F258088

General Info

Members Datasets Scaffolds Average Seq Length
171 145 342 197

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100504095|Ga0070682_1005040952
Length 225
Sequence MTGAARREGGSLDGARIAVLIESDYFEPEIHYYDRRFAEEGAEVHFLTRMWGLSNQTFTGHEWRAPFVAERSLEDVPLDELRSYAAVIVPSGMVADRLRYTEDVDTPSPATRFVARAFAEPGILKGVICHGMWLLTSVPHLVRGRPVTCHNNLVGDVRNMGGRYVDRDVVVDGDLVTGRTGQHAHLFARQIIDLLAATRSAAPPAALVPGPRRTTRGVVTRGAVA

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
44 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
45 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
46 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
58 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
60 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
61 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
62 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
63 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
64 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
65 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
66 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
67 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
77 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
79 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
80 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
81 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
82 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
83 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
84 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
89 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
90 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
91 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
92 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
93 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
94 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
95 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
96 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
97 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
98 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
99 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
100 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
101 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
111 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
118 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
121 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
124 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
127 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
128 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
135 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
136 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
137 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
138 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
139 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
140 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
142 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
143 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
144 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
145 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.15
Metatranscriptomes 4.68
Isolates 1.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.09
Nodule 0
Rhizoplane 2.92
Rhizosphere 77.19
Stem 0
Stem Tuber 0
Unclassified 6.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100504095 3300005337 Bacteria 938
2 JGI25165J46597_1003972 3300003214 Bacteria 3384
3 rootH1_10041832 3300003316 Bacteria 2882
4 rootL2_10024599 3300003322 Bacteria 9700
5 Ga0058863_10070085 3300004799 Bacteria 4569
6 Ga0058861_10005261 3300004800 Bacteria 6106
7 Ga0058862_10230958 3300004803 Bacteria 5645
8 Ga0070658_10180877 3300005327 Bacteria 1774
9 Ga0070658_10276318 3300005327 Bacteria 1429
10 Ga0070683_100001102 3300005329 Bacteria 20356
11 Ga0070680_100204172 3300005336 Bacteria 1667
12 Ga0070660_101014774 3300005339 Bacteria 701
13 Ga0070710_10411564 3300005437 Bacteria 909
14 Ga0070678_100156554 3300005456 Bacteria 1841
15 Ga0070681_10134901 3300005458 Bacteria 2399
16 Ga0070681_10208679 3300005458 Bacteria 1870
17 Ga0070684_100020436 3300005535 Bacteria 5493
18 Ga0070684_101195296 3300005535 Bacteria 715
19 Ga0070697_100921150 3300005536 Bacteria 776
20 Ga0070695_100185464 3300005545 Bacteria 1477
21 Ga0070695_100317942 3300005545 Bacteria 1156
22 Ga0070664_100032711 3300005564 Bacteria 4351
23 Ga0068857_100110258 3300005577 Bacteria 2473
24 Ga0068859_101428820 3300005617 Bacteria 763
25 Ga0081455_10056028 3300005937 Bacteria 3349
26 Ga0070716_100518175 3300006173 Unclassified 883
27 Ga0070712_100181128 3300006175 Bacteria 1642
28 Ga0075428_100572338 3300006844 Bacteria 1207
29 Ga0075430_100219866 3300006846 Bacteria 1576
30 Ga0075433_10031987 3300006852 Unclassified 4503
31 Ga0075434_100374620 3300006871 Bacteria 1444
32 Ga0075429_100223876 3300006880 Unclassified 1648
33 Ga0075436_100001336 3300006914 Bacteria 16770
34 Ga0097620_101429063 3300006931 Bacteria 763
35 Ga0111539_10396441 3300009094 Bacteria 1607
36 Ga0111539_10462008 3300009094 Bacteria 1478
37 Ga0111539_11103203 3300009094 Bacteria 922
38 Ga0114129_10397079 3300009147 Bacteria 1818
39 Ga0114129_10847998 3300009147 Bacteria 1162
40 Ga0105243_10518236 3300009148 Bacteria 1133
41 Ga0105241_10859419 3300009174 Bacteria 840
42 Ga0105248_10007091 3300009177 Bacteria 12277
43 Ga0105238_10487361 3300009551 Bacteria 1233
44 Ga0105239_10220871 3300010375 Bacteria 2125
45 Ga0157369_10700367 3300013105 Unclassified 1043
46 Ga0157369_10708634 3300013105 Bacteria 1036
47 Ga0157378_10920846 3300013297 Bacteria 906
48 Ga0157375_11219297 3300013308 Bacteria 883
49 Ga0206349_1849943 3300020075 Bacteria 1803
50 Ga0206352_10145047 3300020078 Bacteria 3311
51 Ga0213873_10132528 3300021358 Unclassified 739
52 Ga0213875_10013908 3300021388 Bacteria 3937
53 Ga0207427_101246 3300025231 Bacteria 9762
54 Ga0209233_1000406 3300025261 Bacteria 34375
55 Ga0207705_10750892 3300025909 Bacteria 758
56 Ga0207693_10331606 3300025915 Bacteria 1191
57 Ga0207694_10283723 3300025924 Bacteria 1361
58 Ga0207687_10345852 3300025927 Bacteria 1210
59 Ga0207689_10470906 3300025942 Bacteria 1051
60 Ga0207661_10007406 3300025944 Bacteria 7810
61 Ga0207667_10040515 3300025949 Bacteria 4961
62 Ga0207639_10036097 3300026041 Bacteria 3661
63 Ga0207674_10085054 3300026116 Bacteria 3160
64 Ga0207683_10181229 3300026121 Bacteria 1910
65 Ga0207428_10281017 3300027907 Bacteria 1235
66 Ga0268264_10842677 3300028381 Unclassified 918
67 Ga0265334_10001079 3300028573 Bacteria 13341
68 Ga0307515_10008949 3300028794 Bacteria 19448
69 Ga0307515_10228848 3300028794 Bacteria 1657
70 Ga0307515_10329978 3300028794 Bacteria 1185
71 Ga0307512_10062429 3300030522 Bacteria 2858
72 Ga0307513_10005938 3300031456 Bacteria 16022
73 Ga0307509_10027327 3300031507 Bacteria 6349
74 Ga0307508_10035930 3300031616 Bacteria 4463
75 Ga0307508_10310826 3300031616 Bacteria 1168
76 Ga0307508_10540309 3300031616 Bacteria 763
77 Ga0316575_10024639 3300031665 Bacteria 2331
78 Ga0307516_10007850 3300031730 Bacteria 12162
79 Ga0307516_10573405 3300031730 Bacteria 782
80 Ga0307405_10137308 3300031731 Bacteria 1699
81 Ga0307410_10010057 3300031852 Bacteria 5341
82 Ga0307406_10085892 3300031901 Bacteria 2105
83 Ga0307406_10376806 3300031901 Bacteria 1117
84 Ga0307407_10117967 3300031903 Bacteria 1677
85 Ga0307412_10202663 3300031911 Bacteria 1508
86 Ga0307409_100001451 3300031995 Bacteria 11655
87 Ga0307416_100007110 3300032002 Bacteria 7077
88 Ga0307416_100906250 3300032002 Bacteria 982
89 Ga0307414_10067616 3300032004 Bacteria 2561
90 Ga0307415_100007700 3300032126 Bacteria 5914
91 Ga0307415_100454198 3300032126 Bacteria 1108
92 Ga0307510_10229908 3300033180 Bacteria 1358
93 Ga0316592_1002903 3300033524 Bacteria 3021
94 Ga0373940_0001005 3300035088 Bacteria 4830
95 Ga0373939_0137507 3300035114 Bacteria 878
96 Ga0373942_0000590 3300035207 Bacteria 10222
97 Ga0373962_0030204 3300035242 Bacteria 1481
98 Ga0316574_0000466 3300035398 Bacteria 16350
99 Ga0373937_0696487 3300036401 Bacteria 962
100 Ga0265778_000953 3300036457 Bacteria 2480
101 Ga0395905_0537960 3300037471 Bacteria 1069
102 Ga0436364_0754383 3300037853 Bacteria 10345
103 Ga0395901_1010247 3300038443 Bacteria 807
104 Ga0400490_53706 3300038726 Bacteria 11922
105 Ga0400491_19144 3300038727 Unclassified 3273
106 Ga0400488_25118 3300038741 Bacteria 1060
107 Ga0400488_58242 3300038741 Bacteria 3002
108 Ga0400483_222025 3300039062 Bacteria 3627
109 Ga0400487_09700 3300039110 Bacteria 17529
110 Ga0400487_31783 3300039110 Unclassified 1277
111 Ga0436360_0545215 3300039438 Bacteria 1201
112 Ga0436361_0930299 3300039447 Bacteria 857
113 Ga0436363_0526924 3300039450 Unclassified 1979
114 Ga0436362_1263766 3300039453 Bacteria 1564
115 Ga0439439_0021180 3300041406 Bacteria 1619
116 Ga0451835_0429020 3300041492 Bacteria 809
117 Ga0451855_1436172 3300041511 Unclassified 2199
118 Ga0439446_0068381 3300042156 Bacteria 1083
119 Ga0466969_0029930 3300044656 Bacteria 2776
120 Ga0466966_0000281 3300044684 Bacteria 33346
121 Ga0466961_0001558 3300044693 Bacteria 14197
122 Ga0466963_0667223 3300044694 Bacteria 734
123 Ga0453684_0000511 3300044712 Bacteria 150804
124 Ga0453684_0572548 3300044712 Unclassified 1241
125 Ga0466970_0009835 3300044765 Bacteria 4843
126 Ga0466957_0280211 3300044842 Bacteria 1116
127 Ga0466959_0001173 3300045049 Bacteria 15781
128 Ga0495582_0425911 3300046473 Bacteria 766
129 Ga0495640_0099086 3300046533 Bacteria 1915
130 Ga0495586_0005257 3300046535 Bacteria 6925
131 Ga0495634_0083799 3300046642 Bacteria 2080
132 Ga0495658_0006047 3300046683 Bacteria 5946
133 Ga0495613_0143904 3300046689 Bacteria 1702
134 Ga0495674_0401984 3300047319 Bacteria 1106
135 Ga0495680_0117432 3300047322 Bacteria 1967
136 Ga0495686_0005509 3300047472 Bacteria 9963
137 Ga0496105_0360589 3300048908 Bacteria 1160
138 Ga0496112_0136792 3300048915 Bacteria 2420
139 Ga0496114_0045729 3300048917 Bacteria 3638
140 Ga0496114_0087616 3300048917 Bacteria 2640
141 Ga0496114_0469338 3300048917 Bacteria 1114
142 Ga0501031_0173297 3300049568 Bacteria 1410
143 Ga0501041_0171949 3300049577 Bacteria 1356
144 Ga0501071_0335608 3300049587 Bacteria 1149
145 Ga0501072_0314396 3300049588 Bacteria 1245
146 Ga0501074_0407552 3300049590 Bacteria 964
147 Ga0501076_0250655 3300049592 Bacteria 1449
148 Ga0501077_0002686 3300049593 Bacteria 10666
149 Ga0501079_0170100 3300049741 Bacteria 1699
150 Ga0501079_0484232 3300049741 Bacteria 972
151 Ga0501081_0023335 3300049743 Bacteria 4146
152 Ga0501081_0476867 3300049743 Bacteria 928
153 nmdc:mga05p37_190089_c1 3300050507 Bacteria 2493
154 nmdc:mga05p37_352609_c1 3300050507 Bacteria 1732
155 nmdc:mga09592_218416_c1 3300050508 Bacteria 1652
156 nmdc:mga08y16_357178_c1 3300050511 Bacteria 1500
157 nmdc:mga0n895_555164_c1 3300050512 Bacteria 1154
158 nmdc:mga08x19_2414_c1 3300050514 Bacteria 11338
159 Ga0495619_0073727 3300053085 Bacteria 2288
160 Ga0500641_0051959 3300053096 Bacteria 1688
161 Ga0500650_0069197 3300053098 Bacteria 1650
162 Ga0500562_040149 3300053108 Bacteria 1244
163 Ga0500579_049585 3300053143 Bacteria 2576
164 Ga0587111_0023192 3300060346 Bacteria 1212
165 Ga0501082_0164703 3300060353 Bacteria 1927
166 Ga0501082_0674598 3300060353 Bacteria 905
167 Ga0501082_1205931 3300060353 Bacteria 661
168 Ga0466962_0039399 3300061719 Bacteria 2263
169 Ga0530510_0200121 3300061734 Bacteria 1483
170 3006491873 3006486233 Bacteria 8157040
171 8055068748 8055066027 Bacteria 9479577
172 Ga0070682_100504095
173 JGI25165J46597_1003972
174 rootH1_10041832
175 rootL2_10024599
176 Ga0058863_10070085
177 Ga0058861_10005261
178 Ga0058862_10230958
179 Ga0070658_10180877
180 Ga0070658_10276318
181 Ga0070683_100001102
182 Ga0070680_100204172
183 Ga0070660_101014774
184 Ga0070710_10411564
185 Ga0070678_100156554
186 Ga0070681_10134901
187 Ga0070681_10208679
188 Ga0070684_100020436
189 Ga0070684_101195296
190 Ga0070697_100921150
191 Ga0070695_100185464
192 Ga0070695_100317942
193 Ga0070664_100032711
194 Ga0068857_100110258
195 Ga0068859_101428820
196 Ga0081455_10056028
197 Ga0070716_100518175
198 Ga0070712_100181128
199 Ga0075428_100572338
200 Ga0075430_100219866
201 Ga0075433_10031987
202 Ga0075434_100374620
203 Ga0075429_100223876
204 Ga0075436_100001336
205 Ga0097620_101429063
206 Ga0111539_10396441
207 Ga0111539_10462008
208 Ga0111539_11103203
209 Ga0114129_10397079
210 Ga0114129_10847998
211 Ga0105243_10518236
212 Ga0105241_10859419
213 Ga0105248_10007091
214 Ga0105238_10487361
215 Ga0105239_10220871
216 Ga0157369_10700367
217 Ga0157369_10708634
218 Ga0157378_10920846
219 Ga0157375_11219297
220 Ga0206349_1849943
221 Ga0206352_10145047
222 Ga0213873_10132528
223 Ga0213875_10013908
224 Ga0207427_101246
225 Ga0209233_1000406
226 Ga0207705_10750892
227 Ga0207693_10331606
228 Ga0207694_10283723
229 Ga0207687_10345852
230 Ga0207689_10470906
231 Ga0207661_10007406
232 Ga0207667_10040515
233 Ga0207639_10036097
234 Ga0207674_10085054
235 Ga0207683_10181229
236 Ga0207428_10281017
237 Ga0268264_10842677
238 Ga0265334_10001079
239 Ga0307515_10008949
240 Ga0307515_10228848
241 Ga0307515_10329978
242 Ga0307512_10062429
243 Ga0307513_10005938
244 Ga0307509_10027327
245 Ga0307508_10035930
246 Ga0307508_10310826
247 Ga0307508_10540309
248 Ga0316575_10024639
249 Ga0307516_10007850
250 Ga0307516_10573405
251 Ga0307405_10137308
252 Ga0307410_10010057
253 Ga0307406_10085892
254 Ga0307406_10376806
255 Ga0307407_10117967
256 Ga0307412_10202663
257 Ga0307409_100001451
258 Ga0307416_100007110
259 Ga0307416_100906250
260 Ga0307414_10067616
261 Ga0307415_100007700
262 Ga0307415_100454198
263 Ga0307510_10229908
264 Ga0316592_1002903
265 Ga0373940_0001005
266 Ga0373939_0137507
267 Ga0373942_0000590
268 Ga0373962_0030204
269 Ga0316574_0000466
270 Ga0373937_0696487
271 Ga0265778_000953
272 Ga0395905_0537960
273 Ga0436364_0754383
274 Ga0395901_1010247
275 Ga0400490_53706
276 Ga0400491_19144
277 Ga0400488_25118
278 Ga0400488_58242
279 Ga0400483_222025
280 Ga0400487_09700
281 Ga0400487_31783
282 Ga0436360_0545215
283 Ga0436361_0930299
284 Ga0436363_0526924
285 Ga0436362_1263766
286 Ga0439439_0021180
287 Ga0451835_0429020
288 Ga0451855_1436172
289 Ga0439446_0068381
290 Ga0466969_0029930
291 Ga0466966_0000281
292 Ga0466961_0001558
293 Ga0466963_0667223
294 Ga0453684_0000511
295 Ga0453684_0572548
296 Ga0466970_0009835
297 Ga0466957_0280211
298 Ga0466959_0001173
299 Ga0495582_0425911
300 Ga0495640_0099086
301 Ga0495586_0005257
302 Ga0495634_0083799
303 Ga0495658_0006047
304 Ga0495613_0143904
305 Ga0495674_0401984
306 Ga0495680_0117432
307 Ga0495686_0005509
308 Ga0496105_0360589
309 Ga0496112_0136792
310 Ga0496114_0045729
311 Ga0496114_0087616
312 Ga0496114_0469338
313 Ga0501031_0173297
314 Ga0501041_0171949
315 Ga0501071_0335608
316 Ga0501072_0314396
317 Ga0501074_0407552
318 Ga0501076_0250655
319 Ga0501077_0002686
320 Ga0501079_0170100
321 Ga0501079_0484232
322 Ga0501081_0023335
323 Ga0501081_0476867
324 nmdc:mga05p37_190089_c1
325 nmdc:mga05p37_352609_c1
326 nmdc:mga09592_218416_c1
327 nmdc:mga08y16_357178_c1
328 nmdc:mga0n895_555164_c1
329 nmdc:mga08x19_2414_c1
330 Ga0495619_0073727
331 Ga0500641_0051959
332 Ga0500650_0069197
333 Ga0500562_040149
334 Ga0500579_049585
335 Ga0587111_0023192
336 Ga0501082_0164703
337 Ga0501082_0674598
338 Ga0501082_1205931
339 Ga0466962_0039399
340 Ga0530510_0200121
341 3006491873
342 8055068748

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

15

194

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fse-assembly1.cif.gz_A crystal structure of a two-domain protein containing dj-1/thij/pfpi-like and ferritin-like domains (ava_4496) from anabaena variabilis atcc 29413 at 1.90 a resolution 0.9207 3 184
3fse-assembly1.cif.gz_B crystal structure of a two-domain protein containing dj-1/thij/pfpi-like and ferritin-like domains (ava_4496) from anabaena variabilis atcc 29413 at 1.90 a resolution 0.9199 3 184
3l18-assembly1.cif.gz_B ton1285, an intracellular protease from thermococcus onnurineus na1 0.9091 3 183
7r66-assembly1.cif.gz_A structure of pfp1 protease from thermococcus thioreducens: large unit cell at 1.44 a resolution 0.9078 4 183
6q3t-assembly1.cif.gz_A structure of protease1 from pyrococcus horikoshii at room temperature in chipx microfluidic device 0.9075 4 183
ID Description Score Start End Superfamily
3fseB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9104 3 184 3.40.50.880
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8982 4 181 3.40.50.880
4y1eA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8967 3 184 3.40.50.880
4hcjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8851 3 185 3.40.50.880
af_Q58377_26_203_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8837 2 185 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A1G1G2Q7-F1-model_v4 Thiamine biosynthesis protein ThiJ 0.9868 2 183
AF-A0A1Z4MV91-F1-model_v4 ThiJ/PfpI domain-containing protein 0.9864 2 185
AF-K9U694-F1-model_v4 ThiJ/PfpI domain-containing protein 0.986 2 185
AF-A0A7G6XPZ3-F1-model_v4 Thiamine biosynthesis protein ThiJ 0.9854 2 186
AF-A0A495X2U5-F1-model_v4 Protease I 0.9849 3 185 GO:0006508
GO:0008233

Map