F339612

General Info

Members Datasets Scaffolds Average Seq Length
227 156 218 240

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100192299|Ga0070668_1001922991
Length 234
Sequence MTDASKPHIVLVHGAFVDGSGWEGVYRLLKAQGFPVTVTQHPTETVAGDVGYVTRAVAAHDGPAILVGHSYGGLVITEAGRHPQVKALVFVAAWIPDEGESVNAMIGRLPQDGPVPPLAPRDGYLFVDPAKFPDAFAQDVDRATAEFQAIAQLPWALESAGGTIGEPAWKTRPSWALVATDDRMIPPPAQRDMAARAGATVSESPGSHSVFVSHPDAVAKLVEEAAATVLQTAE

Samples

Sample ID Description Type Environment
1 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
2 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
3 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
4 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
5 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
6 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
7 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
104 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
116 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
117 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
118 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
119 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
120 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
124 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
125 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
126 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
136 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
137 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
138 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
139 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
140 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
141 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
142 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
143 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
144 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
145 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
155 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
156 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.48
Metatranscriptomes 0.44
Isolates 3.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.32
Nodule 0.44
Rhizoplane 5.29
Rhizosphere 83.26
Stem 0
Stem Tuber 0
Unclassified 9.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058859_11642043 3300004798 Bacteria 1393
2 Ga0065715_10527717 3300005293 Bacteria 758
3 Ga0065707_10001699 3300005295 Bacteria 8572
4 Ga0065707_10123162 3300005295 Bacteria 2071
5 Ga0070676_10057242 3300005328 Bacteria 2306
6 Ga0070690_100451137 3300005330 Bacteria 954
7 Ga0068869_100051543 3300005334 Bacteria 2986
8 Ga0070666_10185379 3300005335 Bacteria 1461
9 Ga0070682_100536599 3300005337 Bacteria 913
10 Ga0070689_100000303 3300005340 Bacteria 28658
11 Ga0070687_100067962 3300005343 Bacteria 1904
12 Ga0070687_100141850 3300005343 Bacteria 1400
13 Ga0070668_100192299 3300005347 Bacteria 1672
14 Ga0070675_100074858 3300005354 Bacteria 2814
15 Ga0070675_100551652 3300005354 Bacteria 1042
16 Ga0070671_100048912 3300005355 Bacteria 3518
17 Ga0070671_100068143 3300005355 Bacteria 2968
18 Ga0070673_100002586 3300005364 Bacteria 11053
19 Ga0070673_100032381 3300005364 Bacteria 3936
20 Ga0070688_100000216 3300005365 Bacteria 30584
21 Ga0070688_100168094 3300005365 Bacteria 1511
22 Ga0070667_100005569 3300005367 Bacteria 10512
23 Ga0070667_100007810 3300005367 Bacteria 8870
24 Ga0070701_10145637 3300005438 Bacteria 1359
25 Ga0070711_100136703 3300005439 Bacteria 1832
26 Ga0070694_100020737 3300005444 Bacteria 4193
27 Ga0070694_100154864 3300005444 Bacteria 1677
28 Ga0070708_100559407 3300005445 Unclassified 1079
29 Ga0068867_100288596 3300005459 Bacteria 1348
30 Ga0070685_10032392 3300005466 Bacteria 2927
31 Ga0070685_10088415 3300005466 Bacteria 1871
32 Ga0070698_100041633 3300005471 Bacteria 4716
33 Ga0070698_100048646 3300005471 Bacteria 4333
34 Ga0070684_100421376 3300005535 Bacteria 1232
35 Ga0070697_100260152 3300005536 Bacteria 1486
36 Ga0070686_100512009 3300005544 Bacteria 933
37 Ga0070696_100413544 3300005546 Bacteria 1057
38 Ga0070665_100000172 3300005548 Bacteria 115040
39 Ga0070665_100208492 3300005548 Bacteria 1955
40 Ga0068855_100127964 3300005563 Bacteria 2903
41 Ga0068855_100197648 3300005563 Bacteria 2265
42 Ga0070664_100130552 3300005564 Bacteria 2207
43 Ga0068857_100215125 3300005577 Unclassified 1754
44 Ga0068854_100183694 3300005578 Bacteria 1635
45 Ga0068856_100081683 3300005614 Bacteria 3207
46 Ga0068856_100781931 3300005614 Bacteria 974
47 Ga0068859_100023730 3300005617 Bacteria 6156
48 Ga0068859_100057118 3300005617 Bacteria 3931
49 Ga0068859_100063426 3300005617 Bacteria 3726
50 Ga0068859_100308676 3300005617 Bacteria 1675
51 Ga0068864_100000152 3300005618 Bacteria 64211
52 Ga0068864_100068080 3300005618 Bacteria 3092
53 Ga0068861_100504764 3300005719 Bacteria 1094
54 Ga0068863_100009111 3300005841 Bacteria 9693
55 Ga0068863_100296745 3300005841 Bacteria 1567
56 Ga0068858_100002589 3300005842 Bacteria 18214
57 Ga0068858_100006692 3300005842 Bacteria 11213
58 Ga0068860_100008035 3300005843 Bacteria 10520
59 Ga0068860_100786156 3300005843 Bacteria 965
60 Ga0068862_100028040 3300005844 Bacteria 4742
61 Ga0068862_100369326 3300005844 Bacteria 1335
62 Ga0081538_10017843 3300005981 Bacteria 5362
63 Ga0081540_1000580 3300005983 Bacteria 35276
64 Ga0081540_1007484 3300005983 Bacteria 7776
65 Ga0097621_100025603 3300006237 Bacteria 4618
66 Ga0068871_100033648 3300006358 Bacteria 4061
67 Ga0075428_100528716 3300006844 Bacteria 1261
68 Ga0075428_100564763 3300006844 Bacteria 1216
69 Ga0075428_100615418 3300006844 Unclassified 1159
70 Ga0075430_100002119 3300006846 Bacteria 16409
71 Ga0075430_100085772 3300006846 Bacteria 2636
72 Ga0075431_100010855 3300006847 Bacteria 9163
73 Ga0075431_100491143 3300006847 Bacteria 1220
74 Ga0097620_100023731 3300006931 Bacteria 6156
75 Ga0097620_100057120 3300006931 Bacteria 3931
76 Ga0097620_100063426 3300006931 Bacteria 3726
77 Ga0097620_100308677 3300006931 Bacteria 1675
78 Ga0099795_10018053 3300007788 Bacteria 2260
79 Ga0105251_10122223 3300009011 Bacteria 1182
80 Ga0105240_10000308 3300009093 Bacteria 94340
81 Ga0111539_10026627 3300009094 Bacteria 7068
82 Ga0111539_10155741 3300009094 Bacteria 2674
83 Ga0105247_10010739 3300009101 Bacteria 5530
84 Ga0114129_10229116 3300009147 Bacteria 2503
85 Ga0114129_10315140 3300009147 Bacteria 2081
86 Ga0114129_11013777 3300009147 Unclassified 1045
87 Ga0105242_10369034 3300009176 Bacteria 1331
88 Ga0105248_10004459 3300009177 Bacteria 15494
89 Ga0105248_10313923 3300009177 Bacteria 1765
90 Ga0105248_10365503 3300009177 Bacteria 1624
91 Ga0105248_10448545 3300009177 Bacteria 1454
92 Ga0105237_10000931 3300009545 Bacteria 39411
93 Ga0105249_10003054 3300009553 Bacteria 14445
94 Ga0105249_10046954 3300009553 Bacteria 3932
95 Ga0105239_10000535 3300010375 Bacteria 55025
96 Ga0157370_10000481 3300013104 Bacteria 49689
97 Ga0157374_10066344 3300013296 Bacteria 3392
98 Ga0157378_10241119 3300013297 Bacteria 1727
99 Ga0163162_10018976 3300013306 Bacteria 6743
100 Ga0157375_10238518 3300013308 Bacteria 1978
101 Ga0163163_10003435 3300014325 Bacteria 13462
102 Ga0163163_10211729 3300014325 Bacteria 1987
103 Ga0163163_10254247 3300014325 Bacteria 1808
104 Ga0157379_10002745 3300014968 Bacteria 14852
105 Ga0157379_10006683 3300014968 Bacteria 9959
106 Ga0182007_10002906 3300015262 Bacteria 8323
107 Ga0213872_10051156 3300021361 Bacteria 1875
108 Ga0207710_10033344 3300025900 Bacteria 2258
109 Ga0207645_10366611 3300025907 Bacteria 965
110 Ga0207695_10000416 3300025913 Bacteria 94770
111 Ga0207671_10000736 3300025914 Bacteria 41541
112 Ga0207662_10002718 3300025918 Bacteria 8926
113 Ga0207681_10307436 3300025923 Bacteria 1256
114 Ga0207681_10508837 3300025923 Bacteria 987
115 Ga0207664_10184637 3300025929 Bacteria 1792
116 Ga0207644_10035050 3300025931 Bacteria 3514
117 Ga0207706_10063103 3300025933 Bacteria 3263
118 Ga0207686_10484149 3300025934 Bacteria 957
119 Ga0207670_10009353 3300025936 Bacteria 5591
120 Ga0207670_10014409 3300025936 Bacteria 4693
121 Ga0207711_10003281 3300025941 Bacteria 14062
122 Ga0207711_10070072 3300025941 Bacteria 3040
123 Ga0207689_10216353 3300025942 Bacteria 1583
124 Ga0207689_10236280 3300025942 Bacteria 1511
125 Ga0207667_10248953 3300025949 Bacteria 1818
126 Ga0207651_10008749 3300025960 Bacteria 5491
127 Ga0207651_10350318 3300025960 Bacteria 1243
128 Ga0207668_10221307 3300025972 Bacteria 1520
129 Ga0207640_10334917 3300025981 Bacteria 1210
130 Ga0207658_10003561 3300025986 Bacteria 10994
131 Ga0207658_10024363 3300025986 Bacteria 4234
132 Ga0207658_10357916 3300025986 Bacteria 1272
133 Ga0207703_10002189 3300026035 Bacteria 17150
134 Ga0207703_10031493 3300026035 Bacteria 4194
135 Ga0207702_10682759 3300026078 Bacteria 1011
136 Ga0207641_10004792 3300026088 Bacteria 11661
137 Ga0207641_10264073 3300026088 Bacteria 1613
138 Ga0207648_10057327 3300026089 Bacteria 3398
139 Ga0207676_10000731 3300026095 Bacteria 25737
140 Ga0207676_10277377 3300026095 Bacteria 1520
141 Ga0207674_10289435 3300026116 Unclassified 1587
142 Ga0207698_11043485 3300026142 Bacteria 829
143 Ga0268266_10000001 3300028379 Bacteria 4040580
144 Ga0268266_10023338 3300028379 Bacteria 5267
145 Ga0268266_10532057 3300028379 Bacteria 1125
146 Ga0268265_10010290 3300028380 Bacteria 6317
147 Ga0268265_10066278 3300028380 Bacteria 2791
148 Ga0268265_10657632 3300028380 Bacteria 1008
149 Ga0268264_10000755 3300028381 Bacteria 36243
150 Ga0268264_10745431 3300028381 Bacteria 975
151 Ga0265319_1036747 3300028563 Bacteria 1673
152 Ga0265336_10004000 3300028666 Bacteria 5641
153 Ga0307515_10245764 3300028794 Bacteria 1551
154 Ga0265338_10000572 3300028800 Bacteria 64902
155 Ga0265324_10025198 3300029957 Bacteria 2110
156 Ga0307513_10012218 3300031456 Bacteria 10617
157 Ga0307508_10406410 3300031616 Unclassified 953
158 Ga0395905_0252357 3300037471 Bacteria 1648
159 Ga0395901_0384035 3300038443 Bacteria 1445
160 Ga0436361_1207574 3300039447 Bacteria 1290
161 Ga0451576_0685414 3300045051 Bacteria 1077
162 Ga0495651_0317110 3300046462 Bacteria 1040
163 Ga0495628_0160047 3300046516 Bacteria 1711
164 Ga0495587_0202869 3300046536 Bacteria 1121
165 Ga0495597_0012652 3300046542 Bacteria 4064
166 Ga0495625_0003875 3300046660 Bacteria 14449
167 Ga0495659_0000514 3300046664 Bacteria 14251
168 Ga0495623_0182437 3300046679 Bacteria 1218
169 Ga0495600_0099369 3300046809 Bacteria 1897
170 Ga0495604_0367676 3300047317 Bacteria 952
171 Ga0495687_000618 3300047443 Bacteria 41265
172 Ga0495687_013334 3300047443 Bacteria 4300
173 Ga0495684_0162001 3300047471 Bacteria 1668
174 Ga0495626_0091934 3300048091 Bacteria 1333
175 Ga0496100_0332737 3300048903 Bacteria 1143
176 Ga0496101_0206506 3300048904 Bacteria 1520
177 Ga0496102_0000922 3300048905 Bacteria 27690
178 Ga0496102_0079351 3300048905 Bacteria 3023
179 Ga0496103_0002929 3300048906 Bacteria 10571
180 Ga0496104_0124854 3300048907 Bacteria 2471
181 Ga0496104_0332089 3300048907 Bacteria 1433
182 Ga0496106_0206061 3300048909 Bacteria 1566
183 Ga0496107_0374450 3300048910 Bacteria 1059
184 Ga0496107_0504067 3300048910 Bacteria 898
185 Ga0496113_0093214 3300048916 Bacteria 2324
186 Ga0496115_0097974 3300048918 Bacteria 2401
187 Ga0496116_0019370 3300048919 Bacteria 5211
188 Ga0496117_0000655 3300048920 Bacteria 55356
189 Ga0496118_0001907 3300048921 Bacteria 29679
190 Ga0496119_0003255 3300048922 Bacteria 16984
191 Ga0496120_0041538 3300048923 Bacteria 2692
192 Ga0496121_0000125 3300048924 Bacteria 169274
193 Ga0496121_0003859 3300048924 Bacteria 20850
194 Ga0496121_0046837 3300048924 Bacteria 3696
195 Ga0496122_0004607 3300048925 Bacteria 16975
196 Ga0496123_0002503 3300048926 Bacteria 22631
197 Ga0496124_0017524 3300048927 Bacteria 6746
198 Ga0496125_0003120 3300048928 Bacteria 20598
199 Ga0496125_0180392 3300048928 Bacteria 1408
200 Ga0496126_0008829 3300048929 Bacteria 10808
201 Ga0496126_0046296 3300048929 Bacteria 3991
202 nmdc:mga0k408_11602_c1 3300050493 Bacteria 4802
203 nmdc:mga05p37_611053_c1 3300050507 Bacteria 1229
204 nmdc:mga05p37_807124_c1 3300050507 Unclassified 1026
205 nmdc:mga09592_104192_c1 3300050508 Bacteria 2431
206 nmdc:mga0qj67_7502_c1 3300050509 Bacteria 8056
207 nmdc:mga06r32_110285_c1 3300050510 Bacteria 2707
208 nmdc:mga06r32_205286_c1 3300050510 Bacteria 1958
209 nmdc:mga06r32_364015_c1 3300050510 Unclassified 1430
210 nmdc:mga08y16_363870_c1 3300050511 Bacteria 1485
211 nmdc:mga08y16_630202_c1 3300050511 Bacteria 1078
212 nmdc:mga0rr50_380128_c1 3300050513 Bacteria 1191
213 nmdc:mga0rr50_504914_c1 3300050513 Bacteria 1028
214 nmdc:mga0rr50_765663_c1 3300050513 Bacteria 824
215 nmdc:mga0a205_66374_c2 3300050515 Bacteria 2887
216 Ga0500568_0000267 3300053139 Bacteria 44307
217 Ga0500627_0025382 3300053158 Bacteria 2435
218 Ga0530510_0157026 3300061734 Bacteria 1682

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031616 Ga0307508_10406410 Ga0307508_104064101 215
2 3300028794 Ga0307515_10245764 Ga0307515_102457641 217
3 3300009176 Ga0105242_10369034 Ga0105242_103690342 219
4 3300031456 Ga0307513_10012218 Ga0307513_100122186 222
5 3300048910 Ga0496107_0504067 Ga0496107_0504067_130_816 226
6 3300005577 Ga0068857_100215125 Ga0068857_1002151251 227
7 3300026116 Ga0207674_10289435 Ga0207674_102894352 227
8 3300005328 Ga0070676_10057242 Ga0070676_100572422 228
9 3300025907 Ga0207645_10366611 Ga0207645_103666111 228
10 3300025923 Ga0207681_10508837 Ga0207681_105088372 228
11 3300025933 Ga0207706_10063103 Ga0207706_100631032 228
12 3300046660 Ga0495625_0003875 Ga0495625_0003875_9409_10176 228
13 3300053158 Ga0500627_0025382 Ga0500627_0025382_1316_2083 228
14 3300006847 Ga0075431_100491143 Ga0075431_1004911432 229
15 3300007788 Ga0099795_10018053 Ga0099795_100180531 229
16 3300028563 Ga0265319_1036747 Ga0265319_10367471 229
17 3300028666 Ga0265336_10004000 Ga0265336_100040004 229
18 3300028800 Ga0265338_10000572 Ga0265338_1000057245 229
19 3300029957 Ga0265324_10025198 Ga0265324_100251982 229
20 3300039447 Ga0436361_1207574 Ga0436361_1207574_556_1245 229
21 3300046462 Ga0495651_0317110 Ga0495651_0317110_161_850 229
22 3300046516 Ga0495628_0160047 Ga0495628_0160047_485_1174 229
23 3300046536 Ga0495587_0202869 Ga0495587_0202869_51_740 229
24 3300046679 Ga0495623_0182437 Ga0495623_0182437_58_747 229
25 3300046809 Ga0495600_0099369 Ga0495600_0099369_23_712 229
26 3300047317 Ga0495604_0367676 Ga0495604_0367676_240_929 229
27 3300047471 Ga0495684_0162001 Ga0495684_0162001_560_1249 229
28 3300050510 nmdc:mga06r32_205286_c1 nmdc:mga06r32_205286_c1_1023_1718 229
29 3300006844 Ga0075428_100528716 Ga0075428_1005287161 230
30 3300005548 Ga0070665_100208492 Ga0070665_1002084923 231
31 3300005563 Ga0068855_100197648 Ga0068855_1001976482 231
32 3300005614 Ga0068856_100081683 Ga0068856_1000816832 231
33 3300009093 Ga0105240_10000308 Ga0105240_1000030813 231
34 3300009545 Ga0105237_10000931 Ga0105237_1000093121 231
35 3300010375 Ga0105239_10000535 Ga0105239_1000053530 231
36 3300013104 Ga0157370_10000481 Ga0157370_1000048113 231
37 3300015262 Ga0182007_10002906 Ga0182007_100029065 231
38 3300025913 Ga0207695_10000416 Ga0207695_1000041613 231
39 3300025914 Ga0207671_10000736 Ga0207671_1000073623 231
40 3300026142 Ga0207698_11043485 Ga0207698_110434851 231
41 3300028379 Ga0268266_10023338 Ga0268266_100233384 231
42 3300046542 Ga0495597_0012652 Ga0495597_0012652_2369_3064 231
43 3300047443 Ga0495687_000618 Ga0495687_000618_36151_36846 231
44 3300047443 Ga0495687_013334 Ga0495687_013334_229_924 231
45 3300048091 Ga0495626_0091934 Ga0495626_0091934_85_780 231
46 3300048903 Ga0496100_0332737 Ga0496100_0332737_156_911 231
47 3300048904 Ga0496101_0206506 Ga0496101_0206506_85_840 231
48 3300048905 Ga0496102_0000922 Ga0496102_0000922_14045_14800 231
49 3300048906 Ga0496103_0002929 Ga0496103_0002929_9490_10245 231
50 3300048916 Ga0496113_0093214 Ga0496113_0093214_1512_2267 231
51 3300048919 Ga0496116_0019370 Ga0496116_0019370_2355_3110 231
52 3300048920 Ga0496117_0000655 Ga0496117_0000655_52558_53313 231
53 3300048921 Ga0496118_0001907 Ga0496118_0001907_14408_15163 231
54 3300048922 Ga0496119_0003255 Ga0496119_0003255_2044_2799 231
55 3300048923 Ga0496120_0041538 Ga0496120_0041538_938_1693 231
56 3300048924 Ga0496121_0003859 Ga0496121_0003859_18097_18852 231
57 3300048925 Ga0496122_0004607 Ga0496122_0004607_5782_6537 231
58 3300048926 Ga0496123_0002503 Ga0496123_0002503_10130_10885 231
59 3300048927 Ga0496124_0017524 Ga0496124_0017524_2044_2799 231
60 3300048928 Ga0496125_0003120 Ga0496125_0003120_7756_8511 231
61 3300048929 Ga0496126_0008829 Ga0496126_0008829_8668_9423 231
62 3300050493 nmdc:mga0k408_11602_c1 nmdc:mga0k408_11602_c1_3717_4412 231
63 3300053139 Ga0500568_0000267 Ga0500568_0000267_22707_23429 231
64 iso_pu_bacteria 2585427530 2585553605 231
65 iso_pu_bacteria 2615840626 2616311525 231
66 iso_pu_bacteria 2818991453 2819643815 231
67 iso_pu_bacteria 2839993093 2839996341 231
68 iso_pu_bacteria 2839993093 2839998370 231
69 iso_pu_bacteria 2894652903 2894654319 231
70 iso_pu_bacteria 2919119836 2919120898 231
71 3300005334 Ga0068869_100051543 Ga0068869_1000515432 232
72 3300005337 Ga0070682_100536599 Ga0070682_1005365992 232
73 3300005355 Ga0070671_100048912 Ga0070671_1000489123 232
74 3300005364 Ga0070673_100002586 Ga0070673_1000025868 232
75 3300005367 Ga0070667_100005569 Ga0070667_1000055693 232
76 3300005367 Ga0070667_100007810 Ga0070667_1000078102 232
77 3300005548 Ga0070665_100000172 Ga0070665_10000017213 232
78 3300005563 Ga0068855_100127964 Ga0068855_1001279645 232
79 3300005564 Ga0070664_100130552 Ga0070664_1001305522 232
80 3300005614 Ga0068856_100781931 Ga0068856_1007819311 232
81 3300005617 Ga0068859_100023730 Ga0068859_1000237306 232
82 3300005617 Ga0068859_100308676 Ga0068859_1003086761 232
83 3300005618 Ga0068864_100000152 Ga0068864_1000001522 232
84 3300005841 Ga0068863_100009111 Ga0068863_10000911110 232
85 3300005842 Ga0068858_100002589 Ga0068858_1000025898 232
86 3300005843 Ga0068860_100008035 Ga0068860_10000803511 232
87 3300005843 Ga0068860_100786156 Ga0068860_1007861561 232
88 3300006931 Ga0097620_100023731 Ga0097620_1000237316 232
89 3300006931 Ga0097620_100308677 Ga0097620_1003086772 232
90 3300009011 Ga0105251_10122223 Ga0105251_101222231 232
91 3300009101 Ga0105247_10010739 Ga0105247_100107395 232
92 3300009177 Ga0105248_10004459 Ga0105248_100044595 232
93 3300009177 Ga0105248_10365503 Ga0105248_103655031 232
94 3300009553 Ga0105249_10003054 Ga0105249_1000305412 232
95 3300009553 Ga0105249_10046954 Ga0105249_100469541 232
96 3300013306 Ga0163162_10018976 Ga0163162_100189765 232
97 3300013308 Ga0157375_10238518 Ga0157375_102385182 232
98 3300014325 Ga0163163_10003435 Ga0163163_100034359 232
99 3300014968 Ga0157379_10006683 Ga0157379_100066837 232
100 3300025900 Ga0207710_10033344 Ga0207710_100333442 232
101 3300025923 Ga0207681_10307436 Ga0207681_103074361 232
102 3300025931 Ga0207644_10035050 Ga0207644_100350502 232
103 3300025941 Ga0207711_10003281 Ga0207711_1000328110 232
104 3300025942 Ga0207689_10236280 Ga0207689_102362802 232
105 3300025949 Ga0207667_10248953 Ga0207667_102489531 232
106 3300025960 Ga0207651_10008749 Ga0207651_100087495 232
107 3300025986 Ga0207658_10003561 Ga0207658_100035615 232
108 3300025986 Ga0207658_10024363 Ga0207658_100243633 232
109 3300025986 Ga0207658_10357916 Ga0207658_103579162 232
110 3300026035 Ga0207703_10002189 Ga0207703_1000218910 232
111 3300026078 Ga0207702_10682759 Ga0207702_106827592 232
112 3300026088 Ga0207641_10004792 Ga0207641_1000479210 232
113 3300026095 Ga0207676_10000731 Ga0207676_1000073118 232
114 3300028379 Ga0268266_10000001 Ga0268266_100000011667 232
115 3300028381 Ga0268264_10000755 Ga0268264_1000075526 232
116 3300028381 Ga0268264_10745431 Ga0268264_107454311 232
117 3300037471 Ga0395905_0252357 Ga0395905_0252357_335_1093 232
118 3300038443 Ga0395901_0384035 Ga0395901_0384035_235_993 232
119 3300048907 Ga0496104_0124854 Ga0496104_0124854_885_1583 232
120 3300048918 Ga0496115_0097974 Ga0496115_0097974_1026_1724 232
121 3300048924 Ga0496121_0000125 Ga0496121_0000125_93946_94707 232
122 3300005347 Ga0070668_100192299 Ga0070668_1001922991 233
123 3300005439 Ga0070711_100136703 Ga0070711_1001367032 233
124 3300005471 Ga0070698_100048646 Ga0070698_1000486464 233
125 3300005844 Ga0068862_100028040 Ga0068862_1000280402 233
126 3300009147 Ga0114129_10229116 Ga0114129_102291163 233
127 3300025929 Ga0207664_10184637 Ga0207664_101846371 233
128 3300025934 Ga0207686_10484149 Ga0207686_104841492 233
129 3300025972 Ga0207668_10221307 Ga0207668_102213071 233
130 3300028380 Ga0268265_10010290 Ga0268265_100102906 233
131 3300028380 Ga0268265_10066278 Ga0268265_100662785 233
132 3300061734 Ga0530510_0157026 Ga0530510_0157026_439_1140 233
133 3300005355 Ga0070671_100068143 Ga0070671_1000681431 234
134 3300005459 Ga0068867_100288596 Ga0068867_1002885962 234
135 3300005578 Ga0068854_100183694 Ga0068854_1001836942 234
136 3300005983 Ga0081540_1000580 Ga0081540_100058017 234
137 3300005983 Ga0081540_1007484 Ga0081540_10074845 234
138 3300006844 Ga0075428_100615418 Ga0075428_1006154182 234
139 3300006846 Ga0075430_100085772 Ga0075430_1000857722 234
140 3300006847 Ga0075431_100010855 Ga0075431_1000108552 234
141 3300009147 Ga0114129_11013777 Ga0114129_110137772 234
142 3300025981 Ga0207640_10334917 Ga0207640_103349172 234
143 3300026089 Ga0207648_10057327 Ga0207648_100573272 234
144 3300050507 nmdc:mga05p37_807124_c1 nmdc:mga05p37_807124_c1_190_906 234
145 3300050508 nmdc:mga09592_104192_c1 nmdc:mga09592_104192_c1_660_1376 234
146 3300050509 nmdc:mga0qj67_7502_c1 nmdc:mga0qj67_7502_c1_4217_4933 234
147 3300050510 nmdc:mga06r32_110285_c1 nmdc:mga06r32_110285_c1_562_1278 234
148 3300021361 Ga0213872_10051156 Ga0213872_100511562 235
149 3300004798 Ga0058859_11642043 Ga0058859_116420432 236
150 3300005293 Ga0065715_10527717 Ga0065715_105277171 236
151 3300005295 Ga0065707_10001699 Ga0065707_100016994 236
152 3300005295 Ga0065707_10123162 Ga0065707_101231621 236
153 3300005330 Ga0070690_100451137 Ga0070690_1004511371 236
154 3300005335 Ga0070666_10185379 Ga0070666_101853791 236
155 3300005340 Ga0070689_100000303 Ga0070689_1000003032 236
156 3300005340 Ga0070689_100000303 Ga0070689_1000003037 236
157 3300005343 Ga0070687_100067962 Ga0070687_1000679622 236
158 3300005343 Ga0070687_100141850 Ga0070687_1001418502 236
159 3300005354 Ga0070675_100074858 Ga0070675_1000748583 236
160 3300005354 Ga0070675_100551652 Ga0070675_1005516521 236
161 3300005364 Ga0070673_100032381 Ga0070673_1000323813 236
162 3300005365 Ga0070688_100000216 Ga0070688_10000021626 236
163 3300005365 Ga0070688_100000216 Ga0070688_10000021631 236
164 3300005365 Ga0070688_100168094 Ga0070688_1001680942 236
165 3300005438 Ga0070701_10145637 Ga0070701_101456372 236
166 3300005444 Ga0070694_100020737 Ga0070694_1000207374 236
167 3300005444 Ga0070694_100154864 Ga0070694_1001548642 236
168 3300005445 Ga0070708_100559407 Ga0070708_1005594072 236
169 3300005466 Ga0070685_10032392 Ga0070685_100323922 236
170 3300005466 Ga0070685_10088415 Ga0070685_100884152 236
171 3300005471 Ga0070698_100041633 Ga0070698_1000416333 236
172 3300005535 Ga0070684_100421376 Ga0070684_1004213761 236
173 3300005536 Ga0070697_100260152 Ga0070697_1002601522 236
174 3300005544 Ga0070686_100512009 Ga0070686_1005120091 236
175 3300005546 Ga0070696_100413544 Ga0070696_1004135441 236
176 3300005617 Ga0068859_100057118 Ga0068859_1000571182 236
177 3300005617 Ga0068859_100063426 Ga0068859_1000634261 236
178 3300005618 Ga0068864_100068080 Ga0068864_1000680803 236
179 3300005719 Ga0068861_100504764 Ga0068861_1005047641 236
180 3300005841 Ga0068863_100296745 Ga0068863_1002967451 236
181 3300005842 Ga0068858_100006692 Ga0068858_1000066926 236
182 3300005844 Ga0068862_100369326 Ga0068862_1003693262 236
183 3300005981 Ga0081538_10017843 Ga0081538_100178432 236
184 3300006237 Ga0097621_100025603 Ga0097621_1000256035 236
185 3300006358 Ga0068871_100033648 Ga0068871_1000336484 236
186 3300006844 Ga0075428_100564763 Ga0075428_1005647632 236
187 3300006846 Ga0075430_100002119 Ga0075430_1000021192 236
188 3300006931 Ga0097620_100057120 Ga0097620_1000571202 236
189 3300006931 Ga0097620_100063426 Ga0097620_1000634261 236
190 3300009094 Ga0111539_10026627 Ga0111539_100266272 236
191 3300009094 Ga0111539_10155741 Ga0111539_101557413 236
192 3300009147 Ga0114129_10315140 Ga0114129_103151402 236
193 3300009177 Ga0105248_10313923 Ga0105248_103139232 236
194 3300009177 Ga0105248_10448545 Ga0105248_104485452 236
195 3300013296 Ga0157374_10066344 Ga0157374_100663442 236
196 3300013297 Ga0157378_10241119 Ga0157378_102411192 236
197 3300014325 Ga0163163_10211729 Ga0163163_102117292 236
198 3300014325 Ga0163163_10254247 Ga0163163_102542471 236
199 3300014968 Ga0157379_10002745 Ga0157379_100027453 236
200 3300025918 Ga0207662_10002718 Ga0207662_100027184 236
201 3300025936 Ga0207670_10009353 Ga0207670_100093535 236
202 3300025936 Ga0207670_10014409 Ga0207670_100144093 236
203 3300025941 Ga0207711_10070072 Ga0207711_100700724 236
204 3300025942 Ga0207689_10216353 Ga0207689_102163532 236
205 3300025960 Ga0207651_10350318 Ga0207651_103503182 236
206 3300026035 Ga0207703_10031493 Ga0207703_100314936 236
207 3300026088 Ga0207641_10264073 Ga0207641_102640732 236
208 3300026095 Ga0207676_10277377 Ga0207676_102773771 236
209 3300028379 Ga0268266_10532057 Ga0268266_105320571 236
210 3300028380 Ga0268265_10657632 Ga0268265_106576322 236
211 3300045051 Ga0451576_0685414 Ga0451576_0685414_311_1021 236
212 3300046664 Ga0495659_0000514 Ga0495659_0000514_1820_2530 236
213 3300048905 Ga0496102_0079351 Ga0496102_0079351_195_911 236
214 3300048907 Ga0496104_0332089 Ga0496104_0332089_538_1254 236
215 3300048909 Ga0496106_0206061 Ga0496106_0206061_338_1054 236
216 3300048910 Ga0496107_0374450 Ga0496107_0374450_122_838 236
217 3300048924 Ga0496121_0046837 Ga0496121_0046837_732_1505 236
218 3300048928 Ga0496125_0180392 Ga0496125_0180392_100_873 236
219 3300048929 Ga0496126_0046296 Ga0496126_0046296_1897_2670 236
220 3300050507 nmdc:mga05p37_611053_c1 nmdc:mga05p37_611053_c1_75_818 236
221 3300050510 nmdc:mga06r32_364015_c1 nmdc:mga06r32_364015_c1_261_1001 236
222 3300050511 nmdc:mga08y16_363870_c1 nmdc:mga08y16_363870_c1_150_869 236
223 3300050511 nmdc:mga08y16_630202_c1 nmdc:mga08y16_630202_c1_190_933 236
224 3300050513 nmdc:mga0rr50_380128_c1 nmdc:mga0rr50_380128_c1_305_1015 236
225 3300050513 nmdc:mga0rr50_504914_c1 nmdc:mga0rr50_504914_c1_295_1014 236
226 3300050513 nmdc:mga0rr50_765663_c1 nmdc:mga0rr50_765663_c1_61_774 236
227 3300050515 nmdc:mga0a205_66374_c2 nmdc:mga0a205_66374_c2_2019_2729 236

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

9

221

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hfw-assembly1.cif.gz_B the crystal structure of alpha/beta fold hydrolase 0.9144 10 229
7wwf-assembly3.cif.gz_E crystal structure of bioh3 from mycolicibacterium smegmatis 0.8948 9 226
8hfw-assembly2.cif.gz_C-2 the crystal structure of alpha/beta fold hydrolase 0.8879 10 229
8hfw-assembly1.cif.gz_A the crystal structure of alpha/beta fold hydrolase 0.8865 10 229
5y57-assembly3.cif.gz_C crystal structure of a novel pyrethroid hydrolase from sphingobium faniae jz-2 0.8644 8 228
ID Description Score Start End Superfamily
af_Q54QE7_5_233_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9513 9 230 3.40.50.1820
af_Q54QE7_5_233_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9189 9 230 3.40.50.1820
af_F4JRA6_1_133_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8852 8 108 3.40.50.1820
af_Q9FVW3_95_346_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8526 7 227 3.40.50.1820
af_Q8S9K8_14_275_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8453 1 231 3.40.50.1820
ID Description Score Start End GO Terms
AF-G0FR54-F1-model_v4 deleted 1.001 8 230
AF-A0A7U9KPQ2-F1-model_v4 Alpha/beta hydrolase 0.9988 19 227 GO:0016787
AF-A0A7Y7HVM3-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.9985 8 227
AF-A0A7W5ED45-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.9982 8 230
AF-A0A7Y6PTS2-F1-model_v4 Alpha/beta hydrolase 0.9973 9 227 GO:0016787

Feature Viewer

pLDDT pTM Quality
95.16 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map