F353261

General Info

Members Datasets Scaffolds Average Seq Length
240 185 227 226

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0080288|Ga0501040_0080288_919_1653
Length 244
Sequence MTRPQSTAGGVSLSGVHKTYGDGATAVHALRGVDLEVPEGQLVALTGRSGAGKTTLLHVVAGLRPADRGRIVVAGLDVTAADDDALVRLRRDTVGVIHQDFSLLPLLTAEENVGVPLRITRTVPRRRDQRVAELLERTGLTAHAQQRPDEMSGGQQQRVAIARALVNEPRVVLADEPTAQLDSETGVRIMELLHQMVVEEGATALVATHDPLIEQLADSVWHLEDGRVTETSGSSATGAGQGSR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
3 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
4 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
5 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
6 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
7 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
8 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
9 2919395869 Microbacterium resistens 2980 Isolate Unclassified
10 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
11 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
12 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
13 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
14 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
15 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
46 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
61 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
109 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
110 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
111 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
112 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
118 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
119 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
120 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
121 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
122 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
123 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
126 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
127 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
128 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
129 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
130 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
131 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
132 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
144 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
145 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
146 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
149 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
150 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
151 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
163 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
164 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
165 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
172 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
173 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
174 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
175 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
176 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
177 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
178 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
179 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
180 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
181 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
182 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
183 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
184 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.58
Metatranscriptomes 0
Isolates 5.42

Biome Distribution

Category Percentage (%)
Aerial Root 0.83
Bulb 0
Endosphere 7.5
Nodule 0
Rhizoplane 4.58
Rhizosphere 74.17
Stem 0
Stem Tuber 0
Unclassified 12.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2663295 2162886007 Bacteria 6488
2 JGI24736J21556_1000891 3300001904 Bacteria 5513
3 JGI24740J21852_10010248 3300001979 Bacteria 3621
4 JGI25165J46597_1000032 3300003214 Bacteria 294371
5 Ga0065704_10000280 3300005289 Bacteria 50510
6 Ga0065704_10076691 3300005289 Bacteria 5016
7 Ga0065707_10090473 3300005295 Bacteria 4133
8 Ga0070658_10717684 3300005327 Bacteria 868
9 Ga0070670_100000239 3300005331 Bacteria 49801
10 Ga0070668_100003597 3300005347 Bacteria 11435
11 Ga0070668_100009575 3300005347 Bacteria 7190
12 Ga0070669_100001205 3300005353 Bacteria 18825
13 Ga0070669_100020482 3300005353 Bacteria 4724
14 Ga0070671_100085536 3300005355 Bacteria 2638
15 Ga0070671_100140447 3300005355 Bacteria 2038
16 Ga0070667_100000039 3300005367 Bacteria 170228
17 Ga0070667_100000641 3300005367 Bacteria 33965
18 Ga0070667_100001208 3300005367 Bacteria 23502
19 Ga0070714_100023631 3300005435 Bacteria 5052
20 Ga0070713_100678070 3300005436 Bacteria 983
21 Ga0070678_100283915 3300005456 Bacteria 1401
22 Ga0070678_100623587 3300005456 Bacteria 965
23 Ga0070681_10259240 3300005458 Bacteria 1651
24 Ga0068853_100032929 3300005539 Bacteria 4394
25 Ga0070696_100160985 3300005546 Bacteria 1653
26 Ga0070665_100000458 3300005548 Bacteria 59389
27 Ga0070665_100149896 3300005548 Bacteria 2335
28 Ga0068857_100280805 3300005577 Bacteria 1532
29 Ga0068852_100075794 3300005616 Bacteria 2968
30 Ga0068852_100253238 3300005616 Bacteria 1688
31 Ga0068864_100000016 3300005618 Bacteria 292454
32 Ga0068864_100060237 3300005618 Bacteria 3287
33 Ga0068861_100214505 3300005719 Bacteria 1623
34 Ga0068851_10089919 3300005834 Bacteria 1615
35 Ga0068863_100000033 3300005841 Bacteria 170238
36 Ga0068863_100000047 3300005841 Bacteria 140249
37 Ga0068858_100003263 3300005842 Bacteria 16173
38 Ga0068860_100167734 3300005843 Bacteria 2120
39 Ga0068862_100000040 3300005844 Bacteria 167832
40 Ga0068862_100028798 3300005844 Bacteria 4678
41 Ga0081539_10007623 3300005985 Bacteria 9767
42 Ga0070716_100042387 3300006173 Bacteria 2541
43 Ga0075428_100747471 3300006844 Bacteria 1041
44 Ga0105251_10113047 3300009011 Bacteria 1236
45 Ga0105250_10005935 3300009092 Bacteria 5403
46 Ga0111539_10158767 3300009094 Bacteria 2645
47 Ga0105245_10005928 3300009098 Bacteria 10734
48 Ga0105247_10137846 3300009101 Bacteria 1596
49 Ga0105247_10230841 3300009101 Bacteria 1256
50 Ga0105243_10542477 3300009148 Bacteria 1110
51 Ga0105242_10143674 3300009176 Bacteria 2073
52 Ga0105248_10000021 3300009177 Bacteria 276159
53 Ga0105248_10070969 3300009177 Bacteria 3911
54 Ga0105249_10000128 3300009553 Bacteria 101030
55 Ga0157371_10484479 3300013102 Bacteria 912
56 Ga0157369_10250131 3300013105 Bacteria 1850
57 Ga0163162_10014289 3300013306 Bacteria 7756
58 Ga0163162_10038285 3300013306 Bacteria 4786
59 Ga0163162_10058728 3300013306 Bacteria 3877
60 Ga0157372_10442358 3300013307 Bacteria 1515
61 Ga0182008_10124141 3300014497 Bacteria 1284
62 Ga0157379_10055057 3300014968 Bacteria 3554
63 Ga0209233_1000066 3300025261 Bacteria 381218
64 Ga0209455_1031703 3300025272 Bacteria 885
65 Ga0207656_10019825 3300025321 Bacteria 2664
66 Ga0207696_1005361 3300025711 Bacteria 5332
67 Ga0207713_1004913 3300025735 Bacteria 8544
68 Ga0207710_10112903 3300025900 Bacteria 1291
69 Ga0207681_10000090 3300025923 Bacteria 78944
70 Ga0207681_10042349 3300025923 Bacteria 3041
71 Ga0207650_10000398 3300025925 Bacteria 39522
72 Ga0207687_10001006 3300025927 Bacteria 19126
73 Ga0207700_10028592 3300025928 Bacteria 3922
74 Ga0207664_10091796 3300025929 Bacteria 2491
75 Ga0207644_10009592 3300025931 Bacteria 6357
76 Ga0207706_10158531 3300025933 Bacteria 1990
77 Ga0207709_10616722 3300025935 Bacteria 860
78 Ga0207711_10000025 3300025941 Bacteria 289972
79 Ga0207689_10480351 3300025942 Bacteria 1040
80 Ga0207667_10290000 3300025949 Bacteria 1672
81 Ga0207712_10000610 3300025961 Bacteria 28399
82 Ga0207668_10002025 3300025972 Bacteria 11827
83 Ga0207668_10002249 3300025972 Bacteria 11249
84 Ga0207658_10000401 3300025986 Bacteria 41615
85 Ga0207658_10000539 3300025986 Bacteria 34304
86 Ga0207658_10003439 3300025986 Bacteria 11199
87 Ga0207703_10000564 3300026035 Bacteria 38136
88 Ga0207639_10033260 3300026041 Bacteria 3802
89 Ga0207639_10053909 3300026041 Bacteria 3071
90 Ga0207641_10000002 3300026088 Bacteria 981004
91 Ga0207641_10000079 3300026088 Bacteria 141110
92 Ga0207676_10000005 3300026095 Bacteria 698744
93 Ga0207674_10060077 3300026116 Bacteria 3845
94 Ga0207675_100532971 3300026118 Bacteria 1172
95 Ga0268266_10000002 3300028379 Bacteria 3059047
96 Ga0268266_10045715 3300028379 Bacteria 3746
97 Ga0268266_10131301 3300028379 Bacteria 2240
98 Ga0268265_10000003 3300028380 Bacteria 949201
99 Ga0268265_10027622 3300028380 Bacteria 4052
100 Ga0268265_10174840 3300028380 Bacteria 1839
101 Ga0268264_10013314 3300028381 Bacteria 6771
102 Ga0265340_10048241 3300031247 Bacteria 2071
103 Ga0265340_10096187 3300031247 Bacteria 1380
104 Ga0307513_10034115 3300031456 Bacteria 5714
105 Ga0307513_10084494 3300031456 Bacteria 3260
106 Ga0307408_100082202 3300031548 Bacteria 2410
107 Ga0307405_10144610 3300031731 Bacteria 1663
108 Ga0307410_10043549 3300031852 Bacteria 2976
109 Ga0307406_10062074 3300031901 Bacteria 2416
110 Ga0307407_10461626 3300031903 Bacteria 924
111 Ga0307412_10000217 3300031911 Bacteria 38437
112 Ga0307412_10007490 3300031911 Bacteria 6196
113 Ga0307412_10063949 3300031911 Bacteria 2484
114 Ga0307409_100616479 3300031995 Bacteria 1074
115 Ga0307416_100127629 3300032002 Bacteria 2281
116 Ga0307416_100328215 3300032002 Bacteria 1536
117 Ga0307414_10000102 3300032004 Bacteria 61667
118 Ga0307414_10084004 3300032004 Bacteria 2340
119 Ga0307411_10069039 3300032005 Bacteria 2385
120 Ga0307415_100312040 3300032126 Bacteria 1307
121 Ga0307510_10009544 3300033180 Bacteria 11562
122 Ga0307510_10284331 3300033180 Bacteria 1123
123 Ga0395900_0065962 3300037418 Bacteria 3719
124 Ga0395898_0514155 3300037466 Bacteria 1138
125 Ga0395905_0096498 3300037471 Bacteria 2775
126 Ga0395905_0589622 3300037471 Bacteria 1013
127 Ga0436364_1146717 3300037853 Bacteria 1307
128 Ga0395901_0014233 3300038443 Bacteria 8099
129 Ga0451793_0621076 3300041452 Bacteria 1159
130 Ga0439441_071870 3300042001 Bacteria 743
131 Ga0450889_004425 3300042144 Bacteria 1390
132 Ga0466972_0033356 3300044658 Bacteria 2525
133 Ga0466965_0226055 3300044683 Bacteria 998
134 Ga0466963_0128635 3300044694 Bacteria 1748
135 Ga0466963_0363314 3300044694 Bacteria 1020
136 Ga0466970_0225541 3300044765 Bacteria 1046
137 Ga0466967_0122608 3300045976 Bacteria 2404
138 Ga0466967_0962781 3300045976 Bacteria 849
139 Ga0495638_0000249 3300046460 Bacteria 73312
140 Ga0495638_0000344 3300046460 Bacteria 58565
141 Ga0495650_0000058 3300046471 Bacteria 302308
142 Ga0495650_0005879 3300046471 Bacteria 7804
143 Ga0495583_0000262 3300046506 Bacteria 86241
144 Ga0495583_0002572 3300046506 Bacteria 15258
145 Ga0495616_0005044 3300046513 Bacteria 8215
146 Ga0495616_0255594 3300046513 Bacteria 751
147 Ga0495632_0004828 3300046519 Bacteria 9055
148 Ga0495648_0000015 3300046524 Bacteria 285838
149 Ga0495648_0262333 3300046524 Bacteria 828
150 Ga0495609_0036763 3300046538 Bacteria 2210
151 Ga0495633_0047066 3300046558 Bacteria 2039
152 Ga0495668_0008230 3300046616 Bacteria 6540
153 Ga0495668_0015552 3300046616 Bacteria 4440
154 Ga0495625_0000064 3300046660 Bacteria 174730
155 Ga0495625_0027096 3300046660 Bacteria 4320
156 Ga0495670_0015429 3300046691 Bacteria 3754
157 Ga0495671_0000084 3300046692 Bacteria 89406
158 Ga0495649_0236612 3300046694 Bacteria 941
159 Ga0495600_0000496 3300046809 Bacteria 20357
160 Ga0495677_0020823 3300047445 Bacteria 2377
161 Ga0495673_0000206 3300047469 Bacteria 89432
162 Ga0495686_0020430 3300047472 Bacteria 4416
163 Ga0496101_0107553 3300048904 Bacteria 2095
164 Ga0496102_0000162 3300048905 Bacteria 89746
165 Ga0496103_0000190 3300048906 Bacteria 61731
166 Ga0496104_0005413 3300048907 Bacteria 11171
167 Ga0496105_0000395 3300048908 Bacteria 28676
168 Ga0496108_0390772 3300048911 Bacteria 1215
169 Ga0496110_0427259 3300048913 Bacteria 1208
170 Ga0496111_0519139 3300048914 Bacteria 876
171 Ga0496112_0004154 3300048915 Bacteria 12193
172 Ga0496113_0000233 3300048916 Bacteria 26178
173 Ga0496116_0079436 3300048919 Bacteria 2041
174 Ga0496117_0000323 3300048920 Bacteria 83916
175 Ga0496118_0001409 3300048921 Bacteria 36243
176 Ga0496118_0003389 3300048921 Bacteria 20144
177 Ga0496119_0147554 3300048922 Bacteria 1264
178 Ga0496121_0000347 3300048924 Bacteria 96608
179 Ga0496121_0054535 3300048924 Bacteria 3338
180 Ga0496121_0055602 3300048924 Bacteria 3295
181 Ga0496122_0001715 3300048925 Bacteria 34006
182 Ga0496122_0002251 3300048925 Bacteria 27964
183 Ga0496123_0000518 3300048926 Bacteria 67308
184 Ga0496123_0002605 3300048926 Bacteria 21912
185 Ga0496124_0001292 3300048927 Bacteria 38002
186 Ga0496124_0005357 3300048927 Bacteria 14482
187 Ga0496124_0007025 3300048927 Bacteria 12060
188 Ga0496124_0100741 3300048927 Bacteria 2341
189 Ga0496125_0003763 3300048928 Bacteria 18060
190 Ga0496126_0000044 3300048929 Bacteria 335904
191 Ga0501034_0114666 3300049571 Bacteria 2683
192 Ga0501034_0347417 3300049571 Bacteria 1412
193 Ga0501036_0480868 3300049572 Bacteria 1034
194 Ga0501040_0065945 3300049576 Bacteria 2495
195 Ga0501040_0080288 3300049576 Bacteria 2259
196 Ga0501046_0048443 3300049580 Bacteria 3365
197 Ga0501047_0005491 3300049581 Bacteria 11928
198 Ga0501048_0101768 3300049582 Bacteria 2027
199 Ga0501067_0001557 3300049583 Bacteria 12517
200 Ga0501072_0022158 3300049588 Bacteria 4928
201 Ga0501073_0079664 3300049589 Bacteria 2279
202 Ga0501223_000531 3300049663 Bacteria 9182
203 Ga0501224_000012 3300049664 Bacteria 92585
204 Ga0501233_000809 3300049668 Bacteria 5246
205 Ga0501225_0000035 3300049705 Bacteria 46375
206 Ga0501079_0095425 3300049741 Bacteria 2305
207 Ga0501079_0326276 3300049741 Bacteria 1202
208 Ga0501080_0051020 3300049742 Bacteria 3849
209 Ga0501044_0003519 3300049823 Bacteria 17628
210 Ga0501226_000091 3300049853 Bacteria 23656
211 nmdc:mga09592_77098_c1 3300050508 Bacteria 2835
212 Ga0500643_002654 3300053087 Bacteria 9025
213 Ga0500647_0108538 3300053091 Bacteria 1321
214 Ga0500562_009481 3300053108 Bacteria 2458
215 Ga0500595_001738 3300053119 Bacteria 11365
216 Ga0500597_019710 3300053120 Bacteria 2636
217 Ga0500658_0001066 3300053134 Bacteria 11224
218 Ga0500559_0018002 3300053136 Bacteria 2986
219 Ga0500559_0029981 3300053136 Bacteria 2331
220 Ga0500568_0018274 3300053139 Bacteria 3073
221 Ga0500604_0014988 3300053151 Bacteria 2116
222 Ga0500622_0173706 3300053156 Bacteria 1001
223 Ga0500624_000001 3300053157 Bacteria 284974
224 Ga0500627_0000994 3300053158 Bacteria 7709
225 Ga0500636_0001875 3300053177 Bacteria 11512
226 Ga0500637_0000010 3300053178 Bacteria 81649
227 Ga0501084_0000017 3300054114 Bacteria 148659

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046694 Ga0495649_0236612 Ga0495649_0236612_10_597 195
2 3300013105 Ga0157369_10250131 Ga0157369_102501312 203
3 3300048911 Ga0496108_0390772 Ga0496108_0390772_185_814 203
4 3300048913 Ga0496110_0427259 Ga0496110_0427259_114_743 203
5 3300001979 JGI24740J21852_10010248 JGI24740J21852_100102483 211
6 3300013102 Ga0157371_10484479 Ga0157371_104844791 211
7 3300005616 Ga0068852_100253238 Ga0068852_1002532382 214
8 iso_pu_bacteria 2919395869 2919396390 218
9 3300046513 Ga0495616_0255594 Ga0495616_0255594_64_723 219
10 3300046538 Ga0495609_0036763 Ga0495609_0036763_1519_2178 219
11 3300053156 Ga0500622_0173706 Ga0500622_0173706_270_944 220
12 iso_pu_bacteria 2879163058 2879166972 220
13 iso_pu_bacteria 2895880812 2895886115 220
14 iso_pu_bacteria 2928100450 2928101680 220
15 iso_pu_bacteria 2928959182 2928959770 220
16 iso_pu_bacteria 2990265787 2990267768 220
17 iso_pu_bacteria 2993693658 2993694991 220
18 3300001904 JGI24736J21556_1000891 JGI24736J21556_10008912 223
19 3300005347 Ga0070668_100009575 Ga0070668_1000095754 223
20 3300005353 Ga0070669_100020482 Ga0070669_1000204823 223
21 3300005367 Ga0070667_100000641 Ga0070667_1000006413 223
22 3300005539 Ga0068853_100032929 Ga0068853_1000329293 223
23 3300005577 Ga0068857_100280805 Ga0068857_1002808052 223
24 3300005834 Ga0068851_10089919 Ga0068851_100899192 223
25 3300005841 Ga0068863_100000047 Ga0068863_10000004775 223
26 3300025321 Ga0207656_10019825 Ga0207656_100198253 223
27 3300025923 Ga0207681_10042349 Ga0207681_100423492 223
28 3300025972 Ga0207668_10002025 Ga0207668_100020257 223
29 3300025986 Ga0207658_10000539 Ga0207658_1000053933 223
30 3300026041 Ga0207639_10033260 Ga0207639_100332603 223
31 3300026088 Ga0207641_10000079 Ga0207641_1000007974 223
32 3300026116 Ga0207674_10060077 Ga0207674_100600772 223
33 3300028380 Ga0268265_10174840 Ga0268265_101748402 223
34 3300031548 Ga0307408_100082202 Ga0307408_1000822022 223
35 3300031731 Ga0307405_10144610 Ga0307405_101446102 223
36 3300031901 Ga0307406_10062074 Ga0307406_100620743 223
37 3300031903 Ga0307407_10461626 Ga0307407_104616261 223
38 3300031911 Ga0307412_10000217 Ga0307412_100002172 223
39 3300031911 Ga0307412_10063949 Ga0307412_100639492 223
40 3300031995 Ga0307409_100616479 Ga0307409_1006164792 223
41 3300032002 Ga0307416_100127629 Ga0307416_1001276293 223
42 3300032004 Ga0307414_10000102 Ga0307414_1000010245 223
43 3300032004 Ga0307414_10084004 Ga0307414_100840042 223
44 3300033180 Ga0307510_10284331 Ga0307510_102843311 223
45 3300042001 Ga0439441_071870 Ga0439441_071870_45_716 223
46 3300046460 Ga0495638_0000249 Ga0495638_0000249_44179_44850 223
47 3300046471 Ga0495650_0005879 Ga0495650_0005879_5479_6168 223
48 3300046506 Ga0495583_0000262 Ga0495583_0000262_35485_36156 223
49 3300046513 Ga0495616_0005044 Ga0495616_0005044_5197_5871 223
50 3300046519 Ga0495632_0004828 Ga0495632_0004828_2837_3508 223
51 3300046524 Ga0495648_0000015 Ga0495648_0000015_246253_246924 223
52 3300046616 Ga0495668_0008230 Ga0495668_0008230_4928_5602 223
53 3300046692 Ga0495671_0000084 Ga0495671_0000084_35685_36356 223
54 3300047469 Ga0495673_0000206 Ga0495673_0000206_52188_52859 223
55 3300048927 Ga0496124_0007025 Ga0496124_0007025_2770_3441 223
56 3300049571 Ga0501034_0114666 Ga0501034_0114666_576_1247 223
57 3300049663 Ga0501223_000531 Ga0501223_000531_529_1200 223
58 3300049664 Ga0501224_000012 Ga0501224_000012_77190_77861 223
59 3300049668 Ga0501233_000809 Ga0501233_000809_1922_2593 223
60 3300049705 Ga0501225_0000035 Ga0501225_0000035_44893_45564 223
61 3300049853 Ga0501226_000091 Ga0501226_000091_14683_15354 223
62 3300053108 Ga0500562_009481 Ga0500562_009481_540_1211 223
63 3300053120 Ga0500597_019710 Ga0500597_019710_1371_2054 223
64 3300053151 Ga0500604_0014988 Ga0500604_0014988_238_912 223
65 3300053157 Ga0500624_000001 Ga0500624_000001_214792_215475 223
66 3300053158 Ga0500627_0000994 Ga0500627_0000994_2213_2887 223
67 3300053178 Ga0500637_0000010 Ga0500637_0000010_79313_79996 223
68 3300003214 JGI25165J46597_1000032 JGI25165J46597_100003219 224
69 3300005327 Ga0070658_10717684 Ga0070658_107176842 224
70 3300005347 Ga0070668_100003597 Ga0070668_1000035977 224
71 3300005353 Ga0070669_100001205 Ga0070669_1000012053 224
72 3300005355 Ga0070671_100085536 Ga0070671_1000855362 224
73 3300005355 Ga0070671_100140447 Ga0070671_1001404472 224
74 3300005435 Ga0070714_100023631 Ga0070714_1000236313 224
75 3300005436 Ga0070713_100678070 Ga0070713_1006780701 224
76 3300005456 Ga0070678_100283915 Ga0070678_1002839152 224
77 3300005548 Ga0070665_100000458 Ga0070665_10000045826 224
78 3300005618 Ga0068864_100060237 Ga0068864_1000602375 224
79 3300005719 Ga0068861_100214505 Ga0068861_1002145052 224
80 3300005842 Ga0068858_100003263 Ga0068858_10000326311 224
81 3300006173 Ga0070716_100042387 Ga0070716_1000423872 224
82 3300009098 Ga0105245_10005928 Ga0105245_1000592810 224
83 3300009148 Ga0105243_10542477 Ga0105243_105424772 224
84 3300009176 Ga0105242_10143674 Ga0105242_101436744 224
85 3300009177 Ga0105248_10070969 Ga0105248_100709692 224
86 3300013307 Ga0157372_10442358 Ga0157372_104423582 224
87 3300025261 Ga0209233_1000066 Ga0209233_100006620 224
88 3300025272 Ga0209455_1031703 Ga0209455_10317031 224
89 3300025927 Ga0207687_10001006 Ga0207687_1000100616 224
90 3300025928 Ga0207700_10028592 Ga0207700_100285923 224
91 3300025929 Ga0207664_10091796 Ga0207664_100917963 224
92 3300025935 Ga0207709_10616722 Ga0207709_106167222 224
93 3300025942 Ga0207689_10480351 Ga0207689_104803512 224
94 3300025949 Ga0207667_10290000 Ga0207667_102900002 224
95 3300026035 Ga0207703_10000564 Ga0207703_1000056428 224
96 3300026041 Ga0207639_10053909 Ga0207639_100539095 224
97 3300026118 Ga0207675_100532971 Ga0207675_1005329712 224
98 3300028379 Ga0268266_10000002 Ga0268266_100000022225 224
99 3300031456 Ga0307513_10084494 Ga0307513_100844942 224
100 3300031852 Ga0307410_10043549 Ga0307410_100435491 224
101 3300031911 Ga0307412_10007490 Ga0307412_100074903 224
102 3300032002 Ga0307416_100328215 Ga0307416_1003282152 224
103 3300032005 Ga0307411_10069039 Ga0307411_100690392 224
104 3300032126 Ga0307415_100312040 Ga0307415_1003120401 224
105 3300033180 Ga0307510_10009544 Ga0307510_100095447 224
106 3300037418 Ga0395900_0065962 Ga0395900_0065962_1197_1871 224
107 3300037466 Ga0395898_0514155 Ga0395898_0514155_42_716 224
108 3300037471 Ga0395905_0096498 Ga0395905_0096498_1197_1871 224
109 3300037471 Ga0395905_0589622 Ga0395905_0589622_122_796 224
110 3300037853 Ga0436364_1146717 Ga0436364_1146717_350_1024 224
111 3300038443 Ga0395901_0014233 Ga0395901_0014233_6996_7670 224
112 3300041452 Ga0451793_0621076 Ga0451793_0621076_466_1140 224
113 3300044658 Ga0466972_0033356 Ga0466972_0033356_610_1284 224
114 3300044683 Ga0466965_0226055 Ga0466965_0226055_132_806 224
115 3300044694 Ga0466963_0128635 Ga0466963_0128635_543_1217 224
116 3300044694 Ga0466963_0363314 Ga0466963_0363314_204_878 224
117 3300044765 Ga0466970_0225541 Ga0466970_0225541_15_689 224
118 3300045976 Ga0466967_0122608 Ga0466967_0122608_1257_1931 224
119 3300045976 Ga0466967_0962781 Ga0466967_0962781_158_832 224
120 3300046460 Ga0495638_0000344 Ga0495638_0000344_27737_28411 224
121 3300046471 Ga0495650_0000058 Ga0495650_0000058_31657_32331 224
122 3300046506 Ga0495583_0002572 Ga0495583_0002572_3268_3942 224
123 3300046524 Ga0495648_0262333 Ga0495648_0262333_52_726 224
124 3300046558 Ga0495633_0047066 Ga0495633_0047066_186_860 224
125 3300046616 Ga0495668_0015552 Ga0495668_0015552_1266_1940 224
126 3300046660 Ga0495625_0000064 Ga0495625_0000064_173308_173982 224
127 3300046660 Ga0495625_0027096 Ga0495625_0027096_956_1630 224
128 3300046691 Ga0495670_0015429 Ga0495670_0015429_1836_2510 224
129 3300046809 Ga0495600_0000496 Ga0495600_0000496_13309_13983 224
130 3300047445 Ga0495677_0020823 Ga0495677_0020823_814_1488 224
131 3300047472 Ga0495686_0020430 Ga0495686_0020430_2642_3316 224
132 3300048922 Ga0496119_0147554 Ga0496119_0147554_114_797 224
133 3300048924 Ga0496121_0055602 Ga0496121_0055602_2436_3110 224
134 3300048925 Ga0496122_0001715 Ga0496122_0001715_29880_30566 224
135 3300048926 Ga0496123_0000518 Ga0496123_0000518_51743_52429 224
136 3300048927 Ga0496124_0001292 Ga0496124_0001292_22080_22763 224
137 3300048927 Ga0496124_0100741 Ga0496124_0100741_1301_1984 224
138 3300053087 Ga0500643_002654 Ga0500643_002654_4986_5660 224
139 3300053091 Ga0500647_0108538 Ga0500647_0108538_406_1080 224
140 3300053119 Ga0500595_001738 Ga0500595_001738_7610_8284 224
141 3300053134 Ga0500658_0001066 Ga0500658_0001066_6165_6839 224
142 3300053139 Ga0500568_0018274 Ga0500568_0018274_177_851 224
143 3300053177 Ga0500636_0001875 Ga0500636_0001875_7196_7870 224
144 iso_pu_bacteria 2738541275 2738709981 224
145 iso_pu_bacteria 2738541301 2738848406 224
146 iso_pu_bacteria 2738541304 2738864135 224
147 iso_pu_bacteria 2738543022 2739296653 224
148 iso_pu_bacteria 2738543033 2739358331 224
149 3300005456 Ga0070678_100623587 Ga0070678_1006235872 226
150 3300005458 Ga0070681_10259240 Ga0070681_102592402 227
151 3300005546 Ga0070696_100160985 Ga0070696_1001609852 227
152 3300006844 Ga0075428_100747471 Ga0075428_1007474712 227
153 3300009094 Ga0111539_10158767 Ga0111539_101587673 227
154 3300025933 Ga0207706_10158531 Ga0207706_101585312 227
155 3300031456 Ga0307513_10034115 Ga0307513_100341152 227
156 3300042144 Ga0450889_004425 Ga0450889_004425_419_1102 227
157 3300048924 Ga0496121_0000347 Ga0496121_0000347_25925_26608 227
158 3300050508 nmdc:mga09592_77098_c1 nmdc:mga09592_77098_c1_116_799 227
159 3300005616 Ga0068852_100075794 Ga0068852_1000757941 228
160 3300031247 Ga0265340_10048241 Ga0265340_100482412 228
161 3300031247 Ga0265340_10096187 Ga0265340_100961872 228
162 3300049571 Ga0501034_0347417 Ga0501034_0347417_141_854 228
163 3300049576 Ga0501040_0065945 Ga0501040_0065945_138_869 228
164 3300049583 Ga0501067_0001557 Ga0501067_0001557_4369_5085 228
165 3300049588 Ga0501072_0022158 Ga0501072_0022158_3775_4488 228
166 3300049589 Ga0501073_0079664 Ga0501073_0079664_1306_2019 228
167 3300049741 Ga0501079_0326276 Ga0501079_0326276_141_854 228
168 3300054114 Ga0501084_0000017 Ga0501084_0000017_27221_27943 228
169 2162886007 SwRhRL2b_contig_2663295 SwRhRL2b_0930.00008240 229
170 3300005289 Ga0065704_10000280 Ga0065704_100002804 229
171 3300005289 Ga0065704_10076691 Ga0065704_100766915 229
172 3300005295 Ga0065707_10090473 Ga0065707_100904733 229
173 3300005331 Ga0070670_100000239 Ga0070670_10000023919 229
174 3300005367 Ga0070667_100000039 Ga0070667_100000039101 229
175 3300005367 Ga0070667_100001208 Ga0070667_1000012088 229
176 3300005548 Ga0070665_100149896 Ga0070665_1001498963 229
177 3300005618 Ga0068864_100000016 Ga0068864_100000016242 229
178 3300005841 Ga0068863_100000033 Ga0068863_10000003395 229
179 3300005843 Ga0068860_100167734 Ga0068860_1001677341 229
180 3300005844 Ga0068862_100000040 Ga0068862_10000004094 229
181 3300005844 Ga0068862_100028798 Ga0068862_1000287983 229
182 3300005985 Ga0081539_10007623 Ga0081539_100076239 229
183 3300009011 Ga0105251_10113047 Ga0105251_101130472 229
184 3300009092 Ga0105250_10005935 Ga0105250_100059354 229
185 3300009101 Ga0105247_10137846 Ga0105247_101378462 229
186 3300009101 Ga0105247_10230841 Ga0105247_102308412 229
187 3300009177 Ga0105248_10000021 Ga0105248_10000021211 229
188 3300009553 Ga0105249_10000128 Ga0105249_1000012884 229
189 3300013306 Ga0163162_10014289 Ga0163162_100142896 229
190 3300013306 Ga0163162_10038285 Ga0163162_100382852 229
191 3300013306 Ga0163162_10058728 Ga0163162_100587283 229
192 3300014497 Ga0182008_10124141 Ga0182008_101241412 229
193 3300014968 Ga0157379_10055057 Ga0157379_100550572 229
194 3300025711 Ga0207696_1005361 Ga0207696_10053613 229
195 3300025735 Ga0207713_1004913 Ga0207713_10049136 229
196 3300025900 Ga0207710_10112903 Ga0207710_101129032 229
197 3300025923 Ga0207681_10000090 Ga0207681_1000009057 229
198 3300025925 Ga0207650_10000398 Ga0207650_100003988 229
199 3300025931 Ga0207644_10009592 Ga0207644_100095922 229
200 3300025941 Ga0207711_10000025 Ga0207711_1000002585 229
201 3300025961 Ga0207712_10000610 Ga0207712_1000061011 229
202 3300025972 Ga0207668_10002249 Ga0207668_100022492 229
203 3300025986 Ga0207658_10000401 Ga0207658_1000040122 229
204 3300025986 Ga0207658_10003439 Ga0207658_1000343910 229
205 3300026088 Ga0207641_10000002 Ga0207641_1000000294 229
206 3300026095 Ga0207676_10000005 Ga0207676_10000005713 229
207 3300028379 Ga0268266_10045715 Ga0268266_100457154 229
208 3300028379 Ga0268266_10131301 Ga0268266_101313013 229
209 3300028380 Ga0268265_10000003 Ga0268265_10000003897 229
210 3300028380 Ga0268265_10027622 Ga0268265_100276223 229
211 3300028381 Ga0268264_10013314 Ga0268264_100133146 229
212 3300048904 Ga0496101_0107553 Ga0496101_0107553_943_1632 229
213 3300048905 Ga0496102_0000162 Ga0496102_0000162_88119_88808 229
214 3300048906 Ga0496103_0000190 Ga0496103_0000190_52874_53563 229
215 3300048907 Ga0496104_0005413 Ga0496104_0005413_7243_7932 229
216 3300048908 Ga0496105_0000395 Ga0496105_0000395_14781_15470 229
217 3300048914 Ga0496111_0519139 Ga0496111_0519139_80_769 229
218 3300048915 Ga0496112_0004154 Ga0496112_0004154_1568_2257 229
219 3300048916 Ga0496113_0000233 Ga0496113_0000233_19163_19852 229
220 3300048919 Ga0496116_0079436 Ga0496116_0079436_1171_1860 229
221 3300048920 Ga0496117_0000323 Ga0496117_0000323_81345_82034 229
222 3300048921 Ga0496118_0001409 Ga0496118_0001409_6622_7311 229
223 3300048921 Ga0496118_0003389 Ga0496118_0003389_18133_18822 229
224 3300048924 Ga0496121_0054535 Ga0496121_0054535_1607_2296 229
225 3300048925 Ga0496122_0002251 Ga0496122_0002251_19164_19853 229
226 3300048926 Ga0496123_0002605 Ga0496123_0002605_6213_6902 229
227 3300048927 Ga0496124_0005357 Ga0496124_0005357_4399_5088 229
228 3300048928 Ga0496125_0003763 Ga0496125_0003763_5758_6447 229
229 3300048929 Ga0496126_0000044 Ga0496126_0000044_119567_120256 229
230 3300049572 Ga0501036_0480868 Ga0501036_0480868_68_799 229
231 3300049576 Ga0501040_0080288 Ga0501040_0080288_919_1653 229
232 3300049580 Ga0501046_0048443 Ga0501046_0048443_326_1039 229
233 3300049581 Ga0501047_0005491 Ga0501047_0005491_8271_8984 229
234 3300049582 Ga0501048_0101768 Ga0501048_0101768_62_793 229
235 3300049741 Ga0501079_0095425 Ga0501079_0095425_860_1573 229
236 3300049742 Ga0501080_0051020 Ga0501080_0051020_803_1516 229
237 3300049823 Ga0501044_0003519 Ga0501044_0003519_3095_3808 229
238 3300053136 Ga0500559_0018002 Ga0500559_0018002_724_1425 229
239 3300053136 Ga0500559_0029981 Ga0500559_0029981_934_1635 229
240 iso_pu_bacteria 2946787523 2946791081 229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

30

179

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w7a-assembly2.cif.gz_E heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data 0.9459 9 227
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9441 9 229
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9411 9 228
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9409 8 229
5ws4-assembly1.cif.gz_B crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii 0.9383 7 229
ID Description Score Start End Superfamily
af_Q2G0D8_1_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.961 9 228 3.40.50.300
af_P9WQK1_1_231_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.956 7 229 3.40.50.300
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9542 37 229 3.40.50.300
af_P0A9T8_2_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.953 8 229 3.40.50.300
af_Q2FUZ1_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9489 10 229 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2D4VMT8-F1-model_v4 ABC transporter 0.9835 9 229 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0044874
GO:0089705
AF-A0A2U3AGM8-F1-model_v4 Hemin ABC transporter ATP-binding protein 0.9659 9 229 GO:0005524
GO:0016887
AF-A0A353M4F4-F1-model_v4 Lipoprotein-releasing system ATP-binding protein LolD 0.9639 47 206 GO:0005524
GO:0005886
GO:0016887
AF-A0A0P6XHT0-F1-model_v4 ABC transporter ATP-binding protein 0.9622 12 229 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A316F6D1-F1-model_v4 Putative ABC transport system ATP-binding protein 0.9604 11 229 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
92.95 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map