F336063

General Info

Members Datasets Scaffolds Average Seq Length
223 157 223 129

Family's Representative Sequence

Representative Sequence 3300050494|nmdc:mga06z11_54236_c1|nmdc:mga06z11_54236_c1_923_1357
Length 144
Sequence MFSGREFFDRGVKMSMQDPIADMLTCIRNAQTIGIKSLSMPYSNFKLEILRVLKEEGFIEAFEAVSDNNKRNIQVELKYYQGLPVIEKIKRISRPALRVYKGSDEIPLIRGGLGIAIISTPQGVMTDKSARAKKLGGEVVCSVE

Samples

Sample ID Description Type Environment
1 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
52 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
54 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
55 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
58 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
59 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
60 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
61 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
62 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
66 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
67 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
73 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
74 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
75 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
76 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
77 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
78 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
79 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
80 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
81 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
82 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
83 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
84 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
87 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
91 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
92 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
93 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
94 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
95 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
96 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
99 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
100 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
101 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
108 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
109 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
110 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
111 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
117 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
118 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
121 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
122 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
123 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
124 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
141 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
142 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
143 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
147 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
148 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
157 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.69
Metatranscriptomes 10.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.48
Nodule 0
Rhizoplane 1.35
Rhizosphere 86.55
Stem 0
Stem Tuber 0
Unclassified 7.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058859_11732462 3300004798 Bacteria 1256
2 Ga0065707_10090020 3300005295 Bacteria 4227
3 Ga0070670_102051602 3300005331 Bacteria 527
4 Ga0070682_100585967 3300005337 Unclassified 878
5 Ga0070689_100001298 3300005340 Bacteria 15922
6 Ga0070661_100107326 3300005344 Bacteria 2082
7 Ga0070668_101294791 3300005347 Bacteria 662
8 Ga0070701_10856503 3300005438 Bacteria 624
9 Ga0070711_100032538 3300005439 Bacteria 3467
10 Ga0070678_101384834 3300005456 Bacteria 656
11 Ga0070685_10547966 3300005466 Bacteria 825
12 Ga0070685_11140264 3300005466 Bacteria 590
13 Ga0070698_100960494 3300005471 Unclassified 801
14 Ga0070686_100148750 3300005544 Bacteria 1638
15 Ga0070686_100269184 3300005544 Bacteria 1252
16 Ga0070665_100034049 3300005548 Bacteria 5123
17 Ga0068855_100428936 3300005563 Bacteria 1445
18 Ga0068857_101717254 3300005577 Bacteria 614
19 Ga0070702_100695880 3300005615 Bacteria 774
20 Ga0068858_100054092 3300005842 Bacteria 3712
21 Ga0068858_100101802 3300005842 Bacteria 2679
22 Ga0068860_100959239 3300005843 Unclassified 872
23 Ga0070716_100736047 3300006173 Bacteria 757
24 Ga0075367_10142936 3300006178 Bacteria 1483
25 Ga0075367_10194968 3300006178 Bacteria 1265
26 Ga0075370_10171829 3300006353 Bacteria 1274
27 Ga0075428_100000661 3300006844 Bacteria 35429
28 Ga0075428_100005581 3300006844 Bacteria 13974
29 Ga0075428_102299953 3300006844 Bacteria 555
30 Ga0075430_100529435 3300006846 Bacteria 972
31 Ga0075431_100324088 3300006847 Bacteria 1553
32 Ga0075431_100673013 3300006847 Bacteria 1014
33 Ga0075431_101270141 3300006847 Bacteria 698
34 Ga0075433_10903908 3300006852 Bacteria 770
35 Ga0075434_101025193 3300006871 Bacteria 839
36 Ga0075429_101820502 3300006880 Bacteria 528
37 Ga0075435_100404725 3300007076 Bacteria 1174
38 Ga0105240_10001149 3300009093 Bacteria 46318
39 Ga0105240_11520915 3300009093 Bacteria 701
40 Ga0111539_10000048 3300009094 Bacteria 119733
41 Ga0111539_10580489 3300009094 Bacteria 1306
42 Ga0114129_10126592 3300009147 Bacteria 3512
43 Ga0114129_11590390 3300009147 Bacteria 800
44 Ga0105241_11752921 3300009174 Unclassified 605
45 Ga0105248_10511432 3300009177 Bacteria 1354
46 Ga0105238_10210238 3300009551 Bacteria 1921
47 Ga0157374_11433373 3300013296 Unclassified 714
48 Ga0163162_10022197 3300013306 Bacteria 6257
49 Ga0157375_12500759 3300013308 Bacteria 617
50 Ga0209256_1035059 3300025299 Bacteria 1329
51 Ga0207692_10158472 3300025898 Bacteria 1303
52 Ga0207695_10000929 3300025913 Bacteria 52349
53 Ga0207695_11527166 3300025913 Bacteria 548
54 Ga0207694_10290846 3300025924 Bacteria 1344
55 Ga0207670_10003733 3300025936 Bacteria 8088
56 Ga0207711_10780905 3300025941 Archaea 890
57 Ga0207667_10338026 3300025949 Bacteria 1537
58 Ga0207668_11271255 3300025972 Bacteria 662
59 Ga0207703_10070861 3300026035 Bacteria 2878
60 Ga0207703_10205143 3300026035 Bacteria 1754
61 Ga0207676_11526516 3300026095 Bacteria 665
62 Ga0209995_1041983 3300027471 Bacteria 772
63 Ga0209974_10079495 3300027876 Bacteria 1127
64 Ga0207428_10230815 3300027907 Bacteria 1385
65 Ga0268265_10394846 3300028380 Bacteria 1277
66 Ga0265324_10140103 3300029957 Bacteria 821
67 Ga0265330_10190288 3300031235 Bacteria 869
68 Ga0265316_10343689 3300031344 Bacteria 1081
69 Ga0265316_10514985 3300031344 Bacteria 854
70 Ga0307408_101532558 3300031548 Unclassified 631
71 Ga0316579_10164311 3300031691 Bacteria 1073
72 Ga0316576_10272844 3300031727 Bacteria 1267
73 Ga0316578_10051727 3300031728 Bacteria 2406
74 Ga0316578_10900140 3300031728 Bacteria 511
75 Ga0316577_10001901 3300031733 Bacteria 10097
76 Ga0307413_10443321 3300031824 Bacteria 1029
77 Ga0307407_10439214 3300031903 Unclassified 945
78 Ga0307412_10800740 3300031911 Unclassified 818
79 Ga0307409_100874142 3300031995 Unclassified 911
80 Ga0307414_10386447 3300032004 Unclassified 1212
81 Ga0316585_10065063 3300032137 Bacteria 1181
82 Ga0316593_10001816 3300032168 Bacteria 4873
83 Ga0316593_10004460 3300032168 Bacteria 3596
84 Ga0316593_10004621 3300032168 Bacteria 3550
85 Ga0316593_10009539 3300032168 Bacteria 2746
86 Ga0316593_10011958 3300032168 Bacteria 2537
87 Ga0316593_10021516 3300032168 Bacteria 2017
88 Ga0316593_10036608 3300032168 Bacteria 1619
89 Ga0316593_10047889 3300032168 Bacteria 1438
90 Ga0316593_10095073 3300032168 Bacteria 1052
91 Ga0316593_10106088 3300032168 Bacteria 1000
92 Ga0316593_10206993 3300032168 Unclassified 726
93 Ga0316593_10285599 3300032168 Bacteria 622
94 Ga0316592_1097233 3300033524 Bacteria 676
95 Ga0316586_1040454 3300033527 Bacteria 818
96 Ga0316587_1000717 3300033529 Bacteria 3603
97 Ga0316587_1003230 3300033529 Bacteria 2267
98 Ga0316587_1045873 3300033529 Bacteria 794
99 Ga0316596_1000028 3300033541 Bacteria 14394
100 Ga0316596_1000880 3300033541 Bacteria 5653
101 Ga0316596_1017448 3300033541 Bacteria 1805
102 Ga0316596_1042864 3300033541 Unclassified 1191
103 Ga0316596_1072192 3300033541 Bacteria 925
104 Ga0373958_0138004 3300034819 Bacteria 601
105 Ga0373934_0106558 3300035086 Bacteria 1135
106 Ga0373923_0071640 3300035111 Bacteria 1489
107 Ga0373953_0019388 3300035117 Bacteria 2529
108 Ga0373954_0005180 3300035118 Bacteria 5630
109 Ga0373954_0685148 3300035118 Bacteria 508
110 Ga0373956_0013809 3300035119 Bacteria 3364
111 Ga0373957_0112510 3300035120 Bacteria 1097
112 Ga0373955_0039945 3300035172 Bacteria 2507
113 Ga0373955_0135723 3300035172 Bacteria 1439
114 Ga0316574_0027266 3300035398 Bacteria 3440
115 Ga0316574_0056415 3300035398 Bacteria 2457
116 Ga0373924_0024199 3300035410 Bacteria 2391
117 Ga0373927_0045346 3300035695 Bacteria 2844
118 Ga0373927_0210265 3300035695 Bacteria 1278
119 Ga0373933_0002611 3300035724 Bacteria 10097
120 Ga0373933_1038679 3300035724 Bacteria 540
121 Ga0373947_0495297 3300035725 Unclassified 830
122 Ga0373937_0003223 3300036401 Bacteria 13669
123 Ga0373937_0008098 3300036401 Bacteria 9124
124 Ga0373937_0068851 3300036401 Bacteria 3263
125 Ga0373937_0144056 3300036401 Bacteria 2230
126 Ga0316582_0086506 3300036647 Bacteria 2056
127 Ga0316584_0024637 3300036712 Bacteria 4406
128 Ga0316584_0035170 3300036712 Bacteria 3717
129 Ga0373925_1193670 3300037068 Bacteria 625
130 Ga0395900_1673979 3300037418 Bacteria 547
131 Ga0400484_28932 3300038725 Bacteria 10422
132 Ga0400484_44058 3300038725 Bacteria 9517
133 Ga0400490_07361 3300038726 Bacteria 19331
134 Ga0400485_02770 3300038735 Bacteria 7937
135 Ga0400488_51157 3300038741 Bacteria 5303
136 Ga0400488_52572 3300038741 Bacteria 1825
137 Ga0400486_00803 3300038742 Bacteria 2436
138 Ga0400486_25694 3300038742 Bacteria 15655
139 Ga0400483_035353 3300039062 Bacteria 8181
140 Ga0400483_081955 3300039062 Bacteria 1493
141 Ga0400483_141649 3300039062 Bacteria 8613
142 Ga0400483_151451 3300039062 Bacteria 4060
143 Ga0400483_153100 3300039062 Bacteria 13456
144 Ga0400483_205660 3300039062 Bacteria 9867
145 Ga0400487_37424 3300039110 Bacteria 1112
146 Ga0436365_0188979 3300039437 Bacteria 5898
147 Ga0439465_0100476 3300041413 Bacteria 998
148 Ga0451791_1095324 3300041451 Bacteria 762
149 Ga0451807_0970492 3300041486 Bacteria 655
150 Ga0451807_0975225 3300041486 Bacteria 1099
151 Ga0439432_152476 3300042006 Bacteria 678
152 Ga0451577_0060938 3300042876 Bacteria 3364
153 Ga0453683_0088991 3300044673 Bacteria 1935
154 Ga0453684_0000532 3300044712 Bacteria 145255
155 Ga0453684_0039699 3300044712 Bacteria 6406
156 Ga0453684_1435780 3300044712 Bacteria 714
157 Ga0451576_0024779 3300045051 Bacteria 6475
158 Ga0451576_0033579 3300045051 Bacteria 5454
159 Ga0451576_0571110 3300045051 Bacteria 1188
160 Ga0451576_0638114 3300045051 Bacteria 1119
161 Ga0451576_1771679 3300045051 Bacteria 639
162 Ga0495592_0000015 3300046454 Bacteria 145683
163 Ga0495580_1082364 3300046472 Unclassified 508
164 Ga0495662_0012857 3300046476 Bacteria 4080
165 Ga0495664_0006002 3300046477 Bacteria 6694
166 Ga0495594_0731913 3300046499 Bacteria 559
167 Ga0495618_0001289 3300046514 Bacteria 16917
168 Ga0495628_0000722 3300046516 Bacteria 30647
169 Ga0495630_0031802 3300046517 Bacteria 3930
170 Ga0495666_0022514 3300046526 Bacteria 3121
171 Ga0495652_0019958 3300046529 Bacteria 5960
172 Ga0495640_0005038 3300046533 Bacteria 10496
173 Ga0495586_0000979 3300046535 Bacteria 16168
174 Ga0495645_0019740 3300046543 Bacteria 4855
175 Ga0495635_0055297 3300046663 Bacteria 2734
176 Ga0495599_0002301 3300046678 Bacteria 11109
177 Ga0495646_0162568 3300046680 Unclassified 1235
178 Ga0495647_0331767 3300046681 Unclassified 690
179 Ga0495647_0338852 3300046681 Bacteria 683
180 Ga0495624_0006439 3300046690 Bacteria 8332
181 Ga0495604_0870881 3300047317 Unclassified 564
182 Ga0495674_0000992 3300047319 Bacteria 27284
183 Ga0501291_017611 3300049514 Bacteria 1102
184 Ga0501032_0034469 3300049569 Bacteria 3465
185 Ga0501034_0009576 3300049571 Bacteria 10139
186 Ga0501036_0142042 3300049572 Bacteria 2026
187 Ga0501037_0001035 3300049573 Bacteria 20561
188 Ga0501037_0003782 3300049573 Bacteria 10981
189 Ga0501038_0018405 3300049574 Bacteria 6306
190 Ga0501038_0909491 3300049574 Bacteria 649
191 Ga0501043_0669259 3300049579 Bacteria 761
192 Ga0501046_0013020 3300049580 Bacteria 7058
193 Ga0501047_0091863 3300049581 Bacteria 2914
194 Ga0501047_0424541 3300049581 Bacteria 1161
195 Ga0501048_1043818 3300049582 Bacteria 588
196 Ga0501069_0099636 3300049585 Bacteria 1649
197 Ga0501070_0011561 3300049586 Bacteria 7452
198 Ga0501070_0081072 3300049586 Bacteria 2684
199 Ga0501071_0256218 3300049587 Bacteria 1321
200 Ga0501074_0000179 3300049590 Bacteria 34289
201 Ga0501074_0858341 3300049590 Bacteria 639
202 Ga0501209_214807 3300049656 Unclassified 595
203 Ga0501217_061324 3300049661 Bacteria 1005
204 Ga0501236_093795 3300049670 Unclassified 580
205 Ga0501225_0052580 3300049705 Unclassified 1136
206 Ga0501079_0169796 3300049741 Bacteria 1701
207 Ga0501080_0001184 3300049742 Bacteria 21614
208 Ga0501080_0267684 3300049742 Bacteria 1556
209 nmdc:mga03n38_360870_c1 3300050490 Bacteria 792
210 nmdc:mga06z11_160092_c1 3300050494 Bacteria 1286
211 nmdc:mga06z11_54236_c1 3300050494 Bacteria 2065
212 nmdc:mga07m45_168074_c1 3300050496 Bacteria 1274
213 nmdc:mga05p37_277453_c1 3300050507 Bacteria 2000
214 nmdc:mga09592_1592414_c1 3300050508 Bacteria 529
215 nmdc:mga0qj67_1282109_c1 3300050509 Bacteria 568
216 nmdc:mga06r32_698348_c1 3300050510 Bacteria 980
217 nmdc:mga06r32_786082_c1 3300050510 Bacteria 913
218 nmdc:mga08y16_12944_c1 3300050511 Bacteria 8776
219 nmdc:mga08y16_1572141_c1 3300050511 Bacteria 616
220 nmdc:mga0rr50_468394_c1 3300050513 Bacteria 1069
221 nmdc:mga0a205_827908_c1 3300050515 Bacteria 773
222 Ga0500558_294487 3300053106 Bacteria 509
223 Ga0500562_046946 3300053108 Bacteria 1152

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0091863 Ga0501047_0091863_16_330 102
2 3300026095 Ga0207676_11526516 Ga0207676_115265162 103
3 3300045051 Ga0451576_1771679 Ga0451576_1771679_40_360 103
4 3300050490 nmdc:mga03n38_360870_c1 nmdc:mga03n38_360870_c1_459_779 103
5 3300032168 Ga0316593_10106088 Ga0316593_101060881 120
6 3300035398 Ga0316574_0027266 Ga0316574_0027266_187_555 120
7 3300035398 Ga0316574_0056415 Ga0316574_0056415_728_1096 120
8 3300036712 Ga0316584_0035170 Ga0316584_0035170_2381_2749 120
9 3300038741 Ga0400488_51157 Ga0400488_51157_438_806 120
10 3300039062 Ga0400483_205660 Ga0400483_205660_6979_7347 120
11 3300042006 Ga0439432_152476 Ga0439432_152476_18_389 120
12 3300049582 Ga0501048_1043818 Ga0501048_1043818_23_394 120
13 3300046454 Ga0495592_0000015 Ga0495592_0000015_88198_88563 121
14 3300046472 Ga0495580_1082364 Ga0495580_1082364_24_389 121
15 3300046476 Ga0495662_0012857 Ga0495662_0012857_2539_2904 121
16 3300046477 Ga0495664_0006002 Ga0495664_0006002_1012_1377 121
17 3300046514 Ga0495618_0001289 Ga0495618_0001289_12014_12379 121
18 3300046516 Ga0495628_0000722 Ga0495628_0000722_28792_29157 121
19 3300046517 Ga0495630_0031802 Ga0495630_0031802_2071_2436 121
20 3300046526 Ga0495666_0022514 Ga0495666_0022514_444_809 121
21 3300046529 Ga0495652_0019958 Ga0495652_0019958_4542_4907 121
22 3300046533 Ga0495640_0005038 Ga0495640_0005038_7073_7438 121
23 3300046535 Ga0495586_0000979 Ga0495586_0000979_9796_10161 121
24 3300046543 Ga0495645_0019740 Ga0495645_0019740_2247_2612 121
25 3300046678 Ga0495599_0002301 Ga0495599_0002301_7070_7435 121
26 3300046680 Ga0495646_0162568 Ga0495646_0162568_264_629 121
27 3300046690 Ga0495624_0006439 Ga0495624_0006439_6276_6641 121
28 3300047317 Ga0495604_0870881 Ga0495604_0870881_57_422 121
29 3300047319 Ga0495674_0000992 Ga0495674_0000992_20285_20650 121
30 3300005577 Ga0068857_101717254 Ga0068857_1017172542 126
31 3300031344 Ga0265316_10343689 Ga0265316_103436892 126
32 3300049569 Ga0501032_0034469 Ga0501032_0034469_2581_2967 126
33 3300049573 Ga0501037_0001035 Ga0501037_0001035_15343_15729 126
34 3300049573 Ga0501037_0003782 Ga0501037_0003782_3076_3462 126
35 3300049574 Ga0501038_0018405 Ga0501038_0018405_5185_5571 126
36 3300049574 Ga0501038_0909491 Ga0501038_0909491_208_594 126
37 3300049579 Ga0501043_0669259 Ga0501043_0669259_172_558 126
38 3300049580 Ga0501046_0013020 Ga0501046_0013020_1495_1881 126
39 3300049585 Ga0501069_0099636 Ga0501069_0099636_994_1380 126
40 3300049586 Ga0501070_0011561 Ga0501070_0011561_3561_3947 126
41 3300049586 Ga0501070_0081072 Ga0501070_0081072_796_1182 126
42 3300049587 Ga0501071_0256218 Ga0501071_0256218_445_831 126
43 3300049590 Ga0501074_0000179 Ga0501074_0000179_18824_19210 126
44 3300049590 Ga0501074_0858341 Ga0501074_0858341_57_443 126
45 3300049741 Ga0501079_0169796 Ga0501079_0169796_774_1160 126
46 3300049742 Ga0501080_0001184 Ga0501080_0001184_7910_8296 126
47 3300049742 Ga0501080_0267684 Ga0501080_0267684_748_1134 126
48 3300005295 Ga0065707_10090020 Ga0065707_100900207 127
49 3300005331 Ga0070670_102051602 Ga0070670_1020516021 127
50 3300005340 Ga0070689_100001298 Ga0070689_10000129816 127
51 3300005344 Ga0070661_100107326 Ga0070661_1001073262 127
52 3300005347 Ga0070668_101294791 Ga0070668_1012947912 127
53 3300005438 Ga0070701_10856503 Ga0070701_108565031 127
54 3300005439 Ga0070711_100032538 Ga0070711_1000325383 127
55 3300005456 Ga0070678_101384834 Ga0070678_1013848341 127
56 3300005466 Ga0070685_10547966 Ga0070685_105479661 127
57 3300005466 Ga0070685_11140264 Ga0070685_111402641 127
58 3300005471 Ga0070698_100960494 Ga0070698_1009604942 127
59 3300005544 Ga0070686_100148750 Ga0070686_1001487503 127
60 3300005544 Ga0070686_100269184 Ga0070686_1002691842 127
61 3300005548 Ga0070665_100034049 Ga0070665_1000340496 127
62 3300005563 Ga0068855_100428936 Ga0068855_1004289362 127
63 3300005615 Ga0070702_100695880 Ga0070702_1006958801 127
64 3300005842 Ga0068858_100054092 Ga0068858_1000540925 127
65 3300005842 Ga0068858_100101802 Ga0068858_1001018025 127
66 3300005843 Ga0068860_100959239 Ga0068860_1009592391 127
67 3300006178 Ga0075367_10142936 Ga0075367_101429363 127
68 3300006178 Ga0075367_10194968 Ga0075367_101949683 127
69 3300006353 Ga0075370_10171829 Ga0075370_101718292 127
70 3300006844 Ga0075428_100000661 Ga0075428_10000066126 127
71 3300006844 Ga0075428_100005581 Ga0075428_1000055814 127
72 3300006844 Ga0075428_102299953 Ga0075428_1022999531 127
73 3300006846 Ga0075430_100529435 Ga0075430_1005294352 127
74 3300006847 Ga0075431_100324088 Ga0075431_1003240882 127
75 3300006847 Ga0075431_100673013 Ga0075431_1006730132 127
76 3300006847 Ga0075431_101270141 Ga0075431_1012701411 127
77 3300006852 Ga0075433_10903908 Ga0075433_109039082 127
78 3300006871 Ga0075434_101025193 Ga0075434_1010251931 127
79 3300006880 Ga0075429_101820502 Ga0075429_1018205021 127
80 3300007076 Ga0075435_100404725 Ga0075435_1004047252 127
81 3300009093 Ga0105240_11520915 Ga0105240_115209152 127
82 3300009094 Ga0111539_10000048 Ga0111539_1000004858 127
83 3300009094 Ga0111539_10580489 Ga0111539_105804893 127
84 3300009147 Ga0114129_10126592 Ga0114129_101265924 127
85 3300009147 Ga0114129_11590390 Ga0114129_115903902 127
86 3300009177 Ga0105248_10511432 Ga0105248_105114322 127
87 3300013296 Ga0157374_11433373 Ga0157374_114333731 127
88 3300013306 Ga0163162_10022197 Ga0163162_100221972 127
89 3300013308 Ga0157375_12500759 Ga0157375_125007592 127
90 3300025299 Ga0209256_1035059 Ga0209256_10350592 127
91 3300025898 Ga0207692_10158472 Ga0207692_101584721 127
92 3300025913 Ga0207695_11527166 Ga0207695_115271661 127
93 3300025936 Ga0207670_10003733 Ga0207670_1000373315 127
94 3300025941 Ga0207711_10780905 Ga0207711_107809052 127
95 3300025949 Ga0207667_10338026 Ga0207667_103380263 127
96 3300025972 Ga0207668_11271255 Ga0207668_112712552 127
97 3300026035 Ga0207703_10070861 Ga0207703_100708614 127
98 3300026035 Ga0207703_10205143 Ga0207703_102051433 127
99 3300027471 Ga0209995_1041983 Ga0209995_10419832 127
100 3300027876 Ga0209974_10079495 Ga0209974_100794953 127
101 3300027907 Ga0207428_10230815 Ga0207428_102308152 127
102 3300028380 Ga0268265_10394846 Ga0268265_103948463 127
103 3300031235 Ga0265330_10190288 Ga0265330_101902882 127
104 3300031548 Ga0307408_101532558 Ga0307408_1015325581 127
105 3300031691 Ga0316579_10164311 Ga0316579_101643112 127
106 3300031727 Ga0316576_10272844 Ga0316576_102728442 127
107 3300031728 Ga0316578_10051727 Ga0316578_100517276 127
108 3300031728 Ga0316578_10900140 Ga0316578_109001401 127
109 3300031733 Ga0316577_10001901 Ga0316577_100019019 127
110 3300031824 Ga0307413_10443321 Ga0307413_104433212 127
111 3300031903 Ga0307407_10439214 Ga0307407_104392142 127
112 3300031911 Ga0307412_10800740 Ga0307412_108007402 127
113 3300031995 Ga0307409_100874142 Ga0307409_1008741422 127
114 3300032004 Ga0307414_10386447 Ga0307414_103864471 127
115 3300032137 Ga0316585_10065063 Ga0316585_100650633 127
116 3300032168 Ga0316593_10001816 Ga0316593_100018163 127
117 3300032168 Ga0316593_10004460 Ga0316593_100044606 127
118 3300032168 Ga0316593_10004621 Ga0316593_100046217 127
119 3300032168 Ga0316593_10009539 Ga0316593_100095393 127
120 3300032168 Ga0316593_10011958 Ga0316593_100119583 127
121 3300032168 Ga0316593_10021516 Ga0316593_100215163 127
122 3300032168 Ga0316593_10036608 Ga0316593_100366082 127
123 3300032168 Ga0316593_10047889 Ga0316593_100478894 127
124 3300032168 Ga0316593_10095073 Ga0316593_100950731 127
125 3300032168 Ga0316593_10206993 Ga0316593_102069932 127
126 3300032168 Ga0316593_10285599 Ga0316593_102855991 127
127 3300033524 Ga0316592_1097233 Ga0316592_10972332 127
128 3300033527 Ga0316586_1040454 Ga0316586_10404542 127
129 3300033529 Ga0316587_1000717 Ga0316587_10007178 127
130 3300033529 Ga0316587_1003230 Ga0316587_10032301 127
131 3300033529 Ga0316587_1045873 Ga0316587_10458732 127
132 3300033541 Ga0316596_1000028 Ga0316596_100002814 127
133 3300033541 Ga0316596_1000880 Ga0316596_10008802 127
134 3300033541 Ga0316596_1017448 Ga0316596_10174481 127
135 3300033541 Ga0316596_1042864 Ga0316596_10428643 127
136 3300033541 Ga0316596_1072192 Ga0316596_10721922 127
137 3300034819 Ga0373958_0138004 Ga0373958_0138004_188_583 127
138 3300035086 Ga0373934_0106558 Ga0373934_0106558_47_442 127
139 3300035111 Ga0373923_0071640 Ga0373923_0071640_1047_1442 127
140 3300035117 Ga0373953_0019388 Ga0373953_0019388_1669_2064 127
141 3300035118 Ga0373954_0005180 Ga0373954_0005180_139_534 127
142 3300035118 Ga0373954_0685148 Ga0373954_0685148_71_466 127
143 3300035119 Ga0373956_0013809 Ga0373956_0013809_1111_1506 127
144 3300035120 Ga0373957_0112510 Ga0373957_0112510_42_437 127
145 3300035172 Ga0373955_0039945 Ga0373955_0039945_208_603 127
146 3300035172 Ga0373955_0135723 Ga0373955_0135723_467_862 127
147 3300035410 Ga0373924_0024199 Ga0373924_0024199_165_560 127
148 3300035695 Ga0373927_0045346 Ga0373927_0045346_1889_2284 127
149 3300035724 Ga0373933_0002611 Ga0373933_0002611_1999_2394 127
150 3300035724 Ga0373933_1038679 Ga0373933_1038679_20_415 127
151 3300035725 Ga0373947_0495297 Ga0373947_0495297_104_499 127
152 3300036401 Ga0373937_0003223 Ga0373937_0003223_915_1310 127
153 3300036401 Ga0373937_0008098 Ga0373937_0008098_3767_4162 127
154 3300036401 Ga0373937_0068851 Ga0373937_0068851_2705_3100 127
155 3300036401 Ga0373937_0144056 Ga0373937_0144056_198_593 127
156 3300036647 Ga0316582_0086506 Ga0316582_0086506_466_855 127
157 3300036712 Ga0316584_0024637 Ga0316584_0024637_1814_2203 127
158 3300037068 Ga0373925_1193670 Ga0373925_1193670_32_427 127
159 3300037418 Ga0395900_1673979 Ga0395900_1673979_38_427 127
160 3300038725 Ga0400484_28932 Ga0400484_28932_7990_8379 127
161 3300038725 Ga0400484_44058 Ga0400484_44058_3953_4348 127
162 3300038726 Ga0400490_07361 Ga0400490_07361_7609_7998 127
163 3300038735 Ga0400485_02770 Ga0400485_02770_1129_1518 127
164 3300038741 Ga0400488_52572 Ga0400488_52572_978_1367 127
165 3300038742 Ga0400486_00803 Ga0400486_00803_518_907 127
166 3300038742 Ga0400486_25694 Ga0400486_25694_7052_7441 127
167 3300039062 Ga0400483_035353 Ga0400483_035353_4124_4513 127
168 3300039062 Ga0400483_081955 Ga0400483_081955_652_1041 127
169 3300039062 Ga0400483_141649 Ga0400483_141649_1543_1932 127
170 3300039062 Ga0400483_151451 Ga0400483_151451_3563_3952 127
171 3300039062 Ga0400483_153100 Ga0400483_153100_3974_4363 127
172 3300039110 Ga0400487_37424 Ga0400487_37424_39_428 127
173 3300039437 Ga0436365_0188979 Ga0436365_0188979_3980_4369 127
174 3300041413 Ga0439465_0100476 Ga0439465_0100476_370_765 127
175 3300041451 Ga0451791_1095324 Ga0451791_1095324_71_460 127
176 3300041486 Ga0451807_0970492 Ga0451807_0970492_187_576 127
177 3300041486 Ga0451807_0975225 Ga0451807_0975225_685_1080 127
178 3300044673 Ga0453683_0088991 Ga0453683_0088991_1054_1455 127
179 3300044712 Ga0453684_0039699 Ga0453684_0039699_4451_4858 127
180 3300045051 Ga0451576_0033579 Ga0451576_0033579_4575_4970 127
181 3300045051 Ga0451576_0571110 Ga0451576_0571110_532_933 127
182 3300045051 Ga0451576_0638114 Ga0451576_0638114_162_557 127
183 3300046663 Ga0495635_0055297 Ga0495635_0055297_2218_2613 127
184 3300046681 Ga0495647_0331767 Ga0495647_0331767_237_632 127
185 3300046681 Ga0495647_0338852 Ga0495647_0338852_93_488 127
186 3300049514 Ga0501291_017611 Ga0501291_017611_478_870 127
187 3300049571 Ga0501034_0009576 Ga0501034_0009576_4915_5310 127
188 3300049572 Ga0501036_0142042 Ga0501036_0142042_1237_1632 127
189 3300049581 Ga0501047_0424541 Ga0501047_0424541_675_1070 127
190 3300049656 Ga0501209_214807 Ga0501209_214807_43_435 127
191 3300049661 Ga0501217_061324 Ga0501217_061324_478_870 127
192 3300049670 Ga0501236_093795 Ga0501236_093795_134_526 127
193 3300049705 Ga0501225_0052580 Ga0501225_0052580_254_646 127
194 3300050494 nmdc:mga06z11_160092_c1 nmdc:mga06z11_160092_c1_333_722 127
195 3300050494 nmdc:mga06z11_54236_c1 nmdc:mga06z11_54236_c1_923_1357 127
196 3300050496 nmdc:mga07m45_168074_c1 nmdc:mga07m45_168074_c1_272_706 127
197 3300050507 nmdc:mga05p37_277453_c1 nmdc:mga05p37_277453_c1_229_621 127
198 3300050508 nmdc:mga09592_1592414_c1 nmdc:mga09592_1592414_c1_91_486 127
199 3300050509 nmdc:mga0qj67_1282109_c1 nmdc:mga0qj67_1282109_c1_71_463 127
200 3300050510 nmdc:mga06r32_698348_c1 nmdc:mga06r32_698348_c1_280_675 127
201 3300050510 nmdc:mga06r32_786082_c1 nmdc:mga06r32_786082_c1_293_688 127
202 3300050511 nmdc:mga08y16_12944_c1 nmdc:mga08y16_12944_c1_751_1146 127
203 3300050511 nmdc:mga08y16_1572141_c1 nmdc:mga08y16_1572141_c1_104_499 127
204 3300050513 nmdc:mga0rr50_468394_c1 nmdc:mga0rr50_468394_c1_306_701 127
205 3300050515 nmdc:mga0a205_827908_c1 nmdc:mga0a205_827908_c1_328_723 127
206 3300053106 Ga0500558_294487 Ga0500558_294487_43_432 127
207 3300053108 Ga0500562_046946 Ga0500562_046946_508_897 127
208 3300004798 Ga0058859_11732462 Ga0058859_117324623 128
209 3300005337 Ga0070682_100585967 Ga0070682_1005859672 128
210 3300006173 Ga0070716_100736047 Ga0070716_1007360472 128
211 3300009093 Ga0105240_10001149 Ga0105240_1000114916 128
212 3300009174 Ga0105241_11752921 Ga0105241_117529211 128
213 3300009551 Ga0105238_10210238 Ga0105238_102102383 128
214 3300025913 Ga0207695_10000929 Ga0207695_1000092918 128
215 3300025924 Ga0207694_10290846 Ga0207694_102908462 128
216 3300029957 Ga0265324_10140103 Ga0265324_101401031 128
217 3300031344 Ga0265316_10514985 Ga0265316_105149852 128
218 3300035695 Ga0373927_0210265 Ga0373927_0210265_607_996 128
219 3300042876 Ga0451577_0060938 Ga0451577_0060938_78_467 128
220 3300044712 Ga0453684_0000532 Ga0453684_0000532_31844_32233 128
221 3300044712 Ga0453684_1435780 Ga0453684_1435780_134_532 128
222 3300045051 Ga0451576_0024779 Ga0451576_0024779_178_576 128
223 3300046499 Ga0495594_0731913 Ga0495594_0731913_30_428 128

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00410

Ribosomal_S8

Ribosomal protein S8

18

143

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pdb-assembly1.cif.gz_A crystal structure of bacillus anthracis ribosomal protein s8 in complex with an rna aptamer 0.9813 2 128
3j9y-assembly1.cif.gz_h cryo-em structure of tetracycline resistance protein tetm bound to a translating e.coli ribosome 0.977 1 128
7unu-assembly1.cif.gz_h pseudomonas aeruginosa 70s ribosome initiation complex bound to compact if2-gdp (composite structure i-b) 0.9764 1 128
4a2i-assembly1.cif.gz_H cryo-electron microscopy structure of the 30s subunit in complex with the yjeq biogenesis factor 0.9746 3 128
7m4u-assembly1.cif.gz_h a. baumannii ribosome-eravacycline complex: 30s 0.9716 1 128
ID Description Score Start End Superfamily
3ofpH02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.9823 71 128 3.30.1490.10
3uz6K02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.9798 71 128 3.30.1490.10
3ofpH02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.966 71 128 3.30.1490.10
3uz6K02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.9636 71 128 3.30.1490.10
3ofbH01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.9624 3 69 3.30.1370.30
ID Description Score Start End GO Terms
AF-A0A2V7M5U0-F1-model_v4 Small ribosomal subunit protein uS8 (30S ribosomal protein S8) 1.001 69 128 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A1V6DPD0-F1-model_v4 deleted 0.9999 60 128
AF-A0A218L615-F1-model_v4 Small ribosomal subunit protein uS8c (30S ribosomal protein S8, chloroplastic) 0.9994 72 128 GO:0003735
GO:0005840
GO:0006412
GO:0009507
GO:0019843
GO:1990904
AF-L7P5W5-F1-model_v4 Small ribosomal subunit protein uS8c (30S ribosomal protein S8, chloroplastic) 0.9991 72 128 GO:0003735
GO:0005840
GO:0006412
GO:0009507
GO:1990904
AF-A0A1F6RYW0-F1-model_v4 Small ribosomal subunit protein uS8 (30S ribosomal protein S8) 0.9987 70 128 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Feature Viewer

pLDDT pTM Quality
94.72 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map