Bacteria 8435
92 Ga0075431_101369171 3300006847 Bacteria 668
93 Ga0075433_10036844 3300006852 Bacteria 4216
94 Ga0075434_100128936 3300006871 Bacteria 2547
95 Ga0075434_101050022 3300006871 Unclassified 828
96 Ga0075429_100498954 3300006880 Bacteria 1066
97 Ga0068865_100414893 3300006881 Bacteria 1105
98 Ga0097620_100045902 3300006931 Bacteria 4388
99 Ga0097620_100142264 3300006931 Bacteria 2472
100 Ga0097620_100171265 3300006931 Bacteria 2252
101 Ga0097620_100284481 3300006931 Bacteria 1746
102 Ga0097620_100405382 3300006931 Bacteria 1459
103 Ga0097620_101550012 3300006931 Bacteria 732
104 Ga0105240_10437407 3300009093 Bacteria 1466
105 Ga0105240_10972791 3300009093 Bacteria 909
106 Ga0111539_10254759 3300009094 Bacteria 2044
107 Ga0105245_10742456 3300009098 Bacteria 1017
108 Ga0105245_10943004 3300009098 Bacteria 906
109 Ga0105247_11114785 3300009101 Unclassified 623
110 Ga0105247_11512988 3300009101 Unclassified 548
111 Ga0105243_10258848 3300009148 Bacteria 1557
112 Ga0105243_11000575 3300009148 Bacteria 839
113 Ga0105243_11230610 3300009148 Bacteria 763
114 Ga0105241_10359144 3300009174 Bacteria 1267
115 Ga0105242_10052343 3300009176 Bacteria 3331
116 Ga0105242_10140965 3300009176 Bacteria 2092
117 Ga0105242_11285525 3300009176 Bacteria 755
118 Ga0105248_10199216 3300009177 Bacteria 2256
119 Ga0105248_10526343 3300009177 Bacteria 1333
120 Ga0105238_10000007 3300009551 Bacteria 309725
121 Ga0105249_10086795 3300009553 Bacteria 2918
122 Ga0105249_11325134 3300009553 Bacteria 792
123 Ga0099796_10186923 3300010159 Bacteria 834
124 Ga0105239_10163820 3300010375 Bacteria 2486
125 Ga0105239_11980062 3300010375 Bacteria 676
126 Ga0157373_10789663 3300013100 Bacteria 700
127 Ga0157378_10019029 3300013297 Bacteria 6035
128 Ga0157378_10265472 3300013297 Bacteria 1649
129 Ga0157378_11413238 3300013297 Bacteria 739
130 Ga0163162_10069947 3300013306 Bacteria 3562
131 Ga0163162_10429363 3300013306 Bacteria 1453
132 Ga0163162_11276903 3300013306 Bacteria 834
133 Ga0157372_10012169 3300013307 Bacteria 9166
134 Ga0157372_10057214 3300013307 Bacteria 4358
135 Ga0157372_10158339 3300013307 Unclassified 2616
136 Ga0157372_11382111 3300013307 Unclassified 812
137 Ga0157375_10158731 3300013308 Bacteria 2402
138 Ga0163163_10153815 3300014325 Bacteria 2344
139 Ga0163163_10167719 3300014325 Bacteria 2242
140 Ga0163163_10494760 3300014325 Bacteria 1284
141 Ga0157380_10030237 3300014326 Bacteria 4147
142 Ga0157376_11106110 3300014969 Bacteria 818
143 Ga0163161_10854172 3300017792 Unclassified 768
144 Ga0163161_10887294 3300017792 Bacteria 755
145 Ga0213872_10010297 3300021361 Bacteria 4453
146 Ga0213872_10082241 3300021361 Bacteria 1446
147 Ga0213875_10129190 3300021388 Bacteria 1181
148 Ga0207656_10331122 3300025321 Unclassified 758
149 Ga0207682_10014058 3300025893 Bacteria 3119
150 Ga0207645_10098751 3300025907 Unclassified 1883
151 Ga0207684_10020887 3300025910 Bacteria 5594
152 Ga0207684_10055007 3300025910 Bacteria 3377
153 Ga0207707_10011347 3300025912 Bacteria 7757
154 Ga0207671_10536377 3300025914 Bacteria 933
155 Ga0207649_10019417 3300025920 Bacteria 3884
156 Ga0207646_10501886 3300025922 Bacteria 1093
157 Ga0207694_10000007 3300025924 Bacteria 595422
158 Ga0207650_10185864 3300025925 Unclassified 1658
159 Ga0207650_10599761 3300025925 Bacteria 926
160 Ga0207650_10630014 3300025925 Unclassified 903
161 Ga0207690_10473264 3300025932 Bacteria 1010
162 Ga0207706_10000604 3300025933 Bacteria 38186
163 Ga0207706_10029891 3300025933 Bacteria 4863
164 Ga0207686_10201291 3300025934 Bacteria 1426
165 Ga0207686_10202707 3300025934 Bacteria 1422
166 Ga0207686_10225146 3300025934 Bacteria 1356
167 Ga0207709_10310672 3300025935 Bacteria 1176
168 Ga0207709_10411922 3300025935 Bacteria 1036
169 Ga0207670_10359926 3300025936 Bacteria 1154
170 Ga0207704_10231904 3300025938 Bacteria 1373
171 Ga0207711_10630329 3300025941 Bacteria 1000
172 Ga0207689_10106780 3300025942 Bacteria 2300
173 Ga0207689_10893228 3300025942 Bacteria 750
174 Ga0207661_10605622 3300025944 Bacteria 1006
175 Ga0207679_10006976 3300025945 Bacteria 7159
176 Ga0207667_10531336 3300025949 Bacteria 1191
177 Ga0207651_10054648 3300025960 Unclassified 2738
178 Ga0207651_10884365 3300025960 Unclassified 795
179 Ga0207712_10534402 3300025961 Bacteria 1007
180 Ga0207668_10126258 3300025972 Bacteria 1946
181 Ga0207668_10295115 3300025972 Bacteria 1335
182 Ga0207640_10396036 3300025981 Unclassified 1123
183 Ga0207640_11024108 3300025981 Bacteria 727
184 Ga0207658_10255652 3300025986 Bacteria 1490
185 Ga0207703_10128064 3300026035 Bacteria 2188
186 Ga0207703_10404884 3300026035 Bacteria 1266
187 Ga0207703_10560304 3300026035 Bacteria 1078
188 Ga0207639_10008200 3300026041 Bacteria 7151
189 Ga0207641_10251314 3300026088 Bacteria 1651
190 Ga0207641_10638706 3300026088 Bacteria 1045
191 Ga0207648_10548790 3300026089 Unclassified 1061
192 Ga0207648_10605921 3300026089 Bacteria 1010
193 Ga0207648_10748266 3300026089 Bacteria 908
194 Ga0207676_10020421 3300026095 Bacteria 4847
195 Ga0207676_10145370 3300026095 Bacteria 2036
196 Ga0207676_10395047 3300026095 Bacteria 1291
197 Ga0207676_11768965 3300026095 Bacteria 616
198 Ga0207674_10318479 3300026116 Bacteria 1505
199 Ga0207674_10347070 3300026116 Bacteria 1435
200 Ga0209983_1007159 3300027665 Bacteria 2290
201 Ga0209998_10007388 3300027717 Unclassified 2281
202 Ga0209974_10001290 3300027876 Bacteria 9026
203 Ga0207428_10127388 3300027907 Bacteria 1949
204 Ga0268265_10052575 3300028380 Bacteria 3082
205 Ga0268265_10161100 3300028380 Bacteria 1906
206 Ga0268264_10179469 3300028381 Bacteria 1922
207 Ga0268264_10428180 3300028381 Bacteria 1277
208 Ga0265336_10000908 3300028666 Bacteria 15044
209 Ga0265324_10025743 3300029957 Bacteria 2084
210 Ga0265316_10025834 3300031344 Bacteria 4894
211 Ga0307513_10453197 3300031456 Bacteria 1007
212 Ga0307408_100041469 3300031548 Bacteria 3264
213 Ga0307408_100382548 3300031548 Bacteria 1203
214 Ga0307408_100701820 3300031548 Bacteria 909
215 Ga0316576_10177639 3300031727 Bacteria 1606
216 Ga0316578_10015311 3300031728 Bacteria 4121
217 Ga0307405_10003682 3300031731 Bacteria 7106
218 Ga0307405_10088030 3300031731 Unclassified 2048
219 Ga0307413_10060201 3300031824 Bacteria 2337
220 Ga0307413_10597108 3300031824 Bacteria 903
221 Ga0307413_10649508 3300031824 Unclassified 870
222 Ga0307410_10000696 3300031852 Bacteria 13999
223 Ga0307410_10130335 3300031852 Bacteria 1847
224 Ga0307410_10142524 3300031852 Unclassified 1775
225 Ga0307410_10419610 3300031852 Unclassified 1085
226 Ga0307410_10783588 3300031852 Bacteria 810
227 Ga0307406_10002943 3300031901 Bacteria 9277
228 Ga0307406_10013428 3300031901 Bacteria 4692
229 Ga0307406_10540615 3300031901 Bacteria 952
230 Ga0307406_11570328 3300031901 Unclassified 581
231 Ga0307407_10027444 3300031903 Bacteria 3030
232 Ga0307407_10129977 3300031903 Bacteria 1610
233 Ga0307409_100104322 3300031995 Unclassified 2361
234 Ga0307409_100232907 3300031995 Bacteria 1671
235 Ga0307409_100786065 3300031995 Bacteria 958
236 Ga0307409_101065261 3300031995 Bacteria 829
237 Ga0307409_101258578 3300031995 Unclassified 764
238 Ga0307416_100006183 3300032002 Bacteria 7470
239 Ga0307416_100587591 3300032002 Bacteria 1192
240 Ga0307416_100877650 3300032002 Unclassified 996
241 Ga0307416_101233017 3300032002 Bacteria 854
242 Ga0307414_10071839 3300032004 Bacteria 2498
243 Ga0307411_10019316 3300032005 Bacteria 3934
244 Ga0307411_10665802 3300032005 Bacteria 903
245 Ga0307415_100144736 3300032126 Unclassified 1820
246 Ga0373961_0042502 3300035241 Bacteria 1318
247 Ga0316574_0550497 3300035398 Bacteria 716
248 Ga0373947_1050056 3300035725 Unclassified 556
249 Ga0316584_0008166 3300036712 Bacteria 7198
250 Ga0395899_0419645 3300037312 Bacteria 882
251 Ga0395900_0263248 3300037418 Bacteria 1721
252 Ga0395898_0106635 3300037466 Bacteria 2687
253 Ga0436364_0853394 3300037853 Bacteria 7405
254 Ga0395901_0248684 3300038443 Bacteria 1853
255 Ga0436361_0161679 3300039447 Bacteria 21881
256 Ga0436361_0289296 3300039447 Bacteria 1544
257 Ga0436361_0352670 3300039447 Bacteria 8275
258 Ga0436361_0425085 3300039447 Bacteria 709
259 Ga0436361_0535318 3300039447 Bacteria 823
260 Ga0436361_1198231 3300039447 Bacteria 1680
261 Ga0439436_0038858 3300041404 Bacteria 1367
262 Ga0439447_001279 3300041407 Bacteria 9154
263 Ga0439447_100675 3300041407 Bacteria 663
264 Ga0439453_0021455 3300041408 Bacteria 1165
265 Ga0451791_0767263 3300041451 Bacteria 1303
266 Ga0451837_0368369 3300041494 Bacteria 1653
267 Ga0451853_2061972 3300041512 Bacteria 2215
268 Ga0439441_076785 3300042001 Bacteria 723
269 Ga0451577_0038791 3300042876 Bacteria 4283
270 Ga0453683_0000275 3300044673 Bacteria 67591
271 Ga0466965_0222070 3300044683 Bacteria 1007
272 Ga0466961_0005164 3300044693 Bacteria 8217
273 Ga0451576_0388005 3300045051 Bacteria 1464
274 Ga0451576_0778051 3300045051 Bacteria 1005
275 Ga0495650_0202588 3300046471 Bacteria 689
276 Ga0495582_0103565 3300046473 Unclassified 1595
277 Ga0495643_0001137 3300046522 Bacteria 26122
278 Ga0495668_0000660 3300046616 Bacteria 41444
279 Ga0495668_0085255 3300046616 Bacteria 1733
280 Ga0495589_0346474 3300046794 Unclassified 685
281 Ga0495636_0266659 3300047318 Bacteria 795
282 Ga0495672_0006995 3300047320 Bacteria 8574
283 Ga0495672_0341246 3300047320 Unclassified 698
284 Ga0495686_0146170 3300047472 Bacteria 1391
285 Ga0496109_1181739 3300048912 Bacteria 702
286 Ga0496112_1155980 3300048915 Bacteria 691
287 Ga0501031_0006303 3300049568 Bacteria 7733
288 Ga0501032_0218773 3300049569 Bacteria 1240
289 Ga0501034_0001142 3300049571 Bacteria 36925
290 Ga0501034_0216763 3300049571 Bacteria 1868
291 Ga0501034_0256733 3300049571 Bacteria 1691
292 Ga0501038_0002732 3300049574 Bacteria 16442
293 Ga0501040_0522407 3300049576 Bacteria 856
294 Ga0501047_0636166 3300049581 Bacteria 887
295 Ga0501072_0030104 3300049588 Bacteria 4243
296 Ga0501235_048584 3300049669 Unclassified 980
297 Ga0501257_110446 3300049686 Unclassified 728
298 Ga0501265_045449 3300049762 Unclassified 676
299 Ga0501035_0943227 3300049822 Bacteria 681
300 Ga0501044_0787448 3300049823 Bacteria 831
301 nmdc:mga04h51_518968_c1 3300050495 Unclassified 511
302 nmdc:mga09592_1015315_c1 3300050508 Unclassified 693
303 nmdc:mga0qj67_598318_c1 3300050509 Bacteria 882
304 nmdc:mga06r32_1087394_c1 3300050510 Bacteria 749
305 nmdc:mga08y16_1121626_c1 3300050511 Bacteria 761
306 nmdc:mga08y16_77577_c1 3300050511 Bacteria 3464
307 nmdc:mga0n895_1268238_c1 3300050512 Unclassified 709
308 nmdc:mga0a205_59537_c1 3300050515 Bacteria 3689
309 Ga0500583_0173198 3300053092 Bacteria 1075
310 Ga0500622_0002617 3300053156 Bacteria 12802

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031727 Ga0316576_10177639 Ga0316576_101776391 139
2 3300031728 Ga0316578_10015311 Ga0316578_100153114 139
3 3300036712 Ga0316584_0008166 Ga0316584_0008166_6559_7035 139
4 3300021361 Ga0213872_10010297 Ga0213872_100102972 142
5 3300021361 Ga0213872_10082241 Ga0213872_100822412 142
6 3300039447 Ga0436361_0161679 Ga0436361_0161679_645_1112 142
7 3300039447 Ga0436361_0535318 Ga0436361_0535318_241_708 142
8 3300039447 Ga0436361_1198231 Ga0436361_1198231_241_708 142
9 3300039447 Ga0436361_0289296 Ga0436361_0289296_176_643 144
10 3300035725 Ga0373947_1050056 Ga0373947_1050056_59_502 147
11 3300005539 Ga0068853_102394736 Ga0068853_1023947361 148
12 3300006237 Ga0097621_102166939 Ga0097621_1021669391 148
13 3300013307 Ga0157372_11382111 Ga0157372_113821111 148
14 3300017792 Ga0163161_10854172 Ga0163161_108541721 148
15 3300025321 Ga0207656_10331122 Ga0207656_103311221 148
16 3300025907 Ga0207645_10098751 Ga0207645_100987512 148
17 3300025925 Ga0207650_10630014 Ga0207650_106300141 148
18 iso_pu_bacteria 8056120720 8056125541 148
19 3300003322 rootL2_10219636 rootL2_102196361 149
20 3300005334 Ga0068869_100016660 Ga0068869_1000166603 149
21 3300005367 Ga0070667_100107512 Ga0070667_1001075122 149
22 3300005367 Ga0070667_100391697 Ga0070667_1003916972 149
23 3300005459 Ga0068867_100165380 Ga0068867_1001653801 149
24 3300005539 Ga0068853_101852365 Ga0068853_1018523651 149
25 3300005544 Ga0070686_100000044 Ga0070686_100000044107 149
26 3300005578 Ga0068854_100422299 Ga0068854_1004222992 149
27 3300005617 Ga0068859_100045901 Ga0068859_1000459015 149
28 3300005618 Ga0068864_100017436 Ga0068864_1000174364 149
29 3300005618 Ga0068864_100080933 Ga0068864_1000809333 149
30 3300005842 Ga0068858_100274288 Ga0068858_1002742882 149
31 3300005843 Ga0068860_100056786 Ga0068860_1000567865 149
32 3300005844 Ga0068862_100179436 Ga0068862_1001794362 149
33 3300006237 Ga0097621_100098532 Ga0097621_1000985322 149
34 3300006358 Ga0068871_101219644 Ga0068871_1012196441 149
35 3300006931 Ga0097620_100045902 Ga0097620_1000459023 149
36 3300009101 Ga0105247_11512988 Ga0105247_115129881 149
37 3300009176 Ga0105242_10140965 Ga0105242_101409653 149
38 3300009177 Ga0105248_10199216 Ga0105248_101992162 149
39 3300009553 Ga0105249_10086795 Ga0105249_100867954 149
40 3300013306 Ga0163162_10069947 Ga0163162_100699474 149
41 3300013308 Ga0157375_10158731 Ga0157375_101587314 149
42 3300014325 Ga0163163_10153815 Ga0163163_101538152 149
43 3300025925 Ga0207650_10599761 Ga0207650_105997611 149
44 3300025934 Ga0207686_10225146 Ga0207686_102251461 149
45 3300025941 Ga0207711_10630329 Ga0207711_106303292 149
46 3300025942 Ga0207689_10106780 Ga0207689_101067803 149
47 3300025981 Ga0207640_10396036 Ga0207640_103960362 149
48 3300025986 Ga0207658_10255652 Ga0207658_102556521 149
49 3300026035 Ga0207703_10404884 Ga0207703_104048842 149
50 3300026095 Ga0207676_10020421 Ga0207676_100204215 149
51 3300028380 Ga0268265_10161100 Ga0268265_101611002 149
52 3300028381 Ga0268264_10428180 Ga0268264_104281802 149
53 3300047320 Ga0495672_0341246 Ga0495672_0341246_103_552 149
54 iso_pu_bacteria 2547132103 2547374766 149
55 iso_pu_bacteria 2843690924 2843691137 149
56 3300005328 Ga0070676_10066668 Ga0070676_100666682 150
57 3300005331 Ga0070670_100405245 Ga0070670_1004052451 150
58 3300005333 Ga0070677_10011733 Ga0070677_100117333 150
59 3300005336 Ga0070680_100679342 Ga0070680_1006793421 150
60 3300005354 Ga0070675_100351640 Ga0070675_1003516401 150
61 3300005456 Ga0070678_100078727 Ga0070678_1000787272 150
62 3300005466 Ga0070685_10002668 Ga0070685_100026683 150
63 3300005578 Ga0068854_100111314 Ga0068854_1001113142 150
64 3300006358 Ga0068871_100356908 Ga0068871_1003569082 150
65 3300006844 Ga0075428_100015551 Ga0075428_1000155514 150
66 3300009177 Ga0105248_10526343 Ga0105248_105263432 150
67 3300009551 Ga0105238_10000007 Ga0105238_10000007258 150
68 3300013307 Ga0157372_10158339 Ga0157372_101583393 150
69 3300014326 Ga0157380_10030237 Ga0157380_100302373 150
70 3300014969 Ga0157376_11106110 Ga0157376_111061102 150
71 3300021388 Ga0213875_10129190 Ga0213875_101291902 150
72 3300025893 Ga0207682_10014058 Ga0207682_100140582 150
73 3300025925 Ga0207650_10185864 Ga0207650_101858642 150
74 3300026089 Ga0207648_10548790 Ga0207648_105487902 150
75 3300031824 Ga0307413_10597108 Ga0307413_105971082 150
76 3300031824 Ga0307413_10649508 Ga0307413_106495081 150
77 3300031852 Ga0307410_10130335 Ga0307410_101303352 150
78 3300031852 Ga0307410_10783588 Ga0307410_107835882 150
79 3300031901 Ga0307406_10540615 Ga0307406_105406152 150
80 3300031995 Ga0307409_100786065 Ga0307409_1007860652 150
81 3300031995 Ga0307409_101065261 Ga0307409_1010652611 150
82 3300032002 Ga0307416_100587591 Ga0307416_1005875912 150
83 3300032002 Ga0307416_100877650 Ga0307416_1008776501 150
84 3300032004 Ga0307414_10071839 Ga0307414_100718391 150
85 3300032005 Ga0307411_10665802 Ga0307411_106658022 150
86 3300035398 Ga0316574_0550497 Ga0316574_0550497_99_551 150
87 3300037853 Ga0436364_0853394 Ga0436364_0853394_5181_5660 150
88 3300042001 Ga0439441_076785 Ga0439441_076785_54_506 150
89 3300044673 Ga0453683_0000275 Ga0453683_0000275_16111_16563 150
90 3300044693 Ga0466961_0005164 Ga0466961_0005164_3951_4421 150
91 3300049571 Ga0501034_0216763 Ga0501034_0216763_744_1199 150
92 3300050509 nmdc:mga0qj67_598318_c1 nmdc:mga0qj67_598318_c1_107_562 150
93 3300050510 nmdc:mga06r32_1087394_c1 nmdc:mga06r32_1087394_c1_23_493 150
94 3300050511 nmdc:mga08y16_1121626_c1 nmdc:mga08y16_1121626_c1_95_547 150
95 3300005345 Ga0070692_10095735 Ga0070692_100957352 151
96 3300005406 Ga0070703_10174519 Ga0070703_101745191 151
97 3300005444 Ga0070694_100053067 Ga0070694_1000530672 151
98 3300005536 Ga0070697_100267382 Ga0070697_1002673822 151
99 3300005545 Ga0070695_100046262 Ga0070695_1000462622 151
100 3300005545 Ga0070695_100068821 Ga0070695_1000688214 151
101 3300005546 Ga0070696_100042127 Ga0070696_1000421272 151
102 3300005547 Ga0070693_100177283 Ga0070693_1001772831 151
103 3300005547 Ga0070693_100190957 Ga0070693_1001909571 151
104 3300005549 Ga0070704_100183741 Ga0070704_1001837411 151
105 3300005617 Ga0068859_100171267 Ga0068859_1001712672 151
106 3300005617 Ga0068859_100284511 Ga0068859_1002845113 151
107 3300005617 Ga0068859_101550013 Ga0068859_1015500132 151
108 3300006852 Ga0075433_10036844 Ga0075433_100368442 151
109 3300006871 Ga0075434_100128936 Ga0075434_1001289361 151
110 3300006931 Ga0097620_100171265 Ga0097620_1001712652 151
111 3300006931 Ga0097620_100284481 Ga0097620_1002844813 151
112 3300006931 Ga0097620_101550012 Ga0097620_1015500121 151
113 3300009093 Ga0105240_10972791 Ga0105240_109727912 151
114 3300009094 Ga0111539_10254759 Ga0111539_102547594 151
115 3300009098 Ga0105245_10742456 Ga0105245_107424562 151
116 3300009148 Ga0105243_10258848 Ga0105243_102588483 151
117 3300010159 Ga0099796_10186923 Ga0099796_101869232 151
118 3300010375 Ga0105239_10163820 Ga0105239_101638204 151
119 3300013297 Ga0157378_10265472 Ga0157378_102654722 151
120 3300025910 Ga0207684_10055007 Ga0207684_100550072 151
121 3300025912 Ga0207707_10011347 Ga0207707_100113477 151
122 3300025914 Ga0207671_10536377 Ga0207671_105363772 151
123 3300025935 Ga0207709_10411922 Ga0207709_104119222 151
124 3300026088 Ga0207641_10638706 Ga0207641_106387062 151
125 3300027717 Ga0209998_10007388 Ga0209998_100073883 151
126 3300027876 Ga0209974_10001290 Ga0209974_100012907 151
127 3300031824 Ga0307413_10060201 Ga0307413_100602012 151
128 3300035241 Ga0373961_0042502 Ga0373961_0042502_848_1303 151
129 3300037312 Ga0395899_0419645 Ga0395899_0419645_326_781 151
130 3300037418 Ga0395900_0263248 Ga0395900_0263248_605_1060 151
131 3300037466 Ga0395898_0106635 Ga0395898_0106635_809_1264 151
132 3300038443 Ga0395901_0248684 Ga0395901_0248684_953_1408 151
133 3300044683 Ga0466965_0222070 Ga0466965_0222070_48_524 151
134 3300045051 Ga0451576_0388005 Ga0451576_0388005_150_605 151
135 3300046473 Ga0495582_0103565 Ga0495582_0103565_863_1321 151
136 3300048915 Ga0496112_1155980 Ga0496112_1155980_19_474 151
137 3300050508 nmdc:mga09592_1015315_c1 nmdc:mga09592_1015315_c1_214_669 151
138 3300050515 nmdc:mga0a205_59537_c1 nmdc:mga0a205_59537_c1_638_1093 151
139 3300005289 Ga0065704_10139039 Ga0065704_101390393 152
140 3300005293 Ga0065715_10019424 Ga0065715_100194241 152
141 3300005293 Ga0065715_10440386 Ga0065715_104403861 152
142 3300005295 Ga0065707_10232004 Ga0065707_102320042 152
143 3300005444 Ga0070694_100775326 Ga0070694_1007753262 152
144 3300005445 Ga0070708_101249570 Ga0070708_1012495701 152
145 3300005457 Ga0070662_100000341 Ga0070662_1000003412 152
146 3300005459 Ga0068867_100141777 Ga0068867_1001417772 152
147 3300005518 Ga0070699_100697317 Ga0070699_1006973171 152
148 3300005549 Ga0070704_100321079 Ga0070704_1003210791 152
149 3300005616 Ga0068852_101681304 Ga0068852_1016813041 152
150 3300005617 Ga0068859_100142267 Ga0068859_1001422672 152
151 3300005618 Ga0068864_100742377 Ga0068864_1007423772 152
152 3300005841 Ga0068863_101075462 Ga0068863_1010754621 152
153 3300006237 Ga0097621_100393594 Ga0097621_1003935942 152
154 3300006847 Ga0075431_101369171 Ga0075431_1013691711 152
155 3300006880 Ga0075429_100498954 Ga0075429_1004989542 152
156 3300006881 Ga0068865_100414893 Ga0068865_1004148931 152
157 3300006931 Ga0097620_100142264 Ga0097620_1001422642 152
158 3300009093 Ga0105240_10437407 Ga0105240_104374071 152
159 3300009098 Ga0105245_10943004 Ga0105245_109430042 152
160 3300009101 Ga0105247_11114785 Ga0105247_111147851 152
161 3300009174 Ga0105241_10359144 Ga0105241_103591442 152
162 3300009176 Ga0105242_10052343 Ga0105242_100523432 152
163 3300009553 Ga0105249_11325134 Ga0105249_113251342 152
164 3300010375 Ga0105239_11980062 Ga0105239_119800622 152
165 3300013297 Ga0157378_11413238 Ga0157378_114132382 152
166 3300013306 Ga0163162_11276903 Ga0163162_112769031 152
167 3300025933 Ga0207706_10000604 Ga0207706_100006046 152
168 3300025934 Ga0207686_10201291 Ga0207686_102012912 152
169 3300025938 Ga0207704_10231904 Ga0207704_102319042 152
170 3300025942 Ga0207689_10893228 Ga0207689_108932281 152
171 3300026116 Ga0207674_10318479 Ga0207674_103184792 152
172 3300026116 Ga0207674_10347070 Ga0207674_103470702 152
173 3300027665 Ga0209983_1007159 Ga0209983_10071592 152
174 3300032002 Ga0307416_101233017 Ga0307416_1012330172 152
175 3300041408 Ga0439453_0021455 Ga0439453_0021455_311_769 152
176 3300048912 Ga0496109_1181739 Ga0496109_1181739_228_686 152
177 3300053156 Ga0500622_0002617 Ga0500622_0002617_10684_11145 152
178 3300003316 rootH1_10052682 rootH1_100526822 153
179 3300003322 rootL2_10000075 rootL2_100000757 153
180 3300005289 Ga0065704_10137623 Ga0065704_101376231 153
181 3300005295 Ga0065707_10018495 Ga0065707_100184952 153
182 3300005295 Ga0065707_10361003 Ga0065707_103610031 153
183 3300005364 Ga0070673_100246422 Ga0070673_1002464223 153
184 3300005438 Ga0070701_10454061 Ga0070701_104540611 153
185 3300005440 Ga0070705_101273168 Ga0070705_1012731681 153
186 3300005440 Ga0070705_101359805 Ga0070705_1013598051 153
187 3300005444 Ga0070694_100054838 Ga0070694_1000548382 153
188 3300005468 Ga0070707_100302686 Ga0070707_1003026862 153
189 3300005471 Ga0070698_100060155 Ga0070698_1000601552 153
190 3300005518 Ga0070699_100549220 Ga0070699_1005492201 153
191 3300005536 Ga0070697_100000143 Ga0070697_10000014349 153
192 3300005544 Ga0070686_101054935 Ga0070686_1010549351 153
193 3300005545 Ga0070695_100383928 Ga0070695_1003839281 153
194 3300005546 Ga0070696_100150573 Ga0070696_1001505731 153
195 3300005546 Ga0070696_100218424 Ga0070696_1002184242 153
196 3300005546 Ga0070696_100525728 Ga0070696_1005257282 153
197 3300005549 Ga0070704_100154212 Ga0070704_1001542122 153
198 3300005549 Ga0070704_100355736 Ga0070704_1003557362 153
199 3300005844 Ga0068862_102731353 Ga0068862_1027313531 153
200 3300006871 Ga0075434_101050022 Ga0075434_1010500222 153
201 3300009148 Ga0105243_11000575 Ga0105243_110005751 153
202 3300009148 Ga0105243_11230610 Ga0105243_112306102 153
203 3300009176 Ga0105242_11285525 Ga0105242_112855251 153
204 3300013100 Ga0157373_10789663 Ga0157373_107896632 153
205 3300013307 Ga0157372_10057214 Ga0157372_100572143 153
206 3300014325 Ga0163163_10494760 Ga0163163_104947602 153
207 3300017792 Ga0163161_10887294 Ga0163161_108872942 153
208 3300025910 Ga0207684_10020887 Ga0207684_100208874 153
209 3300025922 Ga0207646_10501886 Ga0207646_105018862 153
210 3300025924 Ga0207694_10000007 Ga0207694_10000007258 153
211 3300025934 Ga0207686_10202707 Ga0207686_102027071 153
212 3300025935 Ga0207709_10310672 Ga0207709_103106723 153
213 3300025936 Ga0207670_10359926 Ga0207670_103599262 153
214 3300025944 Ga0207661_10605622 Ga0207661_106056222 153
215 3300025960 Ga0207651_10054648 Ga0207651_100546482 153
216 3300025960 Ga0207651_10884365 Ga0207651_108843652 153
217 3300025981 Ga0207640_11024108 Ga0207640_110241082 153
218 3300026035 Ga0207703_10560304 Ga0207703_105603042 153
219 3300026088 Ga0207641_10251314 Ga0207641_102513143 153
220 3300026089 Ga0207648_10748266 Ga0207648_107482662 153
221 3300026095 Ga0207676_10145370 Ga0207676_101453702 153
222 3300026095 Ga0207676_10395047 Ga0207676_103950472 153
223 3300026095 Ga0207676_11768965 Ga0207676_117689651 153
224 3300028380 Ga0268265_10052575 Ga0268265_100525751 153
225 3300028666 Ga0265336_10000908 Ga0265336_1000090811 153
226 3300029957 Ga0265324_10025743 Ga0265324_100257433 153
227 3300031344 Ga0265316_10025834 Ga0265316_100258347 153
228 3300031456 Ga0307513_10453197 Ga0307513_104531972 153
229 3300031548 Ga0307408_100041469 Ga0307408_1000414692 153
230 3300031548 Ga0307408_100382548 Ga0307408_1003825482 153
231 3300031548 Ga0307408_100701820 Ga0307408_1007018202 153
232 3300031731 Ga0307405_10003682 Ga0307405_100036827 153
233 3300031731 Ga0307405_10088030 Ga0307405_100880302 153
234 3300031852 Ga0307410_10000696 Ga0307410_1000069615 153
235 3300031852 Ga0307410_10142524 Ga0307410_101425241 153
236 3300031852 Ga0307410_10419610 Ga0307410_104196102 153
237 3300031901 Ga0307406_10002943 Ga0307406_100029435 153
238 3300031901 Ga0307406_10013428 Ga0307406_100134283 153
239 3300031901 Ga0307406_11570328 Ga0307406_115703281 153
240 3300031903 Ga0307407_10027444 Ga0307407_100274443 153
241 3300031903 Ga0307407_10129977 Ga0307407_101299772 153
242 3300031995 Ga0307409_100104322 Ga0307409_1001043223 153
243 3300031995 Ga0307409_100232907 Ga0307409_1002329071 153
244 3300031995 Ga0307409_101258578 Ga0307409_1012585782 153
245 3300032002 Ga0307416_100006183 Ga0307416_1000061836 153
246 3300032005 Ga0307411_10019316 Ga0307411_100193163 153
247 3300032126 Ga0307415_100144736 Ga0307415_1001447362 153
248 3300039447 Ga0436361_0352670 Ga0436361_0352670_4901_5365 153
249 3300039447 Ga0436361_0425085 Ga0436361_0425085_173_637 153
250 3300041404 Ga0439436_0038858 Ga0439436_0038858_756_1262 153
251 3300041407 Ga0439447_001279 Ga0439447_001279_8164_8643 153
252 3300041407 Ga0439447_100675 Ga0439447_100675_179_643 153
253 3300041494 Ga0451837_0368369 Ga0451837_0368369_763_1227 153
254 3300041512 Ga0451853_2061972 Ga0451853_2061972_1586_2050 153
255 3300042876 Ga0451577_0038791 Ga0451577_0038791_701_1171 153
256 3300045051 Ga0451576_0778051 Ga0451576_0778051_106_567 153
257 3300046471 Ga0495650_0202588 Ga0495650_0202588_160_633 153
258 3300046522 Ga0495643_0001137 Ga0495643_0001137_8863_9336 153
259 3300046616 Ga0495668_0000660 Ga0495668_0000660_40377_40856 153
260 3300046616 Ga0495668_0085255 Ga0495668_0085255_328_807 153
261 3300046794 Ga0495589_0346474 Ga0495589_0346474_151_612 153
262 3300047318 Ga0495636_0266659 Ga0495636_0266659_35_496 153
263 3300047320 Ga0495672_0006995 Ga0495672_0006995_2582_3043 153
264 3300047472 Ga0495686_0146170 Ga0495686_0146170_392_865 153
265 3300049568 Ga0501031_0006303 Ga0501031_0006303_6797_7261 153
266 3300049569 Ga0501032_0218773 Ga0501032_0218773_306_770 153
267 3300049571 Ga0501034_0001142 Ga0501034_0001142_28056_28523 153
268 3300049571 Ga0501034_0256733 Ga0501034_0256733_894_1361 153
269 3300049574 Ga0501038_0002732 Ga0501038_0002732_3610_4074 153
270 3300049576 Ga0501040_0522407 Ga0501040_0522407_172_636 153
271 3300049581 Ga0501047_0636166 Ga0501047_0636166_67_531 153
272 3300049588 Ga0501072_0030104 Ga0501072_0030104_639_1106 153
273 3300049669 Ga0501235_048584 Ga0501235_048584_27_491 153
274 3300049686 Ga0501257_110446 Ga0501257_110446_166_630 153
275 3300049762 Ga0501265_045449 Ga0501265_045449_200_664 153
276 3300049822 Ga0501035_0943227 Ga0501035_0943227_51_515 153
277 3300049823 Ga0501044_0787448 Ga0501044_0787448_201_665 153
278 3300050495 nmdc:mga04h51_518968_c1 nmdc:mga04h51_518968_c1_17_493 153
279 3300050512 nmdc:mga0n895_1268238_c1 nmdc:mga0n895_1268238_c1_208_669 153
280 3300053092 Ga0500583_0173198 Ga0500583_0173198_325_804 153
281 iso_pu_bacteria 2846033681 2846034136 153
282 iso_pu_bacteria 2846037992 2846039247 153
283 3300000549 LJQas_1000081 LJQas_10000818 154
284 3300005289 Ga0065704_10398445 Ga0065704_103984451 154
285 3300005330 Ga0070690_100665264 Ga0070690_1006652642 154
286 3300005344 Ga0070661_100152097 Ga0070661_1001520971 154
287 3300005366 Ga0070659_100748656 Ga0070659_1007486562 154
288 3300005457 Ga0070662_100071339 Ga0070662_1000713392 154
289 3300005539 Ga0068853_100054364 Ga0068853_1000543642 154
290 3300005546 Ga0070696_100904132 Ga0070696_1009041321 154
291 3300005563 Ga0068855_100451906 Ga0068855_1004519061 154
292 3300005564 Ga0070664_100015318 Ga0070664_1000153185 154
293 3300005617 Ga0068859_100405357 Ga0068859_1004053572 154
294 3300005841 Ga0068863_100053840 Ga0068863_1000538402 154
295 3300005843 Ga0068860_100518732 Ga0068860_1005187321 154
296 3300006931 Ga0097620_100405382 Ga0097620_1004053822 154
297 3300013297 Ga0157378_10019029 Ga0157378_100190294 154
298 3300013306 Ga0163162_10429363 Ga0163162_104293631 154
299 3300013307 Ga0157372_10012169 Ga0157372_100121698 154
300 3300014325 Ga0163163_10167719 Ga0163163_101677192 154
301 3300025920 Ga0207649_10019417 Ga0207649_100194175 154
302 3300025932 Ga0207690_10473264 Ga0207690_104732642 154
303 3300025933 Ga0207706_10029891 Ga0207706_100298915 154
304 3300025945 Ga0207679_10006976 Ga0207679_100069764 154
305 3300025949 Ga0207667_10531336 Ga0207667_105313362 154
306 3300025961 Ga0207712_10534402 Ga0207712_105344022 154
307 3300025972 Ga0207668_10126258 Ga0207668_101262582 154
308 3300025972 Ga0207668_10295115 Ga0207668_102951152 154
309 3300026035 Ga0207703_10128064 Ga0207703_101280643 154
310 3300026041 Ga0207639_10008200 Ga0207639_100082005 154
311 3300026089 Ga0207648_10605921 Ga0207648_106059212 154
312 3300027907 Ga0207428_10127388 Ga0207428_101273883 154
313 3300028381 Ga0268264_10179469 Ga0268264_101794691 154
314 3300041451 Ga0451791_0767263 Ga0451791_0767263_321_791 154
315 3300050511 nmdc:mga08y16_77577_c1 nmdc:mga08y16_77577_c1_2315_2779 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

23

164

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5co4-assembly1.cif.gz_A structural insights into the 2-oh methylation of c/u34 on trna 0.9647 1 147
6qkv-assembly1.cif.gz_B structure of yibk from p. aeruginosa 0.952 1 149
5co4-assembly1.cif.gz_B structural insights into the 2-oh methylation of c/u34 on trna 0.9474 1 147
6qh8-assembly2.cif.gz_B structure of knotted yibk from p. aeruginosa 0.9397 1 149
6qkv-assembly1.cif.gz_A structure of yibk from p. aeruginosa 0.9343 1 149
ID Description Score Start End Superfamily
5co4A00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9647 1 147 3.40.1280.10
af_C6TCU8_69_240_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9337 2 147 3.40.1280.10
4pzkB00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9239 1 147 3.40.1280.10
af_O50394_1_154_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9234 1 147 3.40.1280.10
3l8uA00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9217 1 147 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A0B6WT02-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9915 1 149 GO:0002130
GO:0003723
GO:0005737
GO:0141098
GO:0141102
AF-A0A2D9TGL7-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9889 2 149 GO:0002130
GO:0003723
GO:0005737
GO:0141098
GO:0141102
AF-A0A838U4N0-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9886 1 147 GO:0002130
GO:0003723
GO:0005737
GO:0008175
GO:0008757
AF-A0A3M2D5C6-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9866 1 149 GO:0002130
GO:0003723
GO:0005737
GO:0141098
GO:0141102
AF-A0A833CAW1-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9837 3 147 GO:0002130
GO:0003723
GO:0005737
GO:0008175
GO:0008757

Feature Viewer

pLDDT pTM Quality
93.64 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map