F390758

General Info

Members Datasets Scaffolds Average Seq Length
292 172 292 102

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_101493561|Ga0070669_1014935611
Length 109
Sequence MKRYEGLFILNTAGKEEGIKDAIDKISSEITAAGGKVETVQKMDKKAFARVADKKNSSGFYVNIIFEGNPAALSQLRNRFAMNEEVFRVLFTIAPEPKAAEAQAALSRD

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
90 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
91 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
92 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
93 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
94 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
95 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
96 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
99 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
103 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
104 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
105 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
106 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
107 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
114 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
115 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
117 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
132 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
133 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
134 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
135 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
171 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.21
Metatranscriptomes 4.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.37
Rhizosphere 96.92
Stem 0
Stem Tuber 0
Unclassified 1.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10173085 3300003320 Bacteria 1423
2 Ga0058859_11126225 3300004798 Unclassified 742
3 Ga0058863_10044042 3300004799 Bacteria 807
4 Ga0058863_10045919 3300004799 Unclassified 2640
5 Ga0058863_11807766 3300004799 Unclassified 638
6 Ga0058861_12028210 3300004800 Unclassified 635
7 Ga0058862_12779272 3300004803 Bacteria 936
8 Ga0065707_10973977 3300005295 Unclassified 546
9 Ga0070658_10020046 3300005327 Bacteria 5356
10 Ga0070690_100039609 3300005330 Unclassified 2977
11 Ga0070680_100469819 3300005336 Bacteria 1075
12 Ga0068868_101191901 3300005338 Unclassified 704
13 Ga0070689_100024370 3300005340 Bacteria 4538
14 Ga0070689_100052080 3300005340 Unclassified 3165
15 Ga0070691_10042751 3300005341 Unclassified 2145
16 Ga0070691_10315005 3300005341 Bacteria 859
17 Ga0070669_101493561 3300005353 Bacteria 587
18 Ga0070675_101905450 3300005354 Bacteria 548
19 Ga0070671_101155236 3300005355 Unclassified 681
20 Ga0070688_100746702 3300005365 Bacteria 761
21 Ga0070714_101486966 3300005435 Bacteria 662
22 Ga0070711_100346682 3300005439 Bacteria 1193
23 Ga0070711_101749878 3300005439 Bacteria 545
24 Ga0070711_101927675 3300005439 Unclassified 519
25 Ga0070705_100015074 3300005440 Bacteria 3989
26 Ga0070694_100025824 3300005444 Unclassified 3803
27 Ga0070681_10026491 3300005458 Bacteria 5826
28 Ga0070681_10056358 3300005458 Bacteria 3911
29 Ga0070681_10440888 3300005458 Bacteria 1214
30 Ga0070681_10515698 3300005458 Unclassified 1109
31 Ga0070685_11494247 3300005466 Unclassified 520
32 Ga0070707_100477510 3300005468 Unclassified 1208
33 Ga0070679_100040024 3300005530 Bacteria 4662
34 Ga0070679_100862398 3300005530 Unclassified 849
35 Ga0070697_100783459 3300005536 Bacteria 843
36 Ga0068853_100470455 3300005539 Bacteria 1184
37 Ga0070686_100007698 3300005544 Bacteria 6021
38 Ga0070686_100439495 3300005544 Unclassified 1000
39 Ga0070695_101684578 3300005545 Unclassified 530
40 Ga0070704_100157940 3300005549 Bacteria 1790
41 Ga0068855_100015729 3300005563 Bacteria 9102
42 Ga0068855_100082910 3300005563 Unclassified 3715
43 Ga0068857_100321447 3300005577 Bacteria 1429
44 Ga0068857_101732314 3300005577 Unclassified 611
45 Ga0068856_100409082 3300005614 Bacteria 1376
46 Ga0068856_100999435 3300005614 Bacteria 855
47 Ga0068856_101678731 3300005614 Bacteria 648
48 Ga0070702_100765048 3300005615 Unclassified 743
49 Ga0068859_100483991 3300005617 Bacteria 1333
50 Ga0068859_100497502 3300005617 Unclassified 1314
51 Ga0068859_100977477 3300005617 Bacteria 929
52 Ga0068864_101793394 3300005618 Unclassified 619
53 Ga0068858_100315909 3300005842 Unclassified 1492
54 Ga0097621_100738854 3300006237 Unclassified 908
55 Ga0097621_100977604 3300006237 Bacteria 791
56 Ga0068871_100161145 3300006358 Bacteria 1919
57 Ga0075433_10587293 3300006852 Bacteria 978
58 Ga0075429_100151132 3300006880 Unclassified 2033
59 Ga0075436_101134056 3300006914 Bacteria 589
60 Ga0097620_100483981 3300006931 Bacteria 1333
61 Ga0097620_100497520 3300006931 Unclassified 1314
62 Ga0097620_100977409 3300006931 Bacteria 929
63 Ga0097620_101954671 3300006931 Bacteria 648
64 Ga0099795_10614764 3300007788 Bacteria 518
65 Ga0105240_10385441 3300009093 Bacteria 1582
66 Ga0111539_10508969 3300009094 Unclassified 1402
67 Ga0105243_11940658 3300009148 Unclassified 622
68 Ga0105241_11619677 3300009174 Unclassified 627
69 Ga0105242_10197239 3300009176 Bacteria 1786
70 Ga0105242_10318056 3300009176 Bacteria 1427
71 Ga0105242_11454630 3300009176 Bacteria 714
72 Ga0105237_11277869 3300009545 Bacteria 740
73 Ga0105238_10164251 3300009551 Bacteria 2196
74 Ga0105238_10174750 3300009551 Unclassified 2124
75 Ga0105249_10509976 3300009553 Bacteria 1249
76 Ga0105239_12231933 3300010375 Unclassified 637
77 Ga0157370_10185605 3300013104 Unclassified 1931
78 Ga0157369_10417959 3300013105 Bacteria 1390
79 Ga0157374_10796373 3300013296 Bacteria 961
80 Ga0157374_11809627 3300013296 Viruses 636
81 Ga0157378_12164002 3300013297 Bacteria 607
82 Ga0163162_12048234 3300013306 Viruses 656
83 Ga0157375_11335099 3300013308 Bacteria 844
84 Ga0163163_10084382 3300014325 Unclassified 3182
85 Ga0157380_11529244 3300014326 Unclassified 721
86 Ga0157376_10143905 3300014969 Bacteria 2142
87 Ga0157376_11279952 3300014969 Unclassified 763
88 Ga0157376_11741708 3300014969 Unclassified 659
89 Ga0206356_10688964 3300020070 Bacteria 1307
90 Ga0206352_10379576 3300020078 Bacteria 777
91 Ga0206354_10239141 3300020081 Bacteria 594
92 Ga0207705_10215891 3300025909 Bacteria 1456
93 Ga0207707_10094357 3300025912 Bacteria 2614
94 Ga0207707_10141411 3300025912 Bacteria 2104
95 Ga0207707_10489327 3300025912 Bacteria 1050
96 Ga0207707_10576967 3300025912 Unclassified 954
97 Ga0207707_11389267 3300025912 Bacteria 561
98 Ga0207663_10520811 3300025916 Unclassified 926
99 Ga0207652_10642683 3300025921 Unclassified 949
100 Ga0207652_11184638 3300025921 Unclassified 665
101 Ga0207646_11159781 3300025922 Unclassified 678
102 Ga0207681_11819580 3300025923 Bacteria 508
103 Ga0207694_11426788 3300025924 Unclassified 585
104 Ga0207659_11580995 3300025926 Bacteria 560
105 Ga0207659_11712075 3300025926 Viruses 535
106 Ga0207700_11289986 3300025928 Bacteria 651
107 Ga0207686_10375271 3300025934 Unclassified 1077
108 Ga0207670_10057075 3300025936 Bacteria 2647
109 Ga0207665_11158659 3300025939 Unclassified 617
110 Ga0207691_10335906 3300025940 Viruses 1294
111 Ga0207711_11309274 3300025941 Bacteria 667
112 Ga0207667_10100733 3300025949 Unclassified 2980
113 Ga0207667_11342250 3300025949 Bacteria 690
114 Ga0207667_11865947 3300025949 Unclassified 564
115 Ga0207651_11755497 3300025960 Bacteria 559
116 Ga0207712_10079046 3300025961 Bacteria 2388
117 Ga0207677_10575822 3300026023 Viruses 985
118 Ga0207703_10323617 3300026035 Unclassified 1412
119 Ga0207708_10730014 3300026075 Bacteria 849
120 Ga0207702_12440684 3300026078 Unclassified 510
121 Ga0207674_10175563 3300026116 Bacteria 2095
122 Ga0207675_102739781 3300026118 Bacteria 501
123 Ga0207698_11136554 3300026142 Bacteria 794
124 Ga0265337_1000409 3300028556 Bacteria 22991
125 Ga0265337_1002626 3300028556 Bacteria 8106
126 Ga0265337_1003671 3300028556 Bacteria 6573
127 Ga0265337_1016352 3300028556 Bacteria 2400
128 Ga0265326_10020545 3300028558 Unclassified 1893
129 Ga0265326_10240613 3300028558 Bacteria 522
130 Ga0265319_1000372 3300028563 Bacteria 32397
131 Ga0265319_1011235 3300028563 Unclassified 3680
132 Ga0265319_1132757 3300028563 Unclassified 774
133 Ga0265319_1274842 3300028563 Bacteria 513
134 Ga0265334_10006275 3300028573 Bacteria 5136
135 Ga0265334_10021119 3300028573 Unclassified 2660
136 Ga0265334_10102089 3300028573 Unclassified 1037
137 Ga0265334_10195476 3300028573 Unclassified 704
138 Ga0265318_10049124 3300028577 Unclassified 1587
139 Ga0265318_10136205 3300028577 Unclassified 902
140 Ga0265323_10010663 3300028653 Bacteria 3719
141 Ga0265323_10149753 3300028653 Unclassified 748
142 Ga0265322_10149099 3300028654 Bacteria 669
143 Ga0265336_10000836 3300028666 Bacteria 16045
144 Ga0265336_10105801 3300028666 Bacteria 838
145 Ga0265338_10000452 3300028800 Bacteria 73214
146 Ga0265338_10000836 3300028800 Bacteria 51897
147 Ga0265338_10001224 3300028800 Bacteria 42394
148 Ga0265338_10001643 3300028800 Bacteria 35770
149 Ga0265338_10024830 3300028800 Bacteria 6108
150 Ga0265338_10036364 3300028800 Bacteria 4714
151 Ga0265338_10076063 3300028800 Bacteria 2845
152 Ga0265338_10227084 3300028800 Bacteria 1391
153 Ga0265338_10248793 3300028800 Bacteria 1312
154 Ga0265338_10258105 3300028800 Bacteria 1282
155 Ga0265338_10575063 3300028800 Bacteria 787
156 Ga0265338_10909289 3300028800 Bacteria 599
157 Ga0265324_10005973 3300029957 Bacteria 5154
158 Ga0265324_10014414 3300029957 Unclassified 2926
159 Ga0265324_10036423 3300029957 Bacteria 1711
160 Ga0265324_10164447 3300029957 Bacteria 754
161 Ga0265762_1116842 3300030760 Unclassified 606
162 Ga0265330_10110248 3300031235 Bacteria 1176
163 Ga0265332_10356649 3300031238 Unclassified 603
164 Ga0265332_10474955 3300031238 Unclassified 517
165 Ga0265328_10089661 3300031239 Unclassified 1136
166 Ga0265328_10091992 3300031239 Unclassified 1121
167 Ga0265328_10290928 3300031239 Unclassified 630
168 Ga0265320_10000666 3300031240 Bacteria 26164
169 Ga0265320_10002788 3300031240 Bacteria 12039
170 Ga0265320_10008172 3300031240 Bacteria 6425
171 Ga0265320_10016284 3300031240 Bacteria 4171
172 Ga0265320_10109456 3300031240 Bacteria 1266
173 Ga0265320_10135385 3300031240 Viruses 1118
174 Ga0265320_10546508 3300031240 Bacteria 512
175 Ga0265325_10054963 3300031241 Bacteria 2037
176 Ga0265325_10127833 3300031241 Bacteria 1219
177 Ga0265329_10001129 3300031242 Bacteria 13154
178 Ga0265340_10188976 3300031247 Viruses 929
179 Ga0265340_10372227 3300031247 Unclassified 631
180 Ga0265340_10430578 3300031247 Bacteria 582
181 Ga0265339_10020591 3300031249 Bacteria 3850
182 Ga0265339_10084756 3300031249 Bacteria 1670
183 Ga0265316_10004590 3300031344 Bacteria 13704
184 Ga0265316_10011373 3300031344 Bacteria 8033
185 Ga0265316_10057443 3300031344 Bacteria 3034
186 Ga0265316_10174346 3300031344 Unclassified 1603
187 Ga0265316_10404204 3300031344 Unclassified 983
188 Ga0265316_10742811 3300031344 Bacteria 690
189 Ga0307509_10139184 3300031507 Bacteria 2367
190 Ga0265313_10003311 3300031595 Bacteria 13186
191 Ga0265313_10003545 3300031595 Bacteria 12577
192 Ga0265314_10000034 3300031711 Bacteria 241556
193 Ga0265314_10011573 3300031711 Bacteria 7269
194 Ga0265314_10218982 3300031711 Bacteria 1112
195 Ga0265342_10006839 3300031712 Bacteria 8427
196 Ga0265342_10323528 3300031712 Unclassified 808
197 Ga0265342_10459915 3300031712 Bacteria 652
198 Ga0265342_10462821 3300031712 Unclassified 650
199 Ga0265342_10484678 3300031712 Unclassified 632
200 Ga0373926_0031808 3300035083 Bacteria 1861
201 Ga0373944_0001683 3300035089 Bacteria 5599
202 Ga0373923_0631193 3300035111 Unclassified 529
203 Ga0373923_0683589 3300035111 Unclassified 509
204 Ga0373956_0171121 3300035119 Bacteria 1025
205 Ga0373960_0255969 3300035121 Unclassified 638
206 Ga0373946_0210844 3300035171 Unclassified 934
207 Ga0373946_0212790 3300035171 Viruses 930
208 Ga0373962_0304350 3300035242 Unclassified 566
209 Ga0373924_0073322 3300035410 Bacteria 1447
210 Ga0373935_0030795 3300035692 Bacteria 3326
211 Ga0373935_0310035 3300035692 Bacteria 1117
212 Ga0373927_0029709 3300035695 Unclassified 3564
213 Ga0373933_0256815 3300035724 Bacteria 1126
214 Ga0373933_0266668 3300035724 Unclassified 1105
215 Ga0373947_0034434 3300035725 Bacteria 2995
216 Ga0373937_0103275 3300036401 Unclassified 2647
217 Ga0373925_0039202 3300037068 Unclassified 3504
218 Ga0395900_0031514 3300037418 Bacteria 5449
219 Ga0395905_0095298 3300037471 Bacteria 2793
220 Ga0395901_0448979 3300038443 Bacteria 1319
221 Ga0436361_0580478 3300039447 Unclassified 917
222 Ga0451793_0584627 3300041452 Unclassified 567
223 Ga0451805_005790 3300041461 Viruses 673
224 Ga0451804_0359220 3300041463 Bacteria 888
225 Ga0451849_1109875 3300041505 Bacteria 626
226 Ga0452271_61173 3300041916 Unclassified 538
227 Ga0451577_0035196 3300042876 Bacteria 4511
228 Ga0451577_0069164 3300042876 Bacteria 3148
229 Ga0451577_0071070 3300042876 Bacteria 3103
230 Ga0451577_0090099 3300042876 Bacteria 2737
231 Ga0451577_0516281 3300042876 Bacteria 1085
232 Ga0451577_0578269 3300042876 Unclassified 1020
233 Ga0451577_0775649 3300042876 Unclassified 867
234 Ga0453683_0208690 3300044673 Bacteria 1241
235 Ga0453684_0002118 3300044712 Bacteria 50022
236 Ga0453684_0013213 3300044712 Bacteria 13461
237 Ga0453684_0013422 3300044712 Bacteria 13304
238 Ga0453684_0460919 3300044712 Bacteria 1413
239 Ga0453684_1128191 3300044712 Unclassified 827
240 Ga0453684_1178551 3300044712 Unclassified 805
241 Ga0453684_1529214 3300044712 Unclassified 687
242 Ga0451576_0056737 3300045051 Bacteria 4095
243 Ga0451576_0103483 3300045051 Bacteria 2962
244 Ga0451576_0173359 3300045051 Bacteria 2252
245 Ga0451576_0363410 3300045051 Bacteria 1516
246 Ga0451576_0442110 3300045051 Unclassified 1365
247 Ga0451576_0577870 3300045051 Bacteria 1181
248 Ga0451576_0668199 3300045051 Unclassified 1092
249 Ga0451576_0881510 3300045051 Bacteria 939
250 Ga0451576_0905026 3300045051 Viruses 926
251 Ga0451576_1014541 3300045051 Unclassified 870
252 Ga0451576_1309401 3300045051 Unclassified 755
253 Ga0495629_0254806 3300046459 Bacteria 1207
254 Ga0495651_0958571 3300046462 Unclassified 521
255 Ga0495608_0833980 3300046511 Unclassified 543
256 Ga0495630_0176547 3300046517 Bacteria 1628
257 Ga0495630_0271230 3300046517 Unclassified 1296
258 Ga0495630_0319280 3300046517 Unclassified 1187
259 Ga0495666_0240420 3300046526 Unclassified 826
260 Ga0495666_0508438 3300046526 Bacteria 538
261 Ga0495652_1049711 3300046529 Unclassified 531
262 Ga0495640_0297328 3300046533 Unclassified 1003
263 Ga0495586_0078929 3300046535 Unclassified 1806
264 Ga0495586_0091207 3300046535 Bacteria 1684
265 Ga0495586_0171007 3300046535 Bacteria 1228
266 Ga0495587_0365804 3300046536 Unclassified 803
267 Ga0495634_0630151 3300046642 Bacteria 620
268 Ga0495625_0869121 3300046660 Unclassified 519
269 Ga0495635_0903114 3300046663 Bacteria 565
270 Ga0495658_0006101 3300046683 Bacteria 5918
271 Ga0495613_0002193 3300046689 Bacteria 14793
272 Ga0495604_0815065 3300047317 Unclassified 587
273 Ga0495676_0416002 3300047321 Unclassified 890
274 Ga0495680_0077723 3300047322 Bacteria 2513
275 Ga0495680_0766018 3300047322 Bacteria 633
276 Ga0495683_0145767 3300047323 Bacteria 1106
277 Ga0495675_0192660 3300047444 Bacteria 1244
278 Ga0495675_0441939 3300047444 Unclassified 753
279 Ga0495602_0978859 3300048088 Bacteria 559
280 Ga0496113_1132987 3300048916 Viruses 613
281 Ga0495682_0037455 3300049460 Bacteria 1785
282 Ga0501033_0048200 3300049570 Unclassified 3165
283 Ga0501034_0173431 3300049571 Unclassified 2123
284 Ga0501202_202167 3300049652 Unclassified 544
285 nmdc:mga09592_305485_c1 3300050508 Bacteria 1379
286 nmdc:mga06r32_1807841_c1 3300050510 Unclassified 547
287 nmdc:mga08y16_74147_c1 3300050511 Bacteria 3545
288 nmdc:mga0n895_1538040_c1 3300050512 Unclassified 631
289 nmdc:mga0rr50_892162_c1 3300050513 Unclassified 758
290 nmdc:mga08x19_285428_c1 3300050514 Bacteria 1144
291 Ga0587077_160324 3300059493 Unclassified 595
292 Ga0587107_098725 3300059652 Unclassified 575

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026023 Ga0207677_10575822 Ga0207677_105758222 92
2 3300042876 Ga0451577_0090099 Ga0451577_0090099_310_588 92
3 3300044712 Ga0453684_1529214 Ga0453684_1529214_120_398 92
4 3300046517 Ga0495630_0271230 Ga0495630_0271230_1002_1280 92
5 3300046660 Ga0495625_0869121 Ga0495625_0869121_10_288 92
6 3300048916 Ga0496113_1132987 Ga0496113_1132987_291_569 92
7 3300049570 Ga0501033_0048200 Ga0501033_0048200_1656_1934 92
8 3300009551 Ga0105238_10164251 Ga0105238_101642512 93
9 3300039447 Ga0436361_0580478 Ga0436361_0580478_280_561 93
10 3300042876 Ga0451577_0516281 Ga0451577_0516281_91_372 93
11 3300045051 Ga0451576_0173359 Ga0451576_0173359_939_1220 93
12 3300045051 Ga0451576_0577870 Ga0451576_0577870_251_532 93
13 3300046511 Ga0495608_0833980 Ga0495608_0833980_99_380 93
14 3300047444 Ga0495675_0441939 Ga0495675_0441939_409_690 93
15 3300050508 nmdc:mga09592_305485_c1 nmdc:mga09592_305485_c1_645_977 95
16 3300009094 Ga0111539_10508969 Ga0111539_105089692 96
17 3300013296 Ga0157374_10796373 Ga0157374_107963732 96
18 3300045051 Ga0451576_0103483 Ga0451576_0103483_563_859 96
19 3300046529 Ga0495652_1049711 Ga0495652_1049711_133_429 96
20 3300050511 nmdc:mga08y16_74147_c1 nmdc:mga08y16_74147_c1_628_954 96
21 3300005340 Ga0070689_100024370 Ga0070689_1000243703 97
22 3300005354 Ga0070675_101905450 Ga0070675_1019054501 97
23 3300005577 Ga0068857_100321447 Ga0068857_1003214473 97
24 3300006880 Ga0075429_100151132 Ga0075429_1001511323 97
25 3300025924 Ga0207694_11426788 Ga0207694_114267881 97
26 3300025936 Ga0207670_10057075 Ga0207670_100570753 97
27 3300026116 Ga0207674_10175563 Ga0207674_101755633 97
28 3300014326 Ga0157380_11529244 Ga0157380_115292442 99
29 3300025926 Ga0207659_11580995 Ga0207659_115809952 99
30 3300004799 Ga0058863_10044042 Ga0058863_100440422 101
31 3300004799 Ga0058863_10045919 Ga0058863_100459193 101
32 3300004799 Ga0058863_11807766 Ga0058863_118077662 101
33 3300004800 Ga0058861_12028210 Ga0058861_120282101 101
34 3300004803 Ga0058862_12779272 Ga0058862_127792722 101
35 3300005327 Ga0070658_10020046 Ga0070658_100200465 101
36 3300005330 Ga0070690_100039609 Ga0070690_1000396093 101
37 3300005336 Ga0070680_100469819 Ga0070680_1004698192 101
38 3300005338 Ga0068868_101191901 Ga0068868_1011919011 101
39 3300005341 Ga0070691_10042751 Ga0070691_100427513 101
40 3300005341 Ga0070691_10315005 Ga0070691_103150051 101
41 3300005435 Ga0070714_101486966 Ga0070714_1014869662 101
42 3300005439 Ga0070711_101749878 Ga0070711_1017498781 101
43 3300005440 Ga0070705_100015074 Ga0070705_1000150745 101
44 3300005444 Ga0070694_100025824 Ga0070694_1000258244 101
45 3300005458 Ga0070681_10026491 Ga0070681_100264913 101
46 3300005458 Ga0070681_10056358 Ga0070681_100563583 101
47 3300005458 Ga0070681_10515698 Ga0070681_105156982 101
48 3300005466 Ga0070685_11494247 Ga0070685_114942471 101
49 3300005468 Ga0070707_100477510 Ga0070707_1004775102 101
50 3300005530 Ga0070679_100040024 Ga0070679_1000400242 101
51 3300005530 Ga0070679_100862398 Ga0070679_1008623981 101
52 3300005539 Ga0068853_100470455 Ga0068853_1004704552 101
53 3300005544 Ga0070686_100007698 Ga0070686_1000076985 101
54 3300005549 Ga0070704_100157940 Ga0070704_1001579401 101
55 3300005563 Ga0068855_100015729 Ga0068855_1000157293 101
56 3300005563 Ga0068855_100082910 Ga0068855_1000829102 101
57 3300005577 Ga0068857_101732314 Ga0068857_1017323142 101
58 3300005614 Ga0068856_100409082 Ga0068856_1004090823 101
59 3300005614 Ga0068856_100999435 Ga0068856_1009994352 101
60 3300005614 Ga0068856_101678731 Ga0068856_1016787312 101
61 3300005615 Ga0070702_100765048 Ga0070702_1007650481 101
62 3300005617 Ga0068859_100483991 Ga0068859_1004839912 101
63 3300006237 Ga0097621_100977604 Ga0097621_1009776041 101
64 3300006931 Ga0097620_100483981 Ga0097620_1004839812 101
65 3300009093 Ga0105240_10385441 Ga0105240_103854412 101
66 3300009148 Ga0105243_11940658 Ga0105243_119406581 101
67 3300009174 Ga0105241_11619677 Ga0105241_116196772 101
68 3300009176 Ga0105242_11454630 Ga0105242_114546302 101
69 3300009545 Ga0105237_11277869 Ga0105237_112778692 101
70 3300009551 Ga0105238_10174750 Ga0105238_101747504 101
71 3300009553 Ga0105249_10509976 Ga0105249_105099762 101
72 3300013104 Ga0157370_10185605 Ga0157370_101856052 101
73 3300013105 Ga0157369_10417959 Ga0157369_104179592 101
74 3300013297 Ga0157378_12164002 Ga0157378_121640022 101
75 3300014969 Ga0157376_11279952 Ga0157376_112799522 101
76 3300014969 Ga0157376_11741708 Ga0157376_117417082 101
77 3300020070 Ga0206356_10688964 Ga0206356_106889642 101
78 3300020078 Ga0206352_10379576 Ga0206352_103795762 101
79 3300020081 Ga0206354_10239141 Ga0206354_102391412 101
80 3300025909 Ga0207705_10215891 Ga0207705_102158913 101
81 3300025912 Ga0207707_10094357 Ga0207707_100943574 101
82 3300025912 Ga0207707_10141411 Ga0207707_101414113 101
83 3300025912 Ga0207707_10576967 Ga0207707_105769672 101
84 3300025912 Ga0207707_11389267 Ga0207707_113892671 101
85 3300025921 Ga0207652_10642683 Ga0207652_106426831 101
86 3300025921 Ga0207652_11184638 Ga0207652_111846381 101
87 3300025922 Ga0207646_11159781 Ga0207646_111597811 101
88 3300025928 Ga0207700_11289986 Ga0207700_112899861 101
89 3300025949 Ga0207667_10100733 Ga0207667_101007333 101
90 3300025949 Ga0207667_11342250 Ga0207667_113422502 101
91 3300025949 Ga0207667_11865947 Ga0207667_118659471 101
92 3300025961 Ga0207712_10079046 Ga0207712_100790463 101
93 3300026078 Ga0207702_12440684 Ga0207702_124406841 101
94 3300026118 Ga0207675_102739781 Ga0207675_1027397812 101
95 3300026142 Ga0207698_11136554 Ga0207698_111365541 101
96 3300028556 Ga0265337_1000409 Ga0265337_10004098 101
97 3300028556 Ga0265337_1002626 Ga0265337_10026264 101
98 3300028556 Ga0265337_1016352 Ga0265337_10163522 101
99 3300028558 Ga0265326_10020545 Ga0265326_100205453 101
100 3300028563 Ga0265319_1000372 Ga0265319_100037214 101
101 3300028563 Ga0265319_1274842 Ga0265319_12748422 101
102 3300028573 Ga0265334_10006275 Ga0265334_100062753 101
103 3300028573 Ga0265334_10102089 Ga0265334_101020892 101
104 3300028577 Ga0265318_10136205 Ga0265318_101362052 101
105 3300028653 Ga0265323_10010663 Ga0265323_100106633 101
106 3300028666 Ga0265336_10000836 Ga0265336_100008365 101
107 3300028800 Ga0265338_10000836 Ga0265338_1000083631 101
108 3300028800 Ga0265338_10001224 Ga0265338_100012246 101
109 3300028800 Ga0265338_10001643 Ga0265338_1000164318 101
110 3300028800 Ga0265338_10024830 Ga0265338_100248305 101
111 3300028800 Ga0265338_10248793 Ga0265338_102487933 101
112 3300028800 Ga0265338_10258105 Ga0265338_102581052 101
113 3300028800 Ga0265338_10575063 Ga0265338_105750632 101
114 3300029957 Ga0265324_10005973 Ga0265324_100059732 101
115 3300029957 Ga0265324_10036423 Ga0265324_100364233 101
116 3300029957 Ga0265324_10164447 Ga0265324_101644472 101
117 3300031238 Ga0265332_10474955 Ga0265332_104749551 101
118 3300031239 Ga0265328_10089661 Ga0265328_100896612 101
119 3300031240 Ga0265320_10000666 Ga0265320_1000066616 101
120 3300031240 Ga0265320_10002788 Ga0265320_100027884 101
121 3300031240 Ga0265320_10008172 Ga0265320_100081725 101
122 3300031240 Ga0265320_10016284 Ga0265320_100162841 101
123 3300031240 Ga0265320_10135385 Ga0265320_101353852 101
124 3300031247 Ga0265340_10188976 Ga0265340_101889762 101
125 3300031247 Ga0265340_10430578 Ga0265340_104305782 101
126 3300031249 Ga0265339_10084756 Ga0265339_100847563 101
127 3300031344 Ga0265316_10004590 Ga0265316_1000459012 101
128 3300031344 Ga0265316_10057443 Ga0265316_100574432 101
129 3300031344 Ga0265316_10404204 Ga0265316_104042042 101
130 3300031344 Ga0265316_10742811 Ga0265316_107428112 101
131 3300031507 Ga0307509_10139184 Ga0307509_101391842 101
132 3300031595 Ga0265313_10003311 Ga0265313_1000331111 101
133 3300031711 Ga0265314_10218982 Ga0265314_102189822 101
134 3300031712 Ga0265342_10323528 Ga0265342_103235282 101
135 3300031712 Ga0265342_10459915 Ga0265342_104599152 101
136 3300031712 Ga0265342_10462821 Ga0265342_104628211 101
137 3300035089 Ga0373944_0001683 Ga0373944_0001683_307_612 101
138 3300035111 Ga0373923_0631193 Ga0373923_0631193_11_316 101
139 3300035119 Ga0373956_0171121 Ga0373956_0171121_566_871 101
140 3300035121 Ga0373960_0255969 Ga0373960_0255969_190_495 101
141 3300035171 Ga0373946_0212790 Ga0373946_0212790_118_423 101
142 3300035692 Ga0373935_0310035 Ga0373935_0310035_26_331 101
143 3300036401 Ga0373937_0103275 Ga0373937_0103275_44_349 101
144 3300041452 Ga0451793_0584627 Ga0451793_0584627_52_357 101
145 3300041461 Ga0451805_005790 Ga0451805_005790_153_458 101
146 3300041463 Ga0451804_0359220 Ga0451804_0359220_309_614 101
147 3300041505 Ga0451849_1109875 Ga0451849_1109875_273_578 101
148 3300041916 Ga0452271_61173 Ga0452271_61173_184_489 101
149 3300042876 Ga0451577_0069164 Ga0451577_0069164_1643_1957 101
150 3300042876 Ga0451577_0071070 Ga0451577_0071070_1586_1891 101
151 3300044712 Ga0453684_0002118 Ga0453684_0002118_15991_16305 101
152 3300044712 Ga0453684_0460919 Ga0453684_0460919_903_1223 101
153 3300044712 Ga0453684_1178551 Ga0453684_1178551_414_719 101
154 3300045051 Ga0451576_0056737 Ga0451576_0056737_1763_2077 101
155 3300045051 Ga0451576_0905026 Ga0451576_0905026_495_800 101
156 3300046459 Ga0495629_0254806 Ga0495629_0254806_49_354 101
157 3300046517 Ga0495630_0319280 Ga0495630_0319280_453_758 101
158 3300046526 Ga0495666_0508438 Ga0495666_0508438_136_444 101
159 3300046533 Ga0495640_0297328 Ga0495640_0297328_580_885 101
160 3300046535 Ga0495586_0078929 Ga0495586_0078929_1224_1529 101
161 3300046535 Ga0495586_0091207 Ga0495586_0091207_91_396 101
162 3300046535 Ga0495586_0171007 Ga0495586_0171007_788_1096 101
163 3300046536 Ga0495587_0365804 Ga0495587_0365804_41_346 101
164 3300046642 Ga0495634_0630151 Ga0495634_0630151_106_411 101
165 3300046689 Ga0495613_0002193 Ga0495613_0002193_13987_14292 101
166 3300047317 Ga0495604_0815065 Ga0495604_0815065_208_513 101
167 3300047322 Ga0495680_0077723 Ga0495680_0077723_667_972 101
168 3300047322 Ga0495680_0766018 Ga0495680_0766018_51_356 101
169 3300047323 Ga0495683_0145767 Ga0495683_0145767_369_674 101
170 3300049460 Ga0495682_0037455 Ga0495682_0037455_397_702 101
171 3300049571 Ga0501034_0173431 Ga0501034_0173431_707_1012 101
172 3300049652 Ga0501202_202167 Ga0501202_202167_208_516 101
173 3300050512 nmdc:mga0n895_1538040_c1 nmdc:mga0n895_1538040_c1_285_590 101
174 3300003320 rootH2_10173085 rootH2_101730853 102
175 3300004798 Ga0058859_11126225 Ga0058859_111262251 102
176 3300005295 Ga0065707_10973977 Ga0065707_109739771 102
177 3300005340 Ga0070689_100052080 Ga0070689_1000520804 102
178 3300005353 Ga0070669_101493561 Ga0070669_1014935611 102
179 3300005355 Ga0070671_101155236 Ga0070671_1011552362 102
180 3300005365 Ga0070688_100746702 Ga0070688_1007467022 102
181 3300005439 Ga0070711_100346682 Ga0070711_1003466822 102
182 3300005439 Ga0070711_101927675 Ga0070711_1019276752 102
183 3300005458 Ga0070681_10440888 Ga0070681_104408882 102
184 3300005536 Ga0070697_100783459 Ga0070697_1007834592 102
185 3300005544 Ga0070686_100439495 Ga0070686_1004394952 102
186 3300005545 Ga0070695_101684578 Ga0070695_1016845781 102
187 3300005617 Ga0068859_100497502 Ga0068859_1004975022 102
188 3300005617 Ga0068859_100977477 Ga0068859_1009774772 102
189 3300005618 Ga0068864_101793394 Ga0068864_1017933942 102
190 3300005842 Ga0068858_100315909 Ga0068858_1003159093 102
191 3300006237 Ga0097621_100738854 Ga0097621_1007388541 102
192 3300006358 Ga0068871_100161145 Ga0068871_1001611452 102
193 3300006852 Ga0075433_10587293 Ga0075433_105872932 102
194 3300006914 Ga0075436_101134056 Ga0075436_1011340562 102
195 3300006931 Ga0097620_100497520 Ga0097620_1004975202 102
196 3300006931 Ga0097620_100977409 Ga0097620_1009774092 102
197 3300006931 Ga0097620_101954671 Ga0097620_1019546712 102
198 3300007788 Ga0099795_10614764 Ga0099795_106147642 102
199 3300009176 Ga0105242_10197239 Ga0105242_101972393 102
200 3300009176 Ga0105242_10318056 Ga0105242_103180562 102
201 3300010375 Ga0105239_12231933 Ga0105239_122319331 102
202 3300013296 Ga0157374_11809627 Ga0157374_118096271 102
203 3300013306 Ga0163162_12048234 Ga0163162_120482342 102
204 3300013308 Ga0157375_11335099 Ga0157375_113350992 102
205 3300014325 Ga0163163_10084382 Ga0163163_100843823 102
206 3300014969 Ga0157376_10143905 Ga0157376_101439054 102
207 3300025912 Ga0207707_10489327 Ga0207707_104893272 102
208 3300025916 Ga0207663_10520811 Ga0207663_105208112 102
209 3300025923 Ga0207681_11819580 Ga0207681_118195802 102
210 3300025926 Ga0207659_11712075 Ga0207659_117120751 102
211 3300025934 Ga0207686_10375271 Ga0207686_103752712 102
212 3300025939 Ga0207665_11158659 Ga0207665_111586591 102
213 3300025940 Ga0207691_10335906 Ga0207691_103359063 102
214 3300025941 Ga0207711_11309274 Ga0207711_113092742 102
215 3300025960 Ga0207651_11755497 Ga0207651_117554971 102
216 3300026035 Ga0207703_10323617 Ga0207703_103236173 102
217 3300026075 Ga0207708_10730014 Ga0207708_107300142 102
218 3300028556 Ga0265337_1003671 Ga0265337_10036716 102
219 3300028558 Ga0265326_10240613 Ga0265326_102406132 102
220 3300028563 Ga0265319_1011235 Ga0265319_10112354 102
221 3300028563 Ga0265319_1132757 Ga0265319_11327572 102
222 3300028573 Ga0265334_10021119 Ga0265334_100211193 102
223 3300028573 Ga0265334_10195476 Ga0265334_101954761 102
224 3300028577 Ga0265318_10049124 Ga0265318_100491242 102
225 3300028653 Ga0265323_10149753 Ga0265323_101497531 102
226 3300028654 Ga0265322_10149099 Ga0265322_101490992 102
227 3300028666 Ga0265336_10105801 Ga0265336_101058012 102
228 3300028800 Ga0265338_10000452 Ga0265338_1000045219 102
229 3300028800 Ga0265338_10036364 Ga0265338_100363644 102
230 3300028800 Ga0265338_10076063 Ga0265338_100760631 102
231 3300028800 Ga0265338_10227084 Ga0265338_102270842 102
232 3300028800 Ga0265338_10909289 Ga0265338_109092891 102
233 3300029957 Ga0265324_10014414 Ga0265324_100144143 102
234 3300030760 Ga0265762_1116842 Ga0265762_11168422 102
235 3300031235 Ga0265330_10110248 Ga0265330_101102482 102
236 3300031238 Ga0265332_10356649 Ga0265332_103566492 102
237 3300031239 Ga0265328_10091992 Ga0265328_100919922 102
238 3300031239 Ga0265328_10290928 Ga0265328_102909282 102
239 3300031240 Ga0265320_10109456 Ga0265320_101094562 102
240 3300031240 Ga0265320_10546508 Ga0265320_105465082 102
241 3300031241 Ga0265325_10054963 Ga0265325_100549632 102
242 3300031241 Ga0265325_10127833 Ga0265325_101278332 102
243 3300031242 Ga0265329_10001129 Ga0265329_100011298 102
244 3300031247 Ga0265340_10372227 Ga0265340_103722271 102
245 3300031249 Ga0265339_10020591 Ga0265339_100205911 102
246 3300031344 Ga0265316_10011373 Ga0265316_100113738 102
247 3300031344 Ga0265316_10174346 Ga0265316_101743463 102
248 3300031595 Ga0265313_10003545 Ga0265313_100035455 102
249 3300031711 Ga0265314_10000034 Ga0265314_1000003430 102
250 3300031711 Ga0265314_10011573 Ga0265314_100115732 102
251 3300031712 Ga0265342_10006839 Ga0265342_100068396 102
252 3300031712 Ga0265342_10484678 Ga0265342_104846782 102
253 3300035083 Ga0373926_0031808 Ga0373926_0031808_265_576 102
254 3300035111 Ga0373923_0683589 Ga0373923_0683589_173_484 102
255 3300035171 Ga0373946_0210844 Ga0373946_0210844_289_600 102
256 3300035242 Ga0373962_0304350 Ga0373962_0304350_111_428 102
257 3300035410 Ga0373924_0073322 Ga0373924_0073322_372_686 102
258 3300035692 Ga0373935_0030795 Ga0373935_0030795_2586_2897 102
259 3300035695 Ga0373927_0029709 Ga0373927_0029709_656_967 102
260 3300035724 Ga0373933_0256815 Ga0373933_0256815_388_702 102
261 3300035724 Ga0373933_0266668 Ga0373933_0266668_144_470 102
262 3300035725 Ga0373947_0034434 Ga0373947_0034434_2256_2567 102
263 3300037068 Ga0373925_0039202 Ga0373925_0039202_2648_2959 102
264 3300037418 Ga0395900_0031514 Ga0395900_0031514_4667_4981 102
265 3300037471 Ga0395905_0095298 Ga0395905_0095298_379_693 102
266 3300038443 Ga0395901_0448979 Ga0395901_0448979_299_613 102
267 3300042876 Ga0451577_0035196 Ga0451577_0035196_3805_4119 102
268 3300042876 Ga0451577_0578269 Ga0451577_0578269_131_445 102
269 3300042876 Ga0451577_0775649 Ga0451577_0775649_20_328 102
270 3300044673 Ga0453683_0208690 Ga0453683_0208690_346_669 102
271 3300044712 Ga0453684_0013213 Ga0453684_0013213_12301_12609 102
272 3300044712 Ga0453684_0013422 Ga0453684_0013422_2572_2886 102
273 3300044712 Ga0453684_1128191 Ga0453684_1128191_114_422 102
274 3300045051 Ga0451576_0363410 Ga0451576_0363410_859_1170 102
275 3300045051 Ga0451576_0442110 Ga0451576_0442110_208_519 102
276 3300045051 Ga0451576_0668199 Ga0451576_0668199_80_403 102
277 3300045051 Ga0451576_0881510 Ga0451576_0881510_590_904 102
278 3300045051 Ga0451576_1014541 Ga0451576_1014541_288_605 102
279 3300045051 Ga0451576_1309401 Ga0451576_1309401_30_344 102
280 3300046462 Ga0495651_0958571 Ga0495651_0958571_160_483 102
281 3300046517 Ga0495630_0176547 Ga0495630_0176547_271_582 102
282 3300046526 Ga0495666_0240420 Ga0495666_0240420_54_365 102
283 3300046663 Ga0495635_0903114 Ga0495635_0903114_150_464 102
284 3300046683 Ga0495658_0006101 Ga0495658_0006101_2942_3268 102
285 3300047321 Ga0495676_0416002 Ga0495676_0416002_80_391 102
286 3300047444 Ga0495675_0192660 Ga0495675_0192660_715_1029 102
287 3300048088 Ga0495602_0978859 Ga0495602_0978859_215_529 102
288 3300050510 nmdc:mga06r32_1807841_c1 nmdc:mga06r32_1807841_c1_174_488 102
289 3300050513 nmdc:mga0rr50_892162_c1 nmdc:mga0rr50_892162_c1_195_509 102
290 3300050514 nmdc:mga08x19_285428_c1 nmdc:mga08x19_285428_c1_393_704 102
291 3300059493 Ga0587077_160324 Ga0587077_160324_92_415 102
292 3300059652 Ga0587107_098725 Ga0587107_098725_238_555 102

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01250

Ribosomal_S6

Ribosomal protein S6

3

92

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qjh-assembly1.cif.gz_A-2 protein aggregation and alzheimer's disease: crystallographic analysis of the phenomenon. engineered version of the ribosomal protein s6 used as a stable scaffold to study oligomerization. 0.9064 1 94
8csr-assembly1.cif.gz_E human mitochondrial small subunit assembly intermediate (state c) 0.9052 3 95
2bxj-assembly2.cif.gz_B double mutant of the ribosomal protein s6 0.9025 1 98
1lou-assembly1.cif.gz_A ribosomal protein s6 0.9012 1 98
2j5a-assembly1.cif.gz_A folding of s6 structures with divergent amino-acid composition: pathway flexibility within partly overlapping foldons 0.9003 2 96
ID Description Score Start End Superfamily
2j5aA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.9003 2 96 3.30.70.60
af_Q8I2J0_124_224_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.8902 1 94 3.30.70.60
1vmbA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.8766 2 94 3.30.70.60
af_Q9VZD5_1_134_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.8673 1 101 3.30.70.60
af_I1MGC0_138_240_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.8641 2 101 3.30.70.60
ID Description Score Start End GO Terms
AF-A0A6N6Q4P0-F1-model_v4 Small ribosomal subunit protein bS6 (30S ribosomal protein S6) 0.9666 2 100 GO:0003735
GO:0005840
GO:0006412
GO:0019843
AF-A0A2D7BCE4-F1-model_v4 Small ribosomal subunit protein bS6 (30S ribosomal protein S6) 0.9563 2 94 GO:0003735
GO:0005840
GO:0006412
GO:0019843
AF-A0A353E0T8-F1-model_v4 Small ribosomal subunit protein bS6 (30S ribosomal protein S6) 0.9531 1 94 GO:0003735
GO:0005840
GO:0006412
GO:0019843
AF-A0A554JBH0-F1-model_v4 Small ribosomal subunit protein bS6 0.9513 1 93 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0070181
GO:1990904
AF-A0A7X7ZMY0-F1-model_v4 deleted 0.9481 2 101

Feature Viewer

pLDDT pTM Quality
80.28 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map