F352387

General Info

Members Datasets Scaffolds Average Seq Length
239 170 233 152

Family's Representative Sequence

Representative Sequence 3300060353|Ga0501082_0146211|Ga0501082_0146211_899_1426
Length 175
Sequence LSLGPGAKDPAPGRLEADRRGGGPLTEVRFYHLQRTSLEAALPKLLERTLARGQRAVVMAGSSERVEALTAHLWTYDPNSFLPHGSKRDGHPDRQPVWLTDQDENPNAAAVLFLTDGAQSGAMSGFELCVEMLDGQDEAAVAAGRQRWAAYKEAGHSLVYYQQDENGRWQEKARG

Samples

Sample ID Description Type Environment
1 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
2 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
3 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
4 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
5 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
45 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
72 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
73 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
74 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
75 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
80 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
89 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
90 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
91 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
97 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
98 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
99 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
100 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
101 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
102 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
103 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
104 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
105 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
106 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
107 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
108 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
114 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
115 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
116 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
119 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
120 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
134 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
141 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
142 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
145 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
149 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
155 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
156 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
157 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
158 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
159 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
160 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
161 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
162 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
163 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
164 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
167 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
168 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.49
Metatranscriptomes 0
Isolates 2.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.23
Nodule 0
Rhizoplane 1.67
Rhizosphere 76.99
Stem 0
Stem Tuber 0
Unclassified 7.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10116880 3300001989 Bacteria 798
2 JGI25151J46595_10000192 3300003187 Bacteria 75239
3 JGI25153J46596_10000309 3300003215 Bacteria 36023
4 rootH1_10124833 3300003316 Bacteria 1556
5 rootH2_10016009 3300003320 Bacteria 30912
6 rootL2_10112719 3300003322 Bacteria 1890
7 JGI25160J50197_1003215 3300003354 Bacteria 7389
8 Ga0065704_10127105 3300005289 Bacteria 1680
9 Ga0068869_101551366 3300005334 Bacteria 589
10 Ga0068868_100829720 3300005338 Bacteria 836
11 Ga0070669_100034061 3300005353 Bacteria 3687
12 Ga0070674_100064006 3300005356 Bacteria 2576
13 Ga0070667_100565081 3300005367 Bacteria 1046
14 Ga0070705_100087103 3300005440 Bacteria 1935
15 Ga0070700_101086682 3300005441 Bacteria 662
16 Ga0070694_100006402 3300005444 Bacteria 7141
17 Ga0070698_101182709 3300005471 Bacteria 714
18 Ga0070697_100458384 3300005536 Bacteria 1111
19 Ga0068853_100328876 3300005539 Bacteria 1418
20 Ga0070696_100045635 3300005546 Bacteria 3036
21 Ga0070696_100124832 3300005546 Bacteria 1866
22 Ga0070696_100126939 3300005546 Bacteria 1852
23 Ga0068864_101514098 3300005618 Bacteria 674
24 Ga0068866_10107920 3300005718 Bacteria 1548
25 Ga0068861_100152643 3300005719 Bacteria 1897
26 Ga0068858_100717723 3300005842 Bacteria 973
27 Ga0068860_100733425 3300005843 Bacteria 999
28 Ga0068862_100011428 3300005844 Bacteria 7328
29 Ga0081455_10266124 3300005937 Bacteria 1246
30 Ga0081538_10002230 3300005981 Bacteria 19192
31 Ga0081540_1058425 3300005983 Bacteria 1858
32 Ga0075362_10364258 3300006177 Bacteria 725
33 Ga0097621_100799631 3300006237 Bacteria 874
34 Ga0068865_100205647 3300006881 Bacteria 1531
35 Ga0075436_100123523 3300006914 Bacteria 1813
36 Ga0105240_10016338 3300009093 Bacteria 10052
37 Ga0111539_10003065 3300009094 Bacteria 22143
38 Ga0111539_10473178 3300009094 Bacteria 1459
39 Ga0114129_10116677 3300009147 Bacteria 3678
40 Ga0105237_10159420 3300009545 Bacteria 2254
41 Ga0105249_10218241 3300009553 Bacteria 1875
42 Ga0105029_103206 3300009984 Bacteria 1087
43 Ga0105033_107552 3300009986 Bacteria 944
44 Ga0163163_11282856 3300014325 Bacteria 795
45 Ga0157380_10370106 3300014326 Bacteria 1348
46 Ga0157380_11062414 3300014326 Bacteria 847
47 Ga0157379_10519003 3300014968 Bacteria 1106
48 Ga0209455_1001393 3300025272 Bacteria 10984
49 Ga0209130_1003148 3300025284 Bacteria 7304
50 Ga0209675_1047919 3300025291 Bacteria 895
51 Ga0209676_1000159 3300025292 Bacteria 161731
52 Ga0209676_1011507 3300025292 Bacteria 3560
53 Ga0209025_1000077 3300025294 Bacteria 271958
54 Ga0209025_1164553 3300025294 Unclassified 592
55 Ga0209564_1043772 3300025295 Bacteria 1170
56 Ga0209758_1000005 3300025297 Bacteria 1368918
57 Ga0209758_1005859 3300025297 Bacteria 9176
58 Ga0209758_1006515 3300025297 Bacteria 8334
59 Ga0209050_1017443 3300025298 Bacteria 2863
60 Ga0209050_1083682 3300025298 Unclassified 671
61 Ga0207426_1000304 3300025302 Bacteria 96312
62 Ga0209257_1030316 3300025304 Bacteria 1748
63 Ga0207642_10334176 3300025899 Bacteria 889
64 Ga0207710_10283884 3300025900 Bacteria 833
65 Ga0207669_10092501 3300025937 Bacteria 1973
66 Ga0207689_10872717 3300025942 Unclassified 759
67 Ga0207679_11255161 3300025945 Bacteria 680
68 Ga0207639_10236931 3300026041 Bacteria 1585
69 Ga0207708_11135080 3300026075 Bacteria 682
70 Ga0207648_10291083 3300026089 Bacteria 1462
71 Ga0207676_10880426 3300026095 Bacteria 877
72 Ga0207675_100114534 3300026118 Bacteria 2547
73 Ga0207428_10000096 3300027907 Bacteria 123081
74 Ga0268265_10464589 3300028380 Bacteria 1185
75 Ga0268265_10507508 3300028380 Bacteria 1137
76 Ga0265318_10060216 3300028577 Bacteria 1415
77 Ga0307517_10088771 3300028786 Bacteria 2552
78 Ga0307517_10125028 3300028786 Bacteria 1881
79 Ga0307512_10255355 3300030522 Bacteria 868
80 Ga0265320_10000550 3300031240 Bacteria 28890
81 Ga0265327_10034231 3300031251 Bacteria 2822
82 Ga0265316_10122829 3300031344 Bacteria 1960
83 Ga0307513_10375473 3300031456 Bacteria 1163
84 Ga0307408_100166749 3300031548 Bacteria 1755
85 Ga0307408_100264625 3300031548 Bacteria 1425
86 Ga0265314_10028899 3300031711 Bacteria 4126
87 Ga0307516_10203681 3300031730 Bacteria 1697
88 Ga0307516_10722935 3300031730 Bacteria 654
89 Ga0307413_10006096 3300031824 Bacteria 5467
90 Ga0307410_10010012 3300031852 Bacteria 5349
91 Ga0307410_10717985 3300031852 Bacteria 844
92 Ga0307406_10884363 3300031901 Bacteria 759
93 Ga0307409_100013892 3300031995 Bacteria 5208
94 Ga0307409_100506597 3300031995 Bacteria 1177
95 Ga0307409_101598407 3300031995 Bacteria 680
96 Ga0307416_100278428 3300032002 Bacteria 1648
97 Ga0307414_10482146 3300032004 Bacteria 1094
98 Ga0307414_11327393 3300032004 Bacteria 668
99 Ga0307411_10036592 3300032005 Bacteria 3077
100 Ga0307510_10194773 3300033180 Bacteria 1570
101 Ga0373932_0161548 3300035112 Bacteria 775
102 Ga0373932_0199435 3300035112 Bacteria 711
103 Ga0373939_0350399 3300035114 Bacteria 601
104 Ga0373931_0022288 3300035691 Bacteria 3187
105 Ga0373931_0275773 3300035691 Bacteria 1031
106 Ga0395900_0336060 3300037418 Bacteria 1487
107 Ga0395900_0380130 3300037418 Bacteria 1380
108 Ga0395900_1220931 3300037418 Bacteria 667
109 Ga0395905_1267216 3300037471 Bacteria 641
110 Ga0395901_0183503 3300038443 Bacteria 2195
111 Ga0395901_0254761 3300038443 Bacteria 1828
112 Ga0395901_0686428 3300038443 Bacteria 1023
113 Ga0436365_1310453 3300039437 Bacteria 1301
114 Ga0436361_0927822 3300039447 Bacteria 1476
115 Ga0439465_0338285 3300041413 Bacteria 567
116 Ga0451798_0226351 3300041458 Bacteria 894
117 Ga0451807_0523356 3300041486 Bacteria 1711
118 Ga0451841_0689141 3300041498 Unclassified 584
119 Ga0439433_0039907 3300041999 Bacteria 1091
120 Ga0450889_015399 3300042144 Bacteria 821
121 Ga0450906_042250 3300042145 Bacteria 805
122 Ga0450907_023674 3300042146 Bacteria 1037
123 Ga0451577_0056001 3300042876 Bacteria 3517
124 Ga0466969_0067912 3300044656 Bacteria 1719
125 Ga0453683_0417316 3300044673 Bacteria 866
126 Ga0466966_0094596 3300044684 Bacteria 1852
127 Ga0466961_0619694 3300044693 Bacteria 650
128 Ga0453684_0023259 3300044712 Bacteria 9142
129 Ga0466971_0191006 3300044719 Bacteria 965
130 Ga0451576_0227672 3300045051 Bacteria 1947
131 Ga0451576_1001094 3300045051 Bacteria 876
132 Ga0451576_1730258 3300045051 Unclassified 647
133 Ga0451576_2171635 3300045051 Bacteria 570
134 Ga0466958_0498147 3300045836 Bacteria 790
135 Ga0495610_0014511 3300046512 Bacteria 4624
136 Ga0495610_0092841 3300046512 Bacteria 1365
137 Ga0495669_0035089 3300046684 Bacteria 2214
138 Ga0496106_0590495 3300048909 Bacteria 890
139 Ga0496112_0952979 3300048915 Bacteria 779
140 Ga0496122_0135947 3300048925 Bacteria 1549
141 Ga0495682_0127373 3300049460 Bacteria 911
142 Ga0501031_0395203 3300049568 Bacteria 894
143 Ga0501032_0006388 3300049569 Bacteria 8681
144 Ga0501033_0006267 3300049570 Bacteria 9324
145 Ga0501034_0014375 3300049571 Bacteria 8155
146 Ga0501034_0026493 3300049571 Bacteria 5904
147 Ga0501034_0141229 3300049571 Bacteria 2387
148 Ga0501034_1072927 3300049571 Unclassified 687
149 Ga0501036_0003716 3300049572 Bacteria 12235
150 Ga0501036_0091543 3300049572 Bacteria 2569
151 Ga0501036_0772564 3300049572 Bacteria 792
152 Ga0501037_0005152 3300049573 Bacteria 9508
153 Ga0501037_0032813 3300049573 Bacteria 3836
154 Ga0501037_0608880 3300049573 Bacteria 733
155 Ga0501038_0000855 3300049574 Bacteria 27001
156 Ga0501038_0099509 3300049574 Bacteria 2424
157 Ga0501038_0773673 3300049574 Bacteria 715
158 Ga0501039_0001098 3300049575 Bacteria 19845
159 Ga0501042_0829642 3300049578 Unclassified 673
160 Ga0501042_1084166 3300049578 Unclassified 584
161 Ga0501043_0006194 3300049579 Bacteria 9613
162 Ga0501043_0716587 3300049579 Bacteria 730
163 Ga0501046_0001693 3300049580 Bacteria 21063
164 Ga0501047_0103095 3300049581 Bacteria 2732
165 Ga0501047_0253014 3300049581 Bacteria 1610
166 Ga0501048_0044796 3300049582 Bacteria 3161
167 Ga0501048_0074570 3300049582 Bacteria 2394
168 Ga0501048_0747364 3300049582 Bacteria 703
169 Ga0501067_0020087 3300049583 Bacteria 3695
170 Ga0501069_0000530 3300049585 Bacteria 17469
171 Ga0501070_0002757 3300049586 Bacteria 15330
172 Ga0501070_0528611 3300049586 Bacteria 946
173 Ga0501071_1157535 3300049587 Unclassified 598
174 Ga0501071_1206161 3300049587 Bacteria 585
175 Ga0501071_1566003 3300049587 Bacteria 509
176 Ga0501072_0063302 3300049588 Bacteria 2918
177 Ga0501072_0310077 3300049588 Bacteria 1254
178 Ga0501072_0380759 3300049588 Bacteria 1120
179 Ga0501073_0005360 3300049589 Bacteria 9613
180 Ga0501073_0019102 3300049589 Bacteria 4951
181 Ga0501074_0002512 3300049590 Bacteria 12790
182 Ga0501075_1089391 3300049591 Unclassified 607
183 Ga0501076_0340601 3300049592 Bacteria 1231
184 Ga0501076_0425665 3300049592 Bacteria 1092
185 Ga0501077_0058551 3300049593 Bacteria 2446
186 Ga0501080_0003197 3300049742 Bacteria 14444
187 Ga0501080_0140471 3300049742 Bacteria 2233
188 Ga0501080_0224588 3300049742 Bacteria 1718
189 Ga0501080_0612561 3300049742 Bacteria 966
190 Ga0501080_1127199 3300049742 Unclassified 676
191 Ga0501081_0054805 3300049743 Bacteria 2755
192 Ga0501081_1097694 3300049743 Bacteria 602
193 Ga0501083_0007566 3300049744 Bacteria 7696
194 Ga0501035_0009712 3300049822 Bacteria 8950
195 Ga0501035_0162296 3300049822 Bacteria 1934
196 Ga0501035_0187792 3300049822 Bacteria 1778
197 Ga0501035_0569784 3300049822 Bacteria 926
198 Ga0501044_0009653 3300049823 Bacteria 10498
199 Ga0501044_0078057 3300049823 Bacteria 3356
200 Ga0501044_0079647 3300049823 Bacteria 3319
201 Ga0501044_0348158 3300049823 Bacteria 1402
202 nmdc:mga03683_367782_c1 3300050489 Bacteria 683
203 nmdc:mga0k408_137611_c1 3300050493 Bacteria 1451
204 nmdc:mga09592_159435_c1 3300050508 Bacteria 1948
205 nmdc:mga0qj67_172337_c1 3300050509 Bacteria 1757
206 nmdc:mga06r32_1177925_c1 3300050510 Bacteria 713
207 nmdc:mga06r32_620052_c1 3300050510 Bacteria 1051
208 nmdc:mga08y16_419_c1 3300050511 Bacteria 39080
209 nmdc:mga08y16_98740_c1 3300050511 Bacteria 3040
210 Ga0500646_0051070 3300053090 Bacteria 1193
211 Ga0500651_0119895 3300053093 Bacteria 1598
212 Ga0500562_166491 3300053108 Bacteria 599
213 Ga0500595_017325 3300053119 Unclassified 2661
214 Ga0500642_0004544 3300053130 Bacteria 4360
215 Ga0500642_0018321 3300053130 Bacteria 2705
216 Ga0500559_0370047 3300053136 Unclassified 669
217 Ga0500568_0130121 3300053139 Bacteria 936
218 Ga0500568_0287133 3300053139 Unclassified 597
219 Ga0500588_0011898 3300053146 Bacteria 2143
220 Ga0500604_0341665 3300053151 Unclassified 520
221 Ga0500645_013279 3300053730 Bacteria 2646
222 Ga0500609_000409 3300053731 Bacteria 6344
223 Ga0501084_0241808 3300054114 Bacteria 1524
224 Ga0501084_0284434 3300054114 Bacteria 1396
225 Ga0501084_0287024 3300054114 Bacteria 1390
226 Ga0501084_0363056 3300054114 Bacteria 1224
227 Ga0501084_0807818 3300054114 Bacteria 790
228 Ga0590071_042192 3300059421 Bacteria 1099
229 Ga0590074_036427 3300059423 Bacteria 879
230 Ga0590075_021809 3300059424 Bacteria 1601
231 Ga0501082_0002987 3300060353 Bacteria 14768
232 Ga0501082_0146211 3300060353 Bacteria 2052
233 Ga0501082_0407793 3300060353 Bacteria 1186

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044719 Ga0466971_0191006 Ga0466971_0191006_12_401 124
2 3300025900 Ga0207710_10283884 Ga0207710_102838842 134
3 3300049742 Ga0501080_1127199 Ga0501080_1127199_13_438 135
4 3300053151 Ga0500604_0341665 Ga0500604_0341665_15_485 138
5 3300031344 Ga0265316_10122829 Ga0265316_101228293 141
6 3300003322 rootL2_10112719 rootL2_101127192 145
7 3300025272 Ga0209455_1001393 Ga0209455_10013937 145
8 iso_pu_bacteria 2897803580 2897809097 145
9 3300025291 Ga0209675_1047919 Ga0209675_10479191 146
10 3300025292 Ga0209676_1011507 Ga0209676_10115072 146
11 3300025295 Ga0209564_1043772 Ga0209564_10437722 146
12 3300025298 Ga0209050_1083682 Ga0209050_10836821 146
13 3300025292 Ga0209676_1000159 Ga0209676_100015969 147
14 3300025298 Ga0209050_1017443 Ga0209050_10174431 147
15 3300053136 Ga0500559_0370047 Ga0500559_0370047_213_656 147
16 iso_pu_bacteria 2883291878 2883293478 147
17 iso_pu_bacteria 2883354860 2883357942 147
18 3300003320 rootH2_10016009 rootH2_1001600915 148
19 3300005440 Ga0070705_100087103 Ga0070705_1000871033 148
20 3300005444 Ga0070694_100006402 Ga0070694_1000064026 148
21 3300005536 Ga0070697_100458384 Ga0070697_1004583842 148
22 3300005546 Ga0070696_100045635 Ga0070696_1000456353 148
23 3300005843 Ga0068860_100733425 Ga0068860_1007334252 148
24 3300005937 Ga0081455_10266124 Ga0081455_102661242 148
25 3300009093 Ga0105240_10016338 Ga0105240_100163386 148
26 3300035112 Ga0373932_0161548 Ga0373932_0161548_259_705 148
27 3300035112 Ga0373932_0199435 Ga0373932_0199435_205_651 148
28 3300035114 Ga0373939_0350399 Ga0373939_0350399_58_504 148
29 3300035691 Ga0373931_0022288 Ga0373931_0022288_2725_3171 148
30 3300035691 Ga0373931_0275773 Ga0373931_0275773_519_965 148
31 3300039447 Ga0436361_0927822 Ga0436361_0927822_750_1196 148
32 3300042876 Ga0451577_0056001 Ga0451577_0056001_84_530 148
33 3300044673 Ga0453683_0417316 Ga0453683_0417316_406_852 148
34 3300045051 Ga0451576_1001094 Ga0451576_1001094_334_780 148
35 3300045051 Ga0451576_2171635 Ga0451576_2171635_19_465 148
36 3300046684 Ga0495669_0035089 Ga0495669_0035089_626_1072 148
37 3300049568 Ga0501031_0395203 Ga0501031_0395203_377_823 148
38 3300049571 Ga0501034_1072927 Ga0501034_1072927_23_469 148
39 3300049578 Ga0501042_0829642 Ga0501042_0829642_109_555 148
40 3300049582 Ga0501048_0747364 Ga0501048_0747364_132_578 148
41 3300049587 Ga0501071_1206161 Ga0501071_1206161_85_531 148
42 3300049588 Ga0501072_0063302 Ga0501072_0063302_1253_1699 148
43 3300049592 Ga0501076_0425665 Ga0501076_0425665_312_758 148
44 3300049593 Ga0501077_0058551 Ga0501077_0058551_1744_2190 148
45 3300049742 Ga0501080_0612561 Ga0501080_0612561_176_622 148
46 3300049743 Ga0501081_0054805 Ga0501081_0054805_630_1076 148
47 3300049743 Ga0501081_1097694 Ga0501081_1097694_117_563 148
48 3300053108 Ga0500562_166491 Ga0500562_166491_121_585 148
49 3300053730 Ga0500645_013279 Ga0500645_013279_314_760 148
50 3300060353 Ga0501082_0407793 Ga0501082_0407793_191_637 148
51 3300005289 Ga0065704_10127105 Ga0065704_101271052 149
52 3300031251 Ga0265327_10034231 Ga0265327_100342312 149
53 3300031548 Ga0307408_100264625 Ga0307408_1002646252 149
54 3300031852 Ga0307410_10717985 Ga0307410_107179852 149
55 3300031995 Ga0307409_101598407 Ga0307409_1015984071 149
56 3300032004 Ga0307414_11327393 Ga0307414_113273932 149
57 3300037418 Ga0395900_0336060 Ga0395900_0336060_998_1447 149
58 3300038443 Ga0395901_0686428 Ga0395901_0686428_477_926 149
59 3300039437 Ga0436365_1310453 Ga0436365_1310453_270_734 149
60 3300041999 Ga0439433_0039907 Ga0439433_0039907_393_842 149
61 3300042145 Ga0450906_042250 Ga0450906_042250_338_790 149
62 3300044656 Ga0466969_0067912 Ga0466969_0067912_767_1231 149
63 3300044684 Ga0466966_0094596 Ga0466966_0094596_1112_1576 149
64 3300044693 Ga0466961_0619694 Ga0466961_0619694_121_585 149
65 3300045836 Ga0466958_0498147 Ga0466958_0498147_263_727 149
66 3300048909 Ga0496106_0590495 Ga0496106_0590495_313_765 149
67 3300048925 Ga0496122_0135947 Ga0496122_0135947_839_1288 149
68 3300049571 Ga0501034_0141229 Ga0501034_0141229_1008_1463 149
69 3300049572 Ga0501036_0772564 Ga0501036_0772564_248_703 149
70 3300049573 Ga0501037_0608880 Ga0501037_0608880_93_548 149
71 3300049574 Ga0501038_0099509 Ga0501038_0099509_967_1422 149
72 3300049574 Ga0501038_0773673 Ga0501038_0773673_33_488 149
73 3300049822 Ga0501035_0162296 Ga0501035_0162296_686_1141 149
74 3300049822 Ga0501035_0187792 Ga0501035_0187792_194_649 149
75 3300049823 Ga0501044_0348158 Ga0501044_0348158_731_1186 149
76 3300050509 nmdc:mga0qj67_172337_c1 nmdc:mga0qj67_172337_c1_925_1374 149
77 3300053119 Ga0500595_017325 Ga0500595_017325_1045_1494 149
78 3300053130 Ga0500642_0004544 Ga0500642_0004544_336_785 149
79 3300053146 Ga0500588_0011898 Ga0500588_0011898_128_577 149
80 iso_pu_bacteria 2821443989 2821449375 149
81 iso_pu_bacteria 2844533157 2844533651 149
82 iso_pu_bacteria 8054002106 8054004688 149
83 3300003215 JGI25153J46596_10000309 JGI25153J46596_100003092 150
84 3300005338 Ga0068868_100829720 Ga0068868_1008297202 150
85 3300005471 Ga0070698_101182709 Ga0070698_1011827091 150
86 3300005618 Ga0068864_101514098 Ga0068864_1015140981 150
87 3300005842 Ga0068858_100717723 Ga0068858_1007177232 150
88 3300006237 Ga0097621_100799631 Ga0097621_1007996312 150
89 3300006914 Ga0075436_100123523 Ga0075436_1001235232 150
90 3300014325 Ga0163163_11282856 Ga0163163_112828562 150
91 3300014968 Ga0157379_10519003 Ga0157379_105190031 150
92 3300025297 Ga0209758_1000005 Ga0209758_1000005747 150
93 3300025945 Ga0207679_11255161 Ga0207679_112551611 150
94 3300026095 Ga0207676_10880426 Ga0207676_108804261 150
95 3300048915 Ga0496112_0952979 Ga0496112_0952979_231_683 150
96 3300049571 Ga0501034_0014375 Ga0501034_0014375_4613_5071 150
97 3300049573 Ga0501037_0032813 Ga0501037_0032813_1488_1946 150
98 3300053139 Ga0500568_0130121 Ga0500568_0130121_323_778 150
99 3300005546 Ga0070696_100126939 Ga0070696_1001269392 151
100 3300009094 Ga0111539_10473178 Ga0111539_104731783 151
101 3300009545 Ga0105237_10159420 Ga0105237_101594202 151
102 3300025297 Ga0209758_1005859 Ga0209758_10058597 151
103 3300025304 Ga0209257_1030316 Ga0209257_10303162 151
104 3300028577 Ga0265318_10060216 Ga0265318_100602162 151
105 3300028786 Ga0307517_10088771 Ga0307517_100887712 151
106 3300028786 Ga0307517_10125028 Ga0307517_101250282 151
107 3300030522 Ga0307512_10255355 Ga0307512_102553552 151
108 3300031240 Ga0265320_10000550 Ga0265320_1000055026 151
109 3300031456 Ga0307513_10375473 Ga0307513_103754732 151
110 3300031711 Ga0265314_10028899 Ga0265314_100288994 151
111 3300031730 Ga0307516_10203681 Ga0307516_102036812 151
112 3300031730 Ga0307516_10722935 Ga0307516_107229352 151
113 3300031995 Ga0307409_100506597 Ga0307409_1005065972 151
114 3300033180 Ga0307510_10194773 Ga0307510_101947731 151
115 3300037418 Ga0395900_0380130 Ga0395900_0380130_247_702 151
116 3300037471 Ga0395905_1267216 Ga0395905_1267216_131_586 151
117 3300038443 Ga0395901_0183503 Ga0395901_0183503_1443_1910 151
118 3300038443 Ga0395901_0254761 Ga0395901_0254761_442_897 151
119 3300041458 Ga0451798_0226351 Ga0451798_0226351_61_540 151
120 3300041486 Ga0451807_0523356 Ga0451807_0523356_862_1326 151
121 3300041498 Ga0451841_0689141 Ga0451841_0689141_61_540 151
122 3300049569 Ga0501032_0006388 Ga0501032_0006388_7450_7932 151
123 3300049570 Ga0501033_0006267 Ga0501033_0006267_8805_9287 151
124 3300049571 Ga0501034_0026493 Ga0501034_0026493_4276_4758 151
125 3300049572 Ga0501036_0003716 Ga0501036_0003716_8707_9189 151
126 3300049573 Ga0501037_0005152 Ga0501037_0005152_3016_3498 151
127 3300049574 Ga0501038_0000855 Ga0501038_0000855_15352_15834 151
128 3300049575 Ga0501039_0001098 Ga0501039_0001098_11269_11751 151
129 3300049578 Ga0501042_1084166 Ga0501042_1084166_21_503 151
130 3300049579 Ga0501043_0006194 Ga0501043_0006194_7623_8105 151
131 3300049579 Ga0501043_0716587 Ga0501043_0716587_48_539 151
132 3300049580 Ga0501046_0001693 Ga0501046_0001693_7083_7565 151
133 3300049581 Ga0501047_0103095 Ga0501047_0103095_869_1351 151
134 3300049581 Ga0501047_0253014 Ga0501047_0253014_961_1416 151
135 3300049582 Ga0501048_0044796 Ga0501048_0044796_1817_2299 151
136 3300049583 Ga0501067_0020087 Ga0501067_0020087_1607_2089 151
137 3300049585 Ga0501069_0000530 Ga0501069_0000530_12747_13229 151
138 3300049586 Ga0501070_0002757 Ga0501070_0002757_1147_1629 151
139 3300049586 Ga0501070_0528611 Ga0501070_0528611_375_848 151
140 3300049588 Ga0501072_0310077 Ga0501072_0310077_756_1238 151
141 3300049589 Ga0501073_0005360 Ga0501073_0005360_830_1312 151
142 3300049589 Ga0501073_0019102 Ga0501073_0019102_383_856 151
143 3300049590 Ga0501074_0002512 Ga0501074_0002512_4865_5347 151
144 3300049742 Ga0501080_0003197 Ga0501080_0003197_7643_8125 151
145 3300049742 Ga0501080_0140471 Ga0501080_0140471_864_1319 151
146 3300049742 Ga0501080_0224588 Ga0501080_0224588_477_950 151
147 3300049744 Ga0501083_0007566 Ga0501083_0007566_3407_3889 151
148 3300049822 Ga0501035_0009712 Ga0501035_0009712_1147_1629 151
149 3300049823 Ga0501044_0009653 Ga0501044_0009653_1147_1629 151
150 3300049823 Ga0501044_0078057 Ga0501044_0078057_669_1142 151
151 3300049823 Ga0501044_0079647 Ga0501044_0079647_1011_1484 151
152 3300050511 nmdc:mga08y16_98740_c1 nmdc:mga08y16_98740_c1_1860_2315 151
153 3300053090 Ga0500646_0051070 Ga0500646_0051070_232_726 151
154 3300053093 Ga0500651_0119895 Ga0500651_0119895_667_1161 151
155 3300053130 Ga0500642_0018321 Ga0500642_0018321_331_795 151
156 3300053139 Ga0500568_0287133 Ga0500568_0287133_15_494 151
157 3300053731 Ga0500609_000409 Ga0500609_000409_1649_2143 151
158 3300054114 Ga0501084_0241808 Ga0501084_0241808_621_1076 151
159 3300054114 Ga0501084_0284434 Ga0501084_0284434_869_1351 151
160 3300054114 Ga0501084_0287024 Ga0501084_0287024_727_1182 151
161 3300054114 Ga0501084_0363056 Ga0501084_0363056_616_1089 151
162 3300054114 Ga0501084_0807818 Ga0501084_0807818_263_718 151
163 3300060353 Ga0501082_0002987 Ga0501082_0002987_7076_7558 151
164 3300060353 Ga0501082_0146211 Ga0501082_0146211_899_1426 151
165 3300005334 Ga0068869_101551366 Ga0068869_1015513661 152
166 3300005353 Ga0070669_100034061 Ga0070669_1000340612 152
167 3300005356 Ga0070674_100064006 Ga0070674_1000640062 152
168 3300005441 Ga0070700_101086682 Ga0070700_1010866822 152
169 3300005546 Ga0070696_100124832 Ga0070696_1001248322 152
170 3300005718 Ga0068866_10107920 Ga0068866_101079202 152
171 3300005719 Ga0068861_100152643 Ga0068861_1001526434 152
172 3300005844 Ga0068862_100011428 Ga0068862_1000114289 152
173 3300005981 Ga0081538_10002230 Ga0081538_1000223012 152
174 3300006177 Ga0075362_10364258 Ga0075362_103642582 152
175 3300006881 Ga0068865_100205647 Ga0068865_1002056471 152
176 3300009094 Ga0111539_10003065 Ga0111539_1000306511 152
177 3300009147 Ga0114129_10116677 Ga0114129_101166775 152
178 3300009553 Ga0105249_10218241 Ga0105249_102182414 152
179 3300009984 Ga0105029_103206 Ga0105029_1032062 152
180 3300014326 Ga0157380_11062414 Ga0157380_110624142 152
181 3300025899 Ga0207642_10334176 Ga0207642_103341761 152
182 3300025937 Ga0207669_10092501 Ga0207669_100925014 152
183 3300025942 Ga0207689_10872717 Ga0207689_108727171 152
184 3300026075 Ga0207708_11135080 Ga0207708_111350802 152
185 3300026089 Ga0207648_10291083 Ga0207648_102910832 152
186 3300026118 Ga0207675_100114534 Ga0207675_1001145342 152
187 3300027907 Ga0207428_10000096 Ga0207428_1000009680 152
188 3300028380 Ga0268265_10464589 Ga0268265_104645892 152
189 3300028380 Ga0268265_10507508 Ga0268265_105075081 152
190 3300031548 Ga0307408_100166749 Ga0307408_1001667492 152
191 3300031824 Ga0307413_10006096 Ga0307413_100060964 152
192 3300031852 Ga0307410_10010012 Ga0307410_100100123 152
193 3300031901 Ga0307406_10884363 Ga0307406_108843631 152
194 3300031995 Ga0307409_100013892 Ga0307409_1000138925 152
195 3300032002 Ga0307416_100278428 Ga0307416_1002784282 152
196 3300032004 Ga0307414_10482146 Ga0307414_104821462 152
197 3300032005 Ga0307411_10036592 Ga0307411_100365922 152
198 3300037418 Ga0395900_1220931 Ga0395900_1220931_118_576 152
199 3300042144 Ga0450889_015399 Ga0450889_015399_82_540 152
200 3300044712 Ga0453684_0023259 Ga0453684_0023259_1718_2176 152
201 3300045051 Ga0451576_0227672 Ga0451576_0227672_411_869 152
202 3300045051 Ga0451576_1730258 Ga0451576_1730258_133_591 152
203 3300049587 Ga0501071_1566003 Ga0501071_1566003_39_497 152
204 3300049591 Ga0501075_1089391 Ga0501075_1089391_77_535 152
205 3300049592 Ga0501076_0340601 Ga0501076_0340601_145_603 152
206 3300049822 Ga0501035_0569784 Ga0501035_0569784_448_912 152
207 3300050489 nmdc:mga03683_367782_c1 nmdc:mga03683_367782_c1_121_579 152
208 3300050493 nmdc:mga0k408_137611_c1 nmdc:mga0k408_137611_c1_777_1235 152
209 3300050508 nmdc:mga09592_159435_c1 nmdc:mga09592_159435_c1_1479_1937 152
210 3300050510 nmdc:mga06r32_1177925_c1 nmdc:mga06r32_1177925_c1_38_496 152
211 3300050510 nmdc:mga06r32_620052_c1 nmdc:mga06r32_620052_c1_492_950 152
212 3300050511 nmdc:mga08y16_419_c1 nmdc:mga08y16_419_c1_23555_24013 152
213 3300059421 Ga0590071_042192 Ga0590071_042192_25_483 152
214 3300059423 Ga0590074_036427 Ga0590074_036427_218_676 152
215 3300059424 Ga0590075_021809 Ga0590075_021809_827_1285 152
216 3300003187 JGI25151J46595_10000192 JGI25151J46595_1000019249 153
217 3300003316 rootH1_10124833 rootH1_101248333 153
218 3300003354 JGI25160J50197_1003215 JGI25160J50197_10032153 153
219 3300005367 Ga0070667_100565081 Ga0070667_1005650812 153
220 3300005539 Ga0068853_100328876 Ga0068853_1003288762 153
221 3300005983 Ga0081540_1058425 Ga0081540_10584252 153
222 3300009986 Ga0105033_107552 Ga0105033_1075521 153
223 3300014326 Ga0157380_10370106 Ga0157380_103701062 153
224 3300025284 Ga0209130_1003148 Ga0209130_10031484 153
225 3300025294 Ga0209025_1000077 Ga0209025_1000077219 153
226 3300025294 Ga0209025_1164553 Ga0209025_11645531 153
227 3300025297 Ga0209758_1006515 Ga0209758_10065158 153
228 3300025302 Ga0207426_1000304 Ga0207426_100030445 153
229 3300026041 Ga0207639_10236931 Ga0207639_102369312 153
230 3300041413 Ga0439465_0338285 Ga0439465_0338285_86_547 153
231 3300042146 Ga0450907_023674 Ga0450907_023674_498_959 153
232 3300046512 Ga0495610_0092841 Ga0495610_0092841_219_680 153
233 3300049572 Ga0501036_0091543 Ga0501036_0091543_1350_1820 153
234 3300049582 Ga0501048_0074570 Ga0501048_0074570_1525_1995 153
235 3300049587 Ga0501071_1157535 Ga0501071_1157535_28_498 153
236 3300049588 Ga0501072_0380759 Ga0501072_0380759_98_568 153
237 3300001989 JGI24739J22299_10116880 JGI24739J22299_101168802 154
238 3300046512 Ga0495610_0014511 Ga0495610_0014511_1641_2105 154
239 3300049460 Ga0495682_0127373 Ga0495682_0127373_139_603 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04364

DNA_pol3_chi

DNA polymerase III chi subunit, HolC

25

159

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sxu-assembly1.cif.gz_A structure of the e. coli ssb-dna polymerase iii interface 0.8335 3 140
3sxu-assembly1.cif.gz_A structure of the e. coli ssb-dna polymerase iii interface 0.7871 3 140
5mfx-assembly1.cif.gz_A zika ns3 helicase:rna complex 0.7136 3 107
2v8o-assembly1.cif.gz_A structure of the murray valley encephalitis virus rna helicase to 1. 9a resolution 0.711 4 107
4c30-assembly1.cif.gz_A crystal structure of deinococcus radiodurans uvrd in complex with dna, form 2 0.7073 3 61
ID Description Score Start End Superfamily
1em8C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;DNA polymerase III subunit chi 0.8415 1 136 3.40.50.10110
1em8C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;DNA polymerase III subunit chi 0.7792 1 136 3.40.50.10110
af_K7M6B0_421_558_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7757 3 111 3.40.50.300
af_A0A140LFS6_48_320_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7583 15 75 3.40.50.300
af_Q54T87_324_503_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7423 2 107 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3D3B0B2-F1-model_v4 DNA polymerase III subunit chi 0.9706 1 110 GO:0003677
GO:0003887
GO:0006260
GO:0032298
AF-A0A258K2X1-F1-model_v4 DNA polymerase III subunit chi 0.97 1 125 GO:0003677
GO:0003887
GO:0006260
GO:0032298
AF-A0A0F2Q4I9-F1-model_v4 DNA polymerase III subunit chi 0.9631 1 94 GO:0003677
GO:0003887
GO:0006260
GO:0032298
AF-A0A2E5MVU5-F1-model_v4 DNA polymerase III subunit chi 0.963 1 152 GO:0003677
GO:0003887
GO:0006260
GO:0032298
AF-A0A1M3J2X7-F1-model_v4 DNA polymerase III subunit chi 0.9627 1 148 GO:0003677
GO:0003887
GO:0006260
GO:0032298

Feature Viewer

pLDDT pTM Quality
93.64 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map