F392040

General Info

Members Datasets Scaffolds Average Seq Length
294 234 271 291

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10759296|Ga0111539_107592961
Length 326
Sequence MDNAPRVLICKAPAEPLIFQGVEYPVLKRIVLFVATNLAILFVLNLVLVALERAGVFGESGISRQYGPLMVMSVLFGFGGSFVSLLMSKWIAKWTTRARVIDTPKNATEAWLVDTVRRHAQAAGIGMPEVAIYDAPDMNAFATGASKNSSLVAVSSGLLRDMDRTEVDAVLGHEVSHIANGDMVTLTLIQGVLNTFVIFFSRVIGGLIDSALRSRDGERGGPGIGYFAMVIVTELVLGLFATLIVMWFSRRREFRADRGGATLSGKASMVSALRRLGHEQGSTLPESLAAFGVSGRGAVMGLFRSHPPIEERIRALEALEAVPNAR

Samples

Sample ID Description Type Environment
1 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2643221570 Acidovorax sp. Root568 Isolate Unclassified
4 2643221596 Acidovorax sp. Root70 Isolate Unclassified
5 2643221609 Acidovorax sp. Root217 Isolate Unclassified
6 2643221611 Acidovorax sp. Root219 Isolate Unclassified
7 2643221652 Acidovorax sp. Root402 Isolate Unclassified
8 2643221717 Acidovorax sp. Root267 Isolate Unclassified
9 2721755523 Delftia sp. HK171 Isolate Unclassified
10 2738543012 Acidovorax sp. CF301 Isolate Unclassified
11 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
12 2816332133 Acidovorax radicis 2721A Isolate Unclassified
13 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
14 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
15 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
16 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
17 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
18 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
19 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
20 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
21 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
22 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
23 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
24 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
95 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
125 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
135 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
136 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
147 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
149 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
150 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
151 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
152 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
153 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
156 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
164 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
165 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
168 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
169 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
170 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
171 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
172 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
173 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
174 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
175 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
176 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
177 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
178 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
179 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
180 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
181 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
182 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
185 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
190 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
197 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
198 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
202 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
208 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
211 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
231 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
232 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
233 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
234 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.84
Metatranscriptomes 0.34
Isolates 7.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.04
Nodule 0.68
Rhizoplane 2.38
Rhizosphere 81.29
Stem 0
Stem Tuber 0.34
Unclassified 13.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000066 3300002773 Bacteria 68839
2 Ga0058692_1000102 3300003856 Bacteria 56721
3 Ga0058692_1002588 3300003856 Bacteria 5982
4 Ga0065704_10104144 3300005289 Bacteria 2151
5 Ga0065704_10119941 3300005289 Bacteria 1791
6 Ga0065704_10169113 3300005289 Bacteria 1303
7 Ga0070683_100357344 3300005329 Bacteria 1391
8 Ga0070690_100034643 3300005330 Bacteria 3164
9 Ga0070670_100000064 3300005331 Bacteria 110044
10 Ga0068869_100318503 3300005334 Bacteria 1261
11 Ga0070666_10020339 3300005335 Bacteria 4290
12 Ga0070682_100000291 3300005337 Bacteria 35747
13 Ga0068868_100103854 3300005338 Bacteria 2303
14 Ga0068868_100128436 3300005338 Bacteria 2072
15 Ga0070689_100259132 3300005340 Bacteria 1437
16 Ga0070669_100008388 3300005353 Bacteria 7373
17 Ga0070671_100000025 3300005355 Bacteria 121912
18 Ga0070688_100143619 3300005365 Bacteria 1624
19 Ga0070667_100000095 3300005367 Bacteria 109595
20 Ga0070709_10002971 3300005434 Bacteria 9129
21 Ga0070709_10006534 3300005434 Bacteria 6359
22 Ga0070714_100013915 3300005435 Bacteria 6454
23 Ga0070714_100075766 3300005435 Bacteria 2919
24 Ga0070713_100001943 3300005436 Bacteria 13345
25 Ga0070710_10015695 3300005437 Bacteria 3839
26 Ga0070710_10141464 3300005437 Bacteria 1476
27 Ga0070705_100019336 3300005440 Bacteria 3584
28 Ga0070681_10005058 3300005458 Bacteria 12717
29 Ga0070685_10000005 3300005466 Bacteria 190119
30 Ga0070699_100133305 3300005518 Bacteria 2191
31 Ga0070679_100059172 3300005530 Bacteria 3819
32 Ga0070684_100104013 3300005535 Bacteria 2540
33 Ga0070686_100006079 3300005544 Bacteria 6700
34 Ga0070695_100017171 3300005545 Bacteria 4388
35 Ga0070695_100078513 3300005545 Bacteria 2177
36 Ga0070696_100068993 3300005546 Bacteria 2483
37 Ga0070696_100140563 3300005546 Bacteria 1764
38 Ga0070665_100003525 3300005548 Bacteria 16634
39 Ga0070665_100037379 3300005548 Bacteria 4883
40 Ga0070665_100095021 3300005548 Bacteria 2985
41 Ga0068855_100018545 3300005563 Bacteria 8367
42 Ga0068855_100094237 3300005563 Bacteria 3452
43 Ga0068857_100101783 3300005577 Bacteria 2578
44 Ga0068856_100456970 3300005614 Bacteria 1298
45 Ga0068852_100007157 3300005616 Bacteria 8132
46 Ga0068859_100010303 3300005617 Bacteria 9407
47 Ga0068859_100020903 3300005617 Bacteria 6570
48 Ga0068864_100000073 3300005618 Bacteria 109681
49 Ga0068864_100284726 3300005618 Bacteria 1544
50 Ga0068870_10287749 3300005840 Bacteria 1033
51 Ga0068863_100220485 3300005841 Bacteria 1827
52 Ga0068858_100031406 3300005842 Bacteria 4933
53 Ga0068858_100142312 3300005842 Bacteria 2252
54 Ga0068860_100036924 3300005843 Bacteria 4677
55 Ga0068862_100178199 3300005844 Bacteria 1906
56 Ga0081539_10000332 3300005985 Bacteria 104677
57 Ga0070717_10059618 3300006028 Bacteria 3158
58 Ga0070716_100317948 3300006173 Bacteria 1090
59 Ga0070712_100012664 3300006175 Bacteria 5369
60 Ga0075362_10039538 3300006177 Bacteria 2074
61 Ga0075366_10014806 3300006195 Bacteria 4462
62 Ga0097621_100018860 3300006237 Bacteria 5282
63 Ga0068871_100011163 3300006358 Bacteria 6584
64 Ga0075433_10005913 3300006852 Bacteria 9636
65 Ga0075434_100000566 3300006871 Bacteria 28488
66 Ga0075436_100003489 3300006914 Bacteria 10787
67 Ga0075436_100062319 3300006914 Bacteria 2577
68 Ga0097620_100010303 3300006931 Bacteria 9407
69 Ga0097620_100020903 3300006931 Bacteria 6570
70 Ga0079104_1000658 3300006946 Bacteria 32916
71 Ga0075435_100000249 3300007076 Bacteria 33358
72 Ga0075435_100012977 3300007076 Bacteria 6182
73 Ga0099795_10014237 3300007788 Bacteria 2461
74 Ga0105244_10000268 3300009036 Bacteria 52462
75 Ga0105244_10008716 3300009036 Bacteria 6311
76 Ga0105250_10000077 3300009092 Bacteria 88673
77 Ga0105250_10000966 3300009092 Bacteria 16819
78 Ga0111539_10163310 3300009094 Bacteria 2605
79 Ga0111539_10372437 3300009094 Bacteria 1662
80 Ga0111539_10759296 3300009094 Bacteria 1129
81 Ga0105247_10087121 3300009101 Bacteria 1977
82 Ga0105243_10133435 3300009148 Bacteria 2110
83 Ga0105242_10001456 3300009176 Bacteria 18628
84 Ga0105248_10301097 3300009177 Bacteria 1805
85 Ga0105237_10122970 3300009545 Bacteria 2589
86 Ga0099796_10025661 3300010159 Bacteria 1863
87 Ga0105246_10427183 3300011119 Bacteria 1107
88 Ga0157369_10511873 3300013105 Bacteria 1242
89 Ga0157378_10122116 3300013297 Bacteria 2402
90 Ga0163163_10001096 3300014325 Bacteria 22998
91 Ga0157376_10005707 3300014969 Bacteria 8718
92 Ga0182007_10036103 3300015262 Bacteria 1664
93 Ga0163161_10080413 3300017792 Bacteria 2398
94 Ga0213871_10001763 3300021441 Bacteria 3762
95 Ga0207696_1003660 3300025711 Bacteria 6903
96 Ga0207692_10018760 3300025898 Bacteria 3112
97 Ga0207710_10126382 3300025900 Bacteria 1225
98 Ga0207680_10015400 3300025903 Bacteria 3990
99 Ga0207707_10000775 3300025912 Bacteria 31468
100 Ga0207693_10015362 3300025915 Bacteria 6144
101 Ga0207663_10166861 3300025916 Bacteria 1560
102 Ga0207660_10065912 3300025917 Bacteria 2618
103 Ga0207652_10128047 3300025921 Bacteria 2263
104 Ga0207681_10013886 3300025923 Bacteria 4991
105 Ga0207681_10131212 3300025923 Bacteria 1853
106 Ga0207650_10000106 3300025925 Bacteria 110058
107 Ga0207700_10058984 3300025928 Bacteria 2901
108 Ga0207664_10153841 3300025929 Bacteria 1956
109 Ga0207644_10000049 3300025931 Bacteria 95260
110 Ga0207686_10035045 3300025934 Bacteria 3009
111 Ga0207709_10007648 3300025935 Bacteria 5996
112 Ga0207669_10395270 3300025937 Bacteria 1081
113 Ga0207711_10000393 3300025941 Bacteria 46458
114 Ga0207689_10124536 3300025942 Bacteria 2120
115 Ga0207661_10293463 3300025944 Bacteria 1456
116 Ga0207667_10061455 3300025949 Bacteria 3929
117 Ga0207667_10141207 3300025949 Bacteria 2479
118 Ga0207658_10000073 3300025986 Bacteria 111738
119 Ga0207677_10018355 3300026023 Bacteria 4196
120 Ga0207703_10048270 3300026035 Bacteria 3436
121 Ga0207708_10372605 3300026075 Bacteria 1176
122 Ga0207641_10148621 3300026088 Bacteria 2120
123 Ga0207676_10000010 3300026095 Bacteria 519402
124 Ga0207676_10439748 3300026095 Bacteria 1227
125 Ga0207674_10057459 3300026116 Bacteria 3944
126 Ga0207698_10003491 3300026142 Bacteria 9481
127 Ga0209281_1000002 3300027111 Bacteria 1924012
128 Ga0209371_1000039 3300027312 Bacteria 350081
129 Ga0209588_1058753 3300027671 Bacteria 1243
130 Ga0209971_1000610 3300027682 Bacteria 9288
131 Ga0209974_10095394 3300027876 Bacteria 1035
132 Ga0268266_10006755 3300028379 Bacteria 10459
133 Ga0268266_10037546 3300028379 Bacteria 4125
134 Ga0268266_10069045 3300028379 Bacteria 3061
135 Ga0268265_10001308 3300028380 Bacteria 21377
136 Ga0268264_10000123 3300028381 Bacteria 189361
137 Ga0265334_10000074 3300028573 Bacteria 72899
138 Ga0307515_10000064 3300028794 Bacteria 245452
139 Ga0307515_10011665 3300028794 Bacteria 16648
140 Ga0307515_10137581 3300028794 Bacteria 2643
141 Ga0307515_10245646 3300028794 Bacteria 1552
142 Ga0268256_1000033 3300030500 Bacteria 420973
143 Ga0265330_10000116 3300031235 Bacteria 64622
144 Ga0265332_10000012 3300031238 Bacteria 272641
145 Ga0265325_10010667 3300031241 Bacteria 5308
146 Ga0265340_10019302 3300031247 Bacteria 3510
147 Ga0265327_10000399 3300031251 Bacteria 81304
148 Ga0265327_10013443 3300031251 Bacteria 5435
149 Ga0307513_10000008 3300031456 Bacteria 442128
150 Ga0307513_10005077 3300031456 Bacteria 17411
151 Ga0307513_10027745 3300031456 Bacteria 6490
152 Ga0307513_10384205 3300031456 Bacteria 1143
153 Ga0307514_10002069 3300031649 Bacteria 21669
154 Ga0265314_10000029 3300031711 Bacteria 272506
155 Ga0307516_10004597 3300031730 Bacteria 16937
156 Ga0307516_10023376 3300031730 Bacteria 6337
157 Ga0307411_10442885 3300032005 Bacteria 1085
158 Ga0316593_10028784 3300032168 Bacteria 1793
159 Ga0373938_0043958 3300034957 Bacteria 1001
160 Ga0373923_0048466 3300035111 Bacteria 1774
161 Ga0373939_0027323 3300035114 Bacteria 1616
162 Ga0373939_0028009 3300035114 Bacteria 1600
163 Ga0373941_0022835 3300035115 Bacteria 1780
164 Ga0373953_0018775 3300035117 Bacteria 2563
165 Ga0373956_0046171 3300035119 Bacteria 1945
166 Ga0373957_0014196 3300035120 Bacteria 2719
167 Ga0373960_0008832 3300035121 Bacteria 2427
168 Ga0373960_0029461 3300035121 Bacteria 1522
169 Ga0373955_0003306 3300035172 Bacteria 7076
170 Ga0373961_0041154 3300035241 Bacteria 1334
171 Ga0373924_0030181 3300035410 Bacteria 2171
172 Ga0373931_0163790 3300035691 Bacteria 1305
173 Ga0373933_0017725 3300035724 Bacteria 3995
174 Ga0373937_0020388 3300036401 Bacteria 5944
175 Ga0395900_0095794 3300037418 Bacteria 3049
176 Ga0395905_0000088 3300037471 Bacteria 152506
177 Ga0395905_0001134 3300037471 Bacteria 33337
178 Ga0395905_0041376 3300037471 Bacteria 4324
179 Ga0395905_0060264 3300037471 Bacteria 3549
180 Ga0395901_0050244 3300038443 Bacteria 4333
181 Ga0395901_0358802 3300038443 Bacteria 1503
182 Ga0400483_078477 3300039062 Bacteria 5356
183 Ga0400483_179647 3300039062 Bacteria 8263
184 Ga0436360_1250943 3300039438 Bacteria 9243
185 Ga0436360_1267026 3300039438 Bacteria 990
186 Ga0436361_0419394 3300039447 Bacteria 5067
187 Ga0436361_0944398 3300039447 Bacteria 1674
188 Ga0436363_0758760 3300039450 Bacteria 2123
189 Ga0436362_0460506 3300039453 Bacteria 4315
190 Ga0439436_0000396 3300041404 Bacteria 10877
191 Ga0439461_0004043 3300041410 Bacteria 2434
192 Ga0439466_0000894 3300041411 Bacteria 11359
193 Ga0439465_0017376 3300041413 Bacteria 2245
194 Ga0451800_1674843 3300041459 Bacteria 990
195 Ga0451807_2012880 3300041486 Bacteria 9835
196 Ga0439431_0002668 3300041997 Bacteria 3934
197 Ga0439433_0000528 3300041999 Bacteria 7203
198 Ga0439442_016145 3300042002 Bacteria 1539
199 Ga0439445_0000902 3300042004 Bacteria 6306
200 Ga0439432_006473 3300042006 Bacteria 4180
201 Ga0439449_0002730 3300042007 Bacteria 6867
202 Ga0439452_012871 3300042010 Bacteria 2364
203 Ga0439452_019509 3300042010 Bacteria 1792
204 Ga0439462_0001673 3300042015 Bacteria 4998
205 Ga0439462_0014262 3300042015 Bacteria 2040
206 Ga0439446_0001476 3300042156 Bacteria 5371
207 Ga0451577_0001607 3300042876 Bacteria 29368
208 Ga0451577_0025423 3300042876 Bacteria 5372
209 Ga0451577_0097250 3300042876 Bacteria 2629
210 Ga0466969_0009377 3300044656 Bacteria 5188
211 Ga0453683_0008382 3300044673 Bacteria 6938
212 Ga0466966_0003218 3300044684 Bacteria 10765
213 Ga0466961_0029663 3300044693 Bacteria 3514
214 Ga0453684_0476130 3300044712 Bacteria 1386
215 Ga0466971_0001535 3300044719 Bacteria 9725
216 Ga0466968_0003222 3300044735 Bacteria 6021
217 Ga0466970_0003306 3300044765 Bacteria 7838
218 Ga0466957_0002146 3300044842 Bacteria 10557
219 Ga0466959_0002729 3300045049 Bacteria 11357
220 Ga0451576_0051177 3300045051 Bacteria 4331
221 Ga0451576_0309519 3300045051 Bacteria 1652
222 Ga0451576_0851667 3300045051 Bacteria 957
223 Ga0466958_0334898 3300045836 Bacteria 973
224 Ga0495643_0037715 3300046522 Bacteria 2649
225 Ga0495654_0002797 3300046530 Bacteria 10997
226 Ga0495654_0031413 3300046530 Bacteria 2696
227 Ga0495597_0000054 3300046542 Bacteria 95390
228 Ga0495658_0122935 3300046683 Bacteria 1571
229 Ga0495680_0069236 3300047322 Bacteria 2693
230 Ga0495673_0000007 3300047469 Bacteria 796722
231 Ga0495681_0076300 3300047470 Bacteria 1506
232 Ga0496105_0177373 3300048908 Bacteria 1745
233 Ga0496106_0313743 3300048909 Bacteria 1258
234 Ga0496107_0209263 3300048910 Bacteria 1450
235 Ga0496112_0390401 3300048915 Bacteria 1332
236 Ga0496119_0021768 3300048922 Bacteria 4618
237 Ga0496120_0002575 3300048923 Bacteria 18065
238 Ga0496121_0012540 3300048924 Bacteria 9224
239 Ga0496121_0107215 3300048924 Bacteria 2140
240 Ga0496122_0108718 3300048925 Bacteria 1828
241 Ga0496123_0001316 3300048926 Bacteria 35106
242 Ga0496123_0035341 3300048926 Bacteria 3562
243 Ga0496124_0023473 3300048927 Bacteria 5630
244 Ga0496125_0001094 3300048928 Bacteria 41763
245 Ga0496125_0002158 3300048928 Bacteria 26349
246 Ga0496126_0051945 3300048929 Bacteria 3729
247 Ga0501036_0399765 3300049572 Bacteria 1146
248 Ga0501037_0077444 3300049573 Bacteria 2413
249 Ga0501047_0010219 3300049581 Bacteria 8876
250 Ga0501047_0042539 3300049581 Bacteria 4390
251 Ga0501069_0052458 3300049585 Bacteria 2271
252 Ga0501071_0041738 3300049587 Bacteria 3286
253 Ga0501074_0061805 3300049590 Bacteria 2698
254 Ga0501080_0018836 3300049742 Bacteria 6392
255 Ga0501035_0101893 3300049822 Bacteria 2519
256 Ga0501044_0007714 3300049823 Bacteria 11836
257 nmdc:mga0k408_5712_c1 3300050493 Bacteria 6615
258 nmdc:mga08y16_176148_c1 3300050511 Bacteria 2221
259 nmdc:mga0n895_18878_c1 3300050512 Bacteria 6394
260 nmdc:mga0rr50_132924_c1 3300050513 Bacteria 1994
261 nmdc:mga0rr50_20895_c1 3300050513 Bacteria 4457
262 nmdc:mga0rr50_652_c1 3300050513 Bacteria 18640
263 nmdc:mga08x19_159183_c1 3300050514 Bacteria 1533
264 nmdc:mga08x19_22479_c1 3300050514 Bacteria 3905
265 nmdc:mga08x19_253729_c1 3300050514 Bacteria 1215
266 nmdc:mga08x19_915_c1 3300050514 Bacteria 18639
267 nmdc:mga0a205_4880_c1 3300050515 Bacteria 12067
268 Ga0495612_0014123 3300053078 Bacteria 3214
269 Ga0500593_002243 3300053117 Bacteria 7060
270 Ga0500645_001697 3300053730 Bacteria 10753
271 Ga0590071_005987 3300059421 Bacteria 2911

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053117 Ga0500593_002243 Ga0500593_002243_2944_3771 233
2 iso_pu_bacteria 2919704043 2919706179 238
3 3300045051 Ga0451576_0851667 Ga0451576_0851667_13_759 244
4 3300048910 Ga0496107_0209263 Ga0496107_0209263_17_775 244
5 3300045051 Ga0451576_0309519 Ga0451576_0309519_845_1642 252
6 3300053078 Ga0495612_0014123 Ga0495612_0014123_2392_3198 255
7 3300032168 Ga0316593_10028784 Ga0316593_100287842 256
8 3300035119 Ga0373956_0046171 Ga0373956_0046171_830_1708 263
9 3300014325 Ga0163163_10001096 Ga0163163_1000109619 266
10 3300048927 Ga0496124_0023473 Ga0496124_0023473_4752_5591 266
11 3300037471 Ga0395905_0060264 Ga0395905_0060264_1681_2523 268
12 3300038443 Ga0395901_0050244 Ga0395901_0050244_1183_2025 268
13 3300039062 Ga0400483_078477 Ga0400483_078477_2176_3018 269
14 3300039062 Ga0400483_179647 Ga0400483_179647_1390_2232 269
15 iso_pu_bacteria 8054357960 8054360147 271
16 3300044712 Ga0453684_0476130 Ga0453684_0476130_15_848 272
17 iso_pu_bacteria 2885192300 2885196652 273
18 3300044735 Ga0466968_0003222 Ga0466968_0003222_2122_3015 274
19 iso_pu_bacteria 2547132374 2548499260 274
20 iso_pu_bacteria 2643221570 2643866097 274
21 iso_pu_bacteria 2643221596 2643994083 274
22 iso_pu_bacteria 2643221609 2644057681 274
23 iso_pu_bacteria 2643221611 2644072232 274
24 iso_pu_bacteria 2643221652 2644292911 274
25 iso_pu_bacteria 2643221717 2644647924 274
26 iso_pu_bacteria 2721755523 2722885757 274
27 iso_pu_bacteria 2738543012 2739241958 274
28 iso_pu_bacteria 2816332133 2816470740 274
29 iso_pu_bacteria 2839138175 2839144132 274
30 iso_pu_bacteria 2842718218 2842721847 274
31 iso_pu_bacteria 2974320154 2974322071 274
32 iso_pu_bacteria 2990710928 2990714152 274
33 3300005330 Ga0070690_100034643 Ga0070690_1000346431 275
34 3300005437 Ga0070710_10015695 Ga0070710_100156952 275
35 3300005535 Ga0070684_100104013 Ga0070684_1001040132 275
36 3300005544 Ga0070686_100006079 Ga0070686_1000060792 275
37 3300006237 Ga0097621_100018860 Ga0097621_1000188604 275
38 3300006358 Ga0068871_100011163 Ga0068871_1000111634 275
39 3300025898 Ga0207692_10018760 Ga0207692_100187605 275
40 3300034957 Ga0373938_0043958 Ga0373938_0043958_31_894 275
41 3300035111 Ga0373923_0048466 Ga0373923_0048466_657_1520 275
42 3300035114 Ga0373939_0027323 Ga0373939_0027323_318_1181 275
43 3300035117 Ga0373953_0018775 Ga0373953_0018775_1551_2414 275
44 3300035120 Ga0373957_0014196 Ga0373957_0014196_1792_2655 275
45 3300035172 Ga0373955_0003306 Ga0373955_0003306_2723_3586 275
46 3300035410 Ga0373924_0030181 Ga0373924_0030181_1272_2135 275
47 3300035724 Ga0373933_0017725 Ga0373933_0017725_3056_3919 275
48 3300036401 Ga0373937_0020388 Ga0373937_0020388_3778_4641 275
49 3300047322 Ga0495680_0069236 Ga0495680_0069236_297_1160 275
50 iso_pu_bacteria 2904479285 2904479468 275
51 3300005440 Ga0070705_100019336 Ga0070705_1000193361 276
52 3300005518 Ga0070699_100133305 Ga0070699_1001333052 276
53 3300005545 Ga0070695_100078513 Ga0070695_1000785131 276
54 3300005546 Ga0070696_100068993 Ga0070696_1000689932 276
55 3300005616 Ga0068852_100007157 Ga0068852_1000071572 276
56 3300025917 Ga0207660_10065912 Ga0207660_100659123 276
57 3300026142 Ga0207698_10003491 Ga0207698_100034919 276
58 3300031251 Ga0265327_10013443 Ga0265327_100134435 276
59 3300037418 Ga0395900_0095794 Ga0395900_0095794_1149_2018 276
60 3300037471 Ga0395905_0000088 Ga0395905_0000088_132016_132885 276
61 3300037471 Ga0395905_0001134 Ga0395905_0001134_30115_30984 276
62 3300037471 Ga0395905_0041376 Ga0395905_0041376_616_1485 276
63 3300038443 Ga0395901_0358802 Ga0395901_0358802_501_1370 276
64 3300049585 Ga0501069_0052458 Ga0501069_0052458_186_1055 276
65 3300050513 nmdc:mga0rr50_132924_c1 nmdc:mga0rr50_132924_c1_275_1144 276
66 3300050514 nmdc:mga08x19_159183_c1 nmdc:mga08x19_159183_c1_382_1248 276
67 3300005329 Ga0070683_100357344 Ga0070683_1003573442 277
68 3300005334 Ga0068869_100318503 Ga0068869_1003185032 277
69 3300005338 Ga0068868_100103854 Ga0068868_1001038542 277
70 3300005338 Ga0068868_100128436 Ga0068868_1001284361 277
71 3300005340 Ga0070689_100259132 Ga0070689_1002591322 277
72 3300005365 Ga0070688_100143619 Ga0070688_1001436192 277
73 3300005546 Ga0070696_100140563 Ga0070696_1001405632 277
74 3300005563 Ga0068855_100094237 Ga0068855_1000942373 277
75 3300005614 Ga0068856_100456970 Ga0068856_1004569702 277
76 3300005617 Ga0068859_100020903 Ga0068859_1000209034 277
77 3300005618 Ga0068864_100284726 Ga0068864_1002847261 277
78 3300005840 Ga0068870_10287749 Ga0068870_102877491 277
79 3300005842 Ga0068858_100142312 Ga0068858_1001423122 277
80 3300005843 Ga0068860_100036924 Ga0068860_1000369243 277
81 3300005985 Ga0081539_10000332 Ga0081539_1000033265 277
82 3300006173 Ga0070716_100317948 Ga0070716_1003179481 277
83 3300006852 Ga0075433_10005913 Ga0075433_100059139 277
84 3300006871 Ga0075434_100000566 Ga0075434_10000056625 277
85 3300006914 Ga0075436_100003489 Ga0075436_10000348913 277
86 3300006931 Ga0097620_100020903 Ga0097620_1000209034 277
87 3300007076 Ga0075435_100000249 Ga0075435_10000024932 277
88 3300009094 Ga0111539_10163310 Ga0111539_101633103 277
89 3300009176 Ga0105242_10001456 Ga0105242_1000145616 277
90 3300013297 Ga0157378_10122116 Ga0157378_101221162 277
91 3300014969 Ga0157376_10005707 Ga0157376_100057076 277
92 3300025934 Ga0207686_10035045 Ga0207686_100350452 277
93 3300025942 Ga0207689_10124536 Ga0207689_101245362 277
94 3300025944 Ga0207661_10293463 Ga0207661_102934632 277
95 3300025949 Ga0207667_10061455 Ga0207667_100614553 277
96 3300026023 Ga0207677_10018355 Ga0207677_100183555 277
97 3300026035 Ga0207703_10048270 Ga0207703_100482702 277
98 3300026075 Ga0207708_10372605 Ga0207708_103726052 277
99 3300026095 Ga0207676_10439748 Ga0207676_104397482 277
100 3300027671 Ga0209588_1058753 Ga0209588_10587532 277
101 3300032005 Ga0307411_10442885 Ga0307411_104428852 277
102 3300035114 Ga0373939_0028009 Ga0373939_0028009_591_1460 277
103 3300035115 Ga0373941_0022835 Ga0373941_0022835_450_1319 277
104 3300035121 Ga0373960_0008832 Ga0373960_0008832_718_1587 277
105 3300035121 Ga0373960_0029461 Ga0373960_0029461_251_1120 277
106 3300035241 Ga0373961_0041154 Ga0373961_0041154_49_918 277
107 3300035691 Ga0373931_0163790 Ga0373931_0163790_142_1011 277
108 3300041404 Ga0439436_0000396 Ga0439436_0000396_3176_4048 277
109 3300041410 Ga0439461_0004043 Ga0439461_0004043_388_1260 277
110 3300041411 Ga0439466_0000894 Ga0439466_0000894_6416_7288 277
111 3300041413 Ga0439465_0017376 Ga0439465_0017376_1083_1955 277
112 3300041997 Ga0439431_0002668 Ga0439431_0002668_1980_2852 277
113 3300041999 Ga0439433_0000528 Ga0439433_0000528_4297_5169 277
114 3300042002 Ga0439442_016145 Ga0439442_016145_157_1029 277
115 3300042004 Ga0439445_0000902 Ga0439445_0000902_1972_2844 277
116 3300042006 Ga0439432_006473 Ga0439432_006473_2138_3010 277
117 3300042007 Ga0439449_0002730 Ga0439449_0002730_3233_4105 277
118 3300042010 Ga0439452_012871 Ga0439452_012871_679_1551 277
119 3300042015 Ga0439462_0001673 Ga0439462_0001673_2751_3623 277
120 3300042156 Ga0439446_0001476 Ga0439446_0001476_1601_2473 277
121 3300042876 Ga0451577_0025423 Ga0451577_0025423_3410_4276 277
122 3300046542 Ga0495597_0000054 Ga0495597_0000054_65160_66029 277
123 3300050511 nmdc:mga08y16_176148_c1 nmdc:mga08y16_176148_c1_321_1193 277
124 3300050512 nmdc:mga0n895_18878_c1 nmdc:mga0n895_18878_c1_4622_5494 277
125 3300050513 nmdc:mga0rr50_652_c1 nmdc:mga0rr50_652_c1_9150_10022 277
126 3300050514 nmdc:mga08x19_253729_c1 nmdc:mga08x19_253729_c1_129_998 277
127 3300050514 nmdc:mga08x19_915_c1 nmdc:mga08x19_915_c1_7799_8671 277
128 3300050515 nmdc:mga0a205_4880_c1 nmdc:mga0a205_4880_c1_10136_11008 277
129 3300005289 Ga0065704_10104144 Ga0065704_101041442 278
130 3300005289 Ga0065704_10119941 Ga0065704_101199412 278
131 3300005289 Ga0065704_10169113 Ga0065704_101691132 278
132 3300005548 Ga0070665_100003525 Ga0070665_10000352515 278
133 3300005563 Ga0068855_100018545 Ga0068855_1000185452 278
134 3300006177 Ga0075362_10039538 Ga0075362_100395382 278
135 3300006946 Ga0079104_1000658 Ga0079104_100065818 278
136 3300009092 Ga0105250_10000966 Ga0105250_100009664 278
137 3300009094 Ga0111539_10372437 Ga0111539_103724372 278
138 3300009148 Ga0105243_10133435 Ga0105243_101334353 278
139 3300009545 Ga0105237_10122970 Ga0105237_101229702 278
140 3300011119 Ga0105246_10427183 Ga0105246_104271831 278
141 3300013105 Ga0157369_10511873 Ga0157369_105118731 278
142 3300015262 Ga0182007_10036103 Ga0182007_100361032 278
143 3300017792 Ga0163161_10080413 Ga0163161_100804132 278
144 3300025711 Ga0207696_1003660 Ga0207696_10036604 278
145 3300025923 Ga0207681_10131212 Ga0207681_101312122 278
146 3300025935 Ga0207709_10007648 Ga0207709_100076483 278
147 3300025937 Ga0207669_10395270 Ga0207669_103952701 278
148 3300025949 Ga0207667_10141207 Ga0207667_101412072 278
149 3300027111 Ga0209281_1000002 Ga0209281_1000002760 278
150 3300027682 Ga0209971_1000610 Ga0209971_10006109 278
151 3300027876 Ga0209974_10095394 Ga0209974_100953941 278
152 3300028379 Ga0268266_10069045 Ga0268266_100690452 278
153 3300028794 Ga0307515_10000064 Ga0307515_1000006411 278
154 3300028794 Ga0307515_10011665 Ga0307515_100116654 278
155 3300028794 Ga0307515_10137581 Ga0307515_101375813 278
156 3300028794 Ga0307515_10245646 Ga0307515_102456462 278
157 3300031235 Ga0265330_10000116 Ga0265330_1000011655 278
158 3300031238 Ga0265332_10000012 Ga0265332_10000012221 278
159 3300031241 Ga0265325_10010667 Ga0265325_100106673 278
160 3300031247 Ga0265340_10019302 Ga0265340_100193022 278
161 3300031251 Ga0265327_10000399 Ga0265327_1000039975 278
162 3300031456 Ga0307513_10000008 Ga0307513_10000008167 278
163 3300031456 Ga0307513_10005077 Ga0307513_1000507713 278
164 3300031456 Ga0307513_10027745 Ga0307513_100277454 278
165 3300031456 Ga0307513_10384205 Ga0307513_103842051 278
166 3300031649 Ga0307514_10002069 Ga0307514_100020694 278
167 3300031711 Ga0265314_10000029 Ga0265314_1000002936 278
168 3300031730 Ga0307516_10004597 Ga0307516_1000459711 278
169 3300031730 Ga0307516_10023376 Ga0307516_100233763 278
170 3300041459 Ga0451800_1674843 Ga0451800_1674843_43_924 278
171 3300042010 Ga0439452_019509 Ga0439452_019509_104_1027 278
172 3300042015 Ga0439462_0014262 Ga0439462_0014262_636_1640 278
173 3300042876 Ga0451577_0001607 Ga0451577_0001607_28399_29274 278
174 3300044673 Ga0453683_0008382 Ga0453683_0008382_2413_3288 278
175 3300046522 Ga0495643_0037715 Ga0495643_0037715_1444_2319 278
176 3300046530 Ga0495654_0002797 Ga0495654_0002797_2462_3337 278
177 3300046683 Ga0495658_0122935 Ga0495658_0122935_14_880 278
178 3300048924 Ga0496121_0012540 Ga0496121_0012540_2329_3201 278
179 3300048926 Ga0496123_0035341 Ga0496123_0035341_167_1042 278
180 3300048928 Ga0496125_0001094 Ga0496125_0001094_27635_28510 278
181 3300048928 Ga0496125_0002158 Ga0496125_0002158_20190_21062 278
182 3300049573 Ga0501037_0077444 Ga0501037_0077444_828_1700 278
183 3300049581 Ga0501047_0042539 Ga0501047_0042539_2334_3209 278
184 3300053730 Ga0500645_001697 Ga0500645_001697_6593_7468 278
185 3300059421 Ga0590071_005987 Ga0590071_005987_238_1110 278
186 iso_pu_bacteria 2945909444 2945914291 278
187 3300007788 Ga0099795_10014237 Ga0099795_100142372 279
188 3300010159 Ga0099796_10025661 Ga0099796_100256612 279
189 3300028573 Ga0265334_10000074 Ga0265334_100000746 279
190 3300049572 Ga0501036_0399765 Ga0501036_0399765_74_949 279
191 3300049581 Ga0501047_0010219 Ga0501047_0010219_1190_2065 279
192 3300049590 Ga0501074_0061805 Ga0501074_0061805_648_1523 279
193 3300049742 Ga0501080_0018836 Ga0501080_0018836_2246_3121 279
194 3300049822 Ga0501035_0101893 Ga0501035_0101893_903_1778 279
195 3300049823 Ga0501044_0007714 Ga0501044_0007714_7014_7889 279
196 3300005331 Ga0070670_100000064 Ga0070670_10000006472 280
197 3300005335 Ga0070666_10020339 Ga0070666_100203393 280
198 3300005353 Ga0070669_100008388 Ga0070669_10000838810 280
199 3300005355 Ga0070671_100000025 Ga0070671_10000002587 280
200 3300005367 Ga0070667_100000095 Ga0070667_10000009530 280
201 3300005466 Ga0070685_10000005 Ga0070685_1000000522 280
202 3300005548 Ga0070665_100037379 Ga0070665_1000373796 280
203 3300005617 Ga0068859_100010303 Ga0068859_1000103033 280
204 3300005618 Ga0068864_100000073 Ga0068864_10000007330 280
205 3300005841 Ga0068863_100220485 Ga0068863_1002204852 280
206 3300005842 Ga0068858_100031406 Ga0068858_1000314065 280
207 3300005844 Ga0068862_100178199 Ga0068862_1001781993 280
208 3300006931 Ga0097620_100010303 Ga0097620_1000103033 280
209 3300009101 Ga0105247_10087121 Ga0105247_100871212 280
210 3300009177 Ga0105248_10301097 Ga0105248_103010972 280
211 3300025900 Ga0207710_10126382 Ga0207710_101263821 280
212 3300025903 Ga0207680_10015400 Ga0207680_100154003 280
213 3300025923 Ga0207681_10013886 Ga0207681_100138863 280
214 3300025925 Ga0207650_10000106 Ga0207650_1000010670 280
215 3300025931 Ga0207644_10000049 Ga0207644_1000004960 280
216 3300025941 Ga0207711_10000393 Ga0207711_1000039336 280
217 3300025986 Ga0207658_10000073 Ga0207658_1000007370 280
218 3300026088 Ga0207641_10148621 Ga0207641_101486213 280
219 3300026095 Ga0207676_10000010 Ga0207676_1000001070 280
220 3300028379 Ga0268266_10006755 Ga0268266_100067554 280
221 3300028380 Ga0268265_10001308 Ga0268265_1000130815 280
222 3300028381 Ga0268264_10000123 Ga0268264_10000123161 280
223 3300005337 Ga0070682_100000291 Ga0070682_10000029120 281
224 3300005434 Ga0070709_10002971 Ga0070709_100029717 281
225 3300005434 Ga0070709_10006534 Ga0070709_100065342 281
226 3300005435 Ga0070714_100013915 Ga0070714_1000139156 281
227 3300005435 Ga0070714_100075766 Ga0070714_1000757662 281
228 3300005436 Ga0070713_100001943 Ga0070713_10000194311 281
229 3300005437 Ga0070710_10141464 Ga0070710_101414641 281
230 3300005458 Ga0070681_10005058 Ga0070681_1000505812 281
231 3300005530 Ga0070679_100059172 Ga0070679_1000591722 281
232 3300005545 Ga0070695_100017171 Ga0070695_1000171714 281
233 3300006028 Ga0070717_10059618 Ga0070717_100596183 281
234 3300006175 Ga0070712_100012664 Ga0070712_1000126642 281
235 3300006195 Ga0075366_10014806 Ga0075366_100148062 281
236 3300006914 Ga0075436_100062319 Ga0075436_1000623192 281
237 3300007076 Ga0075435_100012977 Ga0075435_1000129774 281
238 3300021441 Ga0213871_10001763 Ga0213871_100017634 281
239 3300025912 Ga0207707_10000775 Ga0207707_1000077523 281
240 3300025915 Ga0207693_10015362 Ga0207693_100153624 281
241 3300025916 Ga0207663_10166861 Ga0207663_101668612 281
242 3300025921 Ga0207652_10128047 Ga0207652_101280473 281
243 3300025928 Ga0207700_10058984 Ga0207700_100589842 281
244 3300025929 Ga0207664_10153841 Ga0207664_101538412 281
245 3300039438 Ga0436360_1250943 Ga0436360_1250943_5010_5894 281
246 3300039438 Ga0436360_1267026 Ga0436360_1267026_76_963 281
247 3300039447 Ga0436361_0419394 Ga0436361_0419394_3552_4436 281
248 3300039447 Ga0436361_0944398 Ga0436361_0944398_765_1649 281
249 3300039450 Ga0436363_0758760 Ga0436363_0758760_932_1816 281
250 3300039453 Ga0436362_0460506 Ga0436362_0460506_1706_2590 281
251 3300044656 Ga0466969_0009377 Ga0466969_0009377_170_1054 281
252 3300044684 Ga0466966_0003218 Ga0466966_0003218_6572_7456 281
253 3300044693 Ga0466961_0029663 Ga0466961_0029663_1133_2017 281
254 3300044719 Ga0466971_0001535 Ga0466971_0001535_6934_7818 281
255 3300044765 Ga0466970_0003306 Ga0466970_0003306_5892_6776 281
256 3300044842 Ga0466957_0002146 Ga0466957_0002146_9542_10426 281
257 3300045049 Ga0466959_0002729 Ga0466959_0002729_5707_6591 281
258 3300045051 Ga0451576_0051177 Ga0451576_0051177_1466_2359 281
259 3300045836 Ga0466958_0334898 Ga0466958_0334898_59_943 281
260 3300048908 Ga0496105_0177373 Ga0496105_0177373_849_1733 281
261 3300048909 Ga0496106_0313743 Ga0496106_0313743_191_1075 281
262 3300048915 Ga0496112_0390401 Ga0496112_0390401_362_1246 281
263 3300049587 Ga0501071_0041738 Ga0501071_0041738_254_1147 281
264 3300050493 nmdc:mga0k408_5712_c1 nmdc:mga0k408_5712_c1_4378_5277 281
265 3300050513 nmdc:mga0rr50_20895_c1 nmdc:mga0rr50_20895_c1_2350_3234 281
266 3300050514 nmdc:mga08x19_22479_c1 nmdc:mga08x19_22479_c1_461_1345 281
267 3300041486 Ga0451807_2012880 Ga0451807_2012880_4742_5638 283
268 3300005548 Ga0070665_100095021 Ga0070665_1000950214 284
269 3300005577 Ga0068857_100101783 Ga0068857_1001017832 284
270 3300026116 Ga0207674_10057459 Ga0207674_100574592 284
271 3300028379 Ga0268266_10037546 Ga0268266_100375463 284
272 3300042876 Ga0451577_0097250 Ga0451577_0097250_311_1201 284
273 3300048922 Ga0496119_0021768 Ga0496119_0021768_3546_4436 284
274 3300048923 Ga0496120_0002575 Ga0496120_0002575_9971_10861 284
275 3300048924 Ga0496121_0107215 Ga0496121_0107215_1217_2107 284
276 3300048929 Ga0496126_0051945 Ga0496126_0051945_2103_2993 284
277 3300009094 Ga0111539_10759296 Ga0111539_107592961 285
278 iso_pu_bacteria 2537561728 2538424943 289
279 iso_pu_bacteria 2811995292 2813728403 289
280 iso_pu_bacteria 2846540461 2846544342 289
281 iso_pu_bacteria 2871282230 2871285098 289
282 3300002773 JGI25152J39213_1000066 JGI25152J39213_100006637 293
283 3300003856 Ga0058692_1000102 Ga0058692_10001027 293
284 3300003856 Ga0058692_1002588 Ga0058692_100258810 293
285 3300009036 Ga0105244_10000268 Ga0105244_1000026821 293
286 3300009036 Ga0105244_10008716 Ga0105244_100087166 293
287 3300009092 Ga0105250_10000077 Ga0105250_1000007752 293
288 3300027312 Ga0209371_1000039 Ga0209371_1000039198 293
289 3300030500 Ga0268256_1000033 Ga0268256_1000033165 293
290 3300046530 Ga0495654_0031413 Ga0495654_0031413_1350_2231 293
291 3300047469 Ga0495673_0000007 Ga0495673_0000007_382127_383008 293
292 3300047470 Ga0495681_0076300 Ga0495681_0076300_544_1425 293
293 3300048925 Ga0496122_0108718 Ga0496122_0108718_170_1051 293
294 3300048926 Ga0496123_0001316 Ga0496123_0001316_18126_19007 293

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01435

Peptidase_M48

Peptidase family M48

106

320

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cqb-assembly1.cif.gz_B crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.9409 57 146
3cqb-assembly1.cif.gz_A crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.8681 54 147
3cqb-assembly1.cif.gz_B crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.833 57 146
3cqb-assembly1.cif.gz_A crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.77 54 147
2ypt-assembly4.cif.gz_E crystal structure of the human nuclear membrane zinc metalloprotease zmpste24 mutant (e336a) in complex with a synthetic csim tetrapeptide from the c-terminus of prelamin a 0.7197 20 287
ID Description Score Start End Superfamily
af_P23894_64_157_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 1.004 65 156 3.30.2010.10
af_P23894_64_157_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.9718 65 156 3.30.2010.10
af_Q59076_58_147_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.9309 76 155 3.30.2010.10
af_P9WHS5_62_152_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8555 69 154 3.30.2010.10
af_O53978_67_150_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8542 70 154 3.30.2010.10
ID Description Score Start End GO Terms
AF-A0A6I1IQ61-F1-model_v4 deleted 0.9959 39 170
AF-A0A377CHR2-F1-model_v4 M48B family peptidase (EC 3.4.24.-) 0.9756 53 147 GO:0004222
GO:0005886
GO:0006508
GO:0046872
AF-A0A6I1IQ61-F1-model_v4 deleted 0.9738 39 170
AF-G5QYU3-F1-model_v4 Putative protease HtpX 0.9638 1 241 GO:0004222
GO:0005886
GO:0006508
GO:0046872
AF-G5QYU3-F1-model_v4 Putative protease HtpX 0.956 1 241 GO:0004222
GO:0005886
GO:0006508
GO:0046872

Feature Viewer

pLDDT pTM Quality
80.6 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map