F390615

General Info

Members Datasets Scaffolds Average Seq Length
291 224 277 110

Family's Representative Sequence

Representative Sequence 3300053094|Ga0500566_0000338|Ga0500566_0000338_11749_12129
Length 126
Sequence MRLHDGPIEARNTMTKATQIEKYTYRVIWSEEDHEHVGLVAEFPSLSWLAPTTSGALSGITKLVADVVTDMTKSKEVPPEPLSLQQFSGKILVRVPRHQHRELAMETAEQGVSMNRLISQKLSRSR

Samples

Sample ID Description Type Environment
1 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
2 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
3 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
4 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
5 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
6 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
7 2818991452 Burkholderia cepacia 561 Isolate Unclassified
8 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
9 2904564687 Burkholderia sp. 571 Isolate Unclassified
10 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
11 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
12 2928536128 Burkholderia sola 565 Isolate Unclassified
13 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
17 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
56 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
62 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
79 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
80 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
83 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
84 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
85 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
86 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
87 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
88 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
89 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
90 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
91 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
92 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
95 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
103 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
104 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
112 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
113 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
114 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
115 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
116 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
117 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
124 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
133 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
134 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
135 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
136 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
137 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
138 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
139 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
140 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
141 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
142 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
143 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
146 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
147 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
148 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
163 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
164 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
165 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
166 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
169 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
172 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
173 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
174 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
184 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
185 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
186 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
187 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
188 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
189 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
190 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
191 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
192 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
206 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
207 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
208 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
209 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
210 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
211 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
212 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
213 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
214 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
215 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
216 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
217 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
218 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
219 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
220 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
221 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
222 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
223 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
224 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.19
Metatranscriptomes 0
Isolates 4.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.62
Nodule 0.34
Rhizoplane 6.19
Rhizosphere 75.26
Stem 0
Stem Tuber 0
Unclassified 8.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004708 3300001979 Bacteria 5838
2 rootH1_10044319 3300003323 Bacteria 2336
3 JGI25160J50197_1000101 3300003354 Bacteria 83840
4 Ga0055532_1002135 3300003758 Bacteria 4454
5 Ga0055541_1021522 3300003841 Bacteria 747
6 Ga0065165_1000188 3300005262 Bacteria 108637
7 Ga0070683_100739439 3300005329 Unclassified 942
8 Ga0068869_100061087 3300005334 Bacteria 2763
9 Ga0070666_10134845 3300005335 Bacteria 1717
10 Ga0070666_11468814 3300005335 Bacteria 510
11 Ga0070682_100242567 3300005337 Unclassified 1294
12 Ga0070682_100997952 3300005337 Unclassified 695
13 Ga0070661_100015191 3300005344 Bacteria 5433
14 Ga0070659_101088357 3300005366 Bacteria 704
15 Ga0070663_100000001 3300005455 Bacteria 318372
16 Ga0070663_100008433 3300005455 Bacteria 6341
17 Ga0070685_10000338 3300005466 Bacteria 28781
18 Ga0070698_100377655 3300005471 Bacteria 1350
19 Ga0068853_101857792 3300005539 Bacteria 584
20 Ga0068855_101727395 3300005563 Unclassified 637
21 Ga0070664_100000016 3300005564 Bacteria 128509
22 Ga0068856_100000047 3300005614 Bacteria 108894
23 Ga0068852_101175893 3300005616 Bacteria 788
24 Ga0068858_100509439 3300005842 Bacteria 1163
25 Ga0081455_10002255 3300005937 Bacteria 22968
26 Ga0075427_10055792 3300006194 Unclassified 686
27 Ga0075428_100009778 3300006844 Bacteria 10659
28 Ga0075428_100516757 3300006844 Unclassified 1277
29 Ga0075430_100078562 3300006846 Bacteria 2766
30 Ga0075431_100048986 3300006847 Bacteria 4358
31 Ga0075433_11448899 3300006852 Unclassified 593
32 Ga0075433_11555035 3300006852 Bacteria 571
33 Ga0075429_100007920 3300006880 Bacteria 9230
34 Ga0075429_100170654 3300006880 Bacteria 1905
35 Ga0105251_10073557 3300009011 Bacteria 1588
36 Ga0105240_10001524 3300009093 Bacteria 39410
37 Ga0105240_10001943 3300009093 Bacteria 34247
38 Ga0105240_10083857 3300009093 Bacteria 3909
39 Ga0105240_10320081 3300009093 Bacteria 1768
40 Ga0111539_12456537 3300009094 Bacteria 604
41 Ga0105245_10414381 3300009098 Bacteria 1349
42 Ga0114129_10021094 3300009147 Bacteria 9250
43 Ga0114129_10339609 3300009147 Unclassified 1992
44 Ga0105248_10054214 3300009177 Bacteria 4496
45 Ga0105248_10319758 3300009177 Bacteria 1748
46 Ga0105237_10033912 3300009545 Bacteria 5171
47 Ga0105237_10399176 3300009545 Bacteria 1380
48 Ga0105238_10001711 3300009551 Bacteria 22113
49 Ga0105238_10688991 3300009551 Bacteria 1034
50 Ga0105238_11066789 3300009551 Unclassified 830
51 Ga0157373_10309668 3300013100 Bacteria 1122
52 Ga0157371_10000080 3300013102 Bacteria 152121
53 Ga0157371_10353943 3300013102 Bacteria 1069
54 Ga0157369_10000149 3300013105 Bacteria 99754
55 Ga0157378_10050577 3300013297 Bacteria 3698
56 Ga0157372_10000235 3300013307 Bacteria 61511
57 Ga0157372_10030252 3300013307 Bacteria 5923
58 Ga0182008_10620360 3300014497 Bacteria 609
59 Ga0182006_1049737 3300015261 Bacteria 1617
60 Ga0182006_1091037 3300015261 Bacteria 1098
61 Ga0183361_10003 3300016635 Bacteria 577277
62 Ga0213872_10002002 3300021361 Bacteria 12402
63 Ga0213872_10021139 3300021361 Bacteria 2996
64 Ga0209566_100472 3300025225 Bacteria 28862
65 Ga0209147_100121 3300025229 Bacteria 139167
66 Ga0209563_105874 3300025230 Bacteria 2171
67 Ga0209233_1001002 3300025261 Bacteria 12072
68 Ga0209130_1005541 3300025284 Bacteria 4343
69 Ga0207426_1000056 3300025302 Bacteria 373596
70 Ga0207713_1118746 3300025735 Bacteria 889
71 Ga0207695_10000651 3300025913 Bacteria 68979
72 Ga0207695_10002842 3300025913 Bacteria 25156
73 Ga0207695_10003144 3300025913 Bacteria 23575
74 Ga0207695_10915321 3300025913 Bacteria 756
75 Ga0207671_10012464 3300025914 Bacteria 6831
76 Ga0207671_10159414 3300025914 Bacteria 1746
77 Ga0207649_10000442 3300025920 Bacteria 29990
78 Ga0207694_10001209 3300025924 Bacteria 22391
79 Ga0207687_10041450 3300025927 Bacteria 3161
80 Ga0207711_10108950 3300025941 Bacteria 2461
81 Ga0207689_10074504 3300025942 Bacteria 2789
82 Ga0207679_10000012 3300025945 Bacteria 339773
83 Ga0207639_10218824 3300026041 Bacteria 1644
84 Ga0207678_10000028 3300026067 Bacteria 115277
85 Ga0207678_10016869 3300026067 Bacteria 6413
86 Ga0207702_10000188 3300026078 Bacteria 74268
87 Ga0207698_10649376 3300026142 Bacteria 1045
88 Ga0207428_10723243 3300027907 Bacteria 711
89 Ga0265319_1247331 3300028563 Unclassified 544
90 Ga0265318_10017179 3300028577 Unclassified 2973
91 Ga0265318_10060699 3300028577 Unclassified 1409
92 Ga0265336_10070208 3300028666 Bacteria 1047
93 Ga0265338_10159295 3300028800 Bacteria 1745
94 Ga0265338_10250649 3300028800 Unclassified 1306
95 Ga0265324_10052120 3300029957 Bacteria 1405
96 Ga0265324_10301079 3300029957 Bacteria 545
97 Ga0265330_10031166 3300031235 Unclassified 2390
98 Ga0265332_10036435 3300031238 Unclassified 2136
99 Ga0265328_10001213 3300031239 Bacteria 11945
100 Ga0265328_10101247 3300031239 Bacteria 1067
101 Ga0265325_10001320 3300031241 Bacteria 17549
102 Ga0265325_10455820 3300031241 Bacteria 557
103 Ga0265340_10033590 3300031247 Plasmid 2553
104 Ga0265339_10000920 3300031249 Bacteria 22633
105 Ga0265339_10111625 3300031249 Unclassified 1414
106 Ga0265331_10006233 3300031250 Bacteria 7072
107 Ga0265331_10246005 3300031250 Unclassified 802
108 Ga0265327_10001976 3300031251 Bacteria 23332
109 Ga0265327_10035858 3300031251 Bacteria 2736
110 Ga0265327_10080968 3300031251 Bacteria 1604
111 Ga0265327_10088624 3300031251 Bacteria 1513
112 Ga0265327_10406605 3300031251 Unclassified 591
113 Ga0265316_10004851 3300031344 Bacteria 13257
114 Ga0265316_10044353 3300031344 Unclassified 3537
115 Ga0265316_10129160 3300031344 Bacteria 1904
116 Ga0265313_10001233 3300031595 Bacteria 24382
117 Ga0265314_10031458 3300031711 Bacteria 3916
118 Ga0265314_10214357 3300031711 Bacteria 1128
119 Ga0265342_10076508 3300031712 Bacteria 1940
120 Ga0316576_10766481 3300031727 Unclassified 696
121 Ga0307410_10125754 3300031852 Bacteria 1877
122 Ga0307406_10860252 3300031901 Bacteria 769
123 Ga0307407_10407447 3300031903 Bacteria 977
124 Ga0307409_100182571 3300031995 Bacteria 1859
125 Ga0307411_10374446 3300032005 Bacteria 1169
126 Ga0307415_100701982 3300032126 Bacteria 913
127 Ga0373958_0129675 3300034819 Unclassified 616
128 Ga0373954_0298768 3300035118 Bacteria 794
129 Ga0373961_0000354 3300035241 Bacteria 19846
130 Ga0373931_0103169 3300035691 Bacteria 1607
131 Ga0395899_0000005 3300037312 Bacteria 772966
132 Ga0395899_0012026 3300037312 Bacteria 6632
133 Ga0395900_0000003 3300037418 Bacteria 587648
134 Ga0395900_0031098 3300037418 Bacteria 5484
135 Ga0395898_0000003 3300037466 Bacteria 772986
136 Ga0395898_0001138 3300037466 Bacteria 40694
137 Ga0395901_0000023 3300038443 Bacteria 283968
138 Ga0436361_0818289 3300039447 Bacteria 3360
139 Ga0439436_0054689 3300041404 Bacteria 1122
140 Ga0466969_0000937 3300044656 Bacteria 15728
141 Ga0466969_0132942 3300044656 Bacteria 1153
142 Ga0466972_0028456 3300044658 Bacteria 2756
143 Ga0466973_0037447 3300044659 Bacteria 4598
144 Ga0466978_0112105 3300044671 Bacteria 1690
145 Ga0466982_0459108 3300044672 Bacteria 671
146 Ga0466965_0022253 3300044683 Bacteria 3056
147 Ga0466966_0004023 3300044684 Bacteria 9706
148 Ga0466966_0128632 3300044684 Bacteria 1552
149 Ga0466961_0000076 3300044693 Bacteria 61056
150 Ga0466961_0006857 3300044693 Bacteria 7244
151 Ga0466961_0013335 3300044693 Bacteria 5261
152 Ga0466961_0052999 3300044693 Bacteria 2589
153 Ga0466963_0019742 3300044694 Bacteria 4232
154 Ga0466964_0004807 3300044706 Bacteria 4993
155 Ga0453684_0076485 3300044712 Bacteria 4202
156 Ga0466971_0019181 3300044719 Bacteria 3035
157 Ga0466968_0224096 3300044735 Bacteria 886
158 Ga0466968_0649359 3300044735 Bacteria 535
159 Ga0466970_0269358 3300044765 Bacteria 956
160 Ga0466957_0013417 3300044842 Bacteria 4752
161 Ga0466960_0292098 3300044901 Bacteria 916
162 Ga0466959_0006039 3300045049 Bacteria 8358
163 Ga0466959_0072349 3300045049 Bacteria 2495
164 Ga0466959_0250944 3300045049 Bacteria 1220
165 Ga0451576_0000185 3300045051 Bacteria 156955
166 Ga0451576_1193525 3300045051 Bacteria 795
167 Ga0466958_0078048 3300045836 Bacteria 2034
168 Ga0466967_0139473 3300045976 Bacteria 2257
169 Ga0466967_2006466 3300045976 Bacteria 575
170 Ga0495603_0001698 3300046455 Bacteria 12955
171 Ga0495590_0021283 3300046457 Bacteria 2299
172 Ga0495650_0001576 3300046471 Bacteria 21399
173 Ga0495605_0088795 3300046474 Bacteria 1435
174 Ga0495584_0316297 3300046491 Bacteria 793
175 Ga0495583_0014119 3300046506 Bacteria 4420
176 Ga0495643_0031293 3300046522 Bacteria 2962
177 Ga0495648_0076931 3300046524 Bacteria 1914
178 Ga0495648_0359416 3300046524 Bacteria 662
179 Ga0495665_0008603 3300046531 Bacteria 5540
180 Ga0495589_0021056 3300046794 Bacteria 3333
181 Ga0495660_0108038 3300046810 Bacteria 1423
182 Ga0495636_0665219 3300047318 Unclassified 512
183 Ga0495674_0021233 3300047319 Bacteria 6007
184 Ga0495672_0076786 3300047320 Bacteria 1874
185 Ga0495683_0095362 3300047323 Bacteria 1436
186 Ga0495683_0171134 3300047323 Bacteria 998
187 Ga0495687_041887 3300047443 Bacteria 2005
188 Ga0495673_0013815 3300047469 Bacteria 4220
189 Ga0495673_0210683 3300047469 Bacteria 723
190 Ga0495686_0043729 3300047472 Bacteria 2838
191 Ga0495626_0085153 3300048091 Bacteria 1398
192 Ga0496100_0001577 3300048903 Bacteria 11232
193 Ga0496100_0102873 3300048903 Bacteria 1971
194 Ga0496101_0001257 3300048904 Bacteria 15176
195 Ga0496101_0026928 3300048904 Bacteria 3998
196 Ga0496102_0001286 3300048905 Bacteria 22633
197 Ga0496103_0001277 3300048906 Bacteria 17159
198 Ga0496104_0220769 3300048907 Bacteria 1807
199 Ga0496104_0819763 3300048907 Bacteria 836
200 Ga0496105_0285227 3300048908 Bacteria 1330
201 Ga0496106_0764951 3300048909 Bacteria 767
202 Ga0496107_0464337 3300048910 Bacteria 940
203 Ga0496110_1133048 3300048913 Bacteria 691
204 Ga0496112_0123453 3300048915 Bacteria 2560
205 Ga0496113_0001891 3300048916 Bacteria 11945
206 Ga0496116_0066653 3300048919 Bacteria 2303
207 Ga0496116_0171643 3300048919 Bacteria 1174
208 Ga0496117_0000454 3300048920 Bacteria 68282
209 Ga0496118_0001463 3300048921 Bacteria 35422
210 Ga0496118_0038515 3300048921 Bacteria 3830
211 Ga0496119_0159076 3300048922 Bacteria 1203
212 Ga0496119_0253232 3300048922 Bacteria 887
213 Ga0496120_0059014 3300048923 Bacteria 2152
214 Ga0496121_0009409 3300048924 Bacteria 11238
215 Ga0496121_0038352 3300048924 Bacteria 4246
216 Ga0496121_0187102 3300048924 Bacteria 1488
217 Ga0496121_0299426 3300048924 Bacteria 1092
218 Ga0496122_0476809 3300048925 Bacteria 612
219 Ga0496124_0207319 3300048927 Bacteria 1486
220 Ga0496126_0100600 3300048929 Bacteria 2530
221 Ga0496126_0143170 3300048929 Bacteria 2056
222 Ga0496126_0702192 3300048929 Unclassified 786
223 Ga0495678_063835 3300049459 Bacteria 1374
224 Ga0495682_0035007 3300049460 Bacteria 1850
225 Ga0501298_026333 3300049521 Bacteria 1118
226 Ga0501299_014069 3300049522 Unclassified 1387
227 Ga0501033_0405645 3300049570 Bacteria 950
228 Ga0501034_0042890 3300049571 Bacteria 4579
229 Ga0501034_0072689 3300049571 Bacteria 3448
230 Ga0501036_0183844 3300049572 Bacteria 1759
231 Ga0501038_0175536 3300049574 Bacteria 1732
232 Ga0501047_0385980 3300049581 Bacteria 1234
233 Ga0501067_0178243 3300049583 Bacteria 1183
234 Ga0501070_0024934 3300049586 Bacteria 5016
235 Ga0501073_0150604 3300049589 Bacteria 1612
236 Ga0501207_064148 3300049654 Bacteria 678
237 Ga0501209_051068 3300049656 Bacteria 1128
238 Ga0501216_009174 3300049660 Bacteria 1573
239 Ga0501217_024006 3300049661 Unclassified 1456
240 Ga0501223_036580 3300049663 Bacteria 954
241 Ga0501227_011819 3300049665 Bacteria 1906
242 Ga0501257_191074 3300049686 Bacteria 584
243 Ga0501221_063273 3300049704 Bacteria 859
244 Ga0501229_004198 3300049706 Bacteria 1747
245 Ga0501234_021836 3300049707 Bacteria 1021
246 Ga0501079_0705334 3300049741 Bacteria 794
247 Ga0501080_1699045 3300049742 Bacteria 532
248 Ga0501083_0298609 3300049744 Bacteria 1047
249 Ga0501044_0082659 3300049823 Bacteria 3249
250 nmdc:mga0k408_614603_c1 3300050493 Bacteria 640
251 nmdc:mga05p37_191764_c1 3300050507 Bacteria 2481
252 nmdc:mga05p37_746097_c1 3300050507 Bacteria 1080
253 nmdc:mga09592_192178_c1 3300050508 Bacteria 1767
254 nmdc:mga09592_5703_c1 3300050508 Bacteria 10157
255 nmdc:mga0qj67_178256_c1 3300050509 Bacteria 1726
256 nmdc:mga06r32_54072_c1 3300050510 Bacteria 3850
257 nmdc:mga08y16_931932_c1 3300050511 Bacteria 853
258 nmdc:mga0n895_492750_c1 3300050512 Bacteria 1235
259 nmdc:mga0a205_1033126_c1 3300050515 Unclassified 669
260 Ga0500566_0000338 3300053094 Bacteria 25497
261 Ga0500640_000345 3300053095 Bacteria 10821
262 Ga0500554_000235 3300053102 Bacteria 11882
263 Ga0500562_059762 3300053108 Bacteria 1024
264 Ga0500595_025809 3300053119 Bacteria 2031
265 Ga0500597_060650 3300053120 Bacteria 1625
266 Ga0500607_326520 3300053121 Unclassified 547
267 Ga0500614_000327 3300053123 Bacteria 12291
268 Ga0500623_253491 3300053127 Unclassified 585
269 Ga0500559_0007227 3300053136 Bacteria 4938
270 Ga0500585_041928 3300053144 Bacteria 1617
271 Ga0500588_0111382 3300053146 Unclassified 955
272 Ga0500600_0047511 3300053149 Bacteria 2447
273 Ga0500622_0286053 3300053156 Unclassified 708
274 Ga0500636_0006239 3300053177 Bacteria 6836
275 Ga0500637_0077642 3300053178 Bacteria 1916
276 Ga0500576_143122 3300053725 Bacteria 905
277 Ga0466962_0008687 3300061719 Bacteria 4871

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005334 Ga0068869_100061087 Ga0068869_1000610872 97
2 3300009098 Ga0105245_10414381 Ga0105245_104143812 97
3 3300025927 Ga0207687_10041450 Ga0207687_100414502 97
4 3300025942 Ga0207689_10074504 Ga0207689_100745044 97
5 3300041404 Ga0439436_0054689 Ga0439436_0054689_577_960 102
6 iso_pu_bacteria 2599185239 2599736223 103
7 iso_pu_bacteria 2599185240 2599746116 103
8 iso_pu_bacteria 2599185355 2600208050 103
9 iso_pu_bacteria 2675903129 2676743707 103
10 iso_pu_bacteria 2818991452 2819634064 103
11 iso_pu_bacteria 2863421361 2863423870 103
12 iso_pu_bacteria 2904564687 2904568447 103
13 iso_pu_bacteria 2904571731 2904575490 103
14 iso_pu_bacteria 2921643360 2921650535 103
15 iso_pu_bacteria 2928536128 2928536312 103
16 iso_pu_bacteria 8020945358 8020946277 103
17 iso_pu_bacteria 8021120328 8021123502 103
18 3300006844 Ga0075428_100516757 Ga0075428_1005167572 105
19 3300031238 Ga0265332_10036435 Ga0265332_100364352 105
20 3300053177 Ga0500636_0006239 Ga0500636_0006239_4973_5308 105
21 3300035118 Ga0373954_0298768 Ga0373954_0298768_190_522 106
22 3300035241 Ga0373961_0000354 Ga0373961_0000354_12777_13112 106
23 3300045976 Ga0466967_0139473 Ga0466967_0139473_1758_2078 106
24 3300001979 JGI24740J21852_10004708 JGI24740J21852_100047084 107
25 3300003323 rootH1_10044319 rootH1_100443193 107
26 3300003354 JGI25160J50197_1000101 JGI25160J50197_100010117 107
27 3300003758 Ga0055532_1002135 Ga0055532_10021353 107
28 3300003841 Ga0055541_1021522 Ga0055541_10215221 107
29 3300005262 Ga0065165_1000188 Ga0065165_1000188105 107
30 3300005329 Ga0070683_100739439 Ga0070683_1007394392 107
31 3300005335 Ga0070666_10134845 Ga0070666_101348453 107
32 3300005335 Ga0070666_11468814 Ga0070666_114688141 107
33 3300005337 Ga0070682_100242567 Ga0070682_1002425672 107
34 3300005337 Ga0070682_100997952 Ga0070682_1009979521 107
35 3300005344 Ga0070661_100015191 Ga0070661_1000151913 107
36 3300005366 Ga0070659_101088357 Ga0070659_1010883571 107
37 3300005455 Ga0070663_100000001 Ga0070663_100000001107 107
38 3300005455 Ga0070663_100008433 Ga0070663_1000084333 107
39 3300005466 Ga0070685_10000338 Ga0070685_100003387 107
40 3300005471 Ga0070698_100377655 Ga0070698_1003776552 107
41 3300005539 Ga0068853_101857792 Ga0068853_1018577922 107
42 3300005563 Ga0068855_101727395 Ga0068855_1017273951 107
43 3300005564 Ga0070664_100000016 Ga0070664_100000016113 107
44 3300005614 Ga0068856_100000047 Ga0068856_10000004784 107
45 3300005616 Ga0068852_101175893 Ga0068852_1011758932 107
46 3300005842 Ga0068858_100509439 Ga0068858_1005094393 107
47 3300005937 Ga0081455_10002255 Ga0081455_1000225526 107
48 3300006194 Ga0075427_10055792 Ga0075427_100557922 107
49 3300006844 Ga0075428_100009778 Ga0075428_10000977813 107
50 3300006846 Ga0075430_100078562 Ga0075430_1000785624 107
51 3300006847 Ga0075431_100048986 Ga0075431_1000489866 107
52 3300006852 Ga0075433_11448899 Ga0075433_114488991 107
53 3300006852 Ga0075433_11555035 Ga0075433_115550351 107
54 3300006880 Ga0075429_100007920 Ga0075429_10000792012 107
55 3300006880 Ga0075429_100170654 Ga0075429_1001706542 107
56 3300009011 Ga0105251_10073557 Ga0105251_100735574 107
57 3300009093 Ga0105240_10001524 Ga0105240_1000152416 107
58 3300009093 Ga0105240_10001943 Ga0105240_1000194315 107
59 3300009093 Ga0105240_10083857 Ga0105240_100838573 107
60 3300009093 Ga0105240_10320081 Ga0105240_103200812 107
61 3300009094 Ga0111539_12456537 Ga0111539_124565372 107
62 3300009147 Ga0114129_10021094 Ga0114129_100210943 107
63 3300009147 Ga0114129_10339609 Ga0114129_103396092 107
64 3300009177 Ga0105248_10054214 Ga0105248_100542144 107
65 3300009177 Ga0105248_10319758 Ga0105248_103197581 107
66 3300009545 Ga0105237_10033912 Ga0105237_100339125 107
67 3300009545 Ga0105237_10399176 Ga0105237_103991761 107
68 3300009551 Ga0105238_10001711 Ga0105238_1000171121 107
69 3300009551 Ga0105238_10688991 Ga0105238_106889912 107
70 3300009551 Ga0105238_11066789 Ga0105238_110667892 107
71 3300013100 Ga0157373_10309668 Ga0157373_103096683 107
72 3300013102 Ga0157371_10000080 Ga0157371_1000008068 107
73 3300013102 Ga0157371_10353943 Ga0157371_103539432 107
74 3300013105 Ga0157369_10000149 Ga0157369_1000014975 107
75 3300013297 Ga0157378_10050577 Ga0157378_100505772 107
76 3300013307 Ga0157372_10000235 Ga0157372_1000023521 107
77 3300013307 Ga0157372_10030252 Ga0157372_100302522 107
78 3300014497 Ga0182008_10620360 Ga0182008_106203602 107
79 3300015261 Ga0182006_1049737 Ga0182006_10497372 107
80 3300015261 Ga0182006_1091037 Ga0182006_10910371 107
81 3300016635 Ga0183361_10003 Ga0183361_10003320 107
82 3300021361 Ga0213872_10002002 Ga0213872_100020027 107
83 3300021361 Ga0213872_10021139 Ga0213872_100211392 107
84 3300025225 Ga0209566_100472 Ga0209566_10047225 107
85 3300025229 Ga0209147_100121 Ga0209147_1001212 107
86 3300025230 Ga0209563_105874 Ga0209563_1058744 107
87 3300025261 Ga0209233_1001002 Ga0209233_10010023 107
88 3300025284 Ga0209130_1005541 Ga0209130_10055414 107
89 3300025302 Ga0207426_1000056 Ga0207426_1000056165 107
90 3300025735 Ga0207713_1118746 Ga0207713_11187462 107
91 3300025913 Ga0207695_10000651 Ga0207695_1000065115 107
92 3300025913 Ga0207695_10002842 Ga0207695_1000284214 107
93 3300025913 Ga0207695_10003144 Ga0207695_100031442 107
94 3300025913 Ga0207695_10915321 Ga0207695_109153212 107
95 3300025914 Ga0207671_10012464 Ga0207671_100124643 107
96 3300025914 Ga0207671_10159414 Ga0207671_101594143 107
97 3300025920 Ga0207649_10000442 Ga0207649_1000044230 107
98 3300025924 Ga0207694_10001209 Ga0207694_1000120922 107
99 3300025941 Ga0207711_10108950 Ga0207711_101089502 107
100 3300025945 Ga0207679_10000012 Ga0207679_10000012194 107
101 3300026041 Ga0207639_10218824 Ga0207639_102188241 107
102 3300026067 Ga0207678_10000028 Ga0207678_10000028107 107
103 3300026067 Ga0207678_10016869 Ga0207678_100168693 107
104 3300026078 Ga0207702_10000188 Ga0207702_1000018825 107
105 3300026142 Ga0207698_10649376 Ga0207698_106493762 107
106 3300027907 Ga0207428_10723243 Ga0207428_107232432 107
107 3300028563 Ga0265319_1247331 Ga0265319_12473311 107
108 3300028577 Ga0265318_10017179 Ga0265318_100171793 107
109 3300028577 Ga0265318_10060699 Ga0265318_100606992 107
110 3300028666 Ga0265336_10070208 Ga0265336_100702082 107
111 3300028800 Ga0265338_10159295 Ga0265338_101592952 107
112 3300028800 Ga0265338_10250649 Ga0265338_102506492 107
113 3300029957 Ga0265324_10052120 Ga0265324_100521202 107
114 3300029957 Ga0265324_10301079 Ga0265324_103010791 107
115 3300031235 Ga0265330_10031166 Ga0265330_100311662 107
116 3300031239 Ga0265328_10001213 Ga0265328_100012139 107
117 3300031239 Ga0265328_10101247 Ga0265328_101012471 107
118 3300031241 Ga0265325_10001320 Ga0265325_100013205 107
119 3300031241 Ga0265325_10455820 Ga0265325_104558202 107
120 3300031247 Ga0265340_10033590 Ga0265340_100335903 107
121 3300031249 Ga0265339_10000920 Ga0265339_100009209 107
122 3300031249 Ga0265339_10111625 Ga0265339_101116252 107
123 3300031250 Ga0265331_10006233 Ga0265331_100062339 107
124 3300031250 Ga0265331_10246005 Ga0265331_102460052 107
125 3300031251 Ga0265327_10001976 Ga0265327_1000197627 107
126 3300031251 Ga0265327_10035858 Ga0265327_100358583 107
127 3300031251 Ga0265327_10080968 Ga0265327_100809683 107
128 3300031251 Ga0265327_10088624 Ga0265327_100886242 107
129 3300031251 Ga0265327_10406605 Ga0265327_104066051 107
130 3300031344 Ga0265316_10004851 Ga0265316_100048514 107
131 3300031344 Ga0265316_10044353 Ga0265316_100443535 107
132 3300031344 Ga0265316_10129160 Ga0265316_101291602 107
133 3300031595 Ga0265313_10001233 Ga0265313_100012337 107
134 3300031711 Ga0265314_10031458 Ga0265314_100314582 107
135 3300031711 Ga0265314_10214357 Ga0265314_102143572 107
136 3300031712 Ga0265342_10076508 Ga0265342_100765082 107
137 3300031727 Ga0316576_10766481 Ga0316576_107664811 107
138 3300031852 Ga0307410_10125754 Ga0307410_101257544 107
139 3300031901 Ga0307406_10860252 Ga0307406_108602521 107
140 3300031903 Ga0307407_10407447 Ga0307407_104074472 107
141 3300031995 Ga0307409_100182571 Ga0307409_1001825714 107
142 3300032005 Ga0307411_10374446 Ga0307411_103744463 107
143 3300032126 Ga0307415_100701982 Ga0307415_1007019822 107
144 3300034819 Ga0373958_0129675 Ga0373958_0129675_71_427 107
145 3300035691 Ga0373931_0103169 Ga0373931_0103169_574_912 107
146 3300037312 Ga0395899_0000005 Ga0395899_0000005_219812_220135 107
147 3300037312 Ga0395899_0012026 Ga0395899_0012026_1914_2237 107
148 3300037418 Ga0395900_0000003 Ga0395900_0000003_552832_553155 107
149 3300037418 Ga0395900_0031098 Ga0395900_0031098_4149_4472 107
150 3300037466 Ga0395898_0000003 Ga0395898_0000003_219832_220155 107
151 3300037466 Ga0395898_0001138 Ga0395898_0001138_8384_8707 107
152 3300038443 Ga0395901_0000023 Ga0395901_0000023_96345_96668 107
153 3300039447 Ga0436361_0818289 Ga0436361_0818289_1566_1889 107
154 3300044656 Ga0466969_0000937 Ga0466969_0000937_8480_8803 107
155 3300044656 Ga0466969_0132942 Ga0466969_0132942_374_697 107
156 3300044658 Ga0466972_0028456 Ga0466972_0028456_2306_2632 107
157 3300044659 Ga0466973_0037447 Ga0466973_0037447_3246_3569 107
158 3300044671 Ga0466978_0112105 Ga0466978_0112105_1310_1636 107
159 3300044672 Ga0466982_0459108 Ga0466982_0459108_265_591 107
160 3300044683 Ga0466965_0022253 Ga0466965_0022253_869_1195 107
161 3300044684 Ga0466966_0004023 Ga0466966_0004023_5404_5727 107
162 3300044684 Ga0466966_0128632 Ga0466966_0128632_1124_1447 107
163 3300044693 Ga0466961_0000076 Ga0466961_0000076_52216_52542 107
164 3300044693 Ga0466961_0006857 Ga0466961_0006857_411_734 107
165 3300044693 Ga0466961_0013335 Ga0466961_0013335_2298_2639 107
166 3300044693 Ga0466961_0052999 Ga0466961_0052999_1642_1965 107
167 3300044694 Ga0466963_0019742 Ga0466963_0019742_3499_3822 107
168 3300044706 Ga0466964_0004807 Ga0466964_0004807_773_1099 107
169 3300044712 Ga0453684_0076485 Ga0453684_0076485_3298_3621 107
170 3300044719 Ga0466971_0019181 Ga0466971_0019181_262_585 107
171 3300044735 Ga0466968_0224096 Ga0466968_0224096_171_494 107
172 3300044735 Ga0466968_0649359 Ga0466968_0649359_199_525 107
173 3300044765 Ga0466970_0269358 Ga0466970_0269358_347_670 107
174 3300044842 Ga0466957_0013417 Ga0466957_0013417_554_880 107
175 3300044901 Ga0466960_0292098 Ga0466960_0292098_533_859 107
176 3300045049 Ga0466959_0006039 Ga0466959_0006039_6544_6870 107
177 3300045049 Ga0466959_0072349 Ga0466959_0072349_1141_1464 107
178 3300045049 Ga0466959_0250944 Ga0466959_0250944_218_541 107
179 3300045051 Ga0451576_0000185 Ga0451576_0000185_133429_133752 107
180 3300045051 Ga0451576_1193525 Ga0451576_1193525_134_463 107
181 3300045836 Ga0466958_0078048 Ga0466958_0078048_587_910 107
182 3300045976 Ga0466967_2006466 Ga0466967_2006466_242_565 107
183 3300046455 Ga0495603_0001698 Ga0495603_0001698_7376_7726 107
184 3300046457 Ga0495590_0021283 Ga0495590_0021283_974_1297 107
185 3300046471 Ga0495650_0001576 Ga0495650_0001576_10873_11196 107
186 3300046474 Ga0495605_0088795 Ga0495605_0088795_293_643 107
187 3300046491 Ga0495584_0316297 Ga0495584_0316297_46_396 107
188 3300046506 Ga0495583_0014119 Ga0495583_0014119_627_950 107
189 3300046522 Ga0495643_0031293 Ga0495643_0031293_1826_2161 107
190 3300046524 Ga0495648_0076931 Ga0495648_0076931_1041_1391 107
191 3300046524 Ga0495648_0359416 Ga0495648_0359416_45_395 107
192 3300046531 Ga0495665_0008603 Ga0495665_0008603_2034_2384 107
193 3300046794 Ga0495589_0021056 Ga0495589_0021056_1256_1579 107
194 3300046810 Ga0495660_0108038 Ga0495660_0108038_558_881 107
195 3300047318 Ga0495636_0665219 Ga0495636_0665219_28_351 107
196 3300047319 Ga0495674_0021233 Ga0495674_0021233_2402_2725 107
197 3300047320 Ga0495672_0076786 Ga0495672_0076786_306_629 107
198 3300047323 Ga0495683_0095362 Ga0495683_0095362_294_617 107
199 3300047323 Ga0495683_0171134 Ga0495683_0171134_355_705 107
200 3300047443 Ga0495687_041887 Ga0495687_041887_891_1214 107
201 3300047469 Ga0495673_0013815 Ga0495673_0013815_2625_2975 107
202 3300047469 Ga0495673_0210683 Ga0495673_0210683_306_629 107
203 3300047472 Ga0495686_0043729 Ga0495686_0043729_311_634 107
204 3300048091 Ga0495626_0085153 Ga0495626_0085153_375_698 107
205 3300048903 Ga0496100_0001577 Ga0496100_0001577_1130_1453 107
206 3300048903 Ga0496100_0102873 Ga0496100_0102873_364_738 107
207 3300048904 Ga0496101_0001257 Ga0496101_0001257_3483_3806 107
208 3300048904 Ga0496101_0026928 Ga0496101_0026928_3369_3743 107
209 3300048905 Ga0496102_0001286 Ga0496102_0001286_19199_19522 107
210 3300048906 Ga0496103_0001277 Ga0496103_0001277_565_888 107
211 3300048907 Ga0496104_0220769 Ga0496104_0220769_294_668 107
212 3300048907 Ga0496104_0819763 Ga0496104_0819763_231_554 107
213 3300048908 Ga0496105_0285227 Ga0496105_0285227_473_796 107
214 3300048909 Ga0496106_0764951 Ga0496106_0764951_242_616 107
215 3300048910 Ga0496107_0464337 Ga0496107_0464337_293_667 107
216 3300048913 Ga0496110_1133048 Ga0496110_1133048_239_613 107
217 3300048915 Ga0496112_0123453 Ga0496112_0123453_1347_1721 107
218 3300048916 Ga0496113_0001891 Ga0496113_0001891_29_403 107
219 3300048919 Ga0496116_0066653 Ga0496116_0066653_1285_1608 107
220 3300048919 Ga0496116_0171643 Ga0496116_0171643_758_1081 107
221 3300048920 Ga0496117_0000454 Ga0496117_0000454_3313_3636 107
222 3300048921 Ga0496118_0001463 Ga0496118_0001463_18828_19151 107
223 3300048921 Ga0496118_0038515 Ga0496118_0038515_148_471 107
224 3300048922 Ga0496119_0159076 Ga0496119_0159076_277_600 107
225 3300048922 Ga0496119_0253232 Ga0496119_0253232_490_813 107
226 3300048923 Ga0496120_0059014 Ga0496120_0059014_794_1117 107
227 3300048924 Ga0496121_0009409 Ga0496121_0009409_1136_1459 107
228 3300048924 Ga0496121_0038352 Ga0496121_0038352_2787_3110 107
229 3300048924 Ga0496121_0187102 Ga0496121_0187102_335_658 107
230 3300048924 Ga0496121_0299426 Ga0496121_0299426_540_863 107
231 3300048925 Ga0496122_0476809 Ga0496122_0476809_204_527 107
232 3300048927 Ga0496124_0207319 Ga0496124_0207319_497_820 107
233 3300048929 Ga0496126_0100600 Ga0496126_0100600_549_872 107
234 3300048929 Ga0496126_0143170 Ga0496126_0143170_1685_2008 107
235 3300048929 Ga0496126_0702192 Ga0496126_0702192_336_659 107
236 3300049459 Ga0495678_063835 Ga0495678_063835_1040_1363 107
237 3300049460 Ga0495682_0035007 Ga0495682_0035007_765_1088 107
238 3300049521 Ga0501298_026333 Ga0501298_026333_615_947 107
239 3300049522 Ga0501299_014069 Ga0501299_014069_223_555 107
240 3300049570 Ga0501033_0405645 Ga0501033_0405645_68_397 107
241 3300049571 Ga0501034_0042890 Ga0501034_0042890_1074_1403 107
242 3300049571 Ga0501034_0072689 Ga0501034_0072689_1123_1446 107
243 3300049572 Ga0501036_0183844 Ga0501036_0183844_1037_1360 107
244 3300049574 Ga0501038_0175536 Ga0501038_0175536_756_1079 107
245 3300049581 Ga0501047_0385980 Ga0501047_0385980_535_858 107
246 3300049583 Ga0501067_0178243 Ga0501067_0178243_20_343 107
247 3300049586 Ga0501070_0024934 Ga0501070_0024934_4367_4690 107
248 3300049589 Ga0501073_0150604 Ga0501073_0150604_1219_1542 107
249 3300049654 Ga0501207_064148 Ga0501207_064148_43_375 107
250 3300049656 Ga0501209_051068 Ga0501209_051068_497_829 107
251 3300049660 Ga0501216_009174 Ga0501216_009174_622_954 107
252 3300049661 Ga0501217_024006 Ga0501217_024006_953_1285 107
253 3300049663 Ga0501223_036580 Ga0501223_036580_120_452 107
254 3300049665 Ga0501227_011819 Ga0501227_011819_694_1026 107
255 3300049686 Ga0501257_191074 Ga0501257_191074_164_496 107
256 3300049704 Ga0501221_063273 Ga0501221_063273_413_745 107
257 3300049706 Ga0501229_004198 Ga0501229_004198_777_1109 107
258 3300049707 Ga0501234_021836 Ga0501234_021836_190_522 107
259 3300049741 Ga0501079_0705334 Ga0501079_0705334_20_343 107
260 3300049742 Ga0501080_1699045 Ga0501080_1699045_88_411 107
261 3300049744 Ga0501083_0298609 Ga0501083_0298609_503_826 107
262 3300049823 Ga0501044_0082659 Ga0501044_0082659_530_853 107
263 3300050493 nmdc:mga0k408_614603_c1 nmdc:mga0k408_614603_c1_114_437 107
264 3300050507 nmdc:mga05p37_191764_c1 nmdc:mga05p37_191764_c1_65_427 107
265 3300050507 nmdc:mga05p37_746097_c1 nmdc:mga05p37_746097_c1_503_865 107
266 3300050508 nmdc:mga09592_192178_c1 nmdc:mga09592_192178_c1_982_1344 107
267 3300050508 nmdc:mga09592_5703_c1 nmdc:mga09592_5703_c1_2039_2401 107
268 3300050509 nmdc:mga0qj67_178256_c1 nmdc:mga0qj67_178256_c1_1142_1504 107
269 3300050510 nmdc:mga06r32_54072_c1 nmdc:mga06r32_54072_c1_523_885 107
270 3300050511 nmdc:mga08y16_931932_c1 nmdc:mga08y16_931932_c1_424_786 107
271 3300050512 nmdc:mga0n895_492750_c1 nmdc:mga0n895_492750_c1_572_934 107
272 3300050515 nmdc:mga0a205_1033126_c1 nmdc:mga0a205_1033126_c1_206_568 107
273 3300053094 Ga0500566_0000338 Ga0500566_0000338_11749_12129 107
274 3300053095 Ga0500640_000345 Ga0500640_000345_4159_4539 107
275 3300053102 Ga0500554_000235 Ga0500554_000235_5741_6121 107
276 3300053108 Ga0500562_059762 Ga0500562_059762_505_840 107
277 3300053119 Ga0500595_025809 Ga0500595_025809_971_1351 107
278 3300053120 Ga0500597_060650 Ga0500597_060650_593_973 107
279 3300053121 Ga0500607_326520 Ga0500607_326520_16_357 107
280 3300053123 Ga0500614_000327 Ga0500614_000327_8231_8611 107
281 3300053127 Ga0500623_253491 Ga0500623_253491_151_486 107
282 3300053136 Ga0500559_0007227 Ga0500559_0007227_614_994 107
283 3300053144 Ga0500585_041928 Ga0500585_041928_653_1033 107
284 3300053146 Ga0500588_0111382 Ga0500588_0111382_77_412 107
285 3300053149 Ga0500600_0047511 Ga0500600_0047511_1821_2168 107
286 3300053156 Ga0500622_0286053 Ga0500622_0286053_48_383 107
287 3300053178 Ga0500637_0077642 Ga0500637_0077642_884_1264 107
288 3300053725 Ga0500576_143122 Ga0500576_143122_409_789 107
289 3300061719 Ga0466962_0008687 Ga0466962_0008687_2695_3018 107
290 iso_pu_bacteria 2562617112 2563061134 107
291 iso_pu_bacteria 2711768613 2713476094 107

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05534

HicB

HicB family

75

122

0.94

Feature Viewer

pLDDT pTM Quality
74.2 0.39 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map