F401394

General Info

Members Datasets Scaffolds Average Seq Length
311 227 622 84

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_1408674|Ga0496100_1408674_223_510
Length 95
Sequence MAPSSASDKGQLPMTDASQRPPLPDRLSTDPSSPHHVPAVFEHEIGIRFNDKERHDVEEYCVSEGWVRVPAGKTRDRKGKPLLIKLKGKVEAFYR

Samples

Sample ID Description Type Environment
1 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
71 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
101 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
104 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
107 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
126 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
127 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
128 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
129 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
130 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
131 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
132 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
133 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
134 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
135 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
136 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
137 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
138 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
139 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
140 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
141 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
142 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
143 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
144 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
145 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
146 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
149 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
150 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
169 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
172 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
173 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
174 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
177 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
178 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
181 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
182 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
184 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
185 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
189 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
190 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
191 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
192 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
193 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
194 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
195 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
196 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
199 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
200 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
201 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
202 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
205 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
206 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
207 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
208 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
209 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
210 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
211 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
212 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
213 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
214 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
215 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
216 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
217 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
218 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
219 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
220 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
221 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
222 2547132374 Acidovorax radicis N35 Isolate Unclassified
223 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
224 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
225 2643221660 Methylibium sp. Root1272 Isolate Unclassified
226 2643221717 Acidovorax sp. Root267 Isolate Unclassified
227 2831864461 Roseateles noduli HZ7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.07
Metatranscriptomes 0
Isolates 1.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.15
Nodule 0.96
Rhizoplane 6.75
Rhizosphere 71.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496100_1408674 3300048903 Bacteria 550
2 JGI24735J21928_10137902 3300002067 Bacteria 704
3 rootH1_10109801 3300003323 Bacteria 4222
4 Ga0055525_1000021 3300003759 Bacteria 370802
5 Ga0055540_1002058 3300003792 Bacteria 11114
6 Ga0055531_10002249 3300003794 Bacteria 13074
7 Ga0055543_1007757 3300004625 Bacteria 2448
8 Ga0065165_1004499 3300005262 Bacteria 8574
9 Ga0068869_100586009 3300005334 Bacteria 941
10 Ga0068869_101910697 3300005334 Bacteria 532
11 Ga0070666_10025386 3300005335 Bacteria 3863
12 Ga0070682_100721906 3300005337 Bacteria 801
13 Ga0068868_100426953 3300005338 Bacteria 1148
14 Ga0070689_100380026 3300005340 Bacteria 1190
15 Ga0070687_101533711 3300005343 Bacteria 502
16 Ga0070668_100054381 3300005347 Bacteria 3087
17 Ga0070668_100274388 3300005347 Bacteria 1406
18 Ga0070668_100874579 3300005347 Bacteria 802
19 Ga0070669_100248034 3300005353 Bacteria 1417
20 Ga0070669_100460114 3300005353 Bacteria 1050
21 Ga0070675_100052756 3300005354 Bacteria 3343
22 Ga0070675_101239562 3300005354 Bacteria 687
23 Ga0070671_101016508 3300005355 Bacteria 727
24 Ga0070674_100433022 3300005356 Bacteria 1082
25 Ga0070673_100076843 3300005364 Bacteria 2697
26 Ga0070673_100517620 3300005364 Bacteria 1081
27 Ga0070673_100963571 3300005364 Bacteria 793
28 Ga0070659_100007299 3300005366 Bacteria 8024
29 Ga0070667_100050276 3300005367 Bacteria 3513
30 Ga0070667_100402030 3300005367 Bacteria 1247
31 Ga0070663_100243736 3300005455 Bacteria 1420
32 Ga0070663_101582893 3300005455 Bacteria 584
33 Ga0070678_100579377 3300005456 Bacteria 999
34 Ga0070678_101027246 3300005456 Bacteria 759
35 Ga0070681_10011837 3300005458 Bacteria 8647
36 Ga0068867_100148728 3300005459 Bacteria 1838
37 Ga0068867_102422036 3300005459 Bacteria 500
38 Ga0070685_10292139 3300005466 Bacteria 1095
39 Ga0070679_100000733 3300005530 Bacteria 28380
40 Ga0070679_100395104 3300005530 Bacteria 1329
41 Ga0068853_100012723 3300005539 Bacteria 6851
42 Ga0070672_100174700 3300005543 Bacteria 1788
43 Ga0070672_100316411 3300005543 Bacteria 1326
44 Ga0070665_100575017 3300005548 Bacteria 1139
45 Ga0070665_101948803 3300005548 Bacteria 593
46 Ga0070665_102064952 3300005548 Bacteria 575
47 Ga0068857_100050249 3300005577 Bacteria 3700
48 Ga0068857_100670287 3300005577 Bacteria 984
49 Ga0068852_100003877 3300005616 Bacteria 10509
50 Ga0068852_100339537 3300005616 Bacteria 1464
51 Ga0068859_100189195 3300005617 Bacteria 2143
52 Ga0068859_102800691 3300005617 Bacteria 535
53 Ga0068861_100528356 3300005719 Bacteria 1071
54 Ga0068863_100143338 3300005841 Bacteria 2284
55 Ga0068858_100092839 3300005842 Bacteria 2809
56 Ga0068860_100010786 3300005843 Bacteria 9019
57 Ga0068860_102320837 3300005843 Bacteria 557
58 Ga0075363_100015159 3300006048 Bacteria 3783
59 Ga0070715_10793178 3300006163 Bacteria 574
60 Ga0075362_10021533 3300006177 Bacteria 2707
61 Ga0075366_10001734 3300006195 Bacteria 10967
62 Ga0075366_10081264 3300006195 Bacteria 1936
63 Ga0075366_10215224 3300006195 Bacteria 1170
64 Ga0075366_10332000 3300006195 Bacteria 932
65 Ga0097621_100461625 3300006237 Bacteria 1145
66 Ga0075370_10675191 3300006353 Bacteria 628
67 Ga0068871_100133281 3300006358 Bacteria 2108
68 Ga0068871_100767824 3300006358 Bacteria 887
69 Ga0097620_100189182 3300006931 Bacteria 2143
70 Ga0097620_102800807 3300006931 Bacteria 535
71 Ga0099826_10000001 3300006948 Bacteria 1155201
72 Ga0105251_10660028 3300009011 Bacteria 501
73 Ga0111539_13250693 3300009094 Bacteria 524
74 Ga0105243_12097250 3300009148 Bacteria 601
75 Ga0105242_11240012 3300009176 Bacteria 767
76 Ga0105248_10213691 3300009177 Bacteria 2173
77 Ga0105237_10354918 3300009545 Bacteria 1471
78 Ga0105238_10532005 3300009551 Bacteria 1179
79 Ga0105238_12181380 3300009551 Bacteria 589
80 Ga0105249_11050136 3300009553 Bacteria 884
81 Ga0157336_1012207 3300012477 Bacteria 679
82 Ga0157373_10030640 3300013100 Bacteria 3870
83 Ga0157370_10023814 3300013104 Bacteria 6074
84 Ga0157369_11594086 3300013105 Bacteria 664
85 Ga0157378_10267684 3300013297 Bacteria 1642
86 Ga0163162_12762799 3300013306 Bacteria 565
87 Ga0157372_10093736 3300013307 Bacteria 3418
88 Ga0157375_10120446 3300013308 Bacteria 2733
89 Ga0157375_10233888 3300013308 Bacteria 1997
90 Ga0163163_10458936 3300014325 Bacteria 1334
91 Ga0163163_10571650 3300014325 Bacteria 1193
92 Ga0157380_10096464 3300014326 Bacteria 2451
93 Ga0182008_10354842 3300014497 Bacteria 778
94 Ga0157379_10015397 3300014968 Bacteria 6709
95 Ga0157379_12285123 3300014968 Bacteria 538
96 Ga0157376_10219147 3300014969 Bacteria 1761
97 Ga0157376_12429159 3300014969 Bacteria 564
98 Ga0163161_10130344 3300017792 Bacteria 1896
99 Ga0213872_10000046 3300021361 Bacteria 109934
100 Ga0213872_10000048 3300021361 Bacteria 109712
101 Ga0209674_112030 3300025226 Bacteria 860
102 Ga0209563_100005 3300025230 Bacteria 1774893
103 Ga0209673_1011616 3300025273 Bacteria 3616
104 Ga0209673_1027698 3300025273 Bacteria 1839
105 Ga0209564_1018180 3300025295 Bacteria 2695
106 Ga0209051_1000972 3300025303 Bacteria 27946
107 Ga0209257_1000144 3300025304 Bacteria 197078
108 Ga0207680_10015821 3300025903 Bacteria 3947
109 Ga0207705_10860339 3300025909 Bacteria 703
110 Ga0207707_10002686 3300025912 Bacteria 15895
111 Ga0207671_10366460 3300025914 Bacteria 1144
112 Ga0207660_11090809 3300025917 Bacteria 651
113 Ga0207652_10008111 3300025921 Bacteria 8432
114 Ga0207652_10370147 3300025921 Bacteria 1293
115 Ga0207681_10067336 3300025923 Bacteria 2483
116 Ga0207681_10580897 3300025923 Bacteria 924
117 Ga0207650_10030618 3300025925 Bacteria 3878
118 Ga0207650_11105289 3300025925 Bacteria 675
119 Ga0207659_10142604 3300025926 Bacteria 1861
120 Ga0207659_10277590 3300025926 Bacteria 1369
121 Ga0207644_10244882 3300025931 Bacteria 1429
122 Ga0207709_11758642 3300025935 Bacteria 515
123 Ga0207669_10531349 3300025937 Bacteria 946
124 Ga0207691_10066259 3300025940 Bacteria 3268
125 Ga0207691_10859384 3300025940 Bacteria 760
126 Ga0207651_10597693 3300025960 Bacteria 964
127 Ga0207651_11272041 3300025960 Bacteria 661
128 Ga0207668_10572813 3300025972 Bacteria 981
129 Ga0207658_10045338 3300025986 Bacteria 3205
130 Ga0207658_11757891 3300025986 Bacteria 566
131 Ga0207639_10007562 3300026041 Bacteria 7409
132 Ga0207639_10069001 3300026041 Bacteria 2757
133 Ga0207641_10833050 3300026088 Bacteria 914
134 Ga0207648_10095357 3300026089 Bacteria 2602
135 Ga0207648_11892736 3300026089 Bacteria 558
136 Ga0207676_10942982 3300026095 Bacteria 848
137 Ga0207674_10034414 3300026116 Bacteria 5295
138 Ga0207683_10293368 3300026121 Bacteria 1487
139 Ga0207683_10589651 3300026121 Bacteria 1028
140 Ga0207683_10645615 3300026121 Bacteria 980
141 Ga0207698_10002474 3300026142 Bacteria 10953
142 Ga0207698_10990961 3300026142 Bacteria 851
143 Ga0209282_1000001 3300027666 Bacteria 2450367
144 Ga0209974_10187106 3300027876 Bacteria 760
145 Ga0268266_10887600 3300028379 Bacteria 862
146 Ga0268266_11324325 3300028379 Bacteria 696
147 Ga0307515_10001487 3300028794 Bacteria 52645
148 Ga0316182_1142007 3300030745 Bacteria 1733
149 Ga0316182_1293141 3300030745 Bacteria 2520
150 Ga0265316_10000361 3300031344 Bacteria 51370
151 Ga0307513_10181543 3300031456 Bacteria 1967
152 Ga0307513_10529032 3300031456 Bacteria 893
153 Ga0307509_10042695 3300031507 Bacteria 4912
154 Ga0307509_10267580 3300031507 Bacteria 1479
155 Ga0307408_100004838 3300031548 Bacteria 9071
156 Ga0307516_10000340 3300031730 Bacteria 61066
157 Ga0307516_10056207 3300031730 Bacteria 3838
158 Ga0307516_10492117 3300031730 Bacteria 881
159 Ga0307413_10036888 3300031824 Bacteria 2819
160 Ga0307413_10811386 3300031824 Bacteria 787
161 Ga0307518_10117889 3300031838 Bacteria 1883
162 Ga0307410_10135830 3300031852 Bacteria 1813
163 Ga0307410_12125886 3300031852 Bacteria 502
164 Ga0307406_10067058 3300031901 Bacteria 2338
165 Ga0307406_10670291 3300031901 Bacteria 863
166 Ga0307412_10468050 3300031911 Bacteria 1042
167 Ga0307412_11045651 3300031911 Bacteria 724
168 Ga0307409_100003229 3300031995 Bacteria 8784
169 Ga0307416_100009133 3300032002 Bacteria 6464
170 Ga0307416_100399060 3300032002 Bacteria 1412
171 Ga0307416_102815648 3300032002 Bacteria 582
172 Ga0307415_100651312 3300032126 Bacteria 944
173 Ga0373951_0251982 3300035091 Bacteria 531
174 Ga0373931_0723330 3300035691 Bacteria 659
175 Ga0373947_0273871 3300035725 Bacteria 1121
176 Ga0395900_0000131 3300037418 Bacteria 125554
177 Ga0395898_0001654 3300037466 Bacteria 30082
178 Ga0395905_0018157 3300037471 Bacteria 6675
179 Ga0436365_0156802 3300039437 Bacteria 903
180 Ga0436365_0386767 3300039437 Bacteria 723
181 Ga0436361_0633280 3300039447 Bacteria 103480
182 Ga0436361_0943694 3300039447 Bacteria 119574
183 Ga0451787_701701 3300041441 Bacteria 641
184 Ga0451789_0024643 3300041443 Bacteria 1949
185 Ga0451791_1365775 3300041451 Bacteria 993
186 Ga0451793_0319047 3300041452 Bacteria 8683
187 Ga0451793_1302782 3300041452 Bacteria 4210
188 Ga0451795_0609941 3300041456 Bacteria 1414
189 Ga0451795_0767698 3300041456 Bacteria 581
190 Ga0451798_0922510 3300041458 Bacteria 1081
191 Ga0451800_0410622 3300041459 Bacteria 1442
192 Ga0451800_0659857 3300041459 Bacteria 864
193 Ga0451802_0237224 3300041460 Bacteria 3596
194 Ga0451802_0689168 3300041460 Bacteria 545
195 Ga0451802_1755043 3300041460 Bacteria 546
196 Ga0451804_0045125 3300041463 Bacteria 1013
197 Ga0451807_0249378 3300041486 Bacteria 605
198 Ga0451807_1134556 3300041486 Bacteria 5624
199 Ga0451807_2031724 3300041486 Bacteria 665
200 Ga0451833_1097500 3300041491 Bacteria 2199
201 Ga0451835_0276674 3300041492 Bacteria 780
202 Ga0451835_0600594 3300041492 Bacteria 919
203 Ga0451839_1467597 3300041496 Bacteria 1739
204 Ga0451845_0664313 3300041501 Bacteria 1003
205 Ga0451843_0788291 3300041509 Bacteria 853
206 Ga0451853_2558391 3300041512 Bacteria 3309
207 Ga0439441_043580 3300042001 Bacteria 906
208 Ga0450911_021130 3300042115 Bacteria 849
209 Ga0450922_006261 3300042124 Bacteria 1108
210 Ga0450900_046938 3300042136 Bacteria 656
211 Ga0439446_0221128 3300042156 Bacteria 645
212 Ga0451577_0010851 3300042876 Bacteria 8656
213 Ga0451577_0572824 3300042876 Bacteria 1025
214 Ga0466969_0012403 3300044656 Bacteria 4495
215 Ga0466969_0016745 3300044656 Bacteria 3833
216 Ga0466972_0366808 3300044658 Bacteria 674
217 Ga0466965_0047995 3300044683 Bacteria 2114
218 Ga0466965_0070831 3300044683 Bacteria 1753
219 Ga0466965_0081212 3300044683 Bacteria 1639
220 Ga0466966_0019244 3300044684 Bacteria 4493
221 Ga0466966_0075271 3300044684 Bacteria 2109
222 Ga0466961_0006093 3300044693 Bacteria 7650
223 Ga0466961_0024556 3300044693 Bacteria 3877
224 Ga0466963_0007647 3300044694 Bacteria 6452
225 Ga0466964_0006044 3300044706 Bacteria 4511
226 Ga0466964_0026763 3300044706 Bacteria 2260
227 Ga0453684_0051231 3300044712 Bacteria 5416
228 Ga0466971_0027830 3300044719 Bacteria 2531
229 Ga0466971_0253173 3300044719 Bacteria 839
230 Ga0466970_0023050 3300044765 Bacteria 3249
231 Ga0466970_0087430 3300044765 Bacteria 1690
232 Ga0466957_0090781 3300044842 Bacteria 1913
233 Ga0466960_0062248 3300044901 Bacteria 1833
234 Ga0466959_0002404 3300045049 Bacteria 11946
235 Ga0466959_0180191 3300045049 Bacteria 1478
236 Ga0451576_0364193 3300045051 Bacteria 1514
237 Ga0451576_1054816 3300045051 Bacteria 851
238 Ga0466958_0055335 3300045836 Bacteria 2407
239 Ga0466967_0019281 3300045976 Bacteria 5481
240 Ga0466967_2510604 3300045976 Bacteria 510
241 Ga0495653_0513349 3300046463 Bacteria 746
242 Ga0495580_0111530 3300046472 Bacteria 1899
243 Ga0495582_0115490 3300046473 Bacteria 1509
244 Ga0495594_0007094 3300046499 Bacteria 5763
245 Ga0495594_0546422 3300046499 Bacteria 657
246 Ga0495607_0208159 3300046501 Bacteria 964
247 Ga0495620_0134975 3300046515 Bacteria 967
248 Ga0495630_1367762 3300046517 Bacteria 533
249 Ga0495632_0027863 3300046519 Bacteria 2953
250 Ga0495648_0055984 3300046524 Bacteria 2375
251 Ga0495663_0008814 3300046525 Bacteria 2798
252 Ga0495666_0181539 3300046526 Bacteria 971
253 Ga0495621_0024727 3300046539 Bacteria 2009
254 Ga0495633_0456662 3300046558 Bacteria 577
255 Ga0495656_0000558 3300046615 Bacteria 12166
256 Ga0495656_0001957 3300046615 Bacteria 6792
257 Ga0495611_0569643 3300046648 Bacteria 512
258 Ga0495625_0023846 3300046660 Bacteria 4668
259 Ga0495624_0046091 3300046690 Bacteria 2773
260 Ga0495670_0166882 3300046691 Bacteria 1158
261 Ga0495685_140109 3300047447 Bacteria 788
262 Ga0495686_0494636 3300047472 Bacteria 645
263 Ga0495593_0459455 3300047673 Bacteria 637
264 Ga0495615_0008110 3300048090 Bacteria 2018
265 Ga0495615_0008997 3300048090 Bacteria 1949
266 Ga0496108_0078621 3300048911 Bacteria 2792
267 Ga0496115_0350332 3300048918 Bacteria 1204
268 Ga0496115_0413157 3300048918 Bacteria 1094
269 Ga0501292_008912 3300049515 Bacteria 1479
270 Ga0501301_001238 3300049524 Bacteria 1608
271 Ga0501223_016624 3300049663 Bacteria 1454
272 Ga0501238_001363 3300049671 Bacteria 2823
273 Ga0501253_012290 3300049683 Bacteria 1338
274 Ga0501257_077159 3300049686 Bacteria 856
275 Ga0501241_093589 3300049758 Bacteria 639
276 Ga0501262_073161 3300049759 Bacteria 564
277 Ga0501269_007309 3300049766 Bacteria 1333
278 Ga0501035_0454148 3300049822 Bacteria 1060
279 nmdc:mga03683_59020_c1 3300050489 Bacteria 1618
280 nmdc:mga03n38_11480_c1 3300050490 Bacteria 3302
281 nmdc:mga0k408_202616_c1 3300050493 Bacteria 1184
282 nmdc:mga0k408_222465_c1 3300050493 Bacteria 1127
283 nmdc:mga0k408_22680_c1 3300050493 Bacteria 3536
284 nmdc:mga0k408_37056_c1 3300050493 Bacteria 2799
285 nmdc:mga06z11_305032_c1 3300050494 Bacteria 947
286 nmdc:mga07m45_206079_c1 3300050496 Bacteria 1144
287 nmdc:mga09592_546078_c1 3300050508 Bacteria 995
288 Ga0500644_0032969 3300053088 Bacteria 1659
289 Ga0500646_0013674 3300053090 Bacteria 2102
290 Ga0500651_0028827 3300053093 Bacteria 3489
291 Ga0500623_124910 3300053127 Bacteria 1118
292 Ga0500628_002177 3300053129 Bacteria 3268
293 Ga0500642_0007050 3300053130 Bacteria 3749
294 Ga0500652_000204 3300053131 Bacteria 22796
295 Ga0500655_008324 3300053133 Bacteria 1866
296 Ga0500658_0531570 3300053134 Bacteria 530
297 Ga0500568_0060019 3300053139 Bacteria 1473
298 Ga0500577_0035051 3300053142 Bacteria 1787
299 Ga0500579_265794 3300053143 Bacteria 540
300 Ga0500589_132482 3300053147 Bacteria 1039
301 Ga0500619_000157 3300053154 Bacteria 16467
302 Ga0500622_0000227 3300053156 Bacteria 58653
303 Ga0500634_0112938 3300053161 Bacteria 1337
304 Ga0500570_096184 3300053724 Bacteria 1266
305 Ga0466962_0029314 3300061719 Bacteria 2634
306 2548500669 2547132374 Bacteria 5530232
307 2587728457 2585428057 Bacteria 6737412
308 2587736363 2585428058 Bacteria 6853932
309 2644339540 2643221660 Bacteria 4208257
310 2644646779 2643221717 Bacteria 5676132
311 2831866788 2831864461 Bacteria 6502356
312 Ga0496100_1408674
313 JGI24735J21928_10137902
314 rootH1_10109801
315 Ga0055525_1000021
316 Ga0055540_1002058
317 Ga0055531_10002249
318 Ga0055543_1007757
319 Ga0065165_1004499
320 Ga0068869_100586009
321 Ga0068869_101910697
322 Ga0070666_10025386
323 Ga0070682_100721906
324 Ga0068868_100426953
325 Ga0070689_100380026
326 Ga0070687_101533711
327 Ga0070668_100054381
328 Ga0070668_100274388
329 Ga0070668_100874579
330 Ga0070669_100248034
331 Ga0070669_100460114
332 Ga0070675_100052756
333 Ga0070675_101239562
334 Ga0070671_101016508
335 Ga0070674_100433022
336 Ga0070673_100076843
337 Ga0070673_100517620
338 Ga0070673_100963571
339 Ga0070659_100007299
340 Ga0070667_100050276
341 Ga0070667_100402030
342 Ga0070663_100243736
343 Ga0070663_101582893
344 Ga0070678_100579377
345 Ga0070678_101027246
346 Ga0070681_10011837
347 Ga0068867_100148728
348 Ga0068867_102422036
349 Ga0070685_10292139
350 Ga0070679_100000733
351 Ga0070679_100395104
352 Ga0068853_100012723
353 Ga0070672_100174700
354 Ga0070672_100316411
355 Ga0070665_100575017
356 Ga0070665_101948803
357 Ga0070665_102064952
358 Ga0068857_100050249
359 Ga0068857_100670287
360 Ga0068852_100003877
361 Ga0068852_100339537
362 Ga0068859_100189195
363 Ga0068859_102800691
364 Ga0068861_100528356
365 Ga0068863_100143338
366 Ga0068858_100092839
367 Ga0068860_100010786
368 Ga0068860_102320837
369 Ga0075363_100015159
370 Ga0070715_10793178
371 Ga0075362_10021533
372 Ga0075366_10001734
373 Ga0075366_10081264
374 Ga0075366_10215224
375 Ga0075366_10332000
376 Ga0097621_100461625
377 Ga0075370_10675191
378 Ga0068871_100133281
379 Ga0068871_100767824
380 Ga0097620_100189182
381 Ga0097620_102800807
382 Ga0099826_10000001
383 Ga0105251_10660028
384 Ga0111539_13250693
385 Ga0105243_12097250
386 Ga0105242_11240012
387 Ga0105248_10213691
388 Ga0105237_10354918
389 Ga0105238_10532005
390 Ga0105238_12181380
391 Ga0105249_11050136
392 Ga0157336_1012207
393 Ga0157373_10030640
394 Ga0157370_10023814
395 Ga0157369_11594086
396 Ga0157378_10267684
397 Ga0163162_12762799
398 Ga0157372_10093736
399 Ga0157375_10120446
400 Ga0157375_10233888
401 Ga0163163_10458936
402 Ga0163163_10571650
403 Ga0157380_10096464
404 Ga0182008_10354842
405 Ga0157379_10015397
406 Ga0157379_12285123
407 Ga0157376_10219147
408 Ga0157376_12429159
409 Ga0163161_10130344
410 Ga0213872_10000046
411 Ga0213872_10000048
412 Ga0209674_112030
413 Ga0209563_100005
414 Ga0209673_1011616
415 Ga0209673_1027698
416 Ga0209564_1018180
417 Ga0209051_1000972
418 Ga0209257_1000144
419 Ga0207680_10015821
420 Ga0207705_10860339
421 Ga0207707_10002686
422 Ga0207671_10366460
423 Ga0207660_11090809
424 Ga0207652_10008111
425 Ga0207652_10370147
426 Ga0207681_10067336
427 Ga0207681_10580897
428 Ga0207650_10030618
429 Ga0207650_11105289
430 Ga0207659_10142604
431 Ga0207659_10277590
432 Ga0207644_10244882
433 Ga0207709_11758642
434 Ga0207669_10531349
435 Ga0207691_10066259
436 Ga0207691_10859384
437 Ga0207651_10597693
438 Ga0207651_11272041
439 Ga0207668_10572813
440 Ga0207658_10045338
441 Ga0207658_11757891
442 Ga0207639_10007562
443 Ga0207639_10069001
444 Ga0207641_10833050
445 Ga0207648_10095357
446 Ga0207648_11892736
447 Ga0207676_10942982
448 Ga0207674_10034414
449 Ga0207683_10293368
450 Ga0207683_10589651
451 Ga0207683_10645615
452 Ga0207698_10002474
453 Ga0207698_10990961
454 Ga0209282_1000001
455 Ga0209974_10187106
456 Ga0268266_10887600
457 Ga0268266_11324325
458 Ga0307515_10001487
459 Ga0316182_1142007
460 Ga0316182_1293141
461 Ga0265316_10000361
462 Ga0307513_10181543
463 Ga0307513_10529032
464 Ga0307509_10042695
465 Ga0307509_10267580
466 Ga0307408_100004838
467 Ga0307516_10000340
468 Ga0307516_10056207
469 Ga0307516_10492117
470 Ga0307413_10036888
471 Ga0307413_10811386
472 Ga0307518_10117889
473 Ga0307410_10135830
474 Ga0307410_12125886
475 Ga0307406_10067058
476 Ga0307406_10670291
477 Ga0307412_10468050
478 Ga0307412_11045651
479 Ga0307409_100003229
480 Ga0307416_100009133
481 Ga0307416_100399060
482 Ga0307416_102815648
483 Ga0307415_100651312
484 Ga0373951_0251982
485 Ga0373931_0723330
486 Ga0373947_0273871
487 Ga0395900_0000131
488 Ga0395898_0001654
489 Ga0395905_0018157
490 Ga0436365_0156802
491 Ga0436365_0386767
492 Ga0436361_0633280
493 Ga0436361_0943694
494 Ga0451787_701701
495 Ga0451789_0024643
496 Ga0451791_1365775
497 Ga0451793_0319047
498 Ga0451793_1302782
499 Ga0451795_0609941
500 Ga0451795_0767698
501 Ga0451798_0922510
502 Ga0451800_0410622
503 Ga0451800_0659857
504 Ga0451802_0237224
505 Ga0451802_0689168
506 Ga0451802_1755043
507 Ga0451804_0045125
508 Ga0451807_0249378
509 Ga0451807_1134556
510 Ga0451807_2031724
511 Ga0451833_1097500
512 Ga0451835_0276674
513 Ga0451835_0600594
514 Ga0451839_1467597
515 Ga0451845_0664313
516 Ga0451843_0788291
517 Ga0451853_2558391
518 Ga0439441_043580
519 Ga0450911_021130
520 Ga0450922_006261
521 Ga0450900_046938
522 Ga0439446_0221128
523 Ga0451577_0010851
524 Ga0451577_0572824
525 Ga0466969_0012403
526 Ga0466969_0016745
527 Ga0466972_0366808
528 Ga0466965_0047995
529 Ga0466965_0070831
530 Ga0466965_0081212
531 Ga0466966_0019244
532 Ga0466966_0075271
533 Ga0466961_0006093
534 Ga0466961_0024556
535 Ga0466963_0007647
536 Ga0466964_0006044
537 Ga0466964_0026763
538 Ga0453684_0051231
539 Ga0466971_0027830
540 Ga0466971_0253173
541 Ga0466970_0023050
542 Ga0466970_0087430
543 Ga0466957_0090781
544 Ga0466960_0062248
545 Ga0466959_0002404
546 Ga0466959_0180191
547 Ga0451576_0364193
548 Ga0451576_1054816
549 Ga0466958_0055335
550 Ga0466967_0019281
551 Ga0466967_2510604
552 Ga0495653_0513349
553 Ga0495580_0111530
554 Ga0495582_0115490
555 Ga0495594_0007094
556 Ga0495594_0546422
557 Ga0495607_0208159
558 Ga0495620_0134975
559 Ga0495630_1367762
560 Ga0495632_0027863
561 Ga0495648_0055984
562 Ga0495663_0008814
563 Ga0495666_0181539
564 Ga0495621_0024727
565 Ga0495633_0456662
566 Ga0495656_0000558
567 Ga0495656_0001957
568 Ga0495611_0569643
569 Ga0495625_0023846
570 Ga0495624_0046091
571 Ga0495670_0166882
572 Ga0495685_140109
573 Ga0495686_0494636
574 Ga0495593_0459455
575 Ga0495615_0008110
576 Ga0495615_0008997
577 Ga0496108_0078621
578 Ga0496115_0350332
579 Ga0496115_0413157
580 Ga0501292_008912
581 Ga0501301_001238
582 Ga0501223_016624
583 Ga0501238_001363
584 Ga0501253_012290
585 Ga0501257_077159
586 Ga0501241_093589
587 Ga0501262_073161
588 Ga0501269_007309
589 Ga0501035_0454148
590 nmdc:mga03683_59020_c1
591 nmdc:mga03n38_11480_c1
592 nmdc:mga0k408_202616_c1
593 nmdc:mga0k408_222465_c1
594 nmdc:mga0k408_22680_c1
595 nmdc:mga0k408_37056_c1
596 nmdc:mga06z11_305032_c1
597 nmdc:mga07m45_206079_c1
598 nmdc:mga09592_546078_c1
599 Ga0500644_0032969
600 Ga0500646_0013674
601 Ga0500651_0028827
602 Ga0500623_124910
603 Ga0500628_002177
604 Ga0500642_0007050
605 Ga0500652_000204
606 Ga0500655_008324
607 Ga0500658_0531570
608 Ga0500568_0060019
609 Ga0500577_0035051
610 Ga0500579_265794
611 Ga0500589_132482
612 Ga0500619_000157
613 Ga0500622_0000227
614 Ga0500634_0112938
615 Ga0500570_096184
616 Ga0466962_0029314
617 2548500669
618 2587728457
619 2587736363
620 2644339540
621 2644646779
622 2831866788

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11730

DUF3297

Protein of unknown function (DUF3297)

24

94

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
4oby-assembly1.cif.gz_A crystal structure of e.coli arginyl-trna synthetase and ligand binding studies revealed key residues in arginine recognition 0.6579 54 75
2icg-assembly1.cif.gz_A crystal structure of a protein of unknown function (np_472245.1) from listeria innocua at 1.65 a resolution 0.5573 52 74
1vpk-assembly1.cif.gz_A-2 crystal structure of dna polymerase iii, beta subunit (tm0262) from thermotoga maritima at 2.00 a resolution 0.4762 32 81
5yym-assembly2.cif.gz_B crystal structures of e.coli arginyl-trna synthetase (argrs) in complex with substrate arg 0.4671 51 76
3ioz-assembly1.cif.gz_A sivmac239 nef in complex with a tcr zeta polypeptide dp1 (l51-d93) 0.4648 46 76
ID Description Score Start End Superfamily
af_A0A1D6MC42_90_295_2.40.70.10 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.6905 53 77 2.40.70.10
af_A0A1D6LPC7_51_198_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.634 49 75 3.50.50.60
af_Q7K3H0_848_1012_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.6257 53 81 2.60.40.150
af_Q9BL48_11_358_3.90.1410.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 1;set domain protein methyltransferase, domain 1 0.6231 49 81 3.90.1410.10
af_Q8H5X6_117_561_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.598 49 75 3.50.50.100
ID Description Score Start End GO Terms
AF-A0A7W5DF10-F1-model_v4 Glutathione peroxidase 0.9978 8 82
AF-A0A142LHX4-F1-model_v4 Glutathione peroxidase 0.9914 8 82 GO:0004601
AF-A0A1D7NK70-F1-model_v4 HNH endonuclease 0.9908 11 82 GO:0003676
GO:0004519
GO:0008270
AF-A0A1E4IMH7-F1-model_v4 Glutathione peroxidase 0.99 7 82 GO:0004601
AF-A0A437QBN3-F1-model_v4 DUF3297 family protein 0.9843 6 82

Map