F287587

General Info

Members Datasets Scaffolds Average Seq Length
187 131 374 146

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10155265|Ga0114129_101552651
Length 164
Sequence MSSIGSIRFIWPTGPVAKTGSVLAEAEIREIVDRETRAWDRQDIDLLLSVFHPDMVWPWPRTYTSVDPVEWRLTMGRFDAQRWRRVYEDLFSRYELVHNRRSIAKIEISAEADGAIAVVDIDTLWRDRATGDKSNHWLGRTCKVYALVSGEWKMTMQTGALQYE

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
95 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
96 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
104 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
109 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
110 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
111 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
117 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
131 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.07
Rhizosphere 97.86
Stem 0
Stem Tuber 0
Unclassified 28.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10155265 3300009147 Bacteria 3130
2 JGI24748J21848_1000014 3300002074 Bacteria 147126
3 JGI24034J26672_10000012 3300002239 Bacteria 146139
4 JGI24742J22300_10016679 3300002244 Bacteria 1240
5 Ga0065707_10086218 3300005295 Bacteria 5589
6 Ga0068869_100232277 3300005334 Bacteria 1466
7 Ga0070689_100162187 3300005340 Bacteria 1807
8 Ga0070687_100118629 3300005343 Bacteria 1509
9 Ga0070675_100580468 3300005354 Bacteria 1016
10 Ga0070671_100314264 3300005355 Bacteria 1335
11 Ga0070688_100221099 3300005365 Bacteria 1335
12 Ga0070709_11267063 3300005434 Bacteria 594
13 Ga0070701_10421235 3300005438 Bacteria 851
14 Ga0070705_100286005 3300005440 Unclassified 1174
15 Ga0070705_101003885 3300005440 Unclassified 677
16 Ga0070694_100031756 3300005444 Bacteria 3464
17 Ga0070708_101330495 3300005445 Bacteria 671
18 Ga0068867_100788440 3300005459 Unclassified 846
19 Ga0070685_10376612 3300005466 Bacteria 977
20 Ga0070706_100181240 3300005467 Bacteria 1966
21 Ga0070707_100010571 3300005468 Bacteria 8597
22 Ga0070707_100137577 3300005468 Bacteria 2376
23 Ga0070707_100495329 3300005468 Unclassified 1184
24 Ga0070707_100545485 3300005468 Unclassified 1122
25 Ga0070698_100331424 3300005471 Bacteria 1453
26 Ga0070698_101020206 3300005471 Unclassified 775
27 Ga0070699_100014179 3300005518 Bacteria 6858
28 Ga0070699_100263128 3300005518 Bacteria 1543
29 Ga0070699_100397827 3300005518 Bacteria 1245
30 Ga0070697_100238547 3300005536 Bacteria 1552
31 Ga0070697_100435979 3300005536 Unclassified 1140
32 Ga0070697_100687605 3300005536 Unclassified 902
33 Ga0070697_101651578 3300005536 Bacteria 573
34 Ga0070672_100661990 3300005543 Unclassified 912
35 Ga0070686_100782801 3300005544 Bacteria 767
36 Ga0070695_100091604 3300005545 Bacteria 2031
37 Ga0070696_100985610 3300005546 Unclassified 703
38 Ga0070704_100167186 3300005549 Unclassified 1745
39 Ga0070704_101753137 3300005549 Unclassified 574
40 Ga0068854_100181148 3300005578 Bacteria 1646
41 Ga0070702_100134520 3300005615 Bacteria 1566
42 Ga0068859_100471312 3300005617 Unclassified 1351
43 Ga0068859_100543566 3300005617 Bacteria 1256
44 Ga0068864_100784637 3300005618 Bacteria 935
45 Ga0068866_10003048 3300005718 Bacteria 6915
46 Ga0068866_10912963 3300005718 Bacteria 618
47 Ga0068866_11125511 3300005718 Unclassified 563
48 Ga0068861_100018378 3300005719 Bacteria 4981
49 Ga0068863_100463614 3300005841 Bacteria 1244
50 Ga0068858_100000602 3300005842 Bacteria 37601
51 Ga0068858_100111160 3300005842 Unclassified 2559
52 Ga0068858_100704680 3300005842 Bacteria 982
53 Ga0081539_10080225 3300005985 Bacteria 1717
54 Ga0081539_10089442 3300005985 Bacteria 1595
55 Ga0070715_10000013 3300006163 Bacteria 155405
56 Ga0070716_100480879 3300006173 Viruses 912
57 Ga0075428_100340773 3300006844 Bacteria 1610
58 Ga0075431_100010023 3300006847 Bacteria 9518
59 Ga0075433_10009563 3300006852 Bacteria 7752
60 Ga0075433_11044719 3300006852 Unclassified 711
61 Ga0075429_100038111 3300006880 Unclassified 4184
62 Ga0068865_100388617 3300006881 Unclassified 1140
63 Ga0097620_100471309 3300006931 Unclassified 1351
64 Ga0097620_100543566 3300006931 Bacteria 1256
65 Ga0075435_100343097 3300007076 Unclassified 1280
66 Ga0099794_10028383 3300007265 Bacteria 2603
67 Ga0111539_10003562 3300009094 Bacteria 20524
68 Ga0105245_10114446 3300009098 Bacteria 2512
69 Ga0105247_10000050 3300009101 Bacteria 146183
70 Ga0114129_10093717 3300009147 Bacteria 4159
71 Ga0114129_12043777 3300009147 Unclassified 692
72 Ga0105243_10000029 3300009148 Bacteria 190577
73 Ga0105243_10002136 3300009148 Bacteria 16718
74 Ga0105243_11463140 3300009148 Unclassified 706
75 Ga0105241_10147109 3300009174 Bacteria 1924
76 Ga0105242_10000009 3300009176 Bacteria 162286
77 Ga0105242_10000581 3300009176 Bacteria 28877
78 Ga0105242_10898877 3300009176 Unclassified 885
79 Ga0105248_10386582 3300009177 Unclassified 1575
80 Ga0105248_10823103 3300009177 Bacteria 1048
81 Ga0105248_10949007 3300009177 Unclassified 971
82 Ga0105248_11807431 3300009177 Bacteria 693
83 Ga0105249_10587249 3300009553 Bacteria 1167
84 Ga0105249_10982409 3300009553 Unclassified 913
85 Ga0105239_10051197 3300010375 Bacteria 4527
86 Ga0105239_10233618 3300010375 Unclassified 2063
87 Ga0157378_10000047 3300013297 Bacteria 104964
88 Ga0157378_10050276 3300013297 Bacteria 3709
89 Ga0157378_10056036 3300013297 Bacteria 3511
90 Ga0157378_10104764 3300013297 Bacteria 2586
91 Ga0157378_10299560 3300013297 Unclassified 1556
92 Ga0157378_10400879 3300013297 Bacteria 1352
93 Ga0163162_10228573 3300013306 Bacteria 1991
94 Ga0163162_10402313 3300013306 Unclassified 1502
95 Ga0157375_10004211 3300013308 Bacteria 12479
96 Ga0157375_10110816 3300013308 Bacteria 2842
97 Ga0207672_1000326 3300025223 Bacteria 6361
98 Ga0207653_10010259 3300025885 Bacteria 2922
99 Ga0207642_10189174 3300025899 Bacteria 1128
100 Ga0207710_10000003 3300025900 Bacteria 1071597
101 Ga0207685_10000013 3300025905 Bacteria 186374
102 Ga0207684_10228629 3300025910 Bacteria 1605
103 Ga0207662_10051785 3300025918 Unclassified 2442
104 Ga0207646_10007747 3300025922 Bacteria 10866
105 Ga0207646_10174476 3300025922 Bacteria 1941
106 Ga0207646_10424758 3300025922 Unclassified 1200
107 Ga0207646_11136402 3300025922 Unclassified 686
108 Ga0207681_11485284 3300025923 Unclassified 568
109 Ga0207687_10045039 3300025927 Bacteria 3048
110 Ga0207644_10002180 3300025931 Bacteria 12701
111 Ga0207644_10474473 3300025931 Bacteria 1030
112 Ga0207686_10000010 3300025934 Bacteria 227471
113 Ga0207686_10000496 3300025934 Bacteria 25802
114 Ga0207709_10000052 3300025935 Bacteria 227471
115 Ga0207709_10001154 3300025935 Bacteria 19226
116 Ga0207709_10281710 3300025935 Bacteria 1228
117 Ga0207669_10049786 3300025937 Bacteria 2500
118 Ga0207704_10073816 3300025938 Unclassified 2174
119 Ga0207665_10433429 3300025939 Unclassified 1006
120 Ga0207711_10435702 3300025941 Unclassified 1220
121 Ga0207711_10923135 3300025941 Bacteria 811
122 Ga0207689_10003115 3300025942 Bacteria 15213
123 Ga0207689_10152493 3300025942 Bacteria 1905
124 Ga0207640_10820012 3300025981 Unclassified 807
125 Ga0207703_10000355 3300026035 Bacteria 49221
126 Ga0207703_10248502 3300026035 Unclassified 1602
127 Ga0207703_10469108 3300026035 Bacteria 1178
128 Ga0207641_10355098 3300026088 Bacteria 1398
129 Ga0207641_10788661 3300026088 Bacteria 939
130 Ga0207648_10620519 3300026089 Unclassified 998
131 Ga0207675_100005270 3300026118 Bacteria 12439
132 Ga0207675_100470748 3300026118 Unclassified 1247
133 Ga0209982_1036513 3300027552 Bacteria 779
134 Ga0210002_1002486 3300027617 Bacteria 2662
135 Ga0209983_1001861 3300027665 Bacteria 4692
136 Ga0209588_1019432 3300027671 Bacteria 2120
137 Ga0209971_1000761 3300027682 Bacteria 8317
138 Ga0209966_1002371 3300027695 Bacteria 3137
139 Ga0209998_10003802 3300027717 Bacteria 3262
140 Ga0209974_10001594 3300027876 Bacteria 8208
141 Ga0207428_10013998 3300027907 Bacteria 6987
142 Ga0268265_11050926 3300028380 Bacteria 806
143 Ga0268264_11686129 3300028381 Unclassified 644
144 Ga0307513_10004197 3300031456 Bacteria 19272
145 Ga0316579_10008424 3300031691 Bacteria 4297
146 Ga0316577_10384988 3300031733 Bacteria 797
147 Ga0307407_10107552 3300031903 Bacteria 1745
148 Ga0307412_11853549 3300031911 Unclassified 556
149 Ga0307409_100292432 3300031995 Bacteria 1511
150 Ga0307416_100532509 3300032002 Bacteria 1245
151 Ga0307414_10122999 3300032004 Bacteria 1999
152 Ga0307414_10613732 3300032004 Unclassified 977
153 Ga0307415_100189171 3300032126 Bacteria 1623
154 Ga0307415_100692588 3300032126 Unclassified 919
155 Ga0316582_0270035 3300036647 Bacteria 1167
156 Ga0316584_0209654 3300036712 Unclassified 1435
157 Ga0395905_0655924 3300037471 Bacteria 951
158 Ga0316581_0013001 3300037588 Bacteria 2354
159 Ga0395901_1960091 3300038443 Unclassified 532
160 Ga0242420_091081 3300038996 Unclassified 640
161 Ga0400489_43687 3300039093 Bacteria 90859
162 Ga0436362_0320519 3300039453 Unclassified 1224
163 Ga0439444_0138461 3300042437 Unclassified 580
164 Ga0451577_0128333 3300042876 Bacteria 2274
165 Ga0453683_0063258 3300044673 Bacteria 2313
166 Ga0453683_0453542 3300044673 Bacteria 829
167 Ga0453684_0047250 3300044712 Bacteria 5711
168 Ga0453684_0065162 3300044712 Bacteria 4648
169 Ga0453684_0691213 3300044712 Bacteria 1109
170 Ga0451576_0819920 3300045051 Unclassified 977
171 Ga0495636_0006345 3300047318 Bacteria 4645
172 Ga0496106_0008715 3300048909 Bacteria 7502
173 Ga0496113_0674470 3300048916 Unclassified 826
174 Ga0501031_0210894 3300049568 Unclassified 1266
175 Ga0501042_0130171 3300049578 Archaea 1814
176 Ga0501069_0638769 3300049585 Unclassified 640
177 Ga0501072_1307664 3300049588 Bacteria 562
178 Ga0501079_0286034 3300049741 Bacteria 1289
179 Ga0501080_0878326 3300049742 Bacteria 783
180 Ga0501081_0200047 3300049743 Unclassified 1449
181 nmdc:mga05p37_282829_c1 3300050507 Bacteria 1977
182 nmdc:mga09592_78166_c1 3300050508 Bacteria 2816
183 nmdc:mga06r32_31259_c1 3300050510 Bacteria 4999
184 nmdc:mga08y16_46404_c1 3300050511 Bacteria 4549
185 nmdc:mga0n895_79199_c1 3300050512 Bacteria 3272
186 nmdc:mga0a205_1151757_c1 3300050515 Bacteria 623
187 nmdc:mga0a205_6627_c1 3300050515 Bacteria 6819
188 Ga0114129_10155265
189 JGI24748J21848_1000014
190 JGI24034J26672_10000012
191 JGI24742J22300_10016679
192 Ga0065707_10086218
193 Ga0068869_100232277
194 Ga0070689_100162187
195 Ga0070687_100118629
196 Ga0070675_100580468
197 Ga0070671_100314264
198 Ga0070688_100221099
199 Ga0070709_11267063
200 Ga0070701_10421235
201 Ga0070705_100286005
202 Ga0070705_101003885
203 Ga0070694_100031756
204 Ga0070708_101330495
205 Ga0068867_100788440
206 Ga0070685_10376612
207 Ga0070706_100181240
208 Ga0070707_100010571
209 Ga0070707_100137577
210 Ga0070707_100495329
211 Ga0070707_100545485
212 Ga0070698_100331424
213 Ga0070698_101020206
214 Ga0070699_100014179
215 Ga0070699_100263128
216 Ga0070699_100397827
217 Ga0070697_100238547
218 Ga0070697_100435979
219 Ga0070697_100687605
220 Ga0070697_101651578
221 Ga0070672_100661990
222 Ga0070686_100782801
223 Ga0070695_100091604
224 Ga0070696_100985610
225 Ga0070704_100167186
226 Ga0070704_101753137
227 Ga0068854_100181148
228 Ga0070702_100134520
229 Ga0068859_100471312
230 Ga0068859_100543566
231 Ga0068864_100784637
232 Ga0068866_10003048
233 Ga0068866_10912963
234 Ga0068866_11125511
235 Ga0068861_100018378
236 Ga0068863_100463614
237 Ga0068858_100000602
238 Ga0068858_100111160
239 Ga0068858_100704680
240 Ga0081539_10080225
241 Ga0081539_10089442
242 Ga0070715_10000013
243 Ga0070716_100480879
244 Ga0075428_100340773
245 Ga0075431_100010023
246 Ga0075433_10009563
247 Ga0075433_11044719
248 Ga0075429_100038111
249 Ga0068865_100388617
250 Ga0097620_100471309
251 Ga0097620_100543566
252 Ga0075435_100343097
253 Ga0099794_10028383
254 Ga0111539_10003562
255 Ga0105245_10114446
256 Ga0105247_10000050
257 Ga0114129_10093717
258 Ga0114129_12043777
259 Ga0105243_10000029
260 Ga0105243_10002136
261 Ga0105243_11463140
262 Ga0105241_10147109
263 Ga0105242_10000009
264 Ga0105242_10000581
265 Ga0105242_10898877
266 Ga0105248_10386582
267 Ga0105248_10823103
268 Ga0105248_10949007
269 Ga0105248_11807431
270 Ga0105249_10587249
271 Ga0105249_10982409
272 Ga0105239_10051197
273 Ga0105239_10233618
274 Ga0157378_10000047
275 Ga0157378_10050276
276 Ga0157378_10056036
277 Ga0157378_10104764
278 Ga0157378_10299560
279 Ga0157378_10400879
280 Ga0163162_10228573
281 Ga0163162_10402313
282 Ga0157375_10004211
283 Ga0157375_10110816
284 Ga0207672_1000326
285 Ga0207653_10010259
286 Ga0207642_10189174
287 Ga0207710_10000003
288 Ga0207685_10000013
289 Ga0207684_10228629
290 Ga0207662_10051785
291 Ga0207646_10007747
292 Ga0207646_10174476
293 Ga0207646_10424758
294 Ga0207646_11136402
295 Ga0207681_11485284
296 Ga0207687_10045039
297 Ga0207644_10002180
298 Ga0207644_10474473
299 Ga0207686_10000010
300 Ga0207686_10000496
301 Ga0207709_10000052
302 Ga0207709_10001154
303 Ga0207709_10281710
304 Ga0207669_10049786
305 Ga0207704_10073816
306 Ga0207665_10433429
307 Ga0207711_10435702
308 Ga0207711_10923135
309 Ga0207689_10003115
310 Ga0207689_10152493
311 Ga0207640_10820012
312 Ga0207703_10000355
313 Ga0207703_10248502
314 Ga0207703_10469108
315 Ga0207641_10355098
316 Ga0207641_10788661
317 Ga0207648_10620519
318 Ga0207675_100005270
319 Ga0207675_100470748
320 Ga0209982_1036513
321 Ga0210002_1002486
322 Ga0209983_1001861
323 Ga0209588_1019432
324 Ga0209971_1000761
325 Ga0209966_1002371
326 Ga0209998_10003802
327 Ga0209974_10001594
328 Ga0207428_10013998
329 Ga0268265_11050926
330 Ga0268264_11686129
331 Ga0307513_10004197
332 Ga0316579_10008424
333 Ga0316577_10384988
334 Ga0307407_10107552
335 Ga0307412_11853549
336 Ga0307409_100292432
337 Ga0307416_100532509
338 Ga0307414_10122999
339 Ga0307414_10613732
340 Ga0307415_100189171
341 Ga0307415_100692588
342 Ga0316582_0270035
343 Ga0316584_0209654
344 Ga0395905_0655924
345 Ga0316581_0013001
346 Ga0395901_1960091
347 Ga0242420_091081
348 Ga0400489_43687
349 Ga0436362_0320519
350 Ga0439444_0138461
351 Ga0451577_0128333
352 Ga0453683_0063258
353 Ga0453683_0453542
354 Ga0453684_0047250
355 Ga0453684_0065162
356 Ga0453684_0691213
357 Ga0451576_0819920
358 Ga0495636_0006345
359 Ga0496106_0008715
360 Ga0496113_0674470
361 Ga0501031_0210894
362 Ga0501042_0130171
363 Ga0501069_0638769
364 Ga0501072_1307664
365 Ga0501079_0286034
366 Ga0501080_0878326
367 Ga0501081_0200047
368 nmdc:mga05p37_282829_c1
369 nmdc:mga09592_78166_c1
370 nmdc:mga06r32_31259_c1
371 nmdc:mga08y16_46404_c1
372 nmdc:mga0n895_79199_c1
373 nmdc:mga0a205_1151757_c1
374 nmdc:mga0a205_6627_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13577

SnoaL_4

SnoaL-like domain

20

157

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rob-assembly2.cif.gz_D the crystal structure of a conserved protein from planctomyces limnophilus dsm 3776 0.8734 1 137
3rob-assembly2.cif.gz_D the crystal structure of a conserved protein from planctomyces limnophilus dsm 3776 0.8357 1 137
5ien-assembly2.cif.gz_B structure of cdl2.2, a computationally designed vitamin-d3 binder 0.8253 5 136
3fsd-assembly1.cif.gz_A-2 crystal structure of ntf2-like protein of unknown function in nutrient uptake (yp_427473.1) from rhodospirillum rubrum atcc 11170 at 1.70 a resolution 0.8175 8 141
3d9r-assembly2.cif.gz_D crystal structure of ketosteroid isomerase-like protein (yp_049581.1) from erwinia carotovora atroseptica scri1043 at 2.40 a resolution 0.8061 6 136
ID Description Score Start End Superfamily
2r4iB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.822 5 139 3.10.450.50
3fsdA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8064 8 141 3.10.450.50
2r4iB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7987 5 139 3.10.450.50
3d9rD00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.79 6 136 3.10.450.50
3fsdA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7886 8 141 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A7V9PZF7-F1-model_v4 Nuclear transport factor 2 family protein 0.9955 4 141
AF-A0A135VMI3-F1-model_v4 Uncharacterized protein 0.9949 1 141
AF-A0A2M8G512-F1-model_v4 SnoaL-like domain-containing protein 0.9935 5 141
AF-A0A0F9M0Y7-F1-model_v4 DUF4440 domain-containing protein 0.993 1 141
AF-A0A2V7IC33-F1-model_v4 Uncharacterized protein 0.9928 4 141

Map