F330930

General Info

Members Datasets Scaffolds Average Seq Length
219 170 438 100

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10018733|Ga0075364_100187333
Length 102
Sequence MSQTASIWLVIAAALVAANLPFINQRWFAIGPQPRSHSKPLPGRLVELVVLYFLVGGLALLLERRAGQVAPQGWEFYAVTATLFVTLAFPGFVYRYLLRRKV

Samples

Sample ID Description Type Environment
1 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
11 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
12 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
13 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
14 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
15 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
16 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
17 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
18 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
19 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
22 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
23 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
29 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
30 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
31 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
32 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
33 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
34 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
45 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
52 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
53 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
54 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
55 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
56 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
57 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
58 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
59 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
60 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
61 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
62 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
63 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
64 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
65 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
69 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
70 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
71 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
77 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
78 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
79 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
80 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
81 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
82 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
83 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
84 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
85 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
86 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
87 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
88 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
89 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
90 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
91 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
92 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
93 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
94 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
95 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
96 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
97 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
98 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
99 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
100 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
101 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
104 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
105 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
113 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
114 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
115 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
116 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
119 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
120 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
121 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
122 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
125 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
126 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
127 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
138 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
139 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
143 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
144 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
145 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
146 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
147 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
151 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
152 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
153 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
154 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
155 2547132374 Acidovorax radicis N35 Isolate Unclassified
156 2643221570 Acidovorax sp. Root568 Isolate Unclassified
157 2643221596 Acidovorax sp. Root70 Isolate Unclassified
158 2643221609 Acidovorax sp. Root217 Isolate Unclassified
159 2643221611 Acidovorax sp. Root219 Isolate Unclassified
160 2643221652 Acidovorax sp. Root402 Isolate Unclassified
161 2643221717 Acidovorax sp. Root267 Isolate Unclassified
162 2721755523 Delftia sp. HK171 Isolate Unclassified
163 2738543012 Acidovorax sp. CF301 Isolate Unclassified
164 2816332133 Acidovorax radicis 2721A Isolate Unclassified
165 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
166 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
167 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
168 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
169 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
170 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.24
Metatranscriptomes 0.46
Isolates 7.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.44
Nodule 1.37
Rhizoplane 1.83
Rhizosphere 64.84
Stem 0
Stem Tuber 0
Unclassified 1.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075364_10018733 3300006051 Bacteria 4339
2 JGI25156J39149_1000155 3300002705 Bacteria 50271
3 JGI25156J39149_1000196 3300002705 Bacteria 42272
4 JGI25154J39366_1000170 3300002738 Bacteria 50275
5 JGI25154J39366_1000527 3300002738 Bacteria 19218
6 JGI25157J39369_1000091 3300002741 Bacteria 76837
7 Ga0055540_1004451 3300003792 Bacteria 6305
8 Ga0055531_10012323 3300003794 Bacteria 4034
9 Ga0070658_10288951 3300005327 Bacteria 1397
10 Ga0070658_10735453 3300005327 Bacteria 857
11 Ga0068867_101924883 3300005459 Bacteria 558
12 Ga0070707_100581622 3300005468 Bacteria 1082
13 Ga0068857_101635039 3300005577 Bacteria 629
14 Ga0068861_101130833 3300005719 Bacteria 754
15 Ga0075365_10028398 3300006038 Bacteria 3568
16 Ga0075368_10299405 3300006042 Bacteria 694
17 Ga0075363_100183003 3300006048 Bacteria 1193
18 Ga0075362_10032712 3300006177 Bacteria 2259
19 Ga0075362_10125585 3300006177 Bacteria 1217
20 Ga0075362_10285446 3300006177 Bacteria 817
21 Ga0075367_10025675 3300006178 Bacteria 3334
22 Ga0075367_10223142 3300006178 Bacteria 1180
23 Ga0075367_10363347 3300006178 Bacteria 914
24 Ga0075366_10251409 3300006195 Bacteria 1078
25 Ga0075370_10411445 3300006353 Bacteria 812
26 Ga0068871_101351479 3300006358 Bacteria 671
27 Ga0075430_100103770 3300006846 Bacteria 2373
28 Ga0068865_101686885 3300006881 Bacteria 571
29 Ga0079104_1000002 3300006946 Bacteria 514469
30 Ga0105250_10016171 3300009092 Bacteria 3045
31 Ga0114129_10408967 3300009147 Bacteria 1787
32 Ga0105243_10001518 3300009148 Bacteria 20292
33 Ga0105242_11783433 3300009176 Bacteria 653
34 Ga0105249_13217849 3300009553 Bacteria 525
35 Ga0213872_10001066 3300021361 Bacteria 18945
36 Ga0209435_100062 3300025206 Bacteria 77288
37 Ga0209646_1000001 3300025246 Bacteria 3092932
38 Ga0209026_1000224 3300025250 Bacteria 77298
39 Ga0209759_1000013 3300025256 Bacteria 399300
40 Ga0209129_1042441 3300025258 Bacteria 716
41 Ga0209673_1026115 3300025273 Bacteria 1926
42 Ga0209676_1071569 3300025292 Bacteria 822
43 Ga0209051_1006659 3300025303 Bacteria 6466
44 Ga0209257_1000396 3300025304 Bacteria 86000
45 Ga0207696_1035706 3300025711 Bacteria 1478
46 Ga0207688_10733096 3300025901 Bacteria 625
47 Ga0207705_10576549 3300025909 Bacteria 875
48 Ga0207646_10206104 3300025922 Bacteria 1776
49 Ga0207709_10000015 3300025935 Bacteria 493221
50 Ga0207674_10961407 3300026116 Bacteria 823
51 Ga0209281_1000007 3300027111 Bacteria 938265
52 Ga0209973_1046395 3300027252 Bacteria 647
53 Ga0209984_1038087 3300027424 Bacteria 689
54 Ga0209971_1007464 3300027682 Bacteria 2595
55 Ga0209974_10005109 3300027876 Bacteria 4633
56 Ga0209974_10048702 3300027876 Bacteria 1421
57 Ga0268265_12486918 3300028380 Bacteria 524
58 Ga0268264_12032110 3300028381 Bacteria 584
59 Ga0265334_10031809 3300028573 Bacteria 2107
60 Ga0307515_10000515 3300028794 Bacteria 92187
61 Ga0307515_10097900 3300028794 Bacteria 3579
62 Ga0307512_10433371 3300030522 Bacteria 538
63 Ga0265330_10000033 3300031235 Bacteria 126931
64 Ga0265332_10000001 3300031238 Bacteria 863783
65 Ga0265320_10427193 3300031240 Unclassified 585
66 Ga0265325_10041893 3300031241 Bacteria 2397
67 Ga0265340_10042938 3300031247 Bacteria 2218
68 Ga0307513_10033267 3300031456 Bacteria 5796
69 Ga0307513_10091259 3300031456 Bacteria 3105
70 Ga0307408_100000079 3300031548 Bacteria 108053
71 Ga0307408_100332615 3300031548 Bacteria 1283
72 Ga0307408_100447115 3300031548 Bacteria 1120
73 Ga0307514_10000529 3300031649 Bacteria 74752
74 Ga0265314_10000022 3300031711 Bacteria 297299
75 Ga0307406_10000132 3300031901 Bacteria 44227
76 Ga0307407_10227498 3300031903 Bacteria 1265
77 Ga0307412_10242973 3300031911 Bacteria 1394
78 Ga0307412_11935373 3300031911 Bacteria 545
79 Ga0307416_100186447 3300032002 Bacteria 1951
80 Ga0307416_101367586 3300032002 Bacteria 814
81 Ga0307416_101803019 3300032002 Bacteria 716
82 Ga0307416_102982145 3300032002 Bacteria 566
83 Ga0307411_10447192 3300032005 Bacteria 1080
84 Ga0307510_10107318 3300033180 Bacteria 2552
85 Ga0373955_0763378 3300035172 Unclassified 594
86 Ga0373927_0767099 3300035695 Bacteria 637
87 Ga0395899_0012466 3300037312 Bacteria 6512
88 Ga0395900_0007514 3300037418 Bacteria 11260
89 Ga0395900_0511781 3300037418 Bacteria 1149
90 Ga0395900_1921468 3300037418 Bacteria 502
91 Ga0395898_0023604 3300037466 Bacteria 6212
92 Ga0395898_0048246 3300037466 Bacteria 4177
93 Ga0395898_0067439 3300037466 Bacteria 3464
94 Ga0395905_0052837 3300037471 Bacteria 3803
95 Ga0395905_0339628 3300037471 Bacteria 1393
96 Ga0395905_0382978 3300037471 Bacteria 1300
97 Ga0395905_0663825 3300037471 Bacteria 945
98 Ga0395905_0673123 3300037471 Bacteria 937
99 Ga0395901_0019178 3300038443 Bacteria 6992
100 Ga0395901_0142544 3300038443 Bacteria 2518
101 Ga0395901_0374576 3300038443 Bacteria 1466
102 Ga0395901_0428665 3300038443 Bacteria 1355
103 Ga0436361_0240598 3300039447 Bacteria 30904
104 Ga0439436_0034108 3300041404 Bacteria 1472
105 Ga0439436_0034474 3300041404 Bacteria 1463
106 Ga0439439_0064931 3300041406 Bacteria 973
107 Ga0439461_0083688 3300041410 Bacteria 756
108 Ga0439466_0092520 3300041411 Bacteria 947
109 Ga0451791_1902279 3300041451 Bacteria 1274
110 Ga0451793_0380195 3300041452 Bacteria 619
111 Ga0451802_1306549 3300041460 Bacteria 1424
112 Ga0451843_1561611 3300041509 Bacteria 615
113 Ga0451853_1178378 3300041512 Bacteria 613
114 Ga0451853_2563559 3300041512 Bacteria 1196
115 Ga0439431_0099506 3300041997 Bacteria 798
116 Ga0439449_0003325 3300042007 Bacteria 6273
117 Ga0439449_0196669 3300042007 Bacteria 755
118 Ga0439450_182083 3300042008 Bacteria 558
119 Ga0439456_076467 3300042013 Bacteria 745
120 Ga0439457_021830 3300042014 Bacteria 1418
121 Ga0439457_033367 3300042014 Bacteria 1143
122 Ga0450914_009978 3300042118 Bacteria 909
123 Ga0450897_035662 3300042128 Bacteria 575
124 Ga0450899_007334 3300042135 Bacteria 1200
125 Ga0450903_046794 3300042138 Bacteria 636
126 Ga0450903_048408 3300042138 Bacteria 624
127 Ga0450889_024072 3300042144 Bacteria 688
128 Ga0439446_0028688 3300042156 Bacteria 1603
129 Ga0439446_0267013 3300042156 Bacteria 594
130 Ga0450908_035225 3300042184 Bacteria 868
131 Ga0439434_0102218 3300042435 Bacteria 924
132 Ga0439435_0025217 3300042436 Bacteria 1575
133 Ga0439464_0012337 3300042439 Bacteria 2275
134 Ga0450893_0130335 3300042532 Bacteria 531
135 Ga0451577_1849064 3300042876 Bacteria 529
136 Ga0439440_0215643 3300042993 Bacteria 574
137 Ga0466969_0237371 3300044656 Bacteria 828
138 Ga0453683_0002946 3300044673 Bacteria 12812
139 Ga0453683_0410618 3300044673 Bacteria 873
140 Ga0466966_0333374 3300044684 Bacteria 912
141 Ga0466966_0727734 3300044684 Bacteria 598
142 Ga0453684_1584362 3300044712 Bacteria 673
143 Ga0453684_1847526 3300044712 Bacteria 613
144 Ga0466957_0128997 3300044842 Bacteria 1618
145 Ga0466957_0227454 3300044842 Bacteria 1234
146 Ga0466957_0845883 3300044842 Bacteria 652
147 Ga0466959_0183206 3300045049 Bacteria 1464
148 Ga0451576_0350161 3300045051 Bacteria 1546
149 Ga0466967_2431965 3300045976 Bacteria 519
150 Ga0495663_0250443 3300046525 Bacteria 629
151 Ga0495642_0014997 3300046528 Bacteria 3008
152 Ga0495597_0000268 3300046542 Bacteria 47622
153 Ga0495656_0016086 3300046615 Bacteria 2835
154 Ga0495588_0081842 3300046674 Bacteria 1686
155 Ga0495658_0488676 3300046683 Bacteria 787
156 Ga0495669_0076627 3300046684 Bacteria 1531
157 Ga0495636_0273764 3300047318 Bacteria 785
158 Ga0495677_0123572 3300047445 Bacteria 988
159 Ga0495685_140682 3300047447 Bacteria 786
160 Ga0495615_0013158 3300048090 Bacteria 1723
161 Ga0496114_0319817 3300048917 Bacteria 1371
162 Ga0496119_0101366 3300048922 Bacteria 1616
163 Ga0496125_0072388 3300048928 Bacteria 2685
164 Ga0496126_0312587 3300048929 Bacteria 1293
165 Ga0501306_026234 3300049127 Bacteria 843
166 Ga0501033_0202101 3300049570 Bacteria 1419
167 Ga0501033_0402416 3300049570 Bacteria 955
168 Ga0501034_0318162 3300049571 Bacteria 1489
169 Ga0501034_0388714 3300049571 Bacteria 1319
170 Ga0501037_0601121 3300049573 Bacteria 739
171 Ga0501039_1010751 3300049575 Bacteria 646
172 Ga0501043_1108842 3300049579 Bacteria 559
173 Ga0501067_0321119 3300049583 Bacteria 862
174 Ga0501073_0323990 3300049589 Bacteria 1064
175 Ga0501073_1089492 3300049589 Bacteria 549
176 Ga0501223_005358 3300049663 Bacteria 2697
177 Ga0501080_0352261 3300049742 Bacteria 1329
178 Ga0501263_026519 3300049760 Bacteria 802
179 Ga0501266_001162 3300049763 Bacteria 3378
180 Ga0501269_025393 3300049766 Bacteria 747
181 Ga0501035_0177771 3300049822 Bacteria 1835
182 Ga0501044_0484098 3300049823 Bacteria 1140
183 Ga0501044_0601833 3300049823 Bacteria 992
184 nmdc:mga03683_63449_c1 3300050489 Bacteria 1566
185 nmdc:mga03683_635128_c1 3300050489 Unclassified 525
186 nmdc:mga00v17_154582_c1 3300050491 Bacteria 1475
187 nmdc:mga0yw44_136614_c1 3300050492 Bacteria 1591
188 nmdc:mga0yw44_408429_c1 3300050492 Bacteria 918
189 nmdc:mga0k408_207189_c1 3300050493 Bacteria 1171
190 nmdc:mga0k408_775448_c1 3300050493 Bacteria 559
191 nmdc:mga0k408_872_c1 3300050493 Bacteria 16615
192 nmdc:mga06z11_108866_c1 3300050494 Bacteria 1531
193 nmdc:mga06z11_181531_c1 3300050494 Bacteria 1214
194 nmdc:mga06z11_359914_c1 3300050494 Bacteria 872
195 nmdc:mga06z11_833117_c1 3300050494 Bacteria 562
196 nmdc:mga04h51_96305_c1 3300050495 Bacteria 1072
197 nmdc:mga05p37_1820928_c1 3300050507 Bacteria 586
198 nmdc:mga09592_687699_c1 3300050508 Bacteria 871
199 Ga0500643_045477 3300053087 Bacteria 1272
200 Ga0500562_012128 3300053108 Bacteria 2189
201 Ga0500616_0084855 3300053153 Bacteria 1583
202 Ga0500634_0038219 3300053161 Bacteria 2610
203 Ga0590074_009953 3300059423 Bacteria 1588
204 2548500054 2547132374 Bacteria 5530232
205 2643868267 2643221570 Bacteria 5103772
206 2643993740 2643221596 Bacteria 5006805
207 2644059840 2643221609 Bacteria 6756331
208 2644074129 2643221611 Bacteria 6820941
209 2644293871 2643221652 Bacteria 5140275
210 2644644628 2643221717 Bacteria 5676132
211 2722882326 2721755523 Bacteria 6430384
212 2739241370 2738543012 Bacteria 7115078
213 2816473535 2816332133 Bacteria 7249298
214 2842719110 2842718218 Bacteria 4560148
215 2881101632 2881101125 Bacteria 4590519
216 2894024491 2894023352 Bacteria 5167372
217 2939632877 2939631187 Bacteria 6118131
218 2974324251 2974320154 Bacteria 4571377
219 2990711660 2990710928 Bacteria 5002431
220 Ga0075364_10018733
221 JGI25156J39149_1000155
222 JGI25156J39149_1000196
223 JGI25154J39366_1000170
224 JGI25154J39366_1000527
225 JGI25157J39369_1000091
226 Ga0055540_1004451
227 Ga0055531_10012323
228 Ga0070658_10288951
229 Ga0070658_10735453
230 Ga0068867_101924883
231 Ga0070707_100581622
232 Ga0068857_101635039
233 Ga0068861_101130833
234 Ga0075365_10028398
235 Ga0075368_10299405
236 Ga0075363_100183003
237 Ga0075362_10032712
238 Ga0075362_10125585
239 Ga0075362_10285446
240 Ga0075367_10025675
241 Ga0075367_10223142
242 Ga0075367_10363347
243 Ga0075366_10251409
244 Ga0075370_10411445
245 Ga0068871_101351479
246 Ga0075430_100103770
247 Ga0068865_101686885
248 Ga0079104_1000002
249 Ga0105250_10016171
250 Ga0114129_10408967
251 Ga0105243_10001518
252 Ga0105242_11783433
253 Ga0105249_13217849
254 Ga0213872_10001066
255 Ga0209435_100062
256 Ga0209646_1000001
257 Ga0209026_1000224
258 Ga0209759_1000013
259 Ga0209129_1042441
260 Ga0209673_1026115
261 Ga0209676_1071569
262 Ga0209051_1006659
263 Ga0209257_1000396
264 Ga0207696_1035706
265 Ga0207688_10733096
266 Ga0207705_10576549
267 Ga0207646_10206104
268 Ga0207709_10000015
269 Ga0207674_10961407
270 Ga0209281_1000007
271 Ga0209973_1046395
272 Ga0209984_1038087
273 Ga0209971_1007464
274 Ga0209974_10005109
275 Ga0209974_10048702
276 Ga0268265_12486918
277 Ga0268264_12032110
278 Ga0265334_10031809
279 Ga0307515_10000515
280 Ga0307515_10097900
281 Ga0307512_10433371
282 Ga0265330_10000033
283 Ga0265332_10000001
284 Ga0265320_10427193
285 Ga0265325_10041893
286 Ga0265340_10042938
287 Ga0307513_10033267
288 Ga0307513_10091259
289 Ga0307408_100000079
290 Ga0307408_100332615
291 Ga0307408_100447115
292 Ga0307514_10000529
293 Ga0265314_10000022
294 Ga0307406_10000132
295 Ga0307407_10227498
296 Ga0307412_10242973
297 Ga0307412_11935373
298 Ga0307416_100186447
299 Ga0307416_101367586
300 Ga0307416_101803019
301 Ga0307416_102982145
302 Ga0307411_10447192
303 Ga0307510_10107318
304 Ga0373955_0763378
305 Ga0373927_0767099
306 Ga0395899_0012466
307 Ga0395900_0007514
308 Ga0395900_0511781
309 Ga0395900_1921468
310 Ga0395898_0023604
311 Ga0395898_0048246
312 Ga0395898_0067439
313 Ga0395905_0052837
314 Ga0395905_0339628
315 Ga0395905_0382978
316 Ga0395905_0663825
317 Ga0395905_0673123
318 Ga0395901_0019178
319 Ga0395901_0142544
320 Ga0395901_0374576
321 Ga0395901_0428665
322 Ga0436361_0240598
323 Ga0439436_0034108
324 Ga0439436_0034474
325 Ga0439439_0064931
326 Ga0439461_0083688
327 Ga0439466_0092520
328 Ga0451791_1902279
329 Ga0451793_0380195
330 Ga0451802_1306549
331 Ga0451843_1561611
332 Ga0451853_1178378
333 Ga0451853_2563559
334 Ga0439431_0099506
335 Ga0439449_0003325
336 Ga0439449_0196669
337 Ga0439450_182083
338 Ga0439456_076467
339 Ga0439457_021830
340 Ga0439457_033367
341 Ga0450914_009978
342 Ga0450897_035662
343 Ga0450899_007334
344 Ga0450903_046794
345 Ga0450903_048408
346 Ga0450889_024072
347 Ga0439446_0028688
348 Ga0439446_0267013
349 Ga0450908_035225
350 Ga0439434_0102218
351 Ga0439435_0025217
352 Ga0439464_0012337
353 Ga0450893_0130335
354 Ga0451577_1849064
355 Ga0439440_0215643
356 Ga0466969_0237371
357 Ga0453683_0002946
358 Ga0453683_0410618
359 Ga0466966_0333374
360 Ga0466966_0727734
361 Ga0453684_1584362
362 Ga0453684_1847526
363 Ga0466957_0128997
364 Ga0466957_0227454
365 Ga0466957_0845883
366 Ga0466959_0183206
367 Ga0451576_0350161
368 Ga0466967_2431965
369 Ga0495663_0250443
370 Ga0495642_0014997
371 Ga0495597_0000268
372 Ga0495656_0016086
373 Ga0495588_0081842
374 Ga0495658_0488676
375 Ga0495669_0076627
376 Ga0495636_0273764
377 Ga0495677_0123572
378 Ga0495685_140682
379 Ga0495615_0013158
380 Ga0496114_0319817
381 Ga0496119_0101366
382 Ga0496125_0072388
383 Ga0496126_0312587
384 Ga0501306_026234
385 Ga0501033_0202101
386 Ga0501033_0402416
387 Ga0501034_0318162
388 Ga0501034_0388714
389 Ga0501037_0601121
390 Ga0501039_1010751
391 Ga0501043_1108842
392 Ga0501067_0321119
393 Ga0501073_0323990
394 Ga0501073_1089492
395 Ga0501223_005358
396 Ga0501080_0352261
397 Ga0501263_026519
398 Ga0501266_001162
399 Ga0501269_025393
400 Ga0501035_0177771
401 Ga0501044_0484098
402 Ga0501044_0601833
403 nmdc:mga03683_63449_c1
404 nmdc:mga03683_635128_c1
405 nmdc:mga00v17_154582_c1
406 nmdc:mga0yw44_136614_c1
407 nmdc:mga0yw44_408429_c1
408 nmdc:mga0k408_207189_c1
409 nmdc:mga0k408_775448_c1
410 nmdc:mga0k408_872_c1
411 nmdc:mga06z11_108866_c1
412 nmdc:mga06z11_181531_c1
413 nmdc:mga06z11_359914_c1
414 nmdc:mga06z11_833117_c1
415 nmdc:mga04h51_96305_c1
416 nmdc:mga05p37_1820928_c1
417 nmdc:mga09592_687699_c1
418 Ga0500643_045477
419 Ga0500562_012128
420 Ga0500616_0084855
421 Ga0500634_0038219
422 Ga0590074_009953
423 2548500054
424 2643868267
425 2643993740
426 2644059840
427 2644074129
428 2644293871
429 2644644628
430 2722882326
431 2739241370
432 2816473535
433 2842719110
434 2881101632
435 2894024491
436 2939632877
437 2974324251
438 2990711660

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10993

DUF2818

Protein of unknown function (DUF2818)

6

99

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zf6-assembly1.cif.gz_A crystal structure of the dimeric human pnpase 0.7503 5 85
5zf6-assembly1.cif.gz_A crystal structure of the dimeric human pnpase 0.5281 5 85
6hay-assembly1.cif.gz_A crystal structure of protac 1 in complex with the bromodomain of human smarca2 and pvhl:elonginc:elonginb 0.4871 34 89
6d8z-assembly1.cif.gz_A crystal structure of the c-terminal guanine nucleotide exchange factor module of human trio 0.478 40 89
4uic-assembly1.cif.gz_A crystal structure of the s-layer protein rsbsc(31-844) 0.4686 7 85
ID Description Score Start End Superfamily
af_I1K5I4_32_243_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.6979 34 90 1.20.1260.10
af_P26769_25_265_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6452 14 99 1.10.287.70
af_E7FEP5_85_395_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5765 8 99 1.10.287.70
af_Q8VHH7_24_306_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5579 11 99 1.10.287.70
af_Q12431_1_108_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5343 4 91 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A157N8P4-F1-model_v4 Membrane protein 0.9243 1 99 GO:0016020
AF-A0A7W5D7P0-F1-model_v4 DUF2818 family protein 0.9218 1 95 GO:0016020
AF-A0A1B3PQG8-F1-model_v4 Transmembrane protein 0.9159 1 100 GO:0016020
AF-A0A844RVC9-F1-model_v4 deleted 0.9151 1 99
AF-A0A1H4H7V7-F1-model_v4 Transmembrane protein 0.913 1 95 GO:0016020

Map