F390758
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 292 | 172 | 292 | 102 |
Family's Representative Sequence
| Representative Sequence | 3300005353|Ga0070669_101493561|Ga0070669_1014935611 |
| Length | 109 |
| Sequence | MKRYEGLFILNTAGKEEGIKDAIDKISSEITAAGGKVETVQKMDKKAFARVADKKNSSGFYVNIIFEGNPAALSQLRNRFAMNEEVFRVLFTIAPEPKAAEAQAALSRD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 3 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 39 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 40 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 41 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 42 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 64 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 65 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 90 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 91 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 92 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 93 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 94 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 95 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 96 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 97 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 98 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 99 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 100 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 101 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 102 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 103 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 104 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 105 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 106 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 107 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 108 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 109 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 110 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 111 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 112 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 113 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 114 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 115 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 116 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 117 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 118 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 119 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 120 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 121 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 122 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 123 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 124 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 125 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 126 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 127 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 128 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 129 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 130 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 131 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 132 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 133 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 134 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 135 | 3300041916 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run | Metatranscriptome | Unclassified |
| 136 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 137 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 138 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 139 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 140 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 161 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 165 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.21 |
| Metatranscriptomes | 4.79 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.37 |
| Rhizosphere | 96.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10173085 | 3300003320 | Bacteria | 1423 |
| 2 | Ga0058859_11126225 | 3300004798 | Unclassified | 742 |
| 3 | Ga0058863_10044042 | 3300004799 | Bacteria | 807 |
| 4 | Ga0058863_10045919 | 3300004799 | Unclassified | 2640 |
| 5 | Ga0058863_11807766 | 3300004799 | Unclassified | 638 |
| 6 | Ga0058861_12028210 | 3300004800 | Unclassified | 635 |
| 7 | Ga0058862_12779272 | 3300004803 | Bacteria | 936 |
| 8 | Ga0065707_10973977 | 3300005295 | Unclassified | 546 |
| 9 | Ga0070658_10020046 | 3300005327 | Bacteria | 5356 |
| 10 | Ga0070690_100039609 | 3300005330 | Unclassified | 2977 |
| 11 | Ga0070680_100469819 | 3300005336 | Bacteria | 1075 |
| 12 | Ga0068868_101191901 | 3300005338 | Unclassified | 704 |
| 13 | Ga0070689_100024370 | 3300005340 | Bacteria | 4538 |
| 14 | Ga0070689_100052080 | 3300005340 | Unclassified | 3165 |
| 15 | Ga0070691_10042751 | 3300005341 | Unclassified | 2145 |
| 16 | Ga0070691_10315005 | 3300005341 | Bacteria | 859 |
| 17 | Ga0070669_101493561 | 3300005353 | Bacteria | 587 |
| 18 | Ga0070675_101905450 | 3300005354 | Bacteria | 548 |
| 19 | Ga0070671_101155236 | 3300005355 | Unclassified | 681 |
| 20 | Ga0070688_100746702 | 3300005365 | Bacteria | 761 |
| 21 | Ga0070714_101486966 | 3300005435 | Bacteria | 662 |
| 22 | Ga0070711_100346682 | 3300005439 | Bacteria | 1193 |
| 23 | Ga0070711_101749878 | 3300005439 | Bacteria | 545 |
| 24 | Ga0070711_101927675 | 3300005439 | Unclassified | 519 |
| 25 | Ga0070705_100015074 | 3300005440 | Bacteria | 3989 |
| 26 | Ga0070694_100025824 | 3300005444 | Unclassified | 3803 |
| 27 | Ga0070681_10026491 | 3300005458 | Bacteria | 5826 |
| 28 | Ga0070681_10056358 | 3300005458 | Bacteria | 3911 |
| 29 | Ga0070681_10440888 | 3300005458 | Bacteria | 1214 |
| 30 | Ga0070681_10515698 | 3300005458 | Unclassified | 1109 |
| 31 | Ga0070685_11494247 | 3300005466 | Unclassified | 520 |
| 32 | Ga0070707_100477510 | 3300005468 | Unclassified | 1208 |
| 33 | Ga0070679_100040024 | 3300005530 | Bacteria | 4662 |
| 34 | Ga0070679_100862398 | 3300005530 | Unclassified | 849 |
| 35 | Ga0070697_100783459 | 3300005536 | Bacteria | 843 |
| 36 | Ga0068853_100470455 | 3300005539 | Bacteria | 1184 |
| 37 | Ga0070686_100007698 | 3300005544 | Bacteria | 6021 |
| 38 | Ga0070686_100439495 | 3300005544 | Unclassified | 1000 |
| 39 | Ga0070695_101684578 | 3300005545 | Unclassified | 530 |
| 40 | Ga0070704_100157940 | 3300005549 | Bacteria | 1790 |
| 41 | Ga0068855_100015729 | 3300005563 | Bacteria | 9102 |
| 42 | Ga0068855_100082910 | 3300005563 | Unclassified | 3715 |
| 43 | Ga0068857_100321447 | 3300005577 | Bacteria | 1429 |
| 44 | Ga0068857_101732314 | 3300005577 | Unclassified | 611 |
| 45 | Ga0068856_100409082 | 3300005614 | Bacteria | 1376 |
| 46 | Ga0068856_100999435 | 3300005614 | Bacteria | 855 |
| 47 | Ga0068856_101678731 | 3300005614 | Bacteria | 648 |
| 48 | Ga0070702_100765048 | 3300005615 | Unclassified | 743 |
| 49 | Ga0068859_100483991 | 3300005617 | Bacteria | 1333 |
| 50 | Ga0068859_100497502 | 3300005617 | Unclassified | 1314 |
| 51 | Ga0068859_100977477 | 3300005617 | Bacteria | 929 |
| 52 | Ga0068864_101793394 | 3300005618 | Unclassified | 619 |
| 53 | Ga0068858_100315909 | 3300005842 | Unclassified | 1492 |
| 54 | Ga0097621_100738854 | 3300006237 | Unclassified | 908 |
| 55 | Ga0097621_100977604 | 3300006237 | Bacteria | 791 |
| 56 | Ga0068871_100161145 | 3300006358 | Bacteria | 1919 |
| 57 | Ga0075433_10587293 | 3300006852 | Bacteria | 978 |
| 58 | Ga0075429_100151132 | 3300006880 | Unclassified | 2033 |
| 59 | Ga0075436_101134056 | 3300006914 | Bacteria | 589 |
| 60 | Ga0097620_100483981 | 3300006931 | Bacteria | 1333 |
| 61 | Ga0097620_100497520 | 3300006931 | Unclassified | 1314 |
| 62 | Ga0097620_100977409 | 3300006931 | Bacteria | 929 |
| 63 | Ga0097620_101954671 | 3300006931 | Bacteria | 648 |
| 64 | Ga0099795_10614764 | 3300007788 | Bacteria | 518 |
| 65 | Ga0105240_10385441 | 3300009093 | Bacteria | 1582 |
| 66 | Ga0111539_10508969 | 3300009094 | Unclassified | 1402 |
| 67 | Ga0105243_11940658 | 3300009148 | Unclassified | 622 |
| 68 | Ga0105241_11619677 | 3300009174 | Unclassified | 627 |
| 69 | Ga0105242_10197239 | 3300009176 | Bacteria | 1786 |
| 70 | Ga0105242_10318056 | 3300009176 | Bacteria | 1427 |
| 71 | Ga0105242_11454630 | 3300009176 | Bacteria | 714 |
| 72 | Ga0105237_11277869 | 3300009545 | Bacteria | 740 |
| 73 | Ga0105238_10164251 | 3300009551 | Bacteria | 2196 |
| 74 | Ga0105238_10174750 | 3300009551 | Unclassified | 2124 |
| 75 | Ga0105249_10509976 | 3300009553 | Bacteria | 1249 |
| 76 | Ga0105239_12231933 | 3300010375 | Unclassified | 637 |
| 77 | Ga0157370_10185605 | 3300013104 | Unclassified | 1931 |
| 78 | Ga0157369_10417959 | 3300013105 | Bacteria | 1390 |
| 79 | Ga0157374_10796373 | 3300013296 | Bacteria | 961 |
| 80 | Ga0157374_11809627 | 3300013296 | Viruses | 636 |
| 81 | Ga0157378_12164002 | 3300013297 | Bacteria | 607 |
| 82 | Ga0163162_12048234 | 3300013306 | Viruses | 656 |
| 83 | Ga0157375_11335099 | 3300013308 | Bacteria | 844 |
| 84 | Ga0163163_10084382 | 3300014325 | Unclassified | 3182 |
| 85 | Ga0157380_11529244 | 3300014326 | Unclassified | 721 |
| 86 | Ga0157376_10143905 | 3300014969 | Bacteria | 2142 |
| 87 | Ga0157376_11279952 | 3300014969 | Unclassified | 763 |
| 88 | Ga0157376_11741708 | 3300014969 | Unclassified | 659 |
| 89 | Ga0206356_10688964 | 3300020070 | Bacteria | 1307 |
| 90 | Ga0206352_10379576 | 3300020078 | Bacteria | 777 |
| 91 | Ga0206354_10239141 | 3300020081 | Bacteria | 594 |
| 92 | Ga0207705_10215891 | 3300025909 | Bacteria | 1456 |
| 93 | Ga0207707_10094357 | 3300025912 | Bacteria | 2614 |
| 94 | Ga0207707_10141411 | 3300025912 | Bacteria | 2104 |
| 95 | Ga0207707_10489327 | 3300025912 | Bacteria | 1050 |
| 96 | Ga0207707_10576967 | 3300025912 | Unclassified | 954 |
| 97 | Ga0207707_11389267 | 3300025912 | Bacteria | 561 |
| 98 | Ga0207663_10520811 | 3300025916 | Unclassified | 926 |
| 99 | Ga0207652_10642683 | 3300025921 | Unclassified | 949 |
| 100 | Ga0207652_11184638 | 3300025921 | Unclassified | 665 |
| 101 | Ga0207646_11159781 | 3300025922 | Unclassified | 678 |
| 102 | Ga0207681_11819580 | 3300025923 | Bacteria | 508 |
| 103 | Ga0207694_11426788 | 3300025924 | Unclassified | 585 |
| 104 | Ga0207659_11580995 | 3300025926 | Bacteria | 560 |
| 105 | Ga0207659_11712075 | 3300025926 | Viruses | 535 |
| 106 | Ga0207700_11289986 | 3300025928 | Bacteria | 651 |
| 107 | Ga0207686_10375271 | 3300025934 | Unclassified | 1077 |
| 108 | Ga0207670_10057075 | 3300025936 | Bacteria | 2647 |
| 109 | Ga0207665_11158659 | 3300025939 | Unclassified | 617 |
| 110 | Ga0207691_10335906 | 3300025940 | Viruses | 1294 |
| 111 | Ga0207711_11309274 | 3300025941 | Bacteria | 667 |
| 112 | Ga0207667_10100733 | 3300025949 | Unclassified | 2980 |
| 113 | Ga0207667_11342250 | 3300025949 | Bacteria | 690 |
| 114 | Ga0207667_11865947 | 3300025949 | Unclassified | 564 |
| 115 | Ga0207651_11755497 | 3300025960 | Bacteria | 559 |
| 116 | Ga0207712_10079046 | 3300025961 | Bacteria | 2388 |
| 117 | Ga0207677_10575822 | 3300026023 | Viruses | 985 |
| 118 | Ga0207703_10323617 | 3300026035 | Unclassified | 1412 |
| 119 | Ga0207708_10730014 | 3300026075 | Bacteria | 849 |
| 120 | Ga0207702_12440684 | 3300026078 | Unclassified | 510 |
| 121 | Ga0207674_10175563 | 3300026116 | Bacteria | 2095 |
| 122 | Ga0207675_102739781 | 3300026118 | Bacteria | 501 |
| 123 | Ga0207698_11136554 | 3300026142 | Bacteria | 794 |
| 124 | Ga0265337_1000409 | 3300028556 | Bacteria | 22991 |
| 125 | Ga0265337_1002626 | 3300028556 | Bacteria | 8106 |
| 126 | Ga0265337_1003671 | 3300028556 | Bacteria | 6573 |
| 127 | Ga0265337_1016352 | 3300028556 | Bacteria | 2400 |
| 128 | Ga0265326_10020545 | 3300028558 | Unclassified | 1893 |
| 129 | Ga0265326_10240613 | 3300028558 | Bacteria | 522 |
| 130 | Ga0265319_1000372 | 3300028563 | Bacteria | 32397 |
| 131 | Ga0265319_1011235 | 3300028563 | Unclassified | 3680 |
| 132 | Ga0265319_1132757 | 3300028563 | Unclassified | 774 |
| 133 | Ga0265319_1274842 | 3300028563 | Bacteria | 513 |
| 134 | Ga0265334_10006275 | 3300028573 | Bacteria | 5136 |
| 135 | Ga0265334_10021119 | 3300028573 | Unclassified | 2660 |
| 136 | Ga0265334_10102089 | 3300028573 | Unclassified | 1037 |
| 137 | Ga0265334_10195476 | 3300028573 | Unclassified | 704 |
| 138 | Ga0265318_10049124 | 3300028577 | Unclassified | 1587 |
| 139 | Ga0265318_10136205 | 3300028577 | Unclassified | 902 |
| 140 | Ga0265323_10010663 | 3300028653 | Bacteria | 3719 |
| 141 | Ga0265323_10149753 | 3300028653 | Unclassified | 748 |
| 142 | Ga0265322_10149099 | 3300028654 | Bacteria | 669 |
| 143 | Ga0265336_10000836 | 3300028666 | Bacteria | 16045 |
| 144 | Ga0265336_10105801 | 3300028666 | Bacteria | 838 |
| 145 | Ga0265338_10000452 | 3300028800 | Bacteria | 73214 |
| 146 | Ga0265338_10000836 | 3300028800 | Bacteria | 51897 |
| 147 | Ga0265338_10001224 | 3300028800 | Bacteria | 42394 |
| 148 | Ga0265338_10001643 | 3300028800 | Bacteria | 35770 |
| 149 | Ga0265338_10024830 | 3300028800 | Bacteria | 6108 |
| 150 | Ga0265338_10036364 | 3300028800 | Bacteria | 4714 |
| 151 | Ga0265338_10076063 | 3300028800 | Bacteria | 2845 |
| 152 | Ga0265338_10227084 | 3300028800 | Bacteria | 1391 |
| 153 | Ga0265338_10248793 | 3300028800 | Bacteria | 1312 |
| 154 | Ga0265338_10258105 | 3300028800 | Bacteria | 1282 |
| 155 | Ga0265338_10575063 | 3300028800 | Bacteria | 787 |
| 156 | Ga0265338_10909289 | 3300028800 | Bacteria | 599 |
| 157 | Ga0265324_10005973 | 3300029957 | Bacteria | 5154 |
| 158 | Ga0265324_10014414 | 3300029957 | Unclassified | 2926 |
| 159 | Ga0265324_10036423 | 3300029957 | Bacteria | 1711 |
| 160 | Ga0265324_10164447 | 3300029957 | Bacteria | 754 |
| 161 | Ga0265762_1116842 | 3300030760 | Unclassified | 606 |
| 162 | Ga0265330_10110248 | 3300031235 | Bacteria | 1176 |
| 163 | Ga0265332_10356649 | 3300031238 | Unclassified | 603 |
| 164 | Ga0265332_10474955 | 3300031238 | Unclassified | 517 |
| 165 | Ga0265328_10089661 | 3300031239 | Unclassified | 1136 |
| 166 | Ga0265328_10091992 | 3300031239 | Unclassified | 1121 |
| 167 | Ga0265328_10290928 | 3300031239 | Unclassified | 630 |
| 168 | Ga0265320_10000666 | 3300031240 | Bacteria | 26164 |
| 169 | Ga0265320_10002788 | 3300031240 | Bacteria | 12039 |
| 170 | Ga0265320_10008172 | 3300031240 | Bacteria | 6425 |
| 171 | Ga0265320_10016284 | 3300031240 | Bacteria | 4171 |
| 172 | Ga0265320_10109456 | 3300031240 | Bacteria | 1266 |
| 173 | Ga0265320_10135385 | 3300031240 | Viruses | 1118 |
| 174 | Ga0265320_10546508 | 3300031240 | Bacteria | 512 |
| 175 | Ga0265325_10054963 | 3300031241 | Bacteria | 2037 |
| 176 | Ga0265325_10127833 | 3300031241 | Bacteria | 1219 |
| 177 | Ga0265329_10001129 | 3300031242 | Bacteria | 13154 |
| 178 | Ga0265340_10188976 | 3300031247 | Viruses | 929 |
| 179 | Ga0265340_10372227 | 3300031247 | Unclassified | 631 |
| 180 | Ga0265340_10430578 | 3300031247 | Bacteria | 582 |
| 181 | Ga0265339_10020591 | 3300031249 | Bacteria | 3850 |
| 182 | Ga0265339_10084756 | 3300031249 | Bacteria | 1670 |
| 183 | Ga0265316_10004590 | 3300031344 | Bacteria | 13704 |
| 184 | Ga0265316_10011373 | 3300031344 | Bacteria | 8033 |
| 185 | Ga0265316_10057443 | 3300031344 | Bacteria | 3034 |
| 186 | Ga0265316_10174346 | 3300031344 | Unclassified | 1603 |
| 187 | Ga0265316_10404204 | 3300031344 | Unclassified | 983 |
| 188 | Ga0265316_10742811 | 3300031344 | Bacteria | 690 |
| 189 | Ga0307509_10139184 | 3300031507 | Bacteria | 2367 |
| 190 | Ga0265313_10003311 | 3300031595 | Bacteria | 13186 |
| 191 | Ga0265313_10003545 | 3300031595 | Bacteria | 12577 |
| 192 | Ga0265314_10000034 | 3300031711 | Bacteria | 241556 |
| 193 | Ga0265314_10011573 | 3300031711 | Bacteria | 7269 |
| 194 | Ga0265314_10218982 | 3300031711 | Bacteria | 1112 |
| 195 | Ga0265342_10006839 | 3300031712 | Bacteria | 8427 |
| 196 | Ga0265342_10323528 | 3300031712 | Unclassified | 808 |
| 197 | Ga0265342_10459915 | 3300031712 | Bacteria | 652 |
| 198 | Ga0265342_10462821 | 3300031712 | Unclassified | 650 |
| 199 | Ga0265342_10484678 | 3300031712 | Unclassified | 632 |
| 200 | Ga0373926_0031808 | 3300035083 | Bacteria | 1861 |
| 201 | Ga0373944_0001683 | 3300035089 | Bacteria | 5599 |
| 202 | Ga0373923_0631193 | 3300035111 | Unclassified | 529 |
| 203 | Ga0373923_0683589 | 3300035111 | Unclassified | 509 |
| 204 | Ga0373956_0171121 | 3300035119 | Bacteria | 1025 |
| 205 | Ga0373960_0255969 | 3300035121 | Unclassified | 638 |
| 206 | Ga0373946_0210844 | 3300035171 | Unclassified | 934 |
| 207 | Ga0373946_0212790 | 3300035171 | Viruses | 930 |
| 208 | Ga0373962_0304350 | 3300035242 | Unclassified | 566 |
| 209 | Ga0373924_0073322 | 3300035410 | Bacteria | 1447 |
| 210 | Ga0373935_0030795 | 3300035692 | Bacteria | 3326 |
| 211 | Ga0373935_0310035 | 3300035692 | Bacteria | 1117 |
| 212 | Ga0373927_0029709 | 3300035695 | Unclassified | 3564 |
| 213 | Ga0373933_0256815 | 3300035724 | Bacteria | 1126 |
| 214 | Ga0373933_0266668 | 3300035724 | Unclassified | 1105 |
| 215 | Ga0373947_0034434 | 3300035725 | Bacteria | 2995 |
| 216 | Ga0373937_0103275 | 3300036401 | Unclassified | 2647 |
| 217 | Ga0373925_0039202 | 3300037068 | Unclassified | 3504 |
| 218 | Ga0395900_0031514 | 3300037418 | Bacteria | 5449 |
| 219 | Ga0395905_0095298 | 3300037471 | Bacteria | 2793 |
| 220 | Ga0395901_0448979 | 3300038443 | Bacteria | 1319 |
| 221 | Ga0436361_0580478 | 3300039447 | Unclassified | 917 |
| 222 | Ga0451793_0584627 | 3300041452 | Unclassified | 567 |
| 223 | Ga0451805_005790 | 3300041461 | Viruses | 673 |
| 224 | Ga0451804_0359220 | 3300041463 | Bacteria | 888 |
| 225 | Ga0451849_1109875 | 3300041505 | Bacteria | 626 |
| 226 | Ga0452271_61173 | 3300041916 | Unclassified | 538 |
| 227 | Ga0451577_0035196 | 3300042876 | Bacteria | 4511 |
| 228 | Ga0451577_0069164 | 3300042876 | Bacteria | 3148 |
| 229 | Ga0451577_0071070 | 3300042876 | Bacteria | 3103 |
| 230 | Ga0451577_0090099 | 3300042876 | Bacteria | 2737 |
| 231 | Ga0451577_0516281 | 3300042876 | Bacteria | 1085 |
| 232 | Ga0451577_0578269 | 3300042876 | Unclassified | 1020 |
| 233 | Ga0451577_0775649 | 3300042876 | Unclassified | 867 |
| 234 | Ga0453683_0208690 | 3300044673 | Bacteria | 1241 |
| 235 | Ga0453684_0002118 | 3300044712 | Bacteria | 50022 |
| 236 | Ga0453684_0013213 | 3300044712 | Bacteria | 13461 |
| 237 | Ga0453684_0013422 | 3300044712 | Bacteria | 13304 |
| 238 | Ga0453684_0460919 | 3300044712 | Bacteria | 1413 |
| 239 | Ga0453684_1128191 | 3300044712 | Unclassified | 827 |
| 240 | Ga0453684_1178551 | 3300044712 | Unclassified | 805 |
| 241 | Ga0453684_1529214 | 3300044712 | Unclassified | 687 |
| 242 | Ga0451576_0056737 | 3300045051 | Bacteria | 4095 |
| 243 | Ga0451576_0103483 | 3300045051 | Bacteria | 2962 |
| 244 | Ga0451576_0173359 | 3300045051 | Bacteria | 2252 |
| 245 | Ga0451576_0363410 | 3300045051 | Bacteria | 1516 |
| 246 | Ga0451576_0442110 | 3300045051 | Unclassified | 1365 |
| 247 | Ga0451576_0577870 | 3300045051 | Bacteria | 1181 |
| 248 | Ga0451576_0668199 | 3300045051 | Unclassified | 1092 |
| 249 | Ga0451576_0881510 | 3300045051 | Bacteria | 939 |
| 250 | Ga0451576_0905026 | 3300045051 | Viruses | 926 |
| 251 | Ga0451576_1014541 | 3300045051 | Unclassified | 870 |
| 252 | Ga0451576_1309401 | 3300045051 | Unclassified | 755 |
| 253 | Ga0495629_0254806 | 3300046459 | Bacteria | 1207 |
| 254 | Ga0495651_0958571 | 3300046462 | Unclassified | 521 |
| 255 | Ga0495608_0833980 | 3300046511 | Unclassified | 543 |
| 256 | Ga0495630_0176547 | 3300046517 | Bacteria | 1628 |
| 257 | Ga0495630_0271230 | 3300046517 | Unclassified | 1296 |
| 258 | Ga0495630_0319280 | 3300046517 | Unclassified | 1187 |
| 259 | Ga0495666_0240420 | 3300046526 | Unclassified | 826 |
| 260 | Ga0495666_0508438 | 3300046526 | Bacteria | 538 |
| 261 | Ga0495652_1049711 | 3300046529 | Unclassified | 531 |
| 262 | Ga0495640_0297328 | 3300046533 | Unclassified | 1003 |
| 263 | Ga0495586_0078929 | 3300046535 | Unclassified | 1806 |
| 264 | Ga0495586_0091207 | 3300046535 | Bacteria | 1684 |
| 265 | Ga0495586_0171007 | 3300046535 | Bacteria | 1228 |
| 266 | Ga0495587_0365804 | 3300046536 | Unclassified | 803 |
| 267 | Ga0495634_0630151 | 3300046642 | Bacteria | 620 |
| 268 | Ga0495625_0869121 | 3300046660 | Unclassified | 519 |
| 269 | Ga0495635_0903114 | 3300046663 | Bacteria | 565 |
| 270 | Ga0495658_0006101 | 3300046683 | Bacteria | 5918 |
| 271 | Ga0495613_0002193 | 3300046689 | Bacteria | 14793 |
| 272 | Ga0495604_0815065 | 3300047317 | Unclassified | 587 |
| 273 | Ga0495676_0416002 | 3300047321 | Unclassified | 890 |
| 274 | Ga0495680_0077723 | 3300047322 | Bacteria | 2513 |
| 275 | Ga0495680_0766018 | 3300047322 | Bacteria | 633 |
| 276 | Ga0495683_0145767 | 3300047323 | Bacteria | 1106 |
| 277 | Ga0495675_0192660 | 3300047444 | Bacteria | 1244 |
| 278 | Ga0495675_0441939 | 3300047444 | Unclassified | 753 |
| 279 | Ga0495602_0978859 | 3300048088 | Bacteria | 559 |
| 280 | Ga0496113_1132987 | 3300048916 | Viruses | 613 |
| 281 | Ga0495682_0037455 | 3300049460 | Bacteria | 1785 |
| 282 | Ga0501033_0048200 | 3300049570 | Unclassified | 3165 |
| 283 | Ga0501034_0173431 | 3300049571 | Unclassified | 2123 |
| 284 | Ga0501202_202167 | 3300049652 | Unclassified | 544 |
| 285 | nmdc:mga09592_305485_c1 | 3300050508 | Bacteria | 1379 |
| 286 | nmdc:mga06r32_1807841_c1 | 3300050510 | Unclassified | 547 |
| 287 | nmdc:mga08y16_74147_c1 | 3300050511 | Bacteria | 3545 |
| 288 | nmdc:mga0n895_1538040_c1 | 3300050512 | Unclassified | 631 |
| 289 | nmdc:mga0rr50_892162_c1 | 3300050513 | Unclassified | 758 |
| 290 | nmdc:mga08x19_285428_c1 | 3300050514 | Bacteria | 1144 |
| 291 | Ga0587077_160324 | 3300059493 | Unclassified | 595 |
| 292 | Ga0587107_098725 | 3300059652 | Unclassified | 575 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026023 | Ga0207677_10575822 | Ga0207677_105758222 | 92 |
| 2 | 3300042876 | Ga0451577_0090099 | Ga0451577_0090099_310_588 | 92 |
| 3 | 3300044712 | Ga0453684_1529214 | Ga0453684_1529214_120_398 | 92 |
| 4 | 3300046517 | Ga0495630_0271230 | Ga0495630_0271230_1002_1280 | 92 |
| 5 | 3300046660 | Ga0495625_0869121 | Ga0495625_0869121_10_288 | 92 |
| 6 | 3300048916 | Ga0496113_1132987 | Ga0496113_1132987_291_569 | 92 |
| 7 | 3300049570 | Ga0501033_0048200 | Ga0501033_0048200_1656_1934 | 92 |
| 8 | 3300009551 | Ga0105238_10164251 | Ga0105238_101642512 | 93 |
| 9 | 3300039447 | Ga0436361_0580478 | Ga0436361_0580478_280_561 | 93 |
| 10 | 3300042876 | Ga0451577_0516281 | Ga0451577_0516281_91_372 | 93 |
| 11 | 3300045051 | Ga0451576_0173359 | Ga0451576_0173359_939_1220 | 93 |
| 12 | 3300045051 | Ga0451576_0577870 | Ga0451576_0577870_251_532 | 93 |
| 13 | 3300046511 | Ga0495608_0833980 | Ga0495608_0833980_99_380 | 93 |
| 14 | 3300047444 | Ga0495675_0441939 | Ga0495675_0441939_409_690 | 93 |
| 15 | 3300050508 | nmdc:mga09592_305485_c1 | nmdc:mga09592_305485_c1_645_977 | 95 |
| 16 | 3300009094 | Ga0111539_10508969 | Ga0111539_105089692 | 96 |
| 17 | 3300013296 | Ga0157374_10796373 | Ga0157374_107963732 | 96 |
| 18 | 3300045051 | Ga0451576_0103483 | Ga0451576_0103483_563_859 | 96 |
| 19 | 3300046529 | Ga0495652_1049711 | Ga0495652_1049711_133_429 | 96 |
| 20 | 3300050511 | nmdc:mga08y16_74147_c1 | nmdc:mga08y16_74147_c1_628_954 | 96 |
| 21 | 3300005340 | Ga0070689_100024370 | Ga0070689_1000243703 | 97 |
| 22 | 3300005354 | Ga0070675_101905450 | Ga0070675_1019054501 | 97 |
| 23 | 3300005577 | Ga0068857_100321447 | Ga0068857_1003214473 | 97 |
| 24 | 3300006880 | Ga0075429_100151132 | Ga0075429_1001511323 | 97 |
| 25 | 3300025924 | Ga0207694_11426788 | Ga0207694_114267881 | 97 |
| 26 | 3300025936 | Ga0207670_10057075 | Ga0207670_100570753 | 97 |
| 27 | 3300026116 | Ga0207674_10175563 | Ga0207674_101755633 | 97 |
| 28 | 3300014326 | Ga0157380_11529244 | Ga0157380_115292442 | 99 |
| 29 | 3300025926 | Ga0207659_11580995 | Ga0207659_115809952 | 99 |
| 30 | 3300004799 | Ga0058863_10044042 | Ga0058863_100440422 | 101 |
| 31 | 3300004799 | Ga0058863_10045919 | Ga0058863_100459193 | 101 |
| 32 | 3300004799 | Ga0058863_11807766 | Ga0058863_118077662 | 101 |
| 33 | 3300004800 | Ga0058861_12028210 | Ga0058861_120282101 | 101 |
| 34 | 3300004803 | Ga0058862_12779272 | Ga0058862_127792722 | 101 |
| 35 | 3300005327 | Ga0070658_10020046 | Ga0070658_100200465 | 101 |
| 36 | 3300005330 | Ga0070690_100039609 | Ga0070690_1000396093 | 101 |
| 37 | 3300005336 | Ga0070680_100469819 | Ga0070680_1004698192 | 101 |
| 38 | 3300005338 | Ga0068868_101191901 | Ga0068868_1011919011 | 101 |
| 39 | 3300005341 | Ga0070691_10042751 | Ga0070691_100427513 | 101 |
| 40 | 3300005341 | Ga0070691_10315005 | Ga0070691_103150051 | 101 |
| 41 | 3300005435 | Ga0070714_101486966 | Ga0070714_1014869662 | 101 |
| 42 | 3300005439 | Ga0070711_101749878 | Ga0070711_1017498781 | 101 |
| 43 | 3300005440 | Ga0070705_100015074 | Ga0070705_1000150745 | 101 |
| 44 | 3300005444 | Ga0070694_100025824 | Ga0070694_1000258244 | 101 |
| 45 | 3300005458 | Ga0070681_10026491 | Ga0070681_100264913 | 101 |
| 46 | 3300005458 | Ga0070681_10056358 | Ga0070681_100563583 | 101 |
| 47 | 3300005458 | Ga0070681_10515698 | Ga0070681_105156982 | 101 |
| 48 | 3300005466 | Ga0070685_11494247 | Ga0070685_114942471 | 101 |
| 49 | 3300005468 | Ga0070707_100477510 | Ga0070707_1004775102 | 101 |
| 50 | 3300005530 | Ga0070679_100040024 | Ga0070679_1000400242 | 101 |
| 51 | 3300005530 | Ga0070679_100862398 | Ga0070679_1008623981 | 101 |
| 52 | 3300005539 | Ga0068853_100470455 | Ga0068853_1004704552 | 101 |
| 53 | 3300005544 | Ga0070686_100007698 | Ga0070686_1000076985 | 101 |
| 54 | 3300005549 | Ga0070704_100157940 | Ga0070704_1001579401 | 101 |
| 55 | 3300005563 | Ga0068855_100015729 | Ga0068855_1000157293 | 101 |
| 56 | 3300005563 | Ga0068855_100082910 | Ga0068855_1000829102 | 101 |
| 57 | 3300005577 | Ga0068857_101732314 | Ga0068857_1017323142 | 101 |
| 58 | 3300005614 | Ga0068856_100409082 | Ga0068856_1004090823 | 101 |
| 59 | 3300005614 | Ga0068856_100999435 | Ga0068856_1009994352 | 101 |
| 60 | 3300005614 | Ga0068856_101678731 | Ga0068856_1016787312 | 101 |
| 61 | 3300005615 | Ga0070702_100765048 | Ga0070702_1007650481 | 101 |
| 62 | 3300005617 | Ga0068859_100483991 | Ga0068859_1004839912 | 101 |
| 63 | 3300006237 | Ga0097621_100977604 | Ga0097621_1009776041 | 101 |
| 64 | 3300006931 | Ga0097620_100483981 | Ga0097620_1004839812 | 101 |
| 65 | 3300009093 | Ga0105240_10385441 | Ga0105240_103854412 | 101 |
| 66 | 3300009148 | Ga0105243_11940658 | Ga0105243_119406581 | 101 |
| 67 | 3300009174 | Ga0105241_11619677 | Ga0105241_116196772 | 101 |
| 68 | 3300009176 | Ga0105242_11454630 | Ga0105242_114546302 | 101 |
| 69 | 3300009545 | Ga0105237_11277869 | Ga0105237_112778692 | 101 |
| 70 | 3300009551 | Ga0105238_10174750 | Ga0105238_101747504 | 101 |
| 71 | 3300009553 | Ga0105249_10509976 | Ga0105249_105099762 | 101 |
| 72 | 3300013104 | Ga0157370_10185605 | Ga0157370_101856052 | 101 |
| 73 | 3300013105 | Ga0157369_10417959 | Ga0157369_104179592 | 101 |
| 74 | 3300013297 | Ga0157378_12164002 | Ga0157378_121640022 | 101 |
| 75 | 3300014969 | Ga0157376_11279952 | Ga0157376_112799522 | 101 |
| 76 | 3300014969 | Ga0157376_11741708 | Ga0157376_117417082 | 101 |
| 77 | 3300020070 | Ga0206356_10688964 | Ga0206356_106889642 | 101 |
| 78 | 3300020078 | Ga0206352_10379576 | Ga0206352_103795762 | 101 |
| 79 | 3300020081 | Ga0206354_10239141 | Ga0206354_102391412 | 101 |
| 80 | 3300025909 | Ga0207705_10215891 | Ga0207705_102158913 | 101 |
| 81 | 3300025912 | Ga0207707_10094357 | Ga0207707_100943574 | 101 |
| 82 | 3300025912 | Ga0207707_10141411 | Ga0207707_101414113 | 101 |
| 83 | 3300025912 | Ga0207707_10576967 | Ga0207707_105769672 | 101 |
| 84 | 3300025912 | Ga0207707_11389267 | Ga0207707_113892671 | 101 |
| 85 | 3300025921 | Ga0207652_10642683 | Ga0207652_106426831 | 101 |
| 86 | 3300025921 | Ga0207652_11184638 | Ga0207652_111846381 | 101 |
| 87 | 3300025922 | Ga0207646_11159781 | Ga0207646_111597811 | 101 |
| 88 | 3300025928 | Ga0207700_11289986 | Ga0207700_112899861 | 101 |
| 89 | 3300025949 | Ga0207667_10100733 | Ga0207667_101007333 | 101 |
| 90 | 3300025949 | Ga0207667_11342250 | Ga0207667_113422502 | 101 |
| 91 | 3300025949 | Ga0207667_11865947 | Ga0207667_118659471 | 101 |
| 92 | 3300025961 | Ga0207712_10079046 | Ga0207712_100790463 | 101 |
| 93 | 3300026078 | Ga0207702_12440684 | Ga0207702_124406841 | 101 |
| 94 | 3300026118 | Ga0207675_102739781 | Ga0207675_1027397812 | 101 |
| 95 | 3300026142 | Ga0207698_11136554 | Ga0207698_111365541 | 101 |
| 96 | 3300028556 | Ga0265337_1000409 | Ga0265337_10004098 | 101 |
| 97 | 3300028556 | Ga0265337_1002626 | Ga0265337_10026264 | 101 |
| 98 | 3300028556 | Ga0265337_1016352 | Ga0265337_10163522 | 101 |
| 99 | 3300028558 | Ga0265326_10020545 | Ga0265326_100205453 | 101 |
| 100 | 3300028563 | Ga0265319_1000372 | Ga0265319_100037214 | 101 |
| 101 | 3300028563 | Ga0265319_1274842 | Ga0265319_12748422 | 101 |
| 102 | 3300028573 | Ga0265334_10006275 | Ga0265334_100062753 | 101 |
| 103 | 3300028573 | Ga0265334_10102089 | Ga0265334_101020892 | 101 |
| 104 | 3300028577 | Ga0265318_10136205 | Ga0265318_101362052 | 101 |
| 105 | 3300028653 | Ga0265323_10010663 | Ga0265323_100106633 | 101 |
| 106 | 3300028666 | Ga0265336_10000836 | Ga0265336_100008365 | 101 |
| 107 | 3300028800 | Ga0265338_10000836 | Ga0265338_1000083631 | 101 |
| 108 | 3300028800 | Ga0265338_10001224 | Ga0265338_100012246 | 101 |
| 109 | 3300028800 | Ga0265338_10001643 | Ga0265338_1000164318 | 101 |
| 110 | 3300028800 | Ga0265338_10024830 | Ga0265338_100248305 | 101 |
| 111 | 3300028800 | Ga0265338_10248793 | Ga0265338_102487933 | 101 |
| 112 | 3300028800 | Ga0265338_10258105 | Ga0265338_102581052 | 101 |
| 113 | 3300028800 | Ga0265338_10575063 | Ga0265338_105750632 | 101 |
| 114 | 3300029957 | Ga0265324_10005973 | Ga0265324_100059732 | 101 |
| 115 | 3300029957 | Ga0265324_10036423 | Ga0265324_100364233 | 101 |
| 116 | 3300029957 | Ga0265324_10164447 | Ga0265324_101644472 | 101 |
| 117 | 3300031238 | Ga0265332_10474955 | Ga0265332_104749551 | 101 |
| 118 | 3300031239 | Ga0265328_10089661 | Ga0265328_100896612 | 101 |
| 119 | 3300031240 | Ga0265320_10000666 | Ga0265320_1000066616 | 101 |
| 120 | 3300031240 | Ga0265320_10002788 | Ga0265320_100027884 | 101 |
| 121 | 3300031240 | Ga0265320_10008172 | Ga0265320_100081725 | 101 |
| 122 | 3300031240 | Ga0265320_10016284 | Ga0265320_100162841 | 101 |
| 123 | 3300031240 | Ga0265320_10135385 | Ga0265320_101353852 | 101 |
| 124 | 3300031247 | Ga0265340_10188976 | Ga0265340_101889762 | 101 |
| 125 | 3300031247 | Ga0265340_10430578 | Ga0265340_104305782 | 101 |
| 126 | 3300031249 | Ga0265339_10084756 | Ga0265339_100847563 | 101 |
| 127 | 3300031344 | Ga0265316_10004590 | Ga0265316_1000459012 | 101 |
| 128 | 3300031344 | Ga0265316_10057443 | Ga0265316_100574432 | 101 |
| 129 | 3300031344 | Ga0265316_10404204 | Ga0265316_104042042 | 101 |
| 130 | 3300031344 | Ga0265316_10742811 | Ga0265316_107428112 | 101 |
| 131 | 3300031507 | Ga0307509_10139184 | Ga0307509_101391842 | 101 |
| 132 | 3300031595 | Ga0265313_10003311 | Ga0265313_1000331111 | 101 |
| 133 | 3300031711 | Ga0265314_10218982 | Ga0265314_102189822 | 101 |
| 134 | 3300031712 | Ga0265342_10323528 | Ga0265342_103235282 | 101 |
| 135 | 3300031712 | Ga0265342_10459915 | Ga0265342_104599152 | 101 |
| 136 | 3300031712 | Ga0265342_10462821 | Ga0265342_104628211 | 101 |
| 137 | 3300035089 | Ga0373944_0001683 | Ga0373944_0001683_307_612 | 101 |
| 138 | 3300035111 | Ga0373923_0631193 | Ga0373923_0631193_11_316 | 101 |
| 139 | 3300035119 | Ga0373956_0171121 | Ga0373956_0171121_566_871 | 101 |
| 140 | 3300035121 | Ga0373960_0255969 | Ga0373960_0255969_190_495 | 101 |
| 141 | 3300035171 | Ga0373946_0212790 | Ga0373946_0212790_118_423 | 101 |
| 142 | 3300035692 | Ga0373935_0310035 | Ga0373935_0310035_26_331 | 101 |
| 143 | 3300036401 | Ga0373937_0103275 | Ga0373937_0103275_44_349 | 101 |
| 144 | 3300041452 | Ga0451793_0584627 | Ga0451793_0584627_52_357 | 101 |
| 145 | 3300041461 | Ga0451805_005790 | Ga0451805_005790_153_458 | 101 |
| 146 | 3300041463 | Ga0451804_0359220 | Ga0451804_0359220_309_614 | 101 |
| 147 | 3300041505 | Ga0451849_1109875 | Ga0451849_1109875_273_578 | 101 |
| 148 | 3300041916 | Ga0452271_61173 | Ga0452271_61173_184_489 | 101 |
| 149 | 3300042876 | Ga0451577_0069164 | Ga0451577_0069164_1643_1957 | 101 |
| 150 | 3300042876 | Ga0451577_0071070 | Ga0451577_0071070_1586_1891 | 101 |
| 151 | 3300044712 | Ga0453684_0002118 | Ga0453684_0002118_15991_16305 | 101 |
| 152 | 3300044712 | Ga0453684_0460919 | Ga0453684_0460919_903_1223 | 101 |
| 153 | 3300044712 | Ga0453684_1178551 | Ga0453684_1178551_414_719 | 101 |
| 154 | 3300045051 | Ga0451576_0056737 | Ga0451576_0056737_1763_2077 | 101 |
| 155 | 3300045051 | Ga0451576_0905026 | Ga0451576_0905026_495_800 | 101 |
| 156 | 3300046459 | Ga0495629_0254806 | Ga0495629_0254806_49_354 | 101 |
| 157 | 3300046517 | Ga0495630_0319280 | Ga0495630_0319280_453_758 | 101 |
| 158 | 3300046526 | Ga0495666_0508438 | Ga0495666_0508438_136_444 | 101 |
| 159 | 3300046533 | Ga0495640_0297328 | Ga0495640_0297328_580_885 | 101 |
| 160 | 3300046535 | Ga0495586_0078929 | Ga0495586_0078929_1224_1529 | 101 |
| 161 | 3300046535 | Ga0495586_0091207 | Ga0495586_0091207_91_396 | 101 |
| 162 | 3300046535 | Ga0495586_0171007 | Ga0495586_0171007_788_1096 | 101 |
| 163 | 3300046536 | Ga0495587_0365804 | Ga0495587_0365804_41_346 | 101 |
| 164 | 3300046642 | Ga0495634_0630151 | Ga0495634_0630151_106_411 | 101 |
| 165 | 3300046689 | Ga0495613_0002193 | Ga0495613_0002193_13987_14292 | 101 |
| 166 | 3300047317 | Ga0495604_0815065 | Ga0495604_0815065_208_513 | 101 |
| 167 | 3300047322 | Ga0495680_0077723 | Ga0495680_0077723_667_972 | 101 |
| 168 | 3300047322 | Ga0495680_0766018 | Ga0495680_0766018_51_356 | 101 |
| 169 | 3300047323 | Ga0495683_0145767 | Ga0495683_0145767_369_674 | 101 |
| 170 | 3300049460 | Ga0495682_0037455 | Ga0495682_0037455_397_702 | 101 |
| 171 | 3300049571 | Ga0501034_0173431 | Ga0501034_0173431_707_1012 | 101 |
| 172 | 3300049652 | Ga0501202_202167 | Ga0501202_202167_208_516 | 101 |
| 173 | 3300050512 | nmdc:mga0n895_1538040_c1 | nmdc:mga0n895_1538040_c1_285_590 | 101 |
| 174 | 3300003320 | rootH2_10173085 | rootH2_101730853 | 102 |
| 175 | 3300004798 | Ga0058859_11126225 | Ga0058859_111262251 | 102 |
| 176 | 3300005295 | Ga0065707_10973977 | Ga0065707_109739771 | 102 |
| 177 | 3300005340 | Ga0070689_100052080 | Ga0070689_1000520804 | 102 |
| 178 | 3300005353 | Ga0070669_101493561 | Ga0070669_1014935611 | 102 |
| 179 | 3300005355 | Ga0070671_101155236 | Ga0070671_1011552362 | 102 |
| 180 | 3300005365 | Ga0070688_100746702 | Ga0070688_1007467022 | 102 |
| 181 | 3300005439 | Ga0070711_100346682 | Ga0070711_1003466822 | 102 |
| 182 | 3300005439 | Ga0070711_101927675 | Ga0070711_1019276752 | 102 |
| 183 | 3300005458 | Ga0070681_10440888 | Ga0070681_104408882 | 102 |
| 184 | 3300005536 | Ga0070697_100783459 | Ga0070697_1007834592 | 102 |
| 185 | 3300005544 | Ga0070686_100439495 | Ga0070686_1004394952 | 102 |
| 186 | 3300005545 | Ga0070695_101684578 | Ga0070695_1016845781 | 102 |
| 187 | 3300005617 | Ga0068859_100497502 | Ga0068859_1004975022 | 102 |
| 188 | 3300005617 | Ga0068859_100977477 | Ga0068859_1009774772 | 102 |
| 189 | 3300005618 | Ga0068864_101793394 | Ga0068864_1017933942 | 102 |
| 190 | 3300005842 | Ga0068858_100315909 | Ga0068858_1003159093 | 102 |
| 191 | 3300006237 | Ga0097621_100738854 | Ga0097621_1007388541 | 102 |
| 192 | 3300006358 | Ga0068871_100161145 | Ga0068871_1001611452 | 102 |
| 193 | 3300006852 | Ga0075433_10587293 | Ga0075433_105872932 | 102 |
| 194 | 3300006914 | Ga0075436_101134056 | Ga0075436_1011340562 | 102 |
| 195 | 3300006931 | Ga0097620_100497520 | Ga0097620_1004975202 | 102 |
| 196 | 3300006931 | Ga0097620_100977409 | Ga0097620_1009774092 | 102 |
| 197 | 3300006931 | Ga0097620_101954671 | Ga0097620_1019546712 | 102 |
| 198 | 3300007788 | Ga0099795_10614764 | Ga0099795_106147642 | 102 |
| 199 | 3300009176 | Ga0105242_10197239 | Ga0105242_101972393 | 102 |
| 200 | 3300009176 | Ga0105242_10318056 | Ga0105242_103180562 | 102 |
| 201 | 3300010375 | Ga0105239_12231933 | Ga0105239_122319331 | 102 |
| 202 | 3300013296 | Ga0157374_11809627 | Ga0157374_118096271 | 102 |
| 203 | 3300013306 | Ga0163162_12048234 | Ga0163162_120482342 | 102 |
| 204 | 3300013308 | Ga0157375_11335099 | Ga0157375_113350992 | 102 |
| 205 | 3300014325 | Ga0163163_10084382 | Ga0163163_100843823 | 102 |
| 206 | 3300014969 | Ga0157376_10143905 | Ga0157376_101439054 | 102 |
| 207 | 3300025912 | Ga0207707_10489327 | Ga0207707_104893272 | 102 |
| 208 | 3300025916 | Ga0207663_10520811 | Ga0207663_105208112 | 102 |
| 209 | 3300025923 | Ga0207681_11819580 | Ga0207681_118195802 | 102 |
| 210 | 3300025926 | Ga0207659_11712075 | Ga0207659_117120751 | 102 |
| 211 | 3300025934 | Ga0207686_10375271 | Ga0207686_103752712 | 102 |
| 212 | 3300025939 | Ga0207665_11158659 | Ga0207665_111586591 | 102 |
| 213 | 3300025940 | Ga0207691_10335906 | Ga0207691_103359063 | 102 |
| 214 | 3300025941 | Ga0207711_11309274 | Ga0207711_113092742 | 102 |
| 215 | 3300025960 | Ga0207651_11755497 | Ga0207651_117554971 | 102 |
| 216 | 3300026035 | Ga0207703_10323617 | Ga0207703_103236173 | 102 |
| 217 | 3300026075 | Ga0207708_10730014 | Ga0207708_107300142 | 102 |
| 218 | 3300028556 | Ga0265337_1003671 | Ga0265337_10036716 | 102 |
| 219 | 3300028558 | Ga0265326_10240613 | Ga0265326_102406132 | 102 |
| 220 | 3300028563 | Ga0265319_1011235 | Ga0265319_10112354 | 102 |
| 221 | 3300028563 | Ga0265319_1132757 | Ga0265319_11327572 | 102 |
| 222 | 3300028573 | Ga0265334_10021119 | Ga0265334_100211193 | 102 |
| 223 | 3300028573 | Ga0265334_10195476 | Ga0265334_101954761 | 102 |
| 224 | 3300028577 | Ga0265318_10049124 | Ga0265318_100491242 | 102 |
| 225 | 3300028653 | Ga0265323_10149753 | Ga0265323_101497531 | 102 |
| 226 | 3300028654 | Ga0265322_10149099 | Ga0265322_101490992 | 102 |
| 227 | 3300028666 | Ga0265336_10105801 | Ga0265336_101058012 | 102 |
| 228 | 3300028800 | Ga0265338_10000452 | Ga0265338_1000045219 | 102 |
| 229 | 3300028800 | Ga0265338_10036364 | Ga0265338_100363644 | 102 |
| 230 | 3300028800 | Ga0265338_10076063 | Ga0265338_100760631 | 102 |
| 231 | 3300028800 | Ga0265338_10227084 | Ga0265338_102270842 | 102 |
| 232 | 3300028800 | Ga0265338_10909289 | Ga0265338_109092891 | 102 |
| 233 | 3300029957 | Ga0265324_10014414 | Ga0265324_100144143 | 102 |
| 234 | 3300030760 | Ga0265762_1116842 | Ga0265762_11168422 | 102 |
| 235 | 3300031235 | Ga0265330_10110248 | Ga0265330_101102482 | 102 |
| 236 | 3300031238 | Ga0265332_10356649 | Ga0265332_103566492 | 102 |
| 237 | 3300031239 | Ga0265328_10091992 | Ga0265328_100919922 | 102 |
| 238 | 3300031239 | Ga0265328_10290928 | Ga0265328_102909282 | 102 |
| 239 | 3300031240 | Ga0265320_10109456 | Ga0265320_101094562 | 102 |
| 240 | 3300031240 | Ga0265320_10546508 | Ga0265320_105465082 | 102 |
| 241 | 3300031241 | Ga0265325_10054963 | Ga0265325_100549632 | 102 |
| 242 | 3300031241 | Ga0265325_10127833 | Ga0265325_101278332 | 102 |
| 243 | 3300031242 | Ga0265329_10001129 | Ga0265329_100011298 | 102 |
| 244 | 3300031247 | Ga0265340_10372227 | Ga0265340_103722271 | 102 |
| 245 | 3300031249 | Ga0265339_10020591 | Ga0265339_100205911 | 102 |
| 246 | 3300031344 | Ga0265316_10011373 | Ga0265316_100113738 | 102 |
| 247 | 3300031344 | Ga0265316_10174346 | Ga0265316_101743463 | 102 |
| 248 | 3300031595 | Ga0265313_10003545 | Ga0265313_100035455 | 102 |
| 249 | 3300031711 | Ga0265314_10000034 | Ga0265314_1000003430 | 102 |
| 250 | 3300031711 | Ga0265314_10011573 | Ga0265314_100115732 | 102 |
| 251 | 3300031712 | Ga0265342_10006839 | Ga0265342_100068396 | 102 |
| 252 | 3300031712 | Ga0265342_10484678 | Ga0265342_104846782 | 102 |
| 253 | 3300035083 | Ga0373926_0031808 | Ga0373926_0031808_265_576 | 102 |
| 254 | 3300035111 | Ga0373923_0683589 | Ga0373923_0683589_173_484 | 102 |
| 255 | 3300035171 | Ga0373946_0210844 | Ga0373946_0210844_289_600 | 102 |
| 256 | 3300035242 | Ga0373962_0304350 | Ga0373962_0304350_111_428 | 102 |
| 257 | 3300035410 | Ga0373924_0073322 | Ga0373924_0073322_372_686 | 102 |
| 258 | 3300035692 | Ga0373935_0030795 | Ga0373935_0030795_2586_2897 | 102 |
| 259 | 3300035695 | Ga0373927_0029709 | Ga0373927_0029709_656_967 | 102 |
| 260 | 3300035724 | Ga0373933_0256815 | Ga0373933_0256815_388_702 | 102 |
| 261 | 3300035724 | Ga0373933_0266668 | Ga0373933_0266668_144_470 | 102 |
| 262 | 3300035725 | Ga0373947_0034434 | Ga0373947_0034434_2256_2567 | 102 |
| 263 | 3300037068 | Ga0373925_0039202 | Ga0373925_0039202_2648_2959 | 102 |
| 264 | 3300037418 | Ga0395900_0031514 | Ga0395900_0031514_4667_4981 | 102 |
| 265 | 3300037471 | Ga0395905_0095298 | Ga0395905_0095298_379_693 | 102 |
| 266 | 3300038443 | Ga0395901_0448979 | Ga0395901_0448979_299_613 | 102 |
| 267 | 3300042876 | Ga0451577_0035196 | Ga0451577_0035196_3805_4119 | 102 |
| 268 | 3300042876 | Ga0451577_0578269 | Ga0451577_0578269_131_445 | 102 |
| 269 | 3300042876 | Ga0451577_0775649 | Ga0451577_0775649_20_328 | 102 |
| 270 | 3300044673 | Ga0453683_0208690 | Ga0453683_0208690_346_669 | 102 |
| 271 | 3300044712 | Ga0453684_0013213 | Ga0453684_0013213_12301_12609 | 102 |
| 272 | 3300044712 | Ga0453684_0013422 | Ga0453684_0013422_2572_2886 | 102 |
| 273 | 3300044712 | Ga0453684_1128191 | Ga0453684_1128191_114_422 | 102 |
| 274 | 3300045051 | Ga0451576_0363410 | Ga0451576_0363410_859_1170 | 102 |
| 275 | 3300045051 | Ga0451576_0442110 | Ga0451576_0442110_208_519 | 102 |
| 276 | 3300045051 | Ga0451576_0668199 | Ga0451576_0668199_80_403 | 102 |
| 277 | 3300045051 | Ga0451576_0881510 | Ga0451576_0881510_590_904 | 102 |
| 278 | 3300045051 | Ga0451576_1014541 | Ga0451576_1014541_288_605 | 102 |
| 279 | 3300045051 | Ga0451576_1309401 | Ga0451576_1309401_30_344 | 102 |
| 280 | 3300046462 | Ga0495651_0958571 | Ga0495651_0958571_160_483 | 102 |
| 281 | 3300046517 | Ga0495630_0176547 | Ga0495630_0176547_271_582 | 102 |
| 282 | 3300046526 | Ga0495666_0240420 | Ga0495666_0240420_54_365 | 102 |
| 283 | 3300046663 | Ga0495635_0903114 | Ga0495635_0903114_150_464 | 102 |
| 284 | 3300046683 | Ga0495658_0006101 | Ga0495658_0006101_2942_3268 | 102 |
| 285 | 3300047321 | Ga0495676_0416002 | Ga0495676_0416002_80_391 | 102 |
| 286 | 3300047444 | Ga0495675_0192660 | Ga0495675_0192660_715_1029 | 102 |
| 287 | 3300048088 | Ga0495602_0978859 | Ga0495602_0978859_215_529 | 102 |
| 288 | 3300050510 | nmdc:mga06r32_1807841_c1 | nmdc:mga06r32_1807841_c1_174_488 | 102 |
| 289 | 3300050513 | nmdc:mga0rr50_892162_c1 | nmdc:mga0rr50_892162_c1_195_509 | 102 |
| 290 | 3300050514 | nmdc:mga08x19_285428_c1 | nmdc:mga08x19_285428_c1_393_704 | 102 |
| 291 | 3300059493 | Ga0587077_160324 | Ga0587077_160324_92_415 | 102 |
| 292 | 3300059652 | Ga0587107_098725 | Ga0587107_098725_238_555 | 102 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1qjh-assembly1.cif.gz_A-2 | protein aggregation and alzheimer's disease: crystallographic analysis of the phenomenon. engineered version of the ribosomal protein s6 used as a stable scaffold to study oligomerization. | 0.9064 | 1 | 94 |
| 8csr-assembly1.cif.gz_E | human mitochondrial small subunit assembly intermediate (state c) | 0.9052 | 3 | 95 |
| 2bxj-assembly2.cif.gz_B | double mutant of the ribosomal protein s6 | 0.9025 | 1 | 98 |
| 1lou-assembly1.cif.gz_A | ribosomal protein s6 | 0.9012 | 1 | 98 |
| 2j5a-assembly1.cif.gz_A | folding of s6 structures with divergent amino-acid composition: pathway flexibility within partly overlapping foldons | 0.9003 | 2 | 96 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2j5aA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B | 0.9003 | 2 | 96 | 3.30.70.60 |
| af_Q8I2J0_124_224_3.30.70.60 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B | 0.8902 | 1 | 94 | 3.30.70.60 |
| 1vmbA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B | 0.8766 | 2 | 94 | 3.30.70.60 |
| af_Q9VZD5_1_134_3.30.70.60 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B | 0.8673 | 1 | 101 | 3.30.70.60 |
| af_I1MGC0_138_240_3.30.70.60 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B | 0.8641 | 2 | 101 | 3.30.70.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N6Q4P0-F1-model_v4 | Small ribosomal subunit protein bS6 (30S ribosomal protein S6) | 0.9666 | 2 | 100 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 |
| AF-A0A2D7BCE4-F1-model_v4 | Small ribosomal subunit protein bS6 (30S ribosomal protein S6) | 0.9563 | 2 | 94 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 |
| AF-A0A353E0T8-F1-model_v4 | Small ribosomal subunit protein bS6 (30S ribosomal protein S6) | 0.9531 | 1 | 94 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 |
| AF-A0A554JBH0-F1-model_v4 | Small ribosomal subunit protein bS6 | 0.9513 | 1 | 93 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0070181 GO:1990904 |
| AF-A0A7X7ZMY0-F1-model_v4 | deleted | 0.9481 | 2 | 101 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar