F496512
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2176 | 831 | 4352 | 383 |
Family's Representative Sequence
| Representative Sequence | 3300025231|Ga0207427_100042|Ga0207427_100042108 |
| Length | 448 |
| Sequence | VEGASTIAVDFAARFAGVQQDALEFFLAKFISASSYSPAELPRRNRPASATSVPEPADWITVDLYEYQARDLFEQYGVPVLPGIVADTPEEVRAAAEKLGGVVVVKAQVKVGGRGKAGGVKVAKNPDEAEEAAKAILGLDIKGHIVRRVMVAGGARIAKEFYFSVLLDRANRSYLSLTSVEGGMEIEQLAVEKPEALARIEVDPITGVDAAKAAEIAKAAGFPDDLADKVADVFVKLYEVYKGEDATLVEVNPLVLTEEGDIIALDGKVTLDENAGFRHPNHEALEDKAAADPLEAKAKASDLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHKGVKPANFLDIGGGASAAVMAAGLDVILNDPQVKSVFVNVFGGITACDAVANGIVKALEILGDEANKPLVVRLDGNNVDEGRRILTEAAHPLVTLALTMDEGADKAAELAAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 10 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 11 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 13 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 14 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 15 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 16 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 17 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 18 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 27 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 85 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 86 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 87 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 88 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 89 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 90 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 91 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 92 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 93 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 94 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 95 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 96 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 98 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 99 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 100 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 104 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 105 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 106 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 108 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 109 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 110 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 111 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 112 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 113 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 114 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 115 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 117 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 118 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 138 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 155 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 156 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 158 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 166 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 241 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 245 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 246 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 247 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 248 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 249 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 250 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 251 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 252 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 253 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 254 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 255 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 256 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 257 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 258 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 259 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 260 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 261 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 262 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 263 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 264 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 265 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 266 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 267 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 268 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 269 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 270 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 271 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 272 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 273 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 274 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 275 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 276 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 277 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 278 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 279 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 280 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 281 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 282 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 283 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 284 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 285 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 286 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 287 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 288 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 289 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 290 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 291 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 292 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 293 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 294 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 295 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 296 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 297 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 298 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 299 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 300 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 301 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 302 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 303 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 304 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 305 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 306 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 307 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 308 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 309 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 310 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 311 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 312 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 313 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 314 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 315 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 316 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 317 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 318 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 319 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 320 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 321 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 322 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 323 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 324 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 325 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 326 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 327 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 328 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 329 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 330 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 331 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 332 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 333 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 334 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 335 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 336 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 337 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 338 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 339 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 340 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 341 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 342 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 343 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 344 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 345 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 346 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 347 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 348 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 349 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 350 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 351 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 352 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 353 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 354 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 355 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 356 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 357 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 358 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 359 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 360 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 361 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 362 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 363 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 364 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 365 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 366 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 367 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 368 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 369 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 370 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 439 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 440 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 441 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 442 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 443 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 444 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 445 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 446 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 447 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 448 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 449 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 450 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 451 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 452 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 453 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 454 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 455 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 456 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 457 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 458 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 459 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 460 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 461 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 462 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 463 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 464 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 465 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 466 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 467 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 468 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 469 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 470 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 475 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 476 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 484 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 485 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 486 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 487 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 488 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 489 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 490 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 491 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 492 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 494 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 495 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 496 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 497 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 498 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 499 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 500 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 501 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 502 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 503 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 504 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 505 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 506 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 507 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 508 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 509 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 510 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 511 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 512 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 513 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 514 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 515 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 516 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 517 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 518 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 519 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 520 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 521 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 522 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 523 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 524 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 525 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 526 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 528 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 529 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 532 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 533 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 534 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 535 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 536 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 537 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 538 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 539 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 540 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 541 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 542 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 543 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 544 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 545 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 546 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 547 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 548 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 549 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 550 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 551 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 552 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 553 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 554 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 555 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 556 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 557 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 558 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 559 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 560 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 561 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 562 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 563 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 564 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 565 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 566 | 2554235227 | Arthrobacter sp. PAO19 | Isolate | Rhizosphere |
| 567 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 568 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 569 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 570 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 571 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 572 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 573 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 574 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 575 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 576 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 577 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 578 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 579 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 580 | 2643221542 | Microbacterium sp. Root1433D1 | Isolate | Unclassified |
| 581 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 582 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 583 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 584 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 585 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 586 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 587 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 588 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 589 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 590 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 591 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 592 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 593 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 594 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 595 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 596 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 597 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 598 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 599 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 600 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 601 | 2643221697 | Aeromicrobium sp. Root495 | Isolate | Unclassified |
| 602 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 603 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 604 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 605 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 606 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 607 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 608 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 609 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 610 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 611 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 612 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 613 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 614 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 615 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 616 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 617 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 618 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 619 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 620 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 621 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 622 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 623 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 624 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 625 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 626 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 627 | 2739367653 | Kocuria sp. OV113 | Isolate | Unclassified |
| 628 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 629 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 630 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 631 | 2751185788 | Curtobacterium pusillum AA3 | Isolate | Unclassified |
| 632 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 633 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 634 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 635 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 636 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 637 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 638 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 639 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 640 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 641 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 642 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 643 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 644 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 645 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 646 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 647 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 648 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 649 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 650 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 651 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 652 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 653 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 654 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 655 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 656 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 657 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 658 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 659 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 660 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 661 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 662 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 663 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 664 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 665 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 666 | 2816332305 | Kocuria rhizophila FDAARGOS_302 | Isolate | Rhizosphere |
| 667 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 668 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 669 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 670 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 671 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 672 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 673 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 674 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 675 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 676 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 677 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 678 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 679 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 680 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 681 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 682 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 683 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 684 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 685 | 2852663356 | Microbacterium sp. JAI119 | Isolate | Rhizosphere |
| 686 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 687 | 2857479173 | Micrococcus sp. R-74225 | Isolate | Unclassified |
| 688 | 2857632687 | Micrococcus sp. R-73081 | Isolate | Unclassified |
| 689 | 2857710386 | Brevibacterium sp. R-73093 | Isolate | Unclassified |
| 690 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 691 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 692 | 2857727296 | Kocuria sp. R-72562 | Isolate | Unclassified |
| 693 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 694 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 695 | 2857737099 | Lysinimonas sp. R-73066 | Isolate | Unclassified |
| 696 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 697 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 698 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 699 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 700 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 701 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 702 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 703 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 704 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 705 | 2870801768 | Micrococcus endophyticus DSM 17945 | Isolate | Unclassified |
| 706 | 2870804320 | Micrococcus yunnanensis DSM 21948 | Isolate | Unclassified |
| 707 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 708 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 709 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 710 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 711 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 712 | 2893684298 | Kocuria palustris DSM 11925 | Isolate | Rhizosphere |
| 713 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 714 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 715 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 716 | 2897561785 | Pseudoclavibacter endophyticus EGI 60007 | Isolate | Unclassified |
| 717 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 718 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 719 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 720 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 721 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 722 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 723 | 2904430863 | Curtobacterium oceanosedimentum 1519 | Isolate | Rhizosphere |
| 724 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 725 | 2904501621 | Curtobacterium sp. 1909 | Isolate | Unclassified |
| 726 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 727 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 728 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 729 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 730 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 731 | 2908674828 | Curtobacterium sp. 1517 | Isolate | Rhizosphere |
| 732 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 733 | 2909074476 | Curtobacterium sp. 1310 | Isolate | Rhizosphere |
| 734 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 735 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 736 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 737 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 738 | 2919039151 | Curtobacterium sp. 260 | Isolate | Rhizosphere |
| 739 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 740 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 741 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 742 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 743 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 744 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 745 | 2919395869 | Microbacterium resistens 2980 | Isolate | Unclassified |
| 746 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 747 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 748 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 749 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 750 | 2920879853 | Kocuria salina CV6 | Isolate | Unclassified |
| 751 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 752 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 753 | 2928104781 | Curtobacterium sp. 1544 | Isolate | Rhizosphere |
| 754 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 755 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 756 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 757 | 2928500415 | Curtobacterium oceanosedimentum 1257 | Isolate | Rhizosphere |
| 758 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 759 | 2932398195 | Dietzia sp. 2505 | Isolate | Rhizosphere |
| 760 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 761 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 762 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 763 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 764 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 765 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 766 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 767 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 768 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 769 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 770 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 771 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 772 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 773 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 774 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 775 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 776 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 777 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 778 | 2946024296 | Arthrobacter woluwensis W4I2 | Isolate | Rhizosphere |
| 779 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 780 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 781 | 2946041624 | Microbacterium natoriense W4I9-1 | Isolate | Rhizosphere |
| 782 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 783 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 784 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 785 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 786 | 2964326757 | Planctomonas psychrotolerans J5903 | Isolate | Rhizosphere |
| 787 | 2966921586 | Rathayibacter agropyri 617 | Isolate | Rhizosphere |
| 788 | 2966924647 | Frigoribacterium sp. 2355 | Isolate | Rhizosphere |
| 789 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 790 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 791 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 792 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 793 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 794 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 795 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 796 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 797 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 798 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 799 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 800 | 2984592036 | Aeromicrobium sp. SORGH_AS981 | Isolate | Aerial Root |
| 801 | 2995726249 | Leucobacter zeae CC-MF41 | Isolate | Rhizosphere |
| 802 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 803 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 804 | 8002811521 | Leucobacter chinensis NC76-1 | Isolate | Rhizosphere |
| 805 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 806 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 807 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 808 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 809 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
| 810 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
| 811 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 812 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 813 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 814 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 815 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 816 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 817 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 818 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 819 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 820 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 821 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 822 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 823 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 824 | 8055034563 | Leucobacter allii H21R-40 | Isolate | Rhizosphere |
| 825 | 8055037949 | Leucobacter rhizosphaerae H25R-14 | Isolate | Rhizosphere |
| 826 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
| 827 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 828 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 829 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 830 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
| 831 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.29 |
| Metatranscriptomes | 1.98 |
| Isolates | 12.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.23 |
| Bulb | 0 |
| Endosphere | 6.8 |
| Nodule | 0.64 |
| Rhizoplane | 7.9 |
| Rhizosphere | 70.4 |
| Stem | 0 |
| Stem Tuber | 0.09 |
| Unclassified | 0.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207427_100042 | 3300025231 | Bacteria | 254170 |
| 2 | LJQas_1002745 | 3300000549 | Bacteria | 2421 |
| 3 | LJQas_1002873 | 3300000549 | Bacteria | 2346 |
| 4 | JGI24746J21847_1001377 | 3300001977 | Bacteria | 3876 |
| 5 | JGI24740J21852_10002318 | 3300001979 | Bacteria | 8656 |
| 6 | JGI24740J21852_10013880 | 3300001979 | Bacteria | 2990 |
| 7 | JGI24737J22298_10016258 | 3300001990 | Bacteria | 2402 |
| 8 | JGI24737J22298_10025699 | 3300001990 | Bacteria | 1861 |
| 9 | JGI24735J21928_10005710 | 3300002067 | Bacteria | 4113 |
| 10 | JGI24735J21928_10006707 | 3300002067 | Bacteria | 3779 |
| 11 | JGI24738J21930_10011645 | 3300002075 | Bacteria | 1931 |
| 12 | JGI24744J21845_10006576 | 3300002077 | Bacteria | 2410 |
| 13 | JGI25162J39368_1004740 | 3300002737 | Bacteria | 2998 |
| 14 | JGI25154J39366_1001298 | 3300002738 | Bacteria | 9277 |
| 15 | JGI25164J39214_1001137 | 3300002772 | Bacteria | 7544 |
| 16 | JGI25152J39213_1000379 | 3300002773 | Bacteria | 27322 |
| 17 | JGI25151J46595_10038948 | 3300003187 | Bacteria | 1762 |
| 18 | JGI25406J46586_10002406 | 3300003203 | Bacteria | 8846 |
| 19 | JGI25165J46597_1000061 | 3300003214 | Bacteria | 208362 |
| 20 | JGI25407J50210_10004858 | 3300003373 | Bacteria | 3281 |
| 21 | Ga0006562J51391_1003827 | 3300003578 | Bacteria | 12434 |
| 22 | Ga0006562J51391_1026496 | 3300003578 | Bacteria | 3190 |
| 23 | Ga0006562J51391_1028453 | 3300003578 | Bacteria | 7090 |
| 24 | Ga0006562J51391_1032082 | 3300003578 | Bacteria | 2253 |
| 25 | Ga0055539_1000005 | 3300003752 | Bacteria | 609598 |
| 26 | Ga0055533_1000001 | 3300003756 | Bacteria | 1863437 |
| 27 | Ga0055525_1000291 | 3300003759 | Bacteria | 45088 |
| 28 | Ga0055527_1000017 | 3300003760 | Bacteria | 242362 |
| 29 | Ga0055542_1000044 | 3300003762 | Bacteria | 206982 |
| 30 | Ga0055542_1005133 | 3300003762 | Bacteria | 3017 |
| 31 | Ga0055529_1000279 | 3300003763 | Bacteria | 60946 |
| 32 | Ga0055540_1000022 | 3300003792 | Bacteria | 201257 |
| 33 | Ga0055540_1007503 | 3300003792 | Bacteria | 4100 |
| 34 | Ga0055540_1017813 | 3300003792 | Bacteria | 1968 |
| 35 | Ga0055541_1000625 | 3300003841 | Bacteria | 9362 |
| 36 | JGI25405J52794_10000005 | 3300003911 | Archaea | 32830 |
| 37 | Ga0065714_10099404 | 3300005288 | Bacteria | 1681 |
| 38 | Ga0065704_10073835 | 3300005289 | Bacteria | 6749 |
| 39 | Ga0070658_10000394 | 3300005327 | Bacteria | 37936 |
| 40 | Ga0070658_10000448 | 3300005327 | Bacteria | 35674 |
| 41 | Ga0070676_10180578 | 3300005328 | Bacteria | 1372 |
| 42 | Ga0070683_100008624 | 3300005329 | Bacteria | 8662 |
| 43 | Ga0070683_100029105 | 3300005329 | Bacteria | 4998 |
| 44 | Ga0070683_100032968 | 3300005329 | Bacteria | 4720 |
| 45 | Ga0070683_100034639 | 3300005329 | Bacteria | 4613 |
| 46 | Ga0070683_100054846 | 3300005329 | Bacteria | 3696 |
| 47 | Ga0070683_100061592 | 3300005329 | Bacteria | 3489 |
| 48 | Ga0070683_100078600 | 3300005329 | Bacteria | 3087 |
| 49 | Ga0070677_10078333 | 3300005333 | Bacteria | 1408 |
| 50 | Ga0068869_100034322 | 3300005334 | Bacteria | 3588 |
| 51 | Ga0070666_10144317 | 3300005335 | Bacteria | 1659 |
| 52 | Ga0070682_100006780 | 3300005337 | Bacteria | 6426 |
| 53 | Ga0070682_100014519 | 3300005337 | Bacteria | 4553 |
| 54 | Ga0070682_100016045 | 3300005337 | Bacteria | 4350 |
| 55 | Ga0070682_100041420 | 3300005337 | Bacteria | 2838 |
| 56 | Ga0068868_100005688 | 3300005338 | Bacteria | 8777 |
| 57 | Ga0068868_100005768 | 3300005338 | Bacteria | 8720 |
| 58 | Ga0068868_100024841 | 3300005338 | Bacteria | 4549 |
| 59 | Ga0068868_100054112 | 3300005338 | Bacteria | 3162 |
| 60 | Ga0068868_100259251 | 3300005338 | Bacteria | 1465 |
| 61 | Ga0070660_100018405 | 3300005339 | Bacteria | 5105 |
| 62 | Ga0070660_100028725 | 3300005339 | Bacteria | 4163 |
| 63 | Ga0070660_100031568 | 3300005339 | Bacteria | 3980 |
| 64 | Ga0070660_100035294 | 3300005339 | Bacteria | 3784 |
| 65 | Ga0070660_100078401 | 3300005339 | Bacteria | 2590 |
| 66 | Ga0070660_100086430 | 3300005339 | Bacteria | 2467 |
| 67 | Ga0070660_100097095 | 3300005339 | Bacteria | 2331 |
| 68 | Ga0070691_10106531 | 3300005341 | Bacteria | 1398 |
| 69 | Ga0070687_100008987 | 3300005343 | Bacteria | 4258 |
| 70 | Ga0070661_100075188 | 3300005344 | Bacteria | 2488 |
| 71 | Ga0070692_10020367 | 3300005345 | Bacteria | 3216 |
| 72 | Ga0070668_100004760 | 3300005347 | Bacteria | 10070 |
| 73 | Ga0070668_100004776 | 3300005347 | Bacteria | 10049 |
| 74 | Ga0070668_100005919 | 3300005347 | Bacteria | 9060 |
| 75 | Ga0070669_100000820 | 3300005353 | Bacteria | 22620 |
| 76 | Ga0070669_100031283 | 3300005353 | Bacteria | 3845 |
| 77 | Ga0070669_100057358 | 3300005353 | Bacteria | 2857 |
| 78 | Ga0070669_100120181 | 3300005353 | Bacteria | 2003 |
| 79 | Ga0070675_100071687 | 3300005354 | Bacteria | 2875 |
| 80 | Ga0070675_100094331 | 3300005354 | Bacteria | 2511 |
| 81 | Ga0070675_100162207 | 3300005354 | Bacteria | 1923 |
| 82 | Ga0070671_100000413 | 3300005355 | Bacteria | 29605 |
| 83 | Ga0070671_100016620 | 3300005355 | Bacteria | 5948 |
| 84 | Ga0070671_100138032 | 3300005355 | Bacteria | 2056 |
| 85 | Ga0070671_100199550 | 3300005355 | Bacteria | 1696 |
| 86 | Ga0070671_100237954 | 3300005355 | Bacteria | 1545 |
| 87 | Ga0070674_100020814 | 3300005356 | Bacteria | 4200 |
| 88 | Ga0070674_100065570 | 3300005356 | Bacteria | 2549 |
| 89 | Ga0070674_100139963 | 3300005356 | Bacteria | 1815 |
| 90 | Ga0070688_100020289 | 3300005365 | Bacteria | 3862 |
| 91 | Ga0070659_100001798 | 3300005366 | Bacteria | 15428 |
| 92 | Ga0070659_100005058 | 3300005366 | Bacteria | 9455 |
| 93 | Ga0070659_100007670 | 3300005366 | Bacteria | 7847 |
| 94 | Ga0070659_100028072 | 3300005366 | Bacteria | 4343 |
| 95 | Ga0070659_100071106 | 3300005366 | Bacteria | 2766 |
| 96 | Ga0070659_100091466 | 3300005366 | Bacteria | 2439 |
| 97 | Ga0070659_100182920 | 3300005366 | Bacteria | 1721 |
| 98 | Ga0070667_100000605 | 3300005367 | Bacteria | 34996 |
| 99 | Ga0070667_100000674 | 3300005367 | Bacteria | 33136 |
| 100 | Ga0070667_100001634 | 3300005367 | Bacteria | 20056 |
| 101 | Ga0070667_100010065 | 3300005367 | Bacteria | 7832 |
| 102 | Ga0070667_100023104 | 3300005367 | Bacteria | 5158 |
| 103 | Ga0070709_10012741 | 3300005434 | Bacteria | 4711 |
| 104 | Ga0070709_10024755 | 3300005434 | Bacteria | 3537 |
| 105 | Ga0070714_100046967 | 3300005435 | Bacteria | 3665 |
| 106 | Ga0070714_100051731 | 3300005435 | Bacteria | 3503 |
| 107 | Ga0070714_100065288 | 3300005435 | Bacteria | 3134 |
| 108 | Ga0070714_100066546 | 3300005435 | Bacteria | 3105 |
| 109 | Ga0070714_100160700 | 3300005435 | Bacteria | 2032 |
| 110 | Ga0070714_100164208 | 3300005435 | Bacteria | 2011 |
| 111 | Ga0070714_100207909 | 3300005435 | Bacteria | 1793 |
| 112 | Ga0070713_100003424 | 3300005436 | Bacteria | 10477 |
| 113 | Ga0070713_100049495 | 3300005436 | Bacteria | 3467 |
| 114 | Ga0070710_10001407 | 3300005437 | Bacteria | 11356 |
| 115 | Ga0070710_10016635 | 3300005437 | Bacteria | 3747 |
| 116 | Ga0070701_10003564 | 3300005438 | Bacteria | 6181 |
| 117 | Ga0070711_100006432 | 3300005439 | Bacteria | 7085 |
| 118 | Ga0070711_100043841 | 3300005439 | Bacteria | 3032 |
| 119 | Ga0070700_100000049 | 3300005441 | Bacteria | 89497 |
| 120 | Ga0070700_100017266 | 3300005441 | Bacteria | 4122 |
| 121 | Ga0070700_100026697 | 3300005441 | Bacteria | 3414 |
| 122 | Ga0070700_100034233 | 3300005441 | Bacteria | 3067 |
| 123 | Ga0070700_100196840 | 3300005441 | Bacteria | 1413 |
| 124 | Ga0070694_100014338 | 3300005444 | Bacteria | 4960 |
| 125 | Ga0070663_100047102 | 3300005455 | Bacteria | 3053 |
| 126 | Ga0070663_100059261 | 3300005455 | Bacteria | 2752 |
| 127 | Ga0070663_100126923 | 3300005455 | Bacteria | 1933 |
| 128 | Ga0070678_100001296 | 3300005456 | Bacteria | 13268 |
| 129 | Ga0070678_100031232 | 3300005456 | Bacteria | 3671 |
| 130 | Ga0070678_100177184 | 3300005456 | Bacteria | 1742 |
| 131 | Ga0070678_100185230 | 3300005456 | Bacteria | 1708 |
| 132 | Ga0070662_100014959 | 3300005457 | Bacteria | 5188 |
| 133 | Ga0070681_10009503 | 3300005458 | Bacteria | 9573 |
| 134 | Ga0070681_10310482 | 3300005458 | Bacteria | 1486 |
| 135 | Ga0068867_100002347 | 3300005459 | Bacteria | 13325 |
| 136 | Ga0068867_100044172 | 3300005459 | Bacteria | 3264 |
| 137 | Ga0070685_10043877 | 3300005466 | Bacteria | 2558 |
| 138 | Ga0070706_100006459 | 3300005467 | Bacteria | 11069 |
| 139 | Ga0070706_100012286 | 3300005467 | Bacteria | 7935 |
| 140 | Ga0070706_100064391 | 3300005467 | Bacteria | 3389 |
| 141 | Ga0070707_100006726 | 3300005468 | Bacteria | 10657 |
| 142 | Ga0070707_100011559 | 3300005468 | Bacteria | 8234 |
| 143 | Ga0070707_100019191 | 3300005468 | Bacteria | 6441 |
| 144 | Ga0070707_100091207 | 3300005468 | Bacteria | 2950 |
| 145 | Ga0070707_100188369 | 3300005468 | Bacteria | 2011 |
| 146 | Ga0070698_100007659 | 3300005471 | Bacteria | 11684 |
| 147 | Ga0070698_100012160 | 3300005471 | Bacteria | 9118 |
| 148 | Ga0070698_100018135 | 3300005471 | Bacteria | 7408 |
| 149 | Ga0070698_100117481 | 3300005471 | Bacteria | 2622 |
| 150 | Ga0070679_100011185 | 3300005530 | Bacteria | 8551 |
| 151 | Ga0070679_100157345 | 3300005530 | Bacteria | 2247 |
| 152 | Ga0070679_100195083 | 3300005530 | Bacteria | 1993 |
| 153 | Ga0070679_100388985 | 3300005530 | Bacteria | 1341 |
| 154 | Ga0070684_100008109 | 3300005535 | Bacteria | 8198 |
| 155 | Ga0070684_100010114 | 3300005535 | Bacteria | 7460 |
| 156 | Ga0070684_100010640 | 3300005535 | Bacteria | 7295 |
| 157 | Ga0070684_100056129 | 3300005535 | Bacteria | 3436 |
| 158 | Ga0070684_100071021 | 3300005535 | Bacteria | 3064 |
| 159 | Ga0068853_100003640 | 3300005539 | Bacteria | 11814 |
| 160 | Ga0068853_100017372 | 3300005539 | Bacteria | 5941 |
| 161 | Ga0068853_100022417 | 3300005539 | Bacteria | 5274 |
| 162 | Ga0068853_100029542 | 3300005539 | Bacteria | 4622 |
| 163 | Ga0068853_100062708 | 3300005539 | Bacteria | 3218 |
| 164 | Ga0068853_100089100 | 3300005539 | Bacteria | 2710 |
| 165 | Ga0070672_100011247 | 3300005543 | Bacteria | 6241 |
| 166 | Ga0070672_100044260 | 3300005543 | Bacteria | 3437 |
| 167 | Ga0070672_100060413 | 3300005543 | Bacteria | 2984 |
| 168 | Ga0070686_100044352 | 3300005544 | Bacteria | 2795 |
| 169 | Ga0070695_100016540 | 3300005545 | Bacteria | 4465 |
| 170 | Ga0070696_100001265 | 3300005546 | Bacteria | 16421 |
| 171 | Ga0070665_100000450 | 3300005548 | Bacteria | 59867 |
| 172 | Ga0070665_100003803 | 3300005548 | Bacteria | 15980 |
| 173 | Ga0070665_100004177 | 3300005548 | Bacteria | 15190 |
| 174 | Ga0070665_100029488 | 3300005548 | Bacteria | 5522 |
| 175 | Ga0070665_100042334 | 3300005548 | Bacteria | 4577 |
| 176 | Ga0070665_100128311 | 3300005548 | Bacteria | 2539 |
| 177 | Ga0070665_100287046 | 3300005548 | Bacteria | 1648 |
| 178 | Ga0070704_100000144 | 3300005549 | Bacteria | 26925 |
| 179 | Ga0070704_100027059 | 3300005549 | Bacteria | 3797 |
| 180 | Ga0070704_100041179 | 3300005549 | Archaea | 3186 |
| 181 | Ga0070704_100070886 | 3300005549 | Bacteria | 2530 |
| 182 | Ga0068855_100026886 | 3300005563 | Bacteria | 6884 |
| 183 | Ga0068855_100034488 | 3300005563 | Bacteria | 6035 |
| 184 | Ga0068855_100046784 | 3300005563 | Bacteria | 5113 |
| 185 | Ga0068855_100066766 | 3300005563 | Bacteria | 4193 |
| 186 | Ga0068855_100081308 | 3300005563 | Bacteria | 3756 |
| 187 | Ga0068855_100090254 | 3300005563 | Bacteria | 3537 |
| 188 | Ga0068855_100163748 | 3300005563 | Bacteria | 2522 |
| 189 | Ga0068857_100005690 | 3300005577 | Bacteria | 10655 |
| 190 | Ga0068857_100035843 | 3300005577 | Bacteria | 4395 |
| 191 | Ga0068857_100266979 | 3300005577 | Bacteria | 1572 |
| 192 | Ga0068854_100003304 | 3300005578 | Bacteria | 10052 |
| 193 | Ga0068854_100140557 | 3300005578 | Bacteria | 1852 |
| 194 | Ga0068856_100022435 | 3300005614 | Bacteria | 6138 |
| 195 | Ga0068856_100025251 | 3300005614 | Bacteria | 5790 |
| 196 | Ga0068856_100026637 | 3300005614 | Bacteria | 5637 |
| 197 | Ga0068856_100046003 | 3300005614 | Bacteria | 4298 |
| 198 | Ga0068856_100048666 | 3300005614 | Bacteria | 4178 |
| 199 | Ga0068856_100092229 | 3300005614 | Bacteria | 3014 |
| 200 | Ga0068856_100230588 | 3300005614 | Bacteria | 1867 |
| 201 | Ga0070702_100007562 | 3300005615 | Bacteria | 5205 |
| 202 | Ga0070702_100021808 | 3300005615 | Bacteria | 3377 |
| 203 | Ga0070702_100022733 | 3300005615 | Bacteria | 3321 |
| 204 | Ga0068852_100006651 | 3300005616 | Bacteria | 8377 |
| 205 | Ga0068852_100031767 | 3300005616 | Bacteria | 4363 |
| 206 | Ga0068852_100032864 | 3300005616 | Bacteria | 4301 |
| 207 | Ga0068852_100042387 | 3300005616 | Bacteria | 3853 |
| 208 | Ga0068852_100058986 | 3300005616 | Bacteria | 3327 |
| 209 | Ga0068852_100219404 | 3300005616 | Bacteria | 1808 |
| 210 | Ga0068859_100001784 | 3300005617 | Bacteria | 21903 |
| 211 | Ga0068859_100002254 | 3300005617 | Bacteria | 19564 |
| 212 | Ga0068859_100012347 | 3300005617 | Bacteria | 8592 |
| 213 | Ga0068859_100144251 | 3300005617 | Bacteria | 2455 |
| 214 | Ga0068864_100025782 | 3300005618 | Bacteria | 4956 |
| 215 | Ga0068864_100075408 | 3300005618 | Bacteria | 2945 |
| 216 | Ga0068866_10000517 | 3300005718 | Bacteria | 17836 |
| 217 | Ga0068866_10041100 | 3300005718 | Bacteria | 2293 |
| 218 | Ga0068866_10058969 | 3300005718 | Bacteria | 1984 |
| 219 | Ga0068861_100001353 | 3300005719 | Bacteria | 15407 |
| 220 | Ga0068861_100055079 | 3300005719 | Bacteria | 3031 |
| 221 | Ga0068861_100132503 | 3300005719 | Bacteria | 2024 |
| 222 | Ga0068851_10000022 | 3300005834 | Bacteria | 129607 |
| 223 | Ga0068870_10006332 | 3300005840 | Bacteria | 5213 |
| 224 | Ga0068863_100003048 | 3300005841 | Bacteria | 16555 |
| 225 | Ga0068863_100035553 | 3300005841 | Bacteria | 4745 |
| 226 | Ga0068858_100000016 | 3300005842 | Bacteria | 193130 |
| 227 | Ga0068858_100000179 | 3300005842 | Bacteria | 66961 |
| 228 | Ga0068858_100005465 | 3300005842 | Bacteria | 12444 |
| 229 | Ga0068858_100012390 | 3300005842 | Bacteria | 8040 |
| 230 | Ga0068858_100081802 | 3300005842 | Bacteria | 3002 |
| 231 | Ga0068860_100000087 | 3300005843 | Bacteria | 158242 |
| 232 | Ga0068860_100000154 | 3300005843 | Bacteria | 111793 |
| 233 | Ga0068860_100017715 | 3300005843 | Bacteria | 6938 |
| 234 | Ga0068860_100170998 | 3300005843 | Bacteria | 2099 |
| 235 | Ga0068862_100000190 | 3300005844 | Bacteria | 67924 |
| 236 | Ga0068862_100000312 | 3300005844 | Bacteria | 53263 |
| 237 | Ga0068862_100004977 | 3300005844 | Bacteria | 11184 |
| 238 | Ga0081455_10000082 | 3300005937 | Bacteria | 103704 |
| 239 | Ga0081455_10010276 | 3300005937 | Bacteria | 9517 |
| 240 | Ga0081455_10079007 | 3300005937 | Bacteria | 2702 |
| 241 | Ga0081455_10098153 | 3300005937 | Bacteria | 2359 |
| 242 | Ga0081455_10121819 | 3300005937 | Bacteria | 2054 |
| 243 | Ga0081538_10001382 | 3300005981 | Bacteria | 24879 |
| 244 | Ga0081538_10001794 | 3300005981 | Bacteria | 21673 |
| 245 | Ga0081540_1003861 | 3300005983 | Bacteria | 11697 |
| 246 | Ga0081540_1004047 | 3300005983 | Bacteria | 11355 |
| 247 | Ga0081539_10000467 | 3300005985 | Bacteria | 85390 |
| 248 | Ga0081539_10027400 | 3300005985 | Bacteria | 3610 |
| 249 | Ga0081539_10072469 | 3300005985 | Bacteria | 1841 |
| 250 | Ga0070717_10007764 | 3300006028 | Bacteria | 7983 |
| 251 | Ga0070717_10081630 | 3300006028 | Bacteria | 2715 |
| 252 | Ga0075365_10002456 | 3300006038 | Bacteria | 9101 |
| 253 | Ga0075365_10028961 | 3300006038 | Bacteria | 3535 |
| 254 | Ga0075365_10033360 | 3300006038 | Bacteria | 3316 |
| 255 | Ga0075365_10034198 | 3300006038 | Bacteria | 3281 |
| 256 | Ga0075365_10058458 | 3300006038 | Bacteria | 2567 |
| 257 | Ga0075365_10065175 | 3300006038 | Bacteria | 2441 |
| 258 | Ga0075363_100000201 | 3300006048 | Bacteria | 16359 |
| 259 | Ga0075363_100003979 | 3300006048 | Bacteria | 6389 |
| 260 | Ga0075363_100009777 | 3300006048 | Bacteria | 4520 |
| 261 | Ga0075363_100065368 | 3300006048 | Bacteria | 1966 |
| 262 | Ga0075363_100067724 | 3300006048 | Bacteria | 1935 |
| 263 | Ga0075364_10000723 | 3300006051 | Bacteria | 17264 |
| 264 | Ga0075364_10003104 | 3300006051 | Bacteria | 9396 |
| 265 | Ga0075364_10010199 | 3300006051 | Bacteria | 5665 |
| 266 | Ga0075364_10024783 | 3300006051 | Bacteria | 3812 |
| 267 | Ga0075364_10034632 | 3300006051 | Bacteria | 3259 |
| 268 | Ga0075364_10037917 | 3300006051 | Bacteria | 3122 |
| 269 | Ga0075364_10126099 | 3300006051 | Bacteria | 1716 |
| 270 | Ga0075364_10133480 | 3300006051 | Bacteria | 1667 |
| 271 | Ga0070715_10001150 | 3300006163 | Bacteria | 7570 |
| 272 | Ga0070715_10055444 | 3300006163 | Bacteria | 1720 |
| 273 | Ga0070716_100007290 | 3300006173 | Bacteria | 5440 |
| 274 | Ga0070712_100002802 | 3300006175 | Bacteria | 10778 |
| 275 | Ga0070712_100012929 | 3300006175 | Bacteria | 5318 |
| 276 | Ga0070712_100032414 | 3300006175 | Bacteria | 3529 |
| 277 | Ga0070712_100036549 | 3300006175 | Bacteria | 3343 |
| 278 | Ga0070712_100117682 | 3300006175 | Bacteria | 1995 |
| 279 | Ga0075362_10029281 | 3300006177 | Bacteria | 2372 |
| 280 | Ga0075367_10031724 | 3300006178 | Bacteria | 3036 |
| 281 | Ga0075367_10032134 | 3300006178 | Bacteria | 3017 |
| 282 | Ga0075367_10177514 | 3300006178 | Bacteria | 1327 |
| 283 | Ga0075369_10002730 | 3300006186 | Bacteria | 6330 |
| 284 | Ga0075369_10004308 | 3300006186 | Bacteria | 5244 |
| 285 | Ga0075369_10004998 | 3300006186 | Bacteria | 4935 |
| 286 | Ga0075369_10005608 | 3300006186 | Bacteria | 4699 |
| 287 | Ga0075369_10085197 | 3300006186 | Bacteria | 1405 |
| 288 | Ga0097621_100151492 | 3300006237 | Bacteria | 1989 |
| 289 | Ga0075370_10044515 | 3300006353 | Bacteria | 2509 |
| 290 | Ga0075370_10061384 | 3300006353 | Bacteria | 2141 |
| 291 | Ga0075370_10074977 | 3300006353 | Bacteria | 1939 |
| 292 | Ga0075428_100005250 | 3300006844 | Bacteria | 14401 |
| 293 | Ga0075428_100031735 | 3300006844 | Bacteria | 5835 |
| 294 | Ga0075430_100000294 | 3300006846 | Bacteria | 35128 |
| 295 | Ga0075430_100062808 | 3300006846 | Bacteria | 3119 |
| 296 | Ga0075431_100062538 | 3300006847 | Bacteria | 3841 |
| 297 | Ga0075431_100075899 | 3300006847 | Bacteria | 3468 |
| 298 | Ga0075431_100360363 | 3300006847 | Bacteria | 1461 |
| 299 | Ga0075433_10122858 | 3300006852 | Unclassified | 2306 |
| 300 | Ga0075433_10300617 | 3300006852 | Bacteria | 1421 |
| 301 | Ga0075434_100007636 | 3300006871 | Archaea | 10007 |
| 302 | Ga0075429_100023377 | 3300006880 | Bacteria | 5364 |
| 303 | Ga0075429_100070519 | 3300006880 | Bacteria | 3043 |
| 304 | Ga0068865_100002468 | 3300006881 | Bacteria | 10946 |
| 305 | Ga0068865_100044021 | 3300006881 | Bacteria | 3053 |
| 306 | Ga0068865_100066192 | 3300006881 | Bacteria | 2548 |
| 307 | Ga0068865_100278411 | 3300006881 | Bacteria | 1331 |
| 308 | Ga0097620_100000049 | 3300006931 | Bacteria | 137619 |
| 309 | Ga0097620_100001784 | 3300006931 | Bacteria | 21903 |
| 310 | Ga0097620_100002254 | 3300006931 | Bacteria | 19564 |
| 311 | Ga0097620_100012347 | 3300006931 | Bacteria | 8592 |
| 312 | Ga0097620_100144244 | 3300006931 | Bacteria | 2455 |
| 313 | Ga0075435_100011202 | 3300007076 | Bacteria | 6581 |
| 314 | Ga0099794_10000314 | 3300007265 | Bacteria | 16524 |
| 315 | Ga0105244_10033017 | 3300009036 | Bacteria | 2733 |
| 316 | Ga0105244_10033778 | 3300009036 | Bacteria | 2695 |
| 317 | Ga0105244_10112258 | 3300009036 | Bacteria | 1325 |
| 318 | Ga0105240_10005015 | 3300009093 | Bacteria | 19863 |
| 319 | Ga0105240_10051407 | 3300009093 | Bacteria | 5185 |
| 320 | Ga0105240_10085563 | 3300009093 | Bacteria | 3863 |
| 321 | Ga0105240_10313825 | 3300009093 | Bacteria | 1789 |
| 322 | Ga0111539_10094250 | 3300009094 | Bacteria | 3517 |
| 323 | Ga0105245_10004537 | 3300009098 | Bacteria | 12260 |
| 324 | Ga0105245_10006332 | 3300009098 | Bacteria | 10414 |
| 325 | Ga0105245_10025093 | 3300009098 | Bacteria | 5241 |
| 326 | Ga0105245_10111351 | 3300009098 | Bacteria | 2546 |
| 327 | Ga0105245_10126199 | 3300009098 | Bacteria | 2396 |
| 328 | Ga0105245_10149353 | 3300009098 | Bacteria | 2208 |
| 329 | Ga0105247_10000159 | 3300009101 | Bacteria | 66013 |
| 330 | Ga0105247_10000376 | 3300009101 | Bacteria | 37966 |
| 331 | Ga0105247_10004231 | 3300009101 | Bacteria | 9201 |
| 332 | Ga0105247_10043655 | 3300009101 | Bacteria | 2747 |
| 333 | Ga0114129_10025993 | 3300009147 | Bacteria | 8290 |
| 334 | Ga0114129_10043021 | 3300009147 | Bacteria | 6357 |
| 335 | Ga0114129_10063215 | 3300009147 | Bacteria | 5170 |
| 336 | Ga0105243_10012483 | 3300009148 | Bacteria | 6424 |
| 337 | Ga0105243_10029324 | 3300009148 | Bacteria | 4230 |
| 338 | Ga0105243_10069791 | 3300009148 | Bacteria | 2835 |
| 339 | Ga0105243_10201321 | 3300009148 | Bacteria | 1746 |
| 340 | Ga0105241_10007128 | 3300009174 | Bacteria | 8229 |
| 341 | Ga0105241_10023785 | 3300009174 | Bacteria | 4546 |
| 342 | Ga0105242_10000880 | 3300009176 | Bacteria | 23297 |
| 343 | Ga0105242_10018500 | 3300009176 | Bacteria | 5448 |
| 344 | Ga0105242_10135002 | 3300009176 | Bacteria | 2134 |
| 345 | Ga0105242_10196341 | 3300009176 | Bacteria | 1790 |
| 346 | Ga0105248_10000050 | 3300009177 | Bacteria | 152667 |
| 347 | Ga0105248_10015100 | 3300009177 | Bacteria | 8506 |
| 348 | Ga0105248_10058631 | 3300009177 | Bacteria | 4324 |
| 349 | Ga0105248_10071820 | 3300009177 | Bacteria | 3889 |
| 350 | Ga0105248_10085325 | 3300009177 | Bacteria | 3553 |
| 351 | Ga0105248_10093820 | 3300009177 | Bacteria | 3380 |
| 352 | Ga0105248_10102045 | 3300009177 | Bacteria | 3233 |
| 353 | Ga0105248_10139647 | 3300009177 | Bacteria | 2733 |
| 354 | Ga0105237_10000302 | 3300009545 | Bacteria | 68290 |
| 355 | Ga0105237_10001065 | 3300009545 | Bacteria | 36852 |
| 356 | Ga0105237_10004166 | 3300009545 | Bacteria | 16835 |
| 357 | Ga0105237_10005434 | 3300009545 | Bacteria | 14389 |
| 358 | Ga0105237_10035167 | 3300009545 | Bacteria | 5071 |
| 359 | Ga0105237_10059928 | 3300009545 | Bacteria | 3808 |
| 360 | Ga0105237_10139560 | 3300009545 | Bacteria | 2418 |
| 361 | Ga0105237_10140579 | 3300009545 | Bacteria | 2408 |
| 362 | Ga0105238_10026434 | 3300009551 | Bacteria | 5918 |
| 363 | Ga0105238_10053225 | 3300009551 | Bacteria | 4068 |
| 364 | Ga0105238_10133069 | 3300009551 | Bacteria | 2465 |
| 365 | Ga0105249_10000042 | 3300009553 | Bacteria | 195242 |
| 366 | Ga0105249_10010531 | 3300009553 | Bacteria | 8123 |
| 367 | Ga0105249_10048212 | 3300009553 | Bacteria | 3884 |
| 368 | Ga0105249_10082403 | 3300009553 | Bacteria | 2993 |
| 369 | Ga0105249_10128286 | 3300009553 | Bacteria | 2418 |
| 370 | Ga0105249_10172445 | 3300009553 | Bacteria | 2099 |
| 371 | Ga0105249_10267898 | 3300009553 | Bacteria | 1700 |
| 372 | Ga0105239_10004010 | 3300010375 | Bacteria | 17835 |
| 373 | Ga0105239_10012785 | 3300010375 | Bacteria | 9339 |
| 374 | Ga0105239_10100347 | 3300010375 | Bacteria | 3202 |
| 375 | Ga0105246_10003745 | 3300011119 | Bacteria | 9219 |
| 376 | Ga0105246_10073964 | 3300011119 | Bacteria | 2407 |
| 377 | Ga0105246_10094175 | 3300011119 | Bacteria | 2166 |
| 378 | Ga0105246_10096186 | 3300011119 | Bacteria | 2146 |
| 379 | Ga0105246_10130680 | 3300011119 | Bacteria | 1875 |
| 380 | Ga0157373_10035357 | 3300013100 | Bacteria | 3587 |
| 381 | Ga0157371_10041403 | 3300013102 | Bacteria | 3287 |
| 382 | Ga0157371_10066105 | 3300013102 | Bacteria | 2561 |
| 383 | Ga0157371_10069843 | 3300013102 | Bacteria | 2487 |
| 384 | Ga0157370_10002163 | 3300013104 | Bacteria | 23996 |
| 385 | Ga0157370_10007445 | 3300013104 | Bacteria | 11901 |
| 386 | Ga0157370_10027650 | 3300013104 | Bacteria | 5591 |
| 387 | Ga0157370_10034752 | 3300013104 | Bacteria | 4904 |
| 388 | Ga0157370_10046918 | 3300013104 | Bacteria | 4141 |
| 389 | Ga0157370_10293017 | 3300013104 | Bacteria | 1503 |
| 390 | Ga0157369_10000230 | 3300013105 | Bacteria | 77399 |
| 391 | Ga0157369_10002312 | 3300013105 | Bacteria | 22937 |
| 392 | Ga0157369_10010811 | 3300013105 | Bacteria | 10392 |
| 393 | Ga0157369_10012349 | 3300013105 | Bacteria | 9697 |
| 394 | Ga0157369_10014343 | 3300013105 | Bacteria | 8948 |
| 395 | Ga0157369_10022758 | 3300013105 | Bacteria | 6988 |
| 396 | Ga0157369_10067879 | 3300013105 | Bacteria | 3832 |
| 397 | Ga0157369_10132655 | 3300013105 | Bacteria | 2639 |
| 398 | Ga0157369_10149419 | 3300013105 | Bacteria | 2469 |
| 399 | Ga0157369_10199267 | 3300013105 | Bacteria | 2102 |
| 400 | Ga0171462_1001 | 3300013250 | Bacteria | 1135406 |
| 401 | Ga0157374_10011242 | 3300013296 | Bacteria | 7742 |
| 402 | Ga0157374_10041552 | 3300013296 | Bacteria | 4238 |
| 403 | Ga0157378_10003787 | 3300013297 | Bacteria | 13406 |
| 404 | Ga0157378_10033544 | 3300013297 | Bacteria | 4540 |
| 405 | Ga0157378_10085185 | 3300013297 | Bacteria | 2863 |
| 406 | Ga0163162_10029817 | 3300013306 | Bacteria | 5401 |
| 407 | Ga0163162_10046065 | 3300013306 | Bacteria | 4371 |
| 408 | Ga0163162_10084959 | 3300013306 | Bacteria | 3241 |
| 409 | Ga0163162_10195861 | 3300013306 | Bacteria | 2149 |
| 410 | Ga0157372_10001405 | 3300013307 | Bacteria | 25975 |
| 411 | Ga0157372_10022392 | 3300013307 | Bacteria | 6836 |
| 412 | Ga0157372_10069659 | 3300013307 | Bacteria | 3956 |
| 413 | Ga0157372_10079284 | 3300013307 | Bacteria | 3713 |
| 414 | Ga0157372_10088253 | 3300013307 | Bacteria | 3521 |
| 415 | Ga0157372_10092930 | 3300013307 | Bacteria | 3432 |
| 416 | Ga0157372_10222180 | 3300013307 | Bacteria | 2189 |
| 417 | Ga0157375_10013718 | 3300013308 | Bacteria | 7223 |
| 418 | Ga0157375_10016612 | 3300013308 | Bacteria | 6618 |
| 419 | Ga0157375_10076311 | 3300013308 | Bacteria | 3378 |
| 420 | Ga0157375_10087739 | 3300013308 | Bacteria | 3164 |
| 421 | Ga0157375_10102159 | 3300013308 | Bacteria | 2952 |
| 422 | Ga0157375_10236263 | 3300013308 | Bacteria | 1987 |
| 423 | Ga0163163_10004486 | 3300014325 | Bacteria | 11910 |
| 424 | Ga0163163_10056964 | 3300014325 | Bacteria | 3864 |
| 425 | Ga0163163_10072366 | 3300014325 | Bacteria | 3436 |
| 426 | Ga0163163_10104359 | 3300014325 | Bacteria | 2860 |
| 427 | Ga0163163_10235044 | 3300014325 | Bacteria | 1882 |
| 428 | Ga0163163_10342163 | 3300014325 | Bacteria | 1551 |
| 429 | Ga0157380_10192700 | 3300014326 | Bacteria | 1801 |
| 430 | Ga0157377_10024809 | 3300014745 | Bacteria | 3191 |
| 431 | Ga0157379_10002686 | 3300014968 | Bacteria | 14987 |
| 432 | Ga0157379_10004386 | 3300014968 | Bacteria | 12078 |
| 433 | Ga0157379_10008257 | 3300014968 | Bacteria | 9047 |
| 434 | Ga0157379_10016792 | 3300014968 | Bacteria | 6442 |
| 435 | Ga0157379_10051898 | 3300014968 | Bacteria | 3661 |
| 436 | Ga0157379_10219592 | 3300014968 | Bacteria | 1722 |
| 437 | Ga0163161_10010839 | 3300017792 | Bacteria | 6319 |
| 438 | Ga0163161_10031311 | 3300017792 | Bacteria | 3789 |
| 439 | Ga0163161_10039383 | 3300017792 | Bacteria | 3393 |
| 440 | Ga0163161_10116809 | 3300017792 | Bacteria | 2000 |
| 441 | Ga0197907_10127029 | 3300020069 | Bacteria | 2971 |
| 442 | Ga0197907_10587311 | 3300020069 | Bacteria | 1293 |
| 443 | Ga0206356_10558971 | 3300020070 | Bacteria | 1253 |
| 444 | Ga0206351_10127684 | 3300020077 | Bacteria | 1806 |
| 445 | Ga0206351_10456609 | 3300020077 | Bacteria | 1899 |
| 446 | Ga0206350_10025198 | 3300020080 | Bacteria | 1647 |
| 447 | Ga0206350_11148788 | 3300020080 | Bacteria | 1296 |
| 448 | Ga0206354_11217485 | 3300020081 | Bacteria | 4008 |
| 449 | Ga0206354_11437303 | 3300020081 | Bacteria | 1245 |
| 450 | Ga0206353_11101538 | 3300020082 | Bacteria | 2505 |
| 451 | Ga0213875_10011668 | 3300021388 | Bacteria | 4364 |
| 452 | Ga0213871_10015809 | 3300021441 | Bacteria | 1810 |
| 453 | Ga0224712_10010230 | 3300022467 | Bacteria | 2862 |
| 454 | Ga0224712_10020419 | 3300022467 | Bacteria | 2249 |
| 455 | Ga0224712_10023129 | 3300022467 | Bacteria | 2153 |
| 456 | Ga0224712_10042451 | 3300022467 | Bacteria | 1723 |
| 457 | Ga0224572_1006386 | 3300024225 | Bacteria | 2132 |
| 458 | Ga0209566_100053 | 3300025225 | Bacteria | 224436 |
| 459 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 460 | Ga0209672_100039 | 3300025228 | Bacteria | 283064 |
| 461 | Ga0209147_100507 | 3300025229 | Bacteria | 22670 |
| 462 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 463 | Ga0209437_100369 | 3300025233 | Bacteria | 47150 |
| 464 | Ga0207425_1009908 | 3300025245 | Bacteria | 2343 |
| 465 | Ga0209646_1000088 | 3300025246 | Bacteria | 192345 |
| 466 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 467 | Ga0209677_100448 | 3300025253 | Bacteria | 23936 |
| 468 | Ga0209148_1000004 | 3300025254 | Bacteria | 1844481 |
| 469 | Ga0209148_1002289 | 3300025254 | Bacteria | 6896 |
| 470 | Ga0209148_1010632 | 3300025254 | Bacteria | 1737 |
| 471 | Ga0209129_1000109 | 3300025258 | Bacteria | 153068 |
| 472 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 473 | Ga0209455_1000117 | 3300025272 | Bacteria | 176940 |
| 474 | Ga0209455_1001874 | 3300025272 | Bacteria | 8783 |
| 475 | Ga0209673_1017529 | 3300025273 | Bacteria | 2638 |
| 476 | Ga0209025_1000984 | 3300025294 | Bacteria | 42427 |
| 477 | Ga0209051_1000033 | 3300025303 | Bacteria | 380540 |
| 478 | Ga0209051_1000633 | 3300025303 | Bacteria | 40448 |
| 479 | Ga0209051_1002844 | 3300025303 | Bacteria | 11927 |
| 480 | Ga0209051_1015719 | 3300025303 | Bacteria | 3467 |
| 481 | Ga0209051_1029411 | 3300025303 | Bacteria | 2151 |
| 482 | Ga0207697_10077557 | 3300025315 | Bacteria | 1397 |
| 483 | Ga0207656_10000005 | 3300025321 | Bacteria | 490514 |
| 484 | Ga0207655_1021163 | 3300025728 | Bacteria | 3312 |
| 485 | Ga0207655_1025368 | 3300025728 | Bacteria | 2880 |
| 486 | Ga0207655_1062958 | 3300025728 | Bacteria | 1424 |
| 487 | Ga0207713_1034408 | 3300025735 | Bacteria | 2201 |
| 488 | Ga0207682_10005955 | 3300025893 | Bacteria | 4932 |
| 489 | Ga0207692_10026792 | 3300025898 | Bacteria | 2707 |
| 490 | Ga0207642_10000166 | 3300025899 | Bacteria | 18838 |
| 491 | Ga0207642_10067166 | 3300025899 | Bacteria | 1691 |
| 492 | Ga0207642_10085016 | 3300025899 | Bacteria | 1547 |
| 493 | Ga0207710_10000017 | 3300025900 | Bacteria | 370962 |
| 494 | Ga0207710_10000019 | 3300025900 | Bacteria | 339682 |
| 495 | Ga0207710_10000173 | 3300025900 | Bacteria | 66353 |
| 496 | Ga0207688_10008958 | 3300025901 | Bacteria | 5447 |
| 497 | Ga0207688_10114156 | 3300025901 | Bacteria | 1571 |
| 498 | Ga0207647_10009465 | 3300025904 | Bacteria | 6921 |
| 499 | Ga0207647_10023826 | 3300025904 | Bacteria | 4043 |
| 500 | Ga0207647_10027988 | 3300025904 | Bacteria | 3669 |
| 501 | Ga0207647_10046699 | 3300025904 | Bacteria | 2697 |
| 502 | Ga0207685_10000910 | 3300025905 | Bacteria | 5637 |
| 503 | Ga0207685_10056806 | 3300025905 | Bacteria | 1533 |
| 504 | Ga0207645_10029223 | 3300025907 | Bacteria | 3554 |
| 505 | Ga0207643_10065259 | 3300025908 | Bacteria | 2085 |
| 506 | Ga0207705_10000001 | 3300025909 | Bacteria | 2061880 |
| 507 | Ga0207705_10054377 | 3300025909 | Bacteria | 2885 |
| 508 | Ga0207705_10063392 | 3300025909 | Bacteria | 2670 |
| 509 | Ga0207705_10150677 | 3300025909 | Bacteria | 1743 |
| 510 | Ga0207684_10012433 | 3300025910 | Bacteria | 7405 |
| 511 | Ga0207654_10000001 | 3300025911 | Bacteria | 1816198 |
| 512 | Ga0207707_10008370 | 3300025912 | Bacteria | 8976 |
| 513 | Ga0207707_10008629 | 3300025912 | Bacteria | 8841 |
| 514 | Ga0207707_10142229 | 3300025912 | Bacteria | 2098 |
| 515 | Ga0207695_10004239 | 3300025913 | Bacteria | 19705 |
| 516 | Ga0207695_10011642 | 3300025913 | Bacteria | 10631 |
| 517 | Ga0207671_10000016 | 3300025914 | Bacteria | 435413 |
| 518 | Ga0207671_10002478 | 3300025914 | Bacteria | 19723 |
| 519 | Ga0207671_10018148 | 3300025914 | Bacteria | 5406 |
| 520 | Ga0207671_10097567 | 3300025914 | Bacteria | 2222 |
| 521 | Ga0207671_10126529 | 3300025914 | Bacteria | 1958 |
| 522 | Ga0207693_10000366 | 3300025915 | Bacteria | 41351 |
| 523 | Ga0207693_10000550 | 3300025915 | Bacteria | 33865 |
| 524 | Ga0207693_10004959 | 3300025915 | Bacteria | 11185 |
| 525 | Ga0207693_10005203 | 3300025915 | Bacteria | 10890 |
| 526 | Ga0207693_10015176 | 3300025915 | Bacteria | 6182 |
| 527 | Ga0207693_10019113 | 3300025915 | Bacteria | 5453 |
| 528 | Ga0207693_10127422 | 3300025915 | Bacteria | 2001 |
| 529 | Ga0207693_10227148 | 3300025915 | Bacteria | 1466 |
| 530 | Ga0207663_10019629 | 3300025916 | Bacteria | 3813 |
| 531 | Ga0207660_10017090 | 3300025917 | Bacteria | 4814 |
| 532 | Ga0207660_10111176 | 3300025917 | Bacteria | 2062 |
| 533 | Ga0207660_10200760 | 3300025917 | Bacteria | 1557 |
| 534 | Ga0207662_10014650 | 3300025918 | Bacteria | 4402 |
| 535 | Ga0207657_10005602 | 3300025919 | Bacteria | 13110 |
| 536 | Ga0207657_10010726 | 3300025919 | Bacteria | 9124 |
| 537 | Ga0207657_10012581 | 3300025919 | Bacteria | 8341 |
| 538 | Ga0207657_10035747 | 3300025919 | Bacteria | 4452 |
| 539 | Ga0207657_10041968 | 3300025919 | Bacteria | 4040 |
| 540 | Ga0207657_10068982 | 3300025919 | Bacteria | 3002 |
| 541 | Ga0207657_10080923 | 3300025919 | Bacteria | 2729 |
| 542 | Ga0207657_10090348 | 3300025919 | Bacteria | 2556 |
| 543 | Ga0207652_10006710 | 3300025921 | Bacteria | 9274 |
| 544 | Ga0207652_10033838 | 3300025921 | Bacteria | 4305 |
| 545 | Ga0207652_10205567 | 3300025921 | Bacteria | 1772 |
| 546 | Ga0207652_10208365 | 3300025921 | Bacteria | 1760 |
| 547 | Ga0207652_10230134 | 3300025921 | Bacteria | 1671 |
| 548 | Ga0207646_10000477 | 3300025922 | Bacteria | 53501 |
| 549 | Ga0207646_10000516 | 3300025922 | Bacteria | 51539 |
| 550 | Ga0207646_10000701 | 3300025922 | Bacteria | 43458 |
| 551 | Ga0207646_10004516 | 3300025922 | Bacteria | 15070 |
| 552 | Ga0207646_10005407 | 3300025922 | Bacteria | 13435 |
| 553 | Ga0207646_10006235 | 3300025922 | Bacteria | 12393 |
| 554 | Ga0207646_10032861 | 3300025922 | Bacteria | 4693 |
| 555 | Ga0207646_10302369 | 3300025922 | Bacteria | 1445 |
| 556 | Ga0207681_10003622 | 3300025923 | Bacteria | 9604 |
| 557 | Ga0207681_10012735 | 3300025923 | Bacteria | 5195 |
| 558 | Ga0207681_10124519 | 3300025923 | Bacteria | 1895 |
| 559 | Ga0207694_10000057 | 3300025924 | Bacteria | 146441 |
| 560 | Ga0207694_10011213 | 3300025924 | Bacteria | 6767 |
| 561 | Ga0207650_10050965 | 3300025925 | Bacteria | 3062 |
| 562 | Ga0207650_10090769 | 3300025925 | Bacteria | 2333 |
| 563 | Ga0207650_10278000 | 3300025925 | Bacteria | 1362 |
| 564 | Ga0207650_10339941 | 3300025925 | Bacteria | 1233 |
| 565 | Ga0207659_10071749 | 3300025926 | Bacteria | 2529 |
| 566 | Ga0207659_10102824 | 3300025926 | Bacteria | 2157 |
| 567 | Ga0207687_10001986 | 3300025927 | Bacteria | 14051 |
| 568 | Ga0207687_10002057 | 3300025927 | Bacteria | 13776 |
| 569 | Ga0207687_10006572 | 3300025927 | Bacteria | 7670 |
| 570 | Ga0207687_10028962 | 3300025927 | Bacteria | 3722 |
| 571 | Ga0207687_10051744 | 3300025927 | Bacteria | 2864 |
| 572 | Ga0207687_10057739 | 3300025927 | Bacteria | 2728 |
| 573 | Ga0207687_10111857 | 3300025927 | Bacteria | 2028 |
| 574 | Ga0207700_10028709 | 3300025928 | Bacteria | 3916 |
| 575 | Ga0207700_10040797 | 3300025928 | Bacteria | 3390 |
| 576 | Ga0207700_10126325 | 3300025928 | Bacteria | 2081 |
| 577 | Ga0207664_10011215 | 3300025929 | Bacteria | 6354 |
| 578 | Ga0207664_10017974 | 3300025929 | Bacteria | 5195 |
| 579 | Ga0207664_10031585 | 3300025929 | Bacteria | 4053 |
| 580 | Ga0207664_10056316 | 3300025929 | Bacteria | 3122 |
| 581 | Ga0207664_10109584 | 3300025929 | Bacteria | 2294 |
| 582 | Ga0207664_10124094 | 3300025929 | Bacteria | 2166 |
| 583 | Ga0207664_10217091 | 3300025929 | Bacteria | 1657 |
| 584 | Ga0207644_10000533 | 3300025931 | Bacteria | 24656 |
| 585 | Ga0207644_10156728 | 3300025931 | Bacteria | 1766 |
| 586 | Ga0207690_10023284 | 3300025932 | Bacteria | 3864 |
| 587 | Ga0207690_10043003 | 3300025932 | Bacteria | 2971 |
| 588 | Ga0207690_10046233 | 3300025932 | Bacteria | 2882 |
| 589 | Ga0207706_10004090 | 3300025933 | Bacteria | 13781 |
| 590 | Ga0207706_10023329 | 3300025933 | Bacteria | 5557 |
| 591 | Ga0207706_10098926 | 3300025933 | Bacteria | 2566 |
| 592 | Ga0207686_10013657 | 3300025934 | Bacteria | 4498 |
| 593 | Ga0207686_10039601 | 3300025934 | Bacteria | 2860 |
| 594 | Ga0207686_10163127 | 3300025934 | Bacteria | 1564 |
| 595 | Ga0207709_10003392 | 3300025935 | Bacteria | 9517 |
| 596 | Ga0207709_10013839 | 3300025935 | Bacteria | 4454 |
| 597 | Ga0207709_10030200 | 3300025935 | Bacteria | 3151 |
| 598 | Ga0207709_10041889 | 3300025935 | Bacteria | 2751 |
| 599 | Ga0207709_10086590 | 3300025935 | Bacteria | 2034 |
| 600 | Ga0207709_10090833 | 3300025935 | Bacteria | 1996 |
| 601 | Ga0207709_10102032 | 3300025935 | Bacteria | 1899 |
| 602 | Ga0207709_10120608 | 3300025935 | Bacteria | 1770 |
| 603 | Ga0207709_10206581 | 3300025935 | Bacteria | 1406 |
| 604 | Ga0207670_10045463 | 3300025936 | Bacteria | 2911 |
| 605 | Ga0207669_10000321 | 3300025937 | Bacteria | 21927 |
| 606 | Ga0207669_10051938 | 3300025937 | Bacteria | 2459 |
| 607 | Ga0207669_10091373 | 3300025937 | Bacteria | 1983 |
| 608 | Ga0207669_10093143 | 3300025937 | Bacteria | 1968 |
| 609 | Ga0207669_10135214 | 3300025937 | Bacteria | 1701 |
| 610 | Ga0207669_10135649 | 3300025937 | Bacteria | 1699 |
| 611 | Ga0207704_10043537 | 3300025938 | Bacteria | 2652 |
| 612 | Ga0207704_10074438 | 3300025938 | Bacteria | 2167 |
| 613 | Ga0207665_10018374 | 3300025939 | Bacteria | 4595 |
| 614 | Ga0207665_10042074 | 3300025939 | Bacteria | 3053 |
| 615 | Ga0207691_10004828 | 3300025940 | Bacteria | 13038 |
| 616 | Ga0207691_10019669 | 3300025940 | Bacteria | 6387 |
| 617 | Ga0207691_10020522 | 3300025940 | Bacteria | 6247 |
| 618 | Ga0207691_10145476 | 3300025940 | Bacteria | 2087 |
| 619 | Ga0207711_10000988 | 3300025941 | Bacteria | 27253 |
| 620 | Ga0207711_10005023 | 3300025941 | Bacteria | 11222 |
| 621 | Ga0207711_10032150 | 3300025941 | Bacteria | 4436 |
| 622 | Ga0207711_10053676 | 3300025941 | Bacteria | 3456 |
| 623 | Ga0207711_10094465 | 3300025941 | Bacteria | 2635 |
| 624 | Ga0207711_10100070 | 3300025941 | Bacteria | 2564 |
| 625 | Ga0207711_10180181 | 3300025941 | Bacteria | 1921 |
| 626 | Ga0207689_10050492 | 3300025942 | Bacteria | 3429 |
| 627 | Ga0207661_10000257 | 3300025944 | Bacteria | 34367 |
| 628 | Ga0207661_10011892 | 3300025944 | Bacteria | 6320 |
| 629 | Ga0207661_10029811 | 3300025944 | Bacteria | 4194 |
| 630 | Ga0207661_10039576 | 3300025944 | Bacteria | 3701 |
| 631 | Ga0207661_10063407 | 3300025944 | Bacteria | 2993 |
| 632 | Ga0207679_10297567 | 3300025945 | Bacteria | 1390 |
| 633 | Ga0207667_10005061 | 3300025949 | Bacteria | 16105 |
| 634 | Ga0207667_10020001 | 3300025949 | Bacteria | 7457 |
| 635 | Ga0207667_10027633 | 3300025949 | Bacteria | 6172 |
| 636 | Ga0207667_10045682 | 3300025949 | Bacteria | 4638 |
| 637 | Ga0207667_10047897 | 3300025949 | Bacteria | 4521 |
| 638 | Ga0207667_10083612 | 3300025949 | Bacteria | 3305 |
| 639 | Ga0207667_10084614 | 3300025949 | Bacteria | 3283 |
| 640 | Ga0207667_10129403 | 3300025949 | Bacteria | 2600 |
| 641 | Ga0207667_10154487 | 3300025949 | Bacteria | 2361 |
| 642 | Ga0207667_10182780 | 3300025949 | Bacteria | 2153 |
| 643 | Ga0207667_10193446 | 3300025949 | Bacteria | 2087 |
| 644 | Ga0207651_10192083 | 3300025960 | Bacteria | 1629 |
| 645 | Ga0207712_10000010 | 3300025961 | Bacteria | 455972 |
| 646 | Ga0207712_10012828 | 3300025961 | Bacteria | 5359 |
| 647 | Ga0207712_10044673 | 3300025961 | Bacteria | 3063 |
| 648 | Ga0207712_10074694 | 3300025961 | Bacteria | 2448 |
| 649 | Ga0207712_10077306 | 3300025961 | Bacteria | 2412 |
| 650 | Ga0207712_10177215 | 3300025961 | Bacteria | 1671 |
| 651 | Ga0207668_10009380 | 3300025972 | Bacteria | 5862 |
| 652 | Ga0207668_10025670 | 3300025972 | Bacteria | 3815 |
| 653 | Ga0207668_10069477 | 3300025972 | Bacteria | 2508 |
| 654 | Ga0207668_10079801 | 3300025972 | Bacteria | 2368 |
| 655 | Ga0207668_10141430 | 3300025972 | Bacteria | 1851 |
| 656 | Ga0207640_10272808 | 3300025981 | Bacteria | 1324 |
| 657 | Ga0207658_10000278 | 3300025986 | Bacteria | 53527 |
| 658 | Ga0207658_10070698 | 3300025986 | Bacteria | 2641 |
| 659 | Ga0207658_10193554 | 3300025986 | Bacteria | 1693 |
| 660 | Ga0207677_10046959 | 3300026023 | Bacteria | 2895 |
| 661 | Ga0207677_10071358 | 3300026023 | Bacteria | 2451 |
| 662 | Ga0207677_10082134 | 3300026023 | Bacteria | 2315 |
| 663 | Ga0207703_10000013 | 3300026035 | Bacteria | 305126 |
| 664 | Ga0207703_10000345 | 3300026035 | Bacteria | 49953 |
| 665 | Ga0207703_10008645 | 3300026035 | Bacteria | 8035 |
| 666 | Ga0207703_10011120 | 3300026035 | Bacteria | 7008 |
| 667 | Ga0207703_10076268 | 3300026035 | Bacteria | 2780 |
| 668 | Ga0207639_10016458 | 3300026041 | Bacteria | 5233 |
| 669 | Ga0207639_10022472 | 3300026041 | Bacteria | 4543 |
| 670 | Ga0207639_10035803 | 3300026041 | Bacteria | 3674 |
| 671 | Ga0207639_10094180 | 3300026041 | Bacteria | 2404 |
| 672 | Ga0207639_10152400 | 3300026041 | Bacteria | 1938 |
| 673 | Ga0207678_10000229 | 3300026067 | Bacteria | 49946 |
| 674 | Ga0207678_10019579 | 3300026067 | Bacteria | 5949 |
| 675 | Ga0207678_10023067 | 3300026067 | Bacteria | 5446 |
| 676 | Ga0207678_10029378 | 3300026067 | Bacteria | 4797 |
| 677 | Ga0207678_10053285 | 3300026067 | Bacteria | 3487 |
| 678 | Ga0207678_10084801 | 3300026067 | Bacteria | 2709 |
| 679 | Ga0207678_10140891 | 3300026067 | Bacteria | 2058 |
| 680 | Ga0207678_10203261 | 3300026067 | Bacteria | 1694 |
| 681 | Ga0207678_10219045 | 3300026067 | Bacteria | 1629 |
| 682 | Ga0207708_10000029 | 3300026075 | Bacteria | 161861 |
| 683 | Ga0207708_10047044 | 3300026075 | Bacteria | 3286 |
| 684 | Ga0207708_10067474 | 3300026075 | Bacteria | 2736 |
| 685 | Ga0207708_10091878 | 3300026075 | Bacteria | 2341 |
| 686 | Ga0207708_10226059 | 3300026075 | Bacteria | 1501 |
| 687 | Ga0207702_10022503 | 3300026078 | Bacteria | 5225 |
| 688 | Ga0207702_10032719 | 3300026078 | Bacteria | 4339 |
| 689 | Ga0207702_10074804 | 3300026078 | Bacteria | 2924 |
| 690 | Ga0207702_10094243 | 3300026078 | Bacteria | 2628 |
| 691 | Ga0207702_10160339 | 3300026078 | Bacteria | 2054 |
| 692 | Ga0207702_10215120 | 3300026078 | Bacteria | 1788 |
| 693 | Ga0207702_10221456 | 3300026078 | Bacteria | 1763 |
| 694 | Ga0207702_10236734 | 3300026078 | Bacteria | 1709 |
| 695 | Ga0207641_10000784 | 3300026088 | Bacteria | 33944 |
| 696 | Ga0207641_10001715 | 3300026088 | Bacteria | 21243 |
| 697 | Ga0207641_10003875 | 3300026088 | Bacteria | 13095 |
| 698 | Ga0207641_10169662 | 3300026088 | Bacteria | 1990 |
| 699 | Ga0207648_10001482 | 3300026089 | Bacteria | 25825 |
| 700 | Ga0207648_10017928 | 3300026089 | Bacteria | 6421 |
| 701 | Ga0207648_10051302 | 3300026089 | Bacteria | 3605 |
| 702 | Ga0207676_10208626 | 3300026095 | Bacteria | 1732 |
| 703 | Ga0207674_10006801 | 3300026116 | Bacteria | 13418 |
| 704 | Ga0207674_10009792 | 3300026116 | Bacteria | 10916 |
| 705 | Ga0207674_10064434 | 3300026116 | Bacteria | 3696 |
| 706 | Ga0207674_10127782 | 3300026116 | Bacteria | 2506 |
| 707 | Ga0207674_10134200 | 3300026116 | Bacteria | 2438 |
| 708 | Ga0207675_100003809 | 3300026118 | Bacteria | 14698 |
| 709 | Ga0207675_100062849 | 3300026118 | Bacteria | 3469 |
| 710 | Ga0207675_100127813 | 3300026118 | Bacteria | 2408 |
| 711 | Ga0207675_100142217 | 3300026118 | Bacteria | 2280 |
| 712 | Ga0207675_100174383 | 3300026118 | Bacteria | 2057 |
| 713 | Ga0207683_10001283 | 3300026121 | Bacteria | 22741 |
| 714 | Ga0207683_10003164 | 3300026121 | Bacteria | 14369 |
| 715 | Ga0207683_10066126 | 3300026121 | Bacteria | 3188 |
| 716 | Ga0207683_10186624 | 3300026121 | Bacteria | 1881 |
| 717 | Ga0207683_10377498 | 3300026121 | Bacteria | 1303 |
| 718 | Ga0207698_10062658 | 3300026142 | Bacteria | 2905 |
| 719 | Ga0207698_10108734 | 3300026142 | Bacteria | 2318 |
| 720 | Ga0207698_10157060 | 3300026142 | Bacteria | 1983 |
| 721 | Ga0207698_10173142 | 3300026142 | Bacteria | 1903 |
| 722 | Ga0207698_10217215 | 3300026142 | Bacteria | 1725 |
| 723 | Ga0207698_10275758 | 3300026142 | Bacteria | 1553 |
| 724 | Ga0207428_10010654 | 3300027907 | Bacteria | 8202 |
| 725 | Ga0268266_10001660 | 3300028379 | Bacteria | 25696 |
| 726 | Ga0268266_10004579 | 3300028379 | Bacteria | 13206 |
| 727 | Ga0268266_10006280 | 3300028379 | Bacteria | 10903 |
| 728 | Ga0268266_10012115 | 3300028379 | Bacteria | 7464 |
| 729 | Ga0268266_10016431 | 3300028379 | Bacteria | 6326 |
| 730 | Ga0268266_10044774 | 3300028379 | Bacteria | 3783 |
| 731 | Ga0268266_10065440 | 3300028379 | Bacteria | 3143 |
| 732 | Ga0268265_10000014 | 3300028380 | Bacteria | 330186 |
| 733 | Ga0268265_10000041 | 3300028380 | Bacteria | 189918 |
| 734 | Ga0268265_10043944 | 3300028380 | Bacteria | 3324 |
| 735 | Ga0268265_10186334 | 3300028380 | Bacteria | 1788 |
| 736 | Ga0268264_10000150 | 3300028381 | Bacteria | 158263 |
| 737 | Ga0268264_10000210 | 3300028381 | Bacteria | 118222 |
| 738 | Ga0268264_10000498 | 3300028381 | Bacteria | 51440 |
| 739 | Ga0268264_10001010 | 3300028381 | Bacteria | 28549 |
| 740 | Ga0268264_10491113 | 3300028381 | Bacteria | 1196 |
| 741 | Ga0265337_1000861 | 3300028556 | Bacteria | 15952 |
| 742 | Ga0265326_10001260 | 3300028558 | Bacteria | 9015 |
| 743 | Ga0265319_1000828 | 3300028563 | Bacteria | 19683 |
| 744 | Ga0265334_10000237 | 3300028573 | Bacteria | 31781 |
| 745 | Ga0265318_10008654 | 3300028577 | Bacteria | 4513 |
| 746 | Ga0265323_10005269 | 3300028653 | Bacteria | 5495 |
| 747 | Ga0265322_10010118 | 3300028654 | Bacteria | 2734 |
| 748 | Ga0265336_10002720 | 3300028666 | Bacteria | 7155 |
| 749 | Ga0307515_10022361 | 3300028794 | Bacteria | 11146 |
| 750 | Ga0307515_10037313 | 3300028794 | Bacteria | 7819 |
| 751 | Ga0307515_10175114 | 3300028794 | Bacteria | 2119 |
| 752 | Ga0265338_10000376 | 3300028800 | Bacteria | 79928 |
| 753 | Ga0265338_10001480 | 3300028800 | Bacteria | 38067 |
| 754 | Ga0265338_10015126 | 3300028800 | Bacteria | 8512 |
| 755 | Ga0265324_10008950 | 3300029957 | Bacteria | 3939 |
| 756 | Ga0307512_10004160 | 3300030522 | Bacteria | 16050 |
| 757 | Ga0316177_1181774 | 3300030731 | Bacteria | 1669 |
| 758 | Ga0316176_1121577 | 3300030732 | Bacteria | 2280 |
| 759 | Ga0316176_1187053 | 3300030732 | Bacteria | 1347 |
| 760 | Ga0314311_1118439 | 3300030733 | Bacteria | 5825 |
| 761 | Ga0314311_1132449 | 3300030733 | Bacteria | 2662 |
| 762 | Ga0316181_1233539 | 3300030744 | Bacteria | 1738 |
| 763 | Ga0265332_10002532 | 3300031238 | Bacteria | 9274 |
| 764 | Ga0265320_10000532 | 3300031240 | Bacteria | 29415 |
| 765 | Ga0265340_10004583 | 3300031247 | Bacteria | 7694 |
| 766 | Ga0265339_10030866 | 3300031249 | Bacteria | 3033 |
| 767 | Ga0265331_10042159 | 3300031250 | Bacteria | 2215 |
| 768 | Ga0265327_10003399 | 3300031251 | Bacteria | 15275 |
| 769 | Ga0265316_10006104 | 3300031344 | Bacteria | 11560 |
| 770 | Ga0265316_10050856 | 3300031344 | Bacteria | 3258 |
| 771 | Ga0307513_10004729 | 3300031456 | Bacteria | 18102 |
| 772 | Ga0307513_10006259 | 3300031456 | Bacteria | 15592 |
| 773 | Ga0307513_10016777 | 3300031456 | Bacteria | 8812 |
| 774 | Ga0307513_10202081 | 3300031456 | Bacteria | 1827 |
| 775 | Ga0307408_100171077 | 3300031548 | Bacteria | 1734 |
| 776 | Ga0307408_100191933 | 3300031548 | Bacteria | 1646 |
| 777 | Ga0307408_100246721 | 3300031548 | Bacteria | 1470 |
| 778 | Ga0307408_100281850 | 3300031548 | Bacteria | 1384 |
| 779 | Ga0265313_10006611 | 3300031595 | Bacteria | 8146 |
| 780 | Ga0307508_10135401 | 3300031616 | Bacteria | 2067 |
| 781 | Ga0307514_10002631 | 3300031649 | Bacteria | 18347 |
| 782 | Ga0307514_10011079 | 3300031649 | Bacteria | 7511 |
| 783 | Ga0316575_10001074 | 3300031665 | Bacteria | 8520 |
| 784 | Ga0316579_10006667 | 3300031691 | Bacteria | 4722 |
| 785 | Ga0316579_10006821 | 3300031691 | Bacteria | 4679 |
| 786 | Ga0316579_10039363 | 3300031691 | Unclassified | 2190 |
| 787 | Ga0265314_10016241 | 3300031711 | Bacteria | 5890 |
| 788 | Ga0265342_10022810 | 3300031712 | Bacteria | 3973 |
| 789 | Ga0316576_10001380 | 3300031727 | Bacteria | 12959 |
| 790 | Ga0316576_10003072 | 3300031727 | Bacteria | 9720 |
| 791 | Ga0316576_10017375 | 3300031727 | Bacteria | 4885 |
| 792 | Ga0316576_10040477 | 3300031727 | Bacteria | 3350 |
| 793 | Ga0316576_10112338 | 3300031727 | Bacteria | 2043 |
| 794 | Ga0316578_10002012 | 3300031728 | Bacteria | 8648 |
| 795 | Ga0316578_10003078 | 3300031728 | Bacteria | 7531 |
| 796 | Ga0316578_10017612 | 3300031728 | Bacteria | 3892 |
| 797 | Ga0307405_10034091 | 3300031731 | Bacteria | 3026 |
| 798 | Ga0307405_10039590 | 3300031731 | Bacteria | 2850 |
| 799 | Ga0307405_10058979 | 3300031731 | Bacteria | 2417 |
| 800 | Ga0307405_10164076 | 3300031731 | Bacteria | 1577 |
| 801 | Ga0307405_10196397 | 3300031731 | Bacteria | 1461 |
| 802 | Ga0316577_10023806 | 3300031733 | Bacteria | 3399 |
| 803 | Ga0316577_10026975 | 3300031733 | Bacteria | 3201 |
| 804 | Ga0307413_10039726 | 3300031824 | Bacteria | 2739 |
| 805 | Ga0307413_10117076 | 3300031824 | Bacteria | 1796 |
| 806 | Ga0307518_10000445 | 3300031838 | Bacteria | 31568 |
| 807 | Ga0307518_10001456 | 3300031838 | Bacteria | 17573 |
| 808 | Ga0307410_10005711 | 3300031852 | Bacteria | 6627 |
| 809 | Ga0307410_10007860 | 3300031852 | Bacteria | 5872 |
| 810 | Ga0307410_10059763 | 3300031852 | Bacteria | 2603 |
| 811 | Ga0307410_10099559 | 3300031852 | Bacteria | 2081 |
| 812 | Ga0307410_10161920 | 3300031852 | Bacteria | 1677 |
| 813 | Ga0307410_10172421 | 3300031852 | Bacteria | 1631 |
| 814 | Ga0307406_10000520 | 3300031901 | Bacteria | 22113 |
| 815 | Ga0307406_10002180 | 3300031901 | Bacteria | 10659 |
| 816 | Ga0307406_10007260 | 3300031901 | Bacteria | 6137 |
| 817 | Ga0307406_10046164 | 3300031901 | Bacteria | 2740 |
| 818 | Ga0307406_10069841 | 3300031901 | Bacteria | 2298 |
| 819 | Ga0307406_10075032 | 3300031901 | Bacteria | 2229 |
| 820 | Ga0307406_10082055 | 3300031901 | Bacteria | 2146 |
| 821 | Ga0307406_10109972 | 3300031901 | Bacteria | 1895 |
| 822 | Ga0307407_10037797 | 3300031903 | Bacteria | 2670 |
| 823 | Ga0307407_10080214 | 3300031903 | Bacteria | 1971 |
| 824 | Ga0307412_10010775 | 3300031911 | Bacteria | 5275 |
| 825 | Ga0307412_10078687 | 3300031911 | Bacteria | 2272 |
| 826 | Ga0307412_10109312 | 3300031911 | Bacteria | 1971 |
| 827 | Ga0307409_100002130 | 3300031995 | Bacteria | 10199 |
| 828 | Ga0307409_100002984 | 3300031995 | Bacteria | 9018 |
| 829 | Ga0307409_100010167 | 3300031995 | Bacteria | 5831 |
| 830 | Ga0307409_100021286 | 3300031995 | Bacteria | 4442 |
| 831 | Ga0307409_100035071 | 3300031995 | Bacteria | 3672 |
| 832 | Ga0307409_100075439 | 3300031995 | Bacteria | 2700 |
| 833 | Ga0307409_100151170 | 3300031995 | Bacteria | 2016 |
| 834 | Ga0307409_100168606 | 3300031995 | Bacteria | 1924 |
| 835 | Ga0307416_100098400 | 3300032002 | Bacteria | 2537 |
| 836 | Ga0307416_100100882 | 3300032002 | Bacteria | 2512 |
| 837 | Ga0307416_100103395 | 3300032002 | Bacteria | 2487 |
| 838 | Ga0307416_100121442 | 3300032002 | Bacteria | 2329 |
| 839 | Ga0307416_100140122 | 3300032002 | Bacteria | 2196 |
| 840 | Ga0307416_100176682 | 3300032002 | Bacteria | 1996 |
| 841 | Ga0307416_100180815 | 3300032002 | Bacteria | 1976 |
| 842 | Ga0307416_100495966 | 3300032002 | Bacteria | 1284 |
| 843 | Ga0307414_10018011 | 3300032004 | Bacteria | 4335 |
| 844 | Ga0307414_10023359 | 3300032004 | Bacteria | 3921 |
| 845 | Ga0307414_10032644 | 3300032004 | Bacteria | 3431 |
| 846 | Ga0307414_10040079 | 3300032004 | Bacteria | 3161 |
| 847 | Ga0307414_10062940 | 3300032004 | Bacteria | 2635 |
| 848 | Ga0307414_10086547 | 3300032004 | Bacteria | 2313 |
| 849 | Ga0307414_10173992 | 3300032004 | Bacteria | 1724 |
| 850 | Ga0307411_10043938 | 3300032005 | Bacteria | 2862 |
| 851 | Ga0307411_10082429 | 3300032005 | Bacteria | 2218 |
| 852 | Ga0307415_100002009 | 3300032126 | Bacteria | 10023 |
| 853 | Ga0307415_100046464 | 3300032126 | Bacteria | 2917 |
| 854 | Ga0307415_100064299 | 3300032126 | Bacteria | 2552 |
| 855 | Ga0307415_100113327 | 3300032126 | Bacteria | 2016 |
| 856 | Ga0316583_10020853 | 3300032133 | Bacteria | 2349 |
| 857 | Ga0316585_10006425 | 3300032137 | Bacteria | 3361 |
| 858 | Ga0316585_10012405 | 3300032137 | Bacteria | 2524 |
| 859 | Ga0316585_10034867 | 3300032137 | Bacteria | 1592 |
| 860 | Ga0316580_10004313 | 3300032139 | Bacteria | 4118 |
| 861 | Ga0307507_10014085 | 3300033179 | Bacteria | 9590 |
| 862 | Ga0307507_10045062 | 3300033179 | Bacteria | 4346 |
| 863 | Ga0307507_10045348 | 3300033179 | Bacteria | 4326 |
| 864 | Ga0307510_10037636 | 3300033180 | Bacteria | 5365 |
| 865 | Ga0373926_0000004 | 3300035083 | Bacteria | 40904 |
| 866 | Ga0373926_0003287 | 3300035083 | Bacteria | 5194 |
| 867 | Ga0373926_0005331 | 3300035083 | Bacteria | 4233 |
| 868 | Ga0373934_0004066 | 3300035086 | Bacteria | 5389 |
| 869 | Ga0373934_0005307 | 3300035086 | Bacteria | 4766 |
| 870 | Ga0373944_0000024 | 3300035089 | Bacteria | 26949 |
| 871 | Ga0373944_0002808 | 3300035089 | Bacteria | 4455 |
| 872 | Ga0373923_0009922 | 3300035111 | Bacteria | 3449 |
| 873 | Ga0373936_0000240 | 3300035113 | Bacteria | 18113 |
| 874 | Ga0373936_0000251 | 3300035113 | Bacteria | 17775 |
| 875 | Ga0373936_0048159 | 3300035113 | Bacteria | 1720 |
| 876 | Ga0373939_0026080 | 3300035114 | Bacteria | 1644 |
| 877 | Ga0373945_0000140 | 3300035116 | Bacteria | 18218 |
| 878 | Ga0373953_0033415 | 3300035117 | Bacteria | 2012 |
| 879 | Ga0373954_0008715 | 3300035118 | Bacteria | 4458 |
| 880 | Ga0373956_0002606 | 3300035119 | Bacteria | 7312 |
| 881 | Ga0373956_0011366 | 3300035119 | Bacteria | 3666 |
| 882 | Ga0373957_0031735 | 3300035120 | Bacteria | 1942 |
| 883 | Ga0373943_0001314 | 3300035170 | Bacteria | 11168 |
| 884 | Ga0373943_0007804 | 3300035170 | Bacteria | 4805 |
| 885 | Ga0373946_0000089 | 3300035171 | Bacteria | 25208 |
| 886 | Ga0373946_0000252 | 3300035171 | Bacteria | 16973 |
| 887 | Ga0373946_0043766 | 3300035171 | Bacteria | 1846 |
| 888 | Ga0373955_0004750 | 3300035172 | Bacteria | 6044 |
| 889 | Ga0373955_0071397 | 3300035172 | Bacteria | 1942 |
| 890 | Ga0373955_0120938 | 3300035172 | Bacteria | 1522 |
| 891 | Ga0373942_0007025 | 3300035207 | Bacteria | 2602 |
| 892 | Ga0316574_0000415 | 3300035398 | Bacteria | 16875 |
| 893 | Ga0316574_0012915 | 3300035398 | Bacteria | 4789 |
| 894 | Ga0316574_0025924 | 3300035398 | Bacteria | 3523 |
| 895 | Ga0316574_0033681 | 3300035398 | Bacteria | 3118 |
| 896 | Ga0316574_0136805 | 3300035398 | Bacteria | 1577 |
| 897 | Ga0373924_0023755 | 3300035410 | Bacteria | 2409 |
| 898 | Ga0373924_0039200 | 3300035410 | Bacteria | 1935 |
| 899 | Ga0373931_0009909 | 3300035691 | Bacteria | 4565 |
| 900 | Ga0373931_0017982 | 3300035691 | Bacteria | 3507 |
| 901 | Ga0373935_0000586 | 3300035692 | Bacteria | 18964 |
| 902 | Ga0373935_0000834 | 3300035692 | Bacteria | 16581 |
| 903 | Ga0373935_0012962 | 3300035692 | Bacteria | 5024 |
| 904 | Ga0373935_0064795 | 3300035692 | Bacteria | 2343 |
| 905 | Ga0373927_0001993 | 3300035695 | Bacteria | 15054 |
| 906 | Ga0373927_0001996 | 3300035695 | Bacteria | 15042 |
| 907 | Ga0373927_0049873 | 3300035695 | Bacteria | 2706 |
| 908 | Ga0373933_0020579 | 3300035724 | Bacteria | 3741 |
| 909 | Ga0373933_0066690 | 3300035724 | Bacteria | 2181 |
| 910 | Ga0373947_0000007 | 3300035725 | Bacteria | 192259 |
| 911 | Ga0373947_0007154 | 3300035725 | Bacteria | 6469 |
| 912 | Ga0373947_0007697 | 3300035725 | Bacteria | 6225 |
| 913 | Ga0373937_0013695 | 3300036401 | Bacteria | 7144 |
| 914 | Ga0373937_0206334 | 3300036401 | Bacteria | 1848 |
| 915 | Ga0316582_0078006 | 3300036647 | Bacteria | 2157 |
| 916 | Ga0316584_0000383 | 3300036712 | Bacteria | 22877 |
| 917 | Ga0316584_0058602 | 3300036712 | Bacteria | 2883 |
| 918 | Ga0316584_0082555 | 3300036712 | Bacteria | 2407 |
| 919 | Ga0316584_0116975 | 3300036712 | Bacteria | 1993 |
| 920 | Ga0373925_0000004 | 3300037068 | Bacteria | 361597 |
| 921 | Ga0373925_0003736 | 3300037068 | Bacteria | 11690 |
| 922 | Ga0373925_0012813 | 3300037068 | Bacteria | 6074 |
| 923 | Ga0395899_0008790 | 3300037312 | Bacteria | 7771 |
| 924 | Ga0395899_0015761 | 3300037312 | Bacteria | 5763 |
| 925 | Ga0395899_0039667 | 3300037312 | Bacteria | 3523 |
| 926 | Ga0395899_0070232 | 3300037312 | Bacteria | 2563 |
| 927 | Ga0395899_0071152 | 3300037312 | Bacteria | 2545 |
| 928 | Ga0395899_0123009 | 3300037312 | Bacteria | 1857 |
| 929 | Ga0395900_0015052 | 3300037418 | Bacteria | 7884 |
| 930 | Ga0395900_0035372 | 3300037418 | Bacteria | 5144 |
| 931 | Ga0395900_0040502 | 3300037418 | Bacteria | 4801 |
| 932 | Ga0395900_0074598 | 3300037418 | Bacteria | 3487 |
| 933 | Ga0395900_0101893 | 3300037418 | Bacteria | 2949 |
| 934 | Ga0395900_0112660 | 3300037418 | Bacteria | 2793 |
| 935 | Ga0395900_0137294 | 3300037418 | Bacteria | 2505 |
| 936 | Ga0395900_0140005 | 3300037418 | Bacteria | 2478 |
| 937 | Ga0395900_0243208 | 3300037418 | Bacteria | 1804 |
| 938 | Ga0395898_0000381 | 3300037466 | Bacteria | 97274 |
| 939 | Ga0395898_0005576 | 3300037466 | Bacteria | 13569 |
| 940 | Ga0395898_0011069 | 3300037466 | Bacteria | 9393 |
| 941 | Ga0395898_0080616 | 3300037466 | Bacteria | 3139 |
| 942 | Ga0395898_0115294 | 3300037466 | Bacteria | 2574 |
| 943 | Ga0395905_0039073 | 3300037471 | Bacteria | 4452 |
| 944 | Ga0395905_0056411 | 3300037471 | Bacteria | 3675 |
| 945 | Ga0436364_0010700 | 3300037853 | Bacteria | 115369 |
| 946 | Ga0436364_0048623 | 3300037853 | Bacteria | 9076 |
| 947 | Ga0436364_1071680 | 3300037853 | Bacteria | 1719 |
| 948 | Ga0436364_1508399 | 3300037853 | Bacteria | 1852 |
| 949 | Ga0395901_0050485 | 3300038443 | Bacteria | 4321 |
| 950 | Ga0395901_0064601 | 3300038443 | Bacteria | 3810 |
| 951 | Ga0395901_0066733 | 3300038443 | Bacteria | 3747 |
| 952 | Ga0395901_0076931 | 3300038443 | Bacteria | 3482 |
| 953 | Ga0395901_0124894 | 3300038443 | Bacteria | 2704 |
| 954 | Ga0395901_0133959 | 3300038443 | Bacteria | 2604 |
| 955 | Ga0395901_0222281 | 3300038443 | Bacteria | 1974 |
| 956 | Ga0395901_0257884 | 3300038443 | Bacteria | 1815 |
| 957 | Ga0436365_1474856 | 3300039437 | Bacteria | 28836 |
| 958 | Ga0436365_1712156 | 3300039437 | Bacteria | 11498 |
| 959 | Ga0436360_0167640 | 3300039438 | Bacteria | 2739 |
| 960 | Ga0436361_0615022 | 3300039447 | Bacteria | 7070 |
| 961 | Ga0436362_0365102 | 3300039453 | Bacteria | 4965 |
| 962 | Ga0439438_012377 | 3300041405 | Bacteria | 2617 |
| 963 | Ga0439438_025400 | 3300041405 | Bacteria | 1615 |
| 964 | Ga0439461_0000541 | 3300041410 | Bacteria | 5469 |
| 965 | Ga0439461_0001042 | 3300041410 | Bacteria | 4185 |
| 966 | Ga0439461_0006688 | 3300041410 | Bacteria | 2015 |
| 967 | Ga0439461_0010106 | 3300041410 | Bacteria | 1727 |
| 968 | Ga0439466_0001530 | 3300041411 | Bacteria | 9040 |
| 969 | Ga0439466_0006330 | 3300041411 | Bacteria | 4506 |
| 970 | Ga0439466_0008648 | 3300041411 | Bacteria | 3836 |
| 971 | Ga0439466_0009136 | 3300041411 | Bacteria | 3715 |
| 972 | Ga0439465_0003293 | 3300041413 | Bacteria | 5275 |
| 973 | Ga0439465_0047901 | 3300041413 | Bacteria | 1394 |
| 974 | Ga0439431_0000277 | 3300041997 | Bacteria | 10573 |
| 975 | Ga0439431_0009936 | 3300041997 | Bacteria | 2155 |
| 976 | Ga0439431_0013210 | 3300041997 | Bacteria | 1903 |
| 977 | Ga0439431_0016012 | 3300041997 | Bacteria | 1751 |
| 978 | Ga0439433_0000286 | 3300041999 | Bacteria | 8654 |
| 979 | Ga0439433_0000832 | 3300041999 | Bacteria | 6098 |
| 980 | Ga0439442_001243 | 3300042002 | Bacteria | 5059 |
| 981 | Ga0439442_026371 | 3300042002 | Bacteria | 1209 |
| 982 | Ga0439445_0000717 | 3300042004 | Bacteria | 6918 |
| 983 | Ga0439448_0013319 | 3300042005 | Bacteria | 2469 |
| 984 | Ga0439449_0001566 | 3300042007 | Bacteria | 8965 |
| 985 | Ga0439449_0002451 | 3300042007 | Bacteria | 7252 |
| 986 | Ga0439449_0014860 | 3300042007 | Bacteria | 2926 |
| 987 | Ga0439451_004531 | 3300042009 | Bacteria | 2827 |
| 988 | Ga0439452_005887 | 3300042010 | Bacteria | 3896 |
| 989 | Ga0439454_002842 | 3300042011 | Bacteria | 1870 |
| 990 | Ga0439457_000878 | 3300042014 | Bacteria | 9076 |
| 991 | Ga0439457_002559 | 3300042014 | Bacteria | 5154 |
| 992 | Ga0439462_0017634 | 3300042015 | Bacteria | 1849 |
| 993 | Ga0450919_000123 | 3300042121 | Bacteria | 7838 |
| 994 | Ga0450920_006112 | 3300042122 | Bacteria | 2156 |
| 995 | Ga0439446_0008839 | 3300042156 | Bacteria | 2685 |
| 996 | Ga0450908_002157 | 3300042184 | Bacteria | 3855 |
| 997 | Ga0450909_001471 | 3300042185 | Bacteria | 3287 |
| 998 | Ga0439434_0001620 | 3300042435 | Bacteria | 6500 |
| 999 | Ga0439434_0002886 | 3300042435 | Bacteria | 5015 |
| 1000 | Ga0439460_0003464 | 3300042461 | Archaea | 3819 |
| 1001 | Ga0450918_003166 | 3300042531 | Bacteria | 3067 |
| 1002 | Ga0466969_0014150 | 3300044656 | Bacteria | 4196 |
| 1003 | Ga0466969_0015497 | 3300044656 | Bacteria | 3995 |
| 1004 | Ga0466972_0002008 | 3300044658 | Bacteria | 9968 |
| 1005 | Ga0466972_0003353 | 3300044658 | Bacteria | 7937 |
| 1006 | Ga0466972_0006242 | 3300044658 | Bacteria | 5986 |
| 1007 | Ga0466972_0008483 | 3300044658 | Bacteria | 5154 |
| 1008 | Ga0466972_0016501 | 3300044658 | Bacteria | 3692 |
| 1009 | Ga0466972_0024952 | 3300044658 | Bacteria | 2966 |
| 1010 | Ga0466972_0025150 | 3300044658 | Bacteria | 2953 |
| 1011 | Ga0466972_0031016 | 3300044658 | Bacteria | 2631 |
| 1012 | Ga0466972_0095998 | 3300044658 | Bacteria | 1404 |
| 1013 | Ga0466965_0003901 | 3300044683 | Bacteria | 6596 |
| 1014 | Ga0466965_0005424 | 3300044683 | Bacteria | 5746 |
| 1015 | Ga0466965_0016410 | 3300044683 | Bacteria | 3525 |
| 1016 | Ga0466965_0025571 | 3300044683 | Bacteria | 2857 |
| 1017 | Ga0466965_0028877 | 3300044683 | Bacteria | 2696 |
| 1018 | Ga0466965_0031824 | 3300044683 | Bacteria | 2574 |
| 1019 | Ga0466965_0033743 | 3300044683 | Bacteria | 2502 |
| 1020 | Ga0466965_0047425 | 3300044683 | Bacteria | 2127 |
| 1021 | Ga0466965_0056670 | 3300044683 | Bacteria | 1952 |
| 1022 | Ga0466965_0066948 | 3300044683 | Bacteria | 1802 |
| 1023 | Ga0466965_0068084 | 3300044683 | Bacteria | 1787 |
| 1024 | Ga0466966_0002623 | 3300044684 | Bacteria | 11780 |
| 1025 | Ga0466966_0030855 | 3300044684 | Bacteria | 3477 |
| 1026 | Ga0466966_0037815 | 3300044684 | Bacteria | 3110 |
| 1027 | Ga0466966_0138687 | 3300044684 | Bacteria | 1487 |
| 1028 | Ga0466961_0031408 | 3300044693 | Bacteria | 3414 |
| 1029 | Ga0466961_0032806 | 3300044693 | Bacteria | 3336 |
| 1030 | Ga0466961_0038494 | 3300044693 | Bacteria | 3067 |
| 1031 | Ga0466961_0067481 | 3300044693 | Bacteria | 2272 |
| 1032 | Ga0466961_0087585 | 3300044693 | Bacteria | 1967 |
| 1033 | Ga0466961_0093599 | 3300044693 | Bacteria | 1896 |
| 1034 | Ga0466961_0119605 | 3300044693 | Bacteria | 1654 |
| 1035 | Ga0466961_0209194 | 3300044693 | Bacteria | 1205 |
| 1036 | Ga0466963_0002223 | 3300044694 | Bacteria | 10749 |
| 1037 | Ga0466963_0004617 | 3300044694 | Bacteria | 8028 |
| 1038 | Ga0466963_0009504 | 3300044694 | Bacteria | 5856 |
| 1039 | Ga0466963_0030660 | 3300044694 | Bacteria | 3472 |
| 1040 | Ga0466963_0053339 | 3300044694 | Bacteria | 2685 |
| 1041 | Ga0466963_0076175 | 3300044694 | Bacteria | 2265 |
| 1042 | Ga0466963_0079949 | 3300044694 | Bacteria | 2212 |
| 1043 | Ga0466963_0204422 | 3300044694 | Bacteria | 1381 |
| 1044 | Ga0466963_0222462 | 3300044694 | Bacteria | 1322 |
| 1045 | Ga0466964_0025463 | 3300044706 | Bacteria | 2310 |
| 1046 | Ga0466964_0027290 | 3300044706 | Bacteria | 2242 |
| 1047 | Ga0466964_0051855 | 3300044706 | Bacteria | 1685 |
| 1048 | Ga0466964_0095766 | 3300044706 | Bacteria | 1300 |
| 1049 | Ga0466971_0004615 | 3300044719 | Bacteria | 5949 |
| 1050 | Ga0466971_0044965 | 3300044719 | Bacteria | 1983 |
| 1051 | Ga0466971_0062121 | 3300044719 | Bacteria | 1690 |
| 1052 | Ga0466968_0007642 | 3300044735 | Bacteria | 4117 |
| 1053 | Ga0466968_0019763 | 3300044735 | Bacteria | 2714 |
| 1054 | Ga0466968_0051487 | 3300044735 | Bacteria | 1759 |
| 1055 | Ga0466970_0000093 | 3300044765 | Bacteria | 37847 |
| 1056 | Ga0466970_0004325 | 3300044765 | Bacteria | 6989 |
| 1057 | Ga0466970_0005681 | 3300044765 | Bacteria | 6195 |
| 1058 | Ga0466970_0006545 | 3300044765 | Bacteria | 5822 |
| 1059 | Ga0466970_0010125 | 3300044765 | Bacteria | 4777 |
| 1060 | Ga0466970_0013655 | 3300044765 | Bacteria | 4167 |
| 1061 | Ga0466970_0020060 | 3300044765 | Bacteria | 3469 |
| 1062 | Ga0466970_0034709 | 3300044765 | Bacteria | 2671 |
| 1063 | Ga0466970_0051568 | 3300044765 | Bacteria | 2196 |
| 1064 | Ga0466970_0052244 | 3300044765 | Bacteria | 2181 |
| 1065 | Ga0466970_0054498 | 3300044765 | Bacteria | 2135 |
| 1066 | Ga0466970_0100357 | 3300044765 | Bacteria | 1576 |
| 1067 | Ga0466957_0003409 | 3300044842 | Bacteria | 8725 |
| 1068 | Ga0466957_0027743 | 3300044842 | Bacteria | 3366 |
| 1069 | Ga0466957_0036044 | 3300044842 | Bacteria | 2971 |
| 1070 | Ga0466957_0050466 | 3300044842 | Bacteria | 2532 |
| 1071 | Ga0466957_0075158 | 3300044842 | Bacteria | 2096 |
| 1072 | Ga0466957_0111467 | 3300044842 | Bacteria | 1735 |
| 1073 | Ga0466960_0002117 | 3300044901 | Bacteria | 7395 |
| 1074 | Ga0466960_0002276 | 3300044901 | Bacteria | 7183 |
| 1075 | Ga0466960_0004115 | 3300044901 | Bacteria | 5656 |
| 1076 | Ga0466960_0009803 | 3300044901 | Bacteria | 3960 |
| 1077 | Ga0466960_0009870 | 3300044901 | Bacteria | 3947 |
| 1078 | Ga0466960_0010324 | 3300044901 | Bacteria | 3875 |
| 1079 | Ga0466960_0021256 | 3300044901 | Bacteria | 2886 |
| 1080 | Ga0466960_0028067 | 3300044901 | Bacteria | 2573 |
| 1081 | Ga0466960_0037032 | 3300044901 | Bacteria | 2287 |
| 1082 | Ga0466959_0001664 | 3300045049 | Bacteria | 13767 |
| 1083 | Ga0466959_0003675 | 3300045049 | Bacteria | 10116 |
| 1084 | Ga0466959_0006267 | 3300045049 | Bacteria | 8217 |
| 1085 | Ga0466959_0016450 | 3300045049 | Bacteria | 5405 |
| 1086 | Ga0466959_0019389 | 3300045049 | Bacteria | 5002 |
| 1087 | Ga0466959_0032967 | 3300045049 | Bacteria | 3833 |
| 1088 | Ga0466959_0059074 | 3300045049 | Bacteria | 2793 |
| 1089 | Ga0466959_0067718 | 3300045049 | Bacteria | 2588 |
| 1090 | Ga0466958_0001497 | 3300045836 | Bacteria | 11166 |
| 1091 | Ga0466958_0005259 | 3300045836 | Bacteria | 6936 |
| 1092 | Ga0466958_0018627 | 3300045836 | Bacteria | 4032 |
| 1093 | Ga0466958_0034064 | 3300045836 | Bacteria | 3037 |
| 1094 | Ga0466958_0034141 | 3300045836 | Bacteria | 3033 |
| 1095 | Ga0466958_0056887 | 3300045836 | Bacteria | 2377 |
| 1096 | Ga0466958_0135562 | 3300045836 | Bacteria | 1548 |
| 1097 | Ga0466967_0005159 | 3300045976 | Bacteria | 8986 |
| 1098 | Ga0466967_0005915 | 3300045976 | Bacteria | 8574 |
| 1099 | Ga0466967_0013641 | 3300045976 | Bacteria | 6290 |
| 1100 | Ga0466967_0026874 | 3300045976 | Bacteria | 4777 |
| 1101 | Ga0466967_0029449 | 3300045976 | Bacteria | 4595 |
| 1102 | Ga0466967_0030435 | 3300045976 | Bacteria | 4530 |
| 1103 | Ga0466967_0031939 | 3300045976 | Bacteria | 4440 |
| 1104 | Ga0466967_0037879 | 3300045976 | Bacteria | 4131 |
| 1105 | Ga0466967_0050474 | 3300045976 | Bacteria | 3643 |
| 1106 | Ga0466967_0062509 | 3300045976 | Bacteria | 3305 |
| 1107 | Ga0466967_0064440 | 3300045976 | Bacteria | 3259 |
| 1108 | Ga0466967_0073397 | 3300045976 | Bacteria | 3070 |
| 1109 | Ga0466967_0084129 | 3300045976 | Bacteria | 2878 |
| 1110 | Ga0466967_0089613 | 3300045976 | Bacteria | 2793 |
| 1111 | Ga0466967_0119981 | 3300045976 | Bacteria | 2428 |
| 1112 | Ga0466967_0124268 | 3300045976 | Bacteria | 2388 |
| 1113 | Ga0466967_0143959 | 3300045976 | Bacteria | 2222 |
| 1114 | Ga0466967_0163864 | 3300045976 | Bacteria | 2088 |
| 1115 | Ga0466967_0257291 | 3300045976 | Bacteria | 1669 |
| 1116 | Ga0466967_0273131 | 3300045976 | Bacteria | 1620 |
| 1117 | Ga0495627_001142 | 3300046453 | Bacteria | 17148 |
| 1118 | Ga0495592_0038444 | 3300046454 | Bacteria | 3601 |
| 1119 | Ga0495603_0000513 | 3300046455 | Bacteria | 21575 |
| 1120 | Ga0495603_0005295 | 3300046455 | Bacteria | 7690 |
| 1121 | Ga0495603_0008346 | 3300046455 | Bacteria | 6262 |
| 1122 | Ga0495603_0051227 | 3300046455 | Bacteria | 2453 |
| 1123 | Ga0495603_0096202 | 3300046455 | Bacteria | 1730 |
| 1124 | Ga0495590_0000413 | 3300046457 | Bacteria | 21560 |
| 1125 | Ga0495629_0007624 | 3300046459 | Bacteria | 7968 |
| 1126 | Ga0495629_0021240 | 3300046459 | Bacteria | 4633 |
| 1127 | Ga0495629_0022859 | 3300046459 | Bacteria | 4455 |
| 1128 | Ga0495638_0014114 | 3300046460 | Bacteria | 5410 |
| 1129 | Ga0495638_0029044 | 3300046460 | Bacteria | 3566 |
| 1130 | Ga0495638_0078942 | 3300046460 | Bacteria | 2002 |
| 1131 | Ga0495641_0006042 | 3300046461 | Bacteria | 7967 |
| 1132 | Ga0495641_0022516 | 3300046461 | Bacteria | 3151 |
| 1133 | Ga0495651_0017310 | 3300046462 | Bacteria | 5583 |
| 1134 | Ga0495653_0060532 | 3300046463 | Bacteria | 2868 |
| 1135 | Ga0495653_0073595 | 3300046463 | Bacteria | 2549 |
| 1136 | Ga0495653_0103440 | 3300046463 | Bacteria | 2059 |
| 1137 | Ga0495650_0000130 | 3300046471 | Bacteria | 175669 |
| 1138 | Ga0495650_0084504 | 3300046471 | Bacteria | 1218 |
| 1139 | Ga0495580_0016410 | 3300046472 | Bacteria | 5557 |
| 1140 | Ga0495580_0021278 | 3300046472 | Bacteria | 4786 |
| 1141 | Ga0495582_0000875 | 3300046473 | Bacteria | 16684 |
| 1142 | Ga0495582_0019590 | 3300046473 | Bacteria | 3701 |
| 1143 | Ga0495582_0050291 | 3300046473 | Bacteria | 2297 |
| 1144 | Ga0495639_0004796 | 3300046475 | Bacteria | 5815 |
| 1145 | Ga0495662_0000821 | 3300046476 | Bacteria | 15101 |
| 1146 | Ga0495662_0018450 | 3300046476 | Bacteria | 3377 |
| 1147 | Ga0495662_0076855 | 3300046476 | Bacteria | 1621 |
| 1148 | Ga0495664_0001916 | 3300046477 | Bacteria | 11072 |
| 1149 | Ga0495664_0004512 | 3300046477 | Bacteria | 7615 |
| 1150 | Ga0495594_0003942 | 3300046499 | Bacteria | 7636 |
| 1151 | Ga0495594_0003955 | 3300046499 | Bacteria | 7627 |
| 1152 | Ga0495608_0028759 | 3300046511 | Bacteria | 3777 |
| 1153 | Ga0495608_0044556 | 3300046511 | Bacteria | 2960 |
| 1154 | Ga0495618_0007805 | 3300046514 | Bacteria | 6477 |
| 1155 | Ga0495618_0073876 | 3300046514 | Bacteria | 2171 |
| 1156 | Ga0495630_0001272 | 3300046517 | Bacteria | 17379 |
| 1157 | Ga0495630_0009755 | 3300046517 | Bacteria | 6908 |
| 1158 | Ga0495630_0137601 | 3300046517 | Bacteria | 1856 |
| 1159 | Ga0495630_0196151 | 3300046517 | Bacteria | 1540 |
| 1160 | Ga0495643_0077189 | 3300046522 | Bacteria | 1741 |
| 1161 | Ga0495644_0013017 | 3300046523 | Bacteria | 3197 |
| 1162 | Ga0495648_0002340 | 3300046524 | Bacteria | 17589 |
| 1163 | Ga0495648_0014540 | 3300046524 | Bacteria | 5756 |
| 1164 | Ga0495663_0021342 | 3300046525 | Bacteria | 1865 |
| 1165 | Ga0495663_0045978 | 3300046525 | Bacteria | 1340 |
| 1166 | Ga0495666_0000235 | 3300046526 | Bacteria | 23700 |
| 1167 | Ga0495666_0041008 | 3300046526 | Bacteria | 2243 |
| 1168 | Ga0495642_0048447 | 3300046528 | Bacteria | 1743 |
| 1169 | Ga0495652_0013787 | 3300046529 | Bacteria | 7272 |
| 1170 | Ga0495654_0057629 | 3300046530 | Bacteria | 1876 |
| 1171 | Ga0495665_0000915 | 3300046531 | Bacteria | 15550 |
| 1172 | Ga0495665_0008383 | 3300046531 | Bacteria | 5607 |
| 1173 | Ga0495640_0001181 | 3300046533 | Bacteria | 20480 |
| 1174 | Ga0495640_0029616 | 3300046533 | Bacteria | 3928 |
| 1175 | Ga0495640_0076097 | 3300046533 | Bacteria | 2240 |
| 1176 | Ga0495586_0000409 | 3300046535 | Bacteria | 26099 |
| 1177 | Ga0495586_0011384 | 3300046535 | Bacteria | 4731 |
| 1178 | Ga0495587_0018456 | 3300046536 | Bacteria | 4326 |
| 1179 | Ga0495587_0036249 | 3300046536 | Bacteria | 2967 |
| 1180 | Ga0495598_0032263 | 3300046537 | Bacteria | 1479 |
| 1181 | Ga0495645_0063671 | 3300046543 | Bacteria | 2669 |
| 1182 | Ga0495667_0000837 | 3300046559 | Bacteria | 19854 |
| 1183 | Ga0495667_0006229 | 3300046559 | Bacteria | 8086 |
| 1184 | Ga0495667_0031962 | 3300046559 | Bacteria | 3529 |
| 1185 | Ga0495656_0071703 | 3300046615 | Bacteria | 1540 |
| 1186 | Ga0495668_0000505 | 3300046616 | Bacteria | 48713 |
| 1187 | Ga0495634_0003288 | 3300046642 | Bacteria | 13028 |
| 1188 | Ga0495634_0046259 | 3300046642 | Bacteria | 2938 |
| 1189 | Ga0495634_0051142 | 3300046642 | Bacteria | 2773 |
| 1190 | Ga0495611_0028770 | 3300046648 | Bacteria | 2435 |
| 1191 | Ga0495635_0000906 | 3300046663 | Bacteria | 19421 |
| 1192 | Ga0495635_0001201 | 3300046663 | Bacteria | 17274 |
| 1193 | Ga0495635_0006925 | 3300046663 | Bacteria | 7918 |
| 1194 | Ga0495635_0055240 | 3300046663 | Bacteria | 2735 |
| 1195 | Ga0495659_0008125 | 3300046664 | Bacteria | 3335 |
| 1196 | Ga0495661_0054323 | 3300046665 | Bacteria | 2405 |
| 1197 | Ga0495588_0000268 | 3300046674 | Bacteria | 40423 |
| 1198 | Ga0495588_0010400 | 3300046674 | Bacteria | 4328 |
| 1199 | Ga0495588_0011453 | 3300046674 | Bacteria | 4164 |
| 1200 | Ga0495588_0017198 | 3300046674 | Bacteria | 3506 |
| 1201 | Ga0495588_0027537 | 3300046674 | Bacteria | 2840 |
| 1202 | Ga0495588_0129165 | 3300046674 | Bacteria | 1333 |
| 1203 | Ga0495657_0013583 | 3300046675 | Bacteria | 6003 |
| 1204 | Ga0495657_0015029 | 3300046675 | Bacteria | 5677 |
| 1205 | Ga0495599_0007443 | 3300046678 | Bacteria | 6641 |
| 1206 | Ga0495623_0063776 | 3300046679 | Bacteria | 2306 |
| 1207 | Ga0495646_0037868 | 3300046680 | Bacteria | 2981 |
| 1208 | Ga0495647_0047038 | 3300046681 | Bacteria | 1664 |
| 1209 | Ga0495658_0000153 | 3300046683 | Bacteria | 38350 |
| 1210 | Ga0495658_0018789 | 3300046683 | Bacteria | 3600 |
| 1211 | Ga0495658_0049811 | 3300046683 | Bacteria | 2367 |
| 1212 | Ga0495658_0064346 | 3300046683 | Bacteria | 2113 |
| 1213 | Ga0495669_0047978 | 3300046684 | Bacteria | 1909 |
| 1214 | Ga0495613_0001237 | 3300046689 | Bacteria | 19529 |
| 1215 | Ga0495613_0038133 | 3300046689 | Bacteria | 3562 |
| 1216 | Ga0495613_0077661 | 3300046689 | Bacteria | 2415 |
| 1217 | Ga0495613_0230058 | 3300046689 | Bacteria | 1299 |
| 1218 | Ga0495624_0000364 | 3300046690 | Bacteria | 36044 |
| 1219 | Ga0495624_0002578 | 3300046690 | Bacteria | 13698 |
| 1220 | Ga0495670_0044085 | 3300046691 | Bacteria | 2227 |
| 1221 | Ga0495581_0000789 | 3300047315 | Bacteria | 16798 |
| 1222 | Ga0495581_0045150 | 3300047315 | Bacteria | 2547 |
| 1223 | Ga0495581_0053428 | 3300047315 | Bacteria | 2333 |
| 1224 | Ga0495581_0078280 | 3300047315 | Bacteria | 1913 |
| 1225 | Ga0495581_0079686 | 3300047315 | Bacteria | 1895 |
| 1226 | Ga0495604_0034564 | 3300047317 | Bacteria | 3998 |
| 1227 | Ga0495604_0088785 | 3300047317 | Bacteria | 2299 |
| 1228 | Ga0495604_0131629 | 3300047317 | Bacteria | 1797 |
| 1229 | Ga0495604_0178944 | 3300047317 | Bacteria | 1485 |
| 1230 | Ga0495636_0013480 | 3300047318 | Bacteria | 3245 |
| 1231 | Ga0495674_0000640 | 3300047319 | Bacteria | 32750 |
| 1232 | Ga0495674_0009189 | 3300047319 | Bacteria | 9392 |
| 1233 | Ga0495674_0034201 | 3300047319 | Bacteria | 4597 |
| 1234 | Ga0495674_0043532 | 3300047319 | Bacteria | 3996 |
| 1235 | Ga0495672_0002784 | 3300047320 | Bacteria | 15622 |
| 1236 | Ga0495672_0011138 | 3300047320 | Bacteria | 6362 |
| 1237 | Ga0495672_0086173 | 3300047320 | Bacteria | 1738 |
| 1238 | Ga0495676_0015473 | 3300047321 | Bacteria | 6791 |
| 1239 | Ga0495676_0019442 | 3300047321 | Bacteria | 5973 |
| 1240 | Ga0495676_0019639 | 3300047321 | Bacteria | 5941 |
| 1241 | Ga0495676_0098413 | 3300047321 | Bacteria | 2170 |
| 1242 | Ga0495680_0004541 | 3300047322 | Bacteria | 13263 |
| 1243 | Ga0495680_0012084 | 3300047322 | Bacteria | 7617 |
| 1244 | Ga0495680_0110904 | 3300047322 | Bacteria | 2033 |
| 1245 | Ga0495683_0001180 | 3300047323 | Bacteria | 17826 |
| 1246 | Ga0495677_0042011 | 3300047445 | Bacteria | 1674 |
| 1247 | Ga0495673_0045644 | 3300047469 | Bacteria | 1946 |
| 1248 | Ga0495684_0008105 | 3300047471 | Bacteria | 8121 |
| 1249 | Ga0495684_0034970 | 3300047471 | Bacteria | 3854 |
| 1250 | Ga0495684_0049619 | 3300047471 | Bacteria | 3206 |
| 1251 | Ga0495686_0008844 | 3300047472 | Bacteria | 7332 |
| 1252 | Ga0495686_0058772 | 3300047472 | Bacteria | 2396 |
| 1253 | Ga0495593_0003161 | 3300047673 | Bacteria | 9884 |
| 1254 | Ga0495593_0109889 | 3300047673 | Bacteria | 1408 |
| 1255 | Ga0495602_0054850 | 3300048088 | Bacteria | 3515 |
| 1256 | Ga0495602_0131483 | 3300048088 | Bacteria | 1995 |
| 1257 | Ga0495614_0000110 | 3300048089 | Bacteria | 27971 |
| 1258 | Ga0495614_0000222 | 3300048089 | Bacteria | 22134 |
| 1259 | Ga0495615_0018625 | 3300048090 | Bacteria | 1531 |
| 1260 | Ga0496100_0000097 | 3300048903 | Bacteria | 50092 |
| 1261 | Ga0496100_0001715 | 3300048903 | Bacteria | 10911 |
| 1262 | Ga0496100_0002885 | 3300048903 | Bacteria | 8817 |
| 1263 | Ga0496100_0007957 | 3300048903 | Bacteria | 5888 |
| 1264 | Ga0496100_0021361 | 3300048903 | Bacteria | 3896 |
| 1265 | Ga0496100_0182178 | 3300048903 | Bacteria | 1519 |
| 1266 | Ga0496101_0000032 | 3300048904 | Bacteria | 186783 |
| 1267 | Ga0496101_0000178 | 3300048904 | Bacteria | 50994 |
| 1268 | Ga0496101_0002214 | 3300048904 | Bacteria | 11871 |
| 1269 | Ga0496101_0002271 | 3300048904 | Bacteria | 11737 |
| 1270 | Ga0496101_0015250 | 3300048904 | Bacteria | 5173 |
| 1271 | Ga0496101_0016940 | 3300048904 | Bacteria | 4933 |
| 1272 | Ga0496101_0019798 | 3300048904 | Bacteria | 4601 |
| 1273 | Ga0496101_0022334 | 3300048904 | Bacteria | 4354 |
| 1274 | Ga0496101_0033514 | 3300048904 | Bacteria | 3623 |
| 1275 | Ga0496101_0071443 | 3300048904 | Bacteria | 2544 |
| 1276 | Ga0496101_0127472 | 3300048904 | Bacteria | 1930 |
| 1277 | Ga0496102_0000011 | 3300048905 | Bacteria | 321716 |
| 1278 | Ga0496102_0000235 | 3300048905 | Bacteria | 72616 |
| 1279 | Ga0496102_0000236 | 3300048905 | Bacteria | 72601 |
| 1280 | Ga0496102_0002707 | 3300048905 | Bacteria | 15075 |
| 1281 | Ga0496102_0004544 | 3300048905 | Bacteria | 11734 |
| 1282 | Ga0496102_0007433 | 3300048905 | Bacteria | 9359 |
| 1283 | Ga0496102_0024381 | 3300048905 | Bacteria | 5378 |
| 1284 | Ga0496102_0028244 | 3300048905 | Bacteria | 5009 |
| 1285 | Ga0496102_0042950 | 3300048905 | Bacteria | 4097 |
| 1286 | Ga0496102_0057352 | 3300048905 | Bacteria | 3556 |
| 1287 | Ga0496102_0067913 | 3300048905 | Bacteria | 3270 |
| 1288 | Ga0496102_0071661 | 3300048905 | Bacteria | 3182 |
| 1289 | Ga0496102_0077190 | 3300048905 | Bacteria | 3065 |
| 1290 | Ga0496102_0079158 | 3300048905 | Bacteria | 3026 |
| 1291 | Ga0496102_0107025 | 3300048905 | Bacteria | 2603 |
| 1292 | Ga0496102_0129236 | 3300048905 | Bacteria | 2363 |
| 1293 | Ga0496102_0131604 | 3300048905 | Bacteria | 2342 |
| 1294 | Ga0496102_0268364 | 3300048905 | Bacteria | 1609 |
| 1295 | Ga0496102_0300459 | 3300048905 | Bacteria | 1513 |
| 1296 | Ga0496102_0346132 | 3300048905 | Bacteria | 1399 |
| 1297 | Ga0496103_0000032 | 3300048906 | Bacteria | 201453 |
| 1298 | Ga0496103_0000185 | 3300048906 | Bacteria | 62838 |
| 1299 | Ga0496103_0000460 | 3300048906 | Bacteria | 34689 |
| 1300 | Ga0496103_0000624 | 3300048906 | Bacteria | 27194 |
| 1301 | Ga0496103_0001651 | 3300048906 | Bacteria | 14614 |
| 1302 | Ga0496103_0007239 | 3300048906 | Bacteria | 6614 |
| 1303 | Ga0496103_0008384 | 3300048906 | Bacteria | 6141 |
| 1304 | Ga0496103_0071566 | 3300048906 | Bacteria | 2170 |
| 1305 | Ga0496103_0071855 | 3300048906 | Bacteria | 2166 |
| 1306 | Ga0496103_0102378 | 3300048906 | Bacteria | 1813 |
| 1307 | Ga0496103_0146301 | 3300048906 | Bacteria | 1512 |
| 1308 | Ga0496103_0158986 | 3300048906 | Bacteria | 1449 |
| 1309 | Ga0496104_0003431 | 3300048907 | Bacteria | 13673 |
| 1310 | Ga0496104_0004891 | 3300048907 | Bacteria | 11682 |
| 1311 | Ga0496104_0031350 | 3300048907 | Bacteria | 4943 |
| 1312 | Ga0496104_0068187 | 3300048907 | Bacteria | 3380 |
| 1313 | Ga0496104_0072889 | 3300048907 | Bacteria | 3266 |
| 1314 | Ga0496104_0075539 | 3300048907 | Bacteria | 3209 |
| 1315 | Ga0496104_0089024 | 3300048907 | Bacteria | 2949 |
| 1316 | Ga0496104_0092303 | 3300048907 | Bacteria | 2895 |
| 1317 | Ga0496104_0135208 | 3300048907 | Bacteria | 2368 |
| 1318 | Ga0496104_0140953 | 3300048907 | Bacteria | 2316 |
| 1319 | Ga0496104_0170360 | 3300048907 | Bacteria | 2088 |
| 1320 | Ga0496104_0434350 | 3300048907 | Bacteria | 1225 |
| 1321 | Ga0496105_0004208 | 3300048908 | Bacteria | 10809 |
| 1322 | Ga0496105_0004455 | 3300048908 | Bacteria | 10546 |
| 1323 | Ga0496105_0009001 | 3300048908 | Bacteria | 7788 |
| 1324 | Ga0496105_0014439 | 3300048908 | Bacteria | 6287 |
| 1325 | Ga0496105_0018442 | 3300048908 | Bacteria | 5609 |
| 1326 | Ga0496105_0020815 | 3300048908 | Bacteria | 5304 |
| 1327 | Ga0496105_0036703 | 3300048908 | Bacteria | 4038 |
| 1328 | Ga0496105_0105827 | 3300048908 | Bacteria | 2322 |
| 1329 | Ga0496105_0157242 | 3300048908 | Bacteria | 1866 |
| 1330 | Ga0496105_0227897 | 3300048908 | Bacteria | 1515 |
| 1331 | Ga0496105_0233856 | 3300048908 | Bacteria | 1493 |
| 1332 | Ga0496106_0000417 | 3300048909 | Bacteria | 30205 |
| 1333 | Ga0496106_0000768 | 3300048909 | Bacteria | 23207 |
| 1334 | Ga0496106_0039704 | 3300048909 | Bacteria | 3525 |
| 1335 | Ga0496106_0054231 | 3300048909 | Bacteria | 3029 |
| 1336 | Ga0496106_0072794 | 3300048909 | Bacteria | 2628 |
| 1337 | Ga0496106_0077479 | 3300048909 | Bacteria | 2549 |
| 1338 | Ga0496106_0115837 | 3300048909 | Bacteria | 2090 |
| 1339 | Ga0496106_0120446 | 3300048909 | Bacteria | 2051 |
| 1340 | Ga0496106_0160339 | 3300048909 | Bacteria | 1779 |
| 1341 | Ga0496106_0202541 | 3300048909 | Bacteria | 1580 |
| 1342 | Ga0496106_0305993 | 3300048909 | Bacteria | 1275 |
| 1343 | Ga0496107_0001611 | 3300048910 | Bacteria | 14062 |
| 1344 | Ga0496107_0002827 | 3300048910 | Bacteria | 11456 |
| 1345 | Ga0496107_0022212 | 3300048910 | Bacteria | 4483 |
| 1346 | Ga0496107_0027443 | 3300048910 | Bacteria | 4043 |
| 1347 | Ga0496107_0030297 | 3300048910 | Bacteria | 3856 |
| 1348 | Ga0496107_0114477 | 3300048910 | Bacteria | 1984 |
| 1349 | Ga0496108_0001698 | 3300048911 | Bacteria | 17460 |
| 1350 | Ga0496108_0015334 | 3300048911 | Bacteria | 6252 |
| 1351 | Ga0496108_0020224 | 3300048911 | Bacteria | 5470 |
| 1352 | Ga0496108_0026361 | 3300048911 | Bacteria | 4794 |
| 1353 | Ga0496108_0039938 | 3300048911 | Bacteria | 3911 |
| 1354 | Ga0496108_0043103 | 3300048911 | Bacteria | 3769 |
| 1355 | Ga0496108_0064850 | 3300048911 | Bacteria | 3078 |
| 1356 | Ga0496108_0075778 | 3300048911 | Bacteria | 2843 |
| 1357 | Ga0496108_0088604 | 3300048911 | Bacteria | 2630 |
| 1358 | Ga0496108_0113673 | 3300048911 | Bacteria | 2317 |
| 1359 | Ga0496108_0313142 | 3300048911 | Bacteria | 1368 |
| 1360 | Ga0496108_0362172 | 3300048911 | Bacteria | 1266 |
| 1361 | Ga0496109_0000305 | 3300048912 | Bacteria | 46298 |
| 1362 | Ga0496109_0005372 | 3300048912 | Bacteria | 10708 |
| 1363 | Ga0496109_0011265 | 3300048912 | Bacteria | 7680 |
| 1364 | Ga0496109_0013718 | 3300048912 | Bacteria | 7039 |
| 1365 | Ga0496109_0014775 | 3300048912 | Bacteria | 6793 |
| 1366 | Ga0496109_0023643 | 3300048912 | Bacteria | 5455 |
| 1367 | Ga0496109_0041162 | 3300048912 | Bacteria | 4187 |
| 1368 | Ga0496109_0045826 | 3300048912 | Bacteria | 3970 |
| 1369 | Ga0496109_0071036 | 3300048912 | Bacteria | 3195 |
| 1370 | Ga0496109_0091869 | 3300048912 | Bacteria | 2807 |
| 1371 | Ga0496109_0221244 | 3300048912 | Bacteria | 1780 |
| 1372 | Ga0496109_0226132 | 3300048912 | Bacteria | 1760 |
| 1373 | Ga0496110_0002915 | 3300048913 | Bacteria | 12950 |
| 1374 | Ga0496110_0006568 | 3300048913 | Bacteria | 9234 |
| 1375 | Ga0496110_0023163 | 3300048913 | Bacteria | 5281 |
| 1376 | Ga0496110_0023479 | 3300048913 | Bacteria | 5246 |
| 1377 | Ga0496110_0049961 | 3300048913 | Bacteria | 3671 |
| 1378 | Ga0496110_0068720 | 3300048913 | Bacteria | 3136 |
| 1379 | Ga0496110_0112705 | 3300048913 | Bacteria | 2445 |
| 1380 | Ga0496110_0112870 | 3300048913 | Bacteria | 2443 |
| 1381 | Ga0496110_0113775 | 3300048913 | Bacteria | 2434 |
| 1382 | Ga0496110_0134866 | 3300048913 | Bacteria | 2230 |
| 1383 | Ga0496110_0185899 | 3300048913 | Bacteria | 1887 |
| 1384 | Ga0496111_0005153 | 3300048914 | Bacteria | 8333 |
| 1385 | Ga0496111_0016859 | 3300048914 | Bacteria | 5041 |
| 1386 | Ga0496111_0047481 | 3300048914 | Bacteria | 3092 |
| 1387 | Ga0496111_0063129 | 3300048914 | Bacteria | 2686 |
| 1388 | Ga0496111_0090424 | 3300048914 | Bacteria | 2242 |
| 1389 | Ga0496111_0160860 | 3300048914 | Bacteria | 1667 |
| 1390 | Ga0496111_0186655 | 3300048914 | Bacteria | 1541 |
| 1391 | Ga0496112_0013235 | 3300048915 | Bacteria | 7612 |
| 1392 | Ga0496112_0038767 | 3300048915 | Bacteria | 4655 |
| 1393 | Ga0496112_0063842 | 3300048915 | Bacteria | 3633 |
| 1394 | Ga0496112_0070088 | 3300048915 | Bacteria | 3464 |
| 1395 | Ga0496112_0099862 | 3300048915 | Bacteria | 2872 |
| 1396 | Ga0496112_0113579 | 3300048915 | Bacteria | 2679 |
| 1397 | Ga0496112_0320244 | 3300048915 | Bacteria | 1495 |
| 1398 | Ga0496113_0004384 | 3300048916 | Bacteria | 8659 |
| 1399 | Ga0496113_0032886 | 3300048916 | Bacteria | 3771 |
| 1400 | Ga0496113_0048809 | 3300048916 | Bacteria | 3150 |
| 1401 | Ga0496113_0117004 | 3300048916 | Bacteria | 2080 |
| 1402 | Ga0496113_0145554 | 3300048916 | Bacteria | 1866 |
| 1403 | Ga0496113_0160149 | 3300048916 | Bacteria | 1779 |
| 1404 | Ga0496113_0161097 | 3300048916 | Bacteria | 1774 |
| 1405 | Ga0496113_0176928 | 3300048916 | Bacteria | 1691 |
| 1406 | Ga0496113_0242173 | 3300048916 | Bacteria | 1439 |
| 1407 | Ga0496113_0293049 | 3300048916 | Bacteria | 1302 |
| 1408 | Ga0496114_0000856 | 3300048917 | Bacteria | 22807 |
| 1409 | Ga0496114_0002897 | 3300048917 | Bacteria | 13141 |
| 1410 | Ga0496114_0003794 | 3300048917 | Bacteria | 11647 |
| 1411 | Ga0496114_0004945 | 3300048917 | Bacteria | 10389 |
| 1412 | Ga0496114_0005170 | 3300048917 | Bacteria | 10183 |
| 1413 | Ga0496114_0008988 | 3300048917 | Bacteria | 7922 |
| 1414 | Ga0496114_0010173 | 3300048917 | Bacteria | 7483 |
| 1415 | Ga0496114_0010762 | 3300048917 | Bacteria | 7282 |
| 1416 | Ga0496114_0024643 | 3300048917 | Bacteria | 4911 |
| 1417 | Ga0496114_0026758 | 3300048917 | Bacteria | 4724 |
| 1418 | Ga0496114_0159077 | 3300048917 | Bacteria | 1963 |
| 1419 | Ga0496114_0207769 | 3300048917 | Bacteria | 1716 |
| 1420 | Ga0496114_0266356 | 3300048917 | Bacteria | 1509 |
| 1421 | Ga0496114_0296868 | 3300048917 | Bacteria | 1426 |
| 1422 | Ga0496115_0008488 | 3300048918 | Bacteria | 7599 |
| 1423 | Ga0496115_0011413 | 3300048918 | Bacteria | 6660 |
| 1424 | Ga0496115_0012370 | 3300048918 | Bacteria | 6419 |
| 1425 | Ga0496115_0014232 | 3300048918 | Bacteria | 6020 |
| 1426 | Ga0496115_0024138 | 3300048918 | Bacteria | 4724 |
| 1427 | Ga0496115_0025689 | 3300048918 | Bacteria | 4589 |
| 1428 | Ga0496115_0030427 | 3300048918 | Bacteria | 4247 |
| 1429 | Ga0496115_0107161 | 3300048918 | Bacteria | 2294 |
| 1430 | Ga0496115_0109880 | 3300048918 | Bacteria | 2264 |
| 1431 | Ga0496116_0000072 | 3300048919 | Bacteria | 238158 |
| 1432 | Ga0496116_0000192 | 3300048919 | Bacteria | 122270 |
| 1433 | Ga0496116_0000340 | 3300048919 | Bacteria | 74829 |
| 1434 | Ga0496116_0004507 | 3300048919 | Bacteria | 13256 |
| 1435 | Ga0496116_0006124 | 3300048919 | Bacteria | 11002 |
| 1436 | Ga0496116_0040697 | 3300048919 | Bacteria | 3197 |
| 1437 | Ga0496116_0044629 | 3300048919 | Bacteria | 3009 |
| 1438 | Ga0496116_0077370 | 3300048919 | Bacteria | 2079 |
| 1439 | Ga0496117_0000039 | 3300048920 | Bacteria | 322143 |
| 1440 | Ga0496117_0000273 | 3300048920 | Bacteria | 96400 |
| 1441 | Ga0496117_0000387 | 3300048920 | Bacteria | 75589 |
| 1442 | Ga0496117_0000603 | 3300048920 | Bacteria | 58910 |
| 1443 | Ga0496117_0001092 | 3300048920 | Bacteria | 41000 |
| 1444 | Ga0496117_0001118 | 3300048920 | Bacteria | 40433 |
| 1445 | Ga0496117_0003783 | 3300048920 | Bacteria | 17282 |
| 1446 | Ga0496117_0011201 | 3300048920 | Bacteria | 8052 |
| 1447 | Ga0496117_0026526 | 3300048920 | Bacteria | 4532 |
| 1448 | Ga0496117_0029438 | 3300048920 | Bacteria | 4233 |
| 1449 | Ga0496117_0082135 | 3300048920 | Bacteria | 2112 |
| 1450 | Ga0496117_0104653 | 3300048920 | Bacteria | 1780 |
| 1451 | Ga0496118_0000035 | 3300048921 | Bacteria | 322143 |
| 1452 | Ga0496118_0000096 | 3300048921 | Bacteria | 163988 |
| 1453 | Ga0496118_0000455 | 3300048921 | Bacteria | 67720 |
| 1454 | Ga0496118_0000610 | 3300048921 | Bacteria | 58893 |
| 1455 | Ga0496118_0005126 | 3300048921 | Bacteria | 15052 |
| 1456 | Ga0496118_0006081 | 3300048921 | Bacteria | 13430 |
| 1457 | Ga0496118_0012779 | 3300048921 | Bacteria | 8017 |
| 1458 | Ga0496118_0013007 | 3300048921 | Bacteria | 7918 |
| 1459 | Ga0496118_0042972 | 3300048921 | Bacteria | 3558 |
| 1460 | Ga0496118_0056178 | 3300048921 | Bacteria | 2962 |
| 1461 | Ga0496118_0089622 | 3300048921 | Bacteria | 2123 |
| 1462 | Ga0496119_0000035 | 3300048922 | Bacteria | 217007 |
| 1463 | Ga0496119_0000340 | 3300048922 | Bacteria | 65290 |
| 1464 | Ga0496119_0000437 | 3300048922 | Bacteria | 57106 |
| 1465 | Ga0496119_0000617 | 3300048922 | Bacteria | 48028 |
| 1466 | Ga0496119_0002053 | 3300048922 | Bacteria | 22784 |
| 1467 | Ga0496119_0006039 | 3300048922 | Bacteria | 11361 |
| 1468 | Ga0496119_0007359 | 3300048922 | Bacteria | 9945 |
| 1469 | Ga0496119_0009886 | 3300048922 | Bacteria | 8103 |
| 1470 | Ga0496119_0013009 | 3300048922 | Bacteria | 6683 |
| 1471 | Ga0496119_0014900 | 3300048922 | Bacteria | 6044 |
| 1472 | Ga0496119_0015958 | 3300048922 | Bacteria | 5746 |
| 1473 | Ga0496119_0032105 | 3300048922 | Bacteria | 3506 |
| 1474 | Ga0496119_0032848 | 3300048922 | Bacteria | 3453 |
| 1475 | Ga0496119_0037248 | 3300048922 | Bacteria | 3163 |
| 1476 | Ga0496119_0050977 | 3300048922 | Bacteria | 2547 |
| 1477 | Ga0496119_0085588 | 3300048922 | Bacteria | 1804 |
| 1478 | Ga0496120_0000079 | 3300048923 | Bacteria | 160413 |
| 1479 | Ga0496120_0000372 | 3300048923 | Bacteria | 72951 |
| 1480 | Ga0496120_0001715 | 3300048923 | Bacteria | 25001 |
| 1481 | Ga0496120_0002620 | 3300048923 | Bacteria | 17825 |
| 1482 | Ga0496120_0008527 | 3300048923 | Bacteria | 7426 |
| 1483 | Ga0496120_0011616 | 3300048923 | Bacteria | 6043 |
| 1484 | Ga0496120_0019430 | 3300048923 | Bacteria | 4346 |
| 1485 | Ga0496120_0095399 | 3300048923 | Bacteria | 1581 |
| 1486 | Ga0496121_0000004 | 3300048924 | Bacteria | 1139011 |
| 1487 | Ga0496121_0000015 | 3300048924 | Bacteria | 571958 |
| 1488 | Ga0496121_0000546 | 3300048924 | Bacteria | 71177 |
| 1489 | Ga0496121_0002237 | 3300048924 | Bacteria | 30165 |
| 1490 | Ga0496121_0004937 | 3300048924 | Bacteria | 17498 |
| 1491 | Ga0496121_0013057 | 3300048924 | Bacteria | 8969 |
| 1492 | Ga0496121_0022488 | 3300048924 | Bacteria | 6118 |
| 1493 | Ga0496121_0037750 | 3300048924 | Bacteria | 4286 |
| 1494 | Ga0496121_0066703 | 3300048924 | Bacteria | 2920 |
| 1495 | Ga0496122_0000020 | 3300048925 | Bacteria | 401675 |
| 1496 | Ga0496122_0000795 | 3300048925 | Bacteria | 60495 |
| 1497 | Ga0496122_0001425 | 3300048925 | Bacteria | 38734 |
| 1498 | Ga0496122_0004303 | 3300048925 | Bacteria | 17836 |
| 1499 | Ga0496122_0015517 | 3300048925 | Bacteria | 7275 |
| 1500 | Ga0496122_0016794 | 3300048925 | Bacteria | 6895 |
| 1501 | Ga0496122_0017673 | 3300048925 | Bacteria | 6649 |
| 1502 | Ga0496122_0028074 | 3300048925 | Bacteria | 4789 |
| 1503 | Ga0496122_0045039 | 3300048925 | Bacteria | 3433 |
| 1504 | Ga0496122_0105451 | 3300048925 | Bacteria | 1869 |
| 1505 | Ga0496122_0143312 | 3300048925 | Bacteria | 1490 |
| 1506 | Ga0496123_0000003 | 3300048926 | Bacteria | 866556 |
| 1507 | Ga0496123_0000951 | 3300048926 | Bacteria | 45055 |
| 1508 | Ga0496123_0007387 | 3300048926 | Bacteria | 10379 |
| 1509 | Ga0496123_0011837 | 3300048926 | Bacteria | 7506 |
| 1510 | Ga0496123_0015631 | 3300048926 | Bacteria | 6212 |
| 1511 | Ga0496123_0022138 | 3300048926 | Bacteria | 4909 |
| 1512 | Ga0496123_0025167 | 3300048926 | Bacteria | 4496 |
| 1513 | Ga0496124_0000012 | 3300048927 | Bacteria | 512581 |
| 1514 | Ga0496124_0000135 | 3300048927 | Bacteria | 152458 |
| 1515 | Ga0496124_0002749 | 3300048927 | Bacteria | 22432 |
| 1516 | Ga0496124_0008894 | 3300048927 | Bacteria | 10415 |
| 1517 | Ga0496124_0009299 | 3300048927 | Bacteria | 10131 |
| 1518 | Ga0496124_0035580 | 3300048927 | Bacteria | 4355 |
| 1519 | Ga0496124_0043473 | 3300048927 | Bacteria | 3862 |
| 1520 | Ga0496124_0090835 | 3300048927 | Bacteria | 2489 |
| 1521 | Ga0496124_0107082 | 3300048927 | Bacteria | 2256 |
| 1522 | Ga0496124_0144633 | 3300048927 | Bacteria | 1872 |
| 1523 | Ga0496125_0000003 | 3300048928 | Bacteria | 1189767 |
| 1524 | Ga0496125_0000128 | 3300048928 | Bacteria | 163865 |
| 1525 | Ga0496125_0000209 | 3300048928 | Bacteria | 122267 |
| 1526 | Ga0496125_0000859 | 3300048928 | Bacteria | 48719 |
| 1527 | Ga0496125_0002332 | 3300048928 | Bacteria | 24952 |
| 1528 | Ga0496125_0002425 | 3300048928 | Bacteria | 24246 |
| 1529 | Ga0496125_0016465 | 3300048928 | Bacteria | 7097 |
| 1530 | Ga0496125_0024752 | 3300048928 | Bacteria | 5513 |
| 1531 | Ga0496125_0034370 | 3300048928 | Bacteria | 4469 |
| 1532 | Ga0496125_0055163 | 3300048928 | Bacteria | 3240 |
| 1533 | Ga0496125_0058704 | 3300048928 | Bacteria | 3106 |
| 1534 | Ga0496125_0061796 | 3300048928 | Bacteria | 3001 |
| 1535 | Ga0496125_0103900 | 3300048928 | Bacteria | 2083 |
| 1536 | Ga0496126_0000001 | 3300048929 | Bacteria | 1139011 |
| 1537 | Ga0496126_0000123 | 3300048929 | Bacteria | 182726 |
| 1538 | Ga0496126_0000246 | 3300048929 | Bacteria | 116854 |
| 1539 | Ga0496126_0000547 | 3300048929 | Bacteria | 72557 |
| 1540 | Ga0496126_0004322 | 3300048929 | Bacteria | 17045 |
| 1541 | Ga0496126_0005415 | 3300048929 | Bacteria | 14563 |
| 1542 | Ga0496126_0005422 | 3300048929 | Bacteria | 14550 |
| 1543 | Ga0496126_0006761 | 3300048929 | Bacteria | 12730 |
| 1544 | Ga0496126_0009000 | 3300048929 | Bacteria | 10683 |
| 1545 | Ga0496126_0033062 | 3300048929 | Bacteria | 4867 |
| 1546 | Ga0496126_0033726 | 3300048929 | Bacteria | 4815 |
| 1547 | Ga0496126_0035255 | 3300048929 | Bacteria | 4691 |
| 1548 | Ga0496126_0035799 | 3300048929 | Bacteria | 4647 |
| 1549 | Ga0496126_0058035 | 3300048929 | Bacteria | 3490 |
| 1550 | Ga0496126_0061064 | 3300048929 | Bacteria | 3387 |
| 1551 | Ga0496126_0068695 | 3300048929 | Bacteria | 3163 |
| 1552 | Ga0496126_0084657 | 3300048929 | Bacteria | 2796 |
| 1553 | Ga0496126_0088878 | 3300048929 | Bacteria | 2720 |
| 1554 | Ga0496126_0090950 | 3300048929 | Bacteria | 2684 |
| 1555 | Ga0496126_0098562 | 3300048929 | Bacteria | 2560 |
| 1556 | Ga0496126_0121614 | 3300048929 | Bacteria | 2263 |
| 1557 | Ga0496126_0246344 | 3300048929 | Bacteria | 1491 |
| 1558 | Ga0501309_003333 | 3300049129 | Bacteria | 1814 |
| 1559 | Ga0501305_008308 | 3300049161 | Bacteria | 1340 |
| 1560 | Ga0501307_005589 | 3300049162 | Bacteria | 1330 |
| 1561 | Ga0501311_006846 | 3300049527 | Bacteria | 1297 |
| 1562 | Ga0501312_001617 | 3300049528 | Bacteria | 2258 |
| 1563 | Ga0501313_005060 | 3300049529 | Bacteria | 1379 |
| 1564 | Ga0501315_005844 | 3300049531 | Bacteria | 1348 |
| 1565 | Ga0501315_006619 | 3300049531 | Bacteria | 1295 |
| 1566 | Ga0501316_000498 | 3300049532 | Bacteria | 2738 |
| 1567 | Ga0501318_005390 | 3300049534 | Bacteria | 1267 |
| 1568 | Ga0501321_003486 | 3300049537 | Bacteria | 1443 |
| 1569 | Ga0501321_004061 | 3300049537 | Bacteria | 1379 |
| 1570 | Ga0501323_004697 | 3300049539 | Bacteria | 1458 |
| 1571 | Ga0501324_002466 | 3300049540 | Bacteria | 1340 |
| 1572 | Ga0501325_001168 | 3300049541 | Bacteria | 1547 |
| 1573 | Ga0501335_000889 | 3300049551 | Bacteria | 2129 |
| 1574 | Ga0501031_0000870 | 3300049568 | Bacteria | 18185 |
| 1575 | Ga0501031_0007030 | 3300049568 | Bacteria | 7346 |
| 1576 | Ga0501031_0010393 | 3300049568 | Bacteria | 6062 |
| 1577 | Ga0501031_0012245 | 3300049568 | Archaea | 5591 |
| 1578 | Ga0501031_0045672 | 3300049568 | Bacteria | 2858 |
| 1579 | Ga0501031_0089772 | 3300049568 | Bacteria | 2004 |
| 1580 | Ga0501031_0090382 | 3300049568 | Bacteria | 1997 |
| 1581 | Ga0501032_0001154 | 3300049569 | Bacteria | 21164 |
| 1582 | Ga0501032_0001277 | 3300049569 | Bacteria | 20179 |
| 1583 | Ga0501032_0002711 | 3300049569 | Bacteria | 13809 |
| 1584 | Ga0501032_0008178 | 3300049569 | Bacteria | 7627 |
| 1585 | Ga0501032_0033588 | 3300049569 | Bacteria | 3514 |
| 1586 | Ga0501032_0071221 | 3300049569 | Bacteria | 2317 |
| 1587 | Ga0501032_0102712 | 3300049569 | Bacteria | 1894 |
| 1588 | Ga0501033_0003100 | 3300049570 | Bacteria | 13804 |
| 1589 | Ga0501033_0007412 | 3300049570 | Bacteria | 8544 |
| 1590 | Ga0501033_0044237 | 3300049570 | Bacteria | 3315 |
| 1591 | Ga0501033_0060294 | 3300049570 | Bacteria | 2800 |
| 1592 | Ga0501033_0060590 | 3300049570 | Bacteria | 2791 |
| 1593 | Ga0501033_0070028 | 3300049570 | Archaea | 2577 |
| 1594 | Ga0501034_0000112 | 3300049571 | Bacteria | 150146 |
| 1595 | Ga0501034_0000672 | 3300049571 | Bacteria | 51948 |
| 1596 | Ga0501034_0008588 | 3300049571 | Bacteria | 10780 |
| 1597 | Ga0501034_0013440 | 3300049571 | Bacteria | 8425 |
| 1598 | Ga0501034_0017156 | 3300049571 | Bacteria | 7429 |
| 1599 | Ga0501034_0023234 | 3300049571 | Bacteria | 6318 |
| 1600 | Ga0501034_0025497 | 3300049571 | Bacteria | 6020 |
| 1601 | Ga0501034_0034048 | 3300049571 | Bacteria | 5165 |
| 1602 | Ga0501034_0046877 | 3300049571 | Bacteria | 4366 |
| 1603 | Ga0501034_0076870 | 3300049571 | Bacteria | 3345 |
| 1604 | Ga0501034_0114513 | 3300049571 | Bacteria | 2685 |
| 1605 | Ga0501034_0142301 | 3300049571 | Bacteria | 2377 |
| 1606 | Ga0501036_0002900 | 3300049572 | Bacteria | 13613 |
| 1607 | Ga0501036_0004295 | 3300049572 | Archaea | 11515 |
| 1608 | Ga0501036_0013420 | 3300049572 | Bacteria | 6808 |
| 1609 | Ga0501036_0016775 | 3300049572 | Bacteria | 6118 |
| 1610 | Ga0501036_0325757 | 3300049572 | Bacteria | 1283 |
| 1611 | Ga0501037_0000110 | 3300049573 | Bacteria | 77484 |
| 1612 | Ga0501037_0004426 | 3300049573 | Bacteria | 10203 |
| 1613 | Ga0501037_0006221 | 3300049573 | Archaea | 8730 |
| 1614 | Ga0501037_0010166 | 3300049573 | Bacteria | 6904 |
| 1615 | Ga0501037_0012462 | 3300049573 | Bacteria | 6263 |
| 1616 | Ga0501037_0056202 | 3300049573 | Bacteria | 2875 |
| 1617 | Ga0501037_0082702 | 3300049573 | Bacteria | 2326 |
| 1618 | Ga0501037_0176832 | 3300049573 | Bacteria | 1515 |
| 1619 | Ga0501038_0003260 | 3300049574 | Bacteria | 15140 |
| 1620 | Ga0501038_0010528 | 3300049574 | Bacteria | 8459 |
| 1621 | Ga0501038_0014550 | 3300049574 | Bacteria | 7170 |
| 1622 | Ga0501038_0024701 | 3300049574 | Bacteria | 5358 |
| 1623 | Ga0501038_0032164 | 3300049574 | Bacteria | 4630 |
| 1624 | Ga0501038_0051802 | 3300049574 | Bacteria | 3540 |
| 1625 | Ga0501038_0190298 | 3300049574 | Bacteria | 1651 |
| 1626 | Ga0501039_0000736 | 3300049575 | Bacteria | 23619 |
| 1627 | Ga0501039_0000850 | 3300049575 | Bacteria | 22060 |
| 1628 | Ga0501039_0001189 | 3300049575 | Archaea | 19065 |
| 1629 | Ga0501039_0009621 | 3300049575 | Bacteria | 7368 |
| 1630 | Ga0501039_0016611 | 3300049575 | Bacteria | 5638 |
| 1631 | Ga0501039_0026165 | 3300049575 | Bacteria | 4484 |
| 1632 | Ga0501039_0047333 | 3300049575 | Bacteria | 3324 |
| 1633 | Ga0501039_0053386 | 3300049575 | Bacteria | 3127 |
| 1634 | Ga0501040_0000341 | 3300049576 | Archaea | 27311 |
| 1635 | Ga0501040_0000580 | 3300049576 | Bacteria | 22270 |
| 1636 | Ga0501040_0003562 | 3300049576 | Bacteria | 10068 |
| 1637 | Ga0501040_0006598 | 3300049576 | Bacteria | 7532 |
| 1638 | Ga0501041_0000246 | 3300049577 | Bacteria | 25337 |
| 1639 | Ga0501041_0009959 | 3300049577 | Archaea | 5600 |
| 1640 | Ga0501041_0030224 | 3300049577 | Bacteria | 3270 |
| 1641 | Ga0501041_0071012 | 3300049577 | Bacteria | 2138 |
| 1642 | Ga0501041_0087092 | 3300049577 | Bacteria | 1927 |
| 1643 | Ga0501042_0000686 | 3300049578 | Bacteria | 18336 |
| 1644 | Ga0501042_0005870 | 3300049578 | Bacteria | 7935 |
| 1645 | Ga0501042_0006117 | 3300049578 | Archaea | 7799 |
| 1646 | Ga0501042_0015173 | 3300049578 | Bacteria | 5270 |
| 1647 | Ga0501042_0021443 | 3300049578 | Bacteria | 4503 |
| 1648 | Ga0501042_0092887 | 3300049578 | Bacteria | 2166 |
| 1649 | Ga0501043_0001848 | 3300049579 | Bacteria | 18132 |
| 1650 | Ga0501043_0013658 | 3300049579 | Archaea | 6356 |
| 1651 | Ga0501043_0017486 | 3300049579 | Bacteria | 5621 |
| 1652 | Ga0501043_0028591 | 3300049579 | Bacteria | 4377 |
| 1653 | Ga0501043_0071980 | 3300049579 | Bacteria | 2715 |
| 1654 | Ga0501043_0112879 | 3300049579 | Bacteria | 2134 |
| 1655 | Ga0501043_0156350 | 3300049579 | Bacteria | 1783 |
| 1656 | Ga0501043_0192190 | 3300049579 | Bacteria | 1587 |
| 1657 | Ga0501043_0218664 | 3300049579 | Bacteria | 1474 |
| 1658 | Ga0501046_0002303 | 3300049580 | Archaea | 17997 |
| 1659 | Ga0501046_0003132 | 3300049580 | Bacteria | 15274 |
| 1660 | Ga0501046_0006458 | 3300049580 | Bacteria | 10372 |
| 1661 | Ga0501046_0016573 | 3300049580 | Bacteria | 6165 |
| 1662 | Ga0501046_0068395 | 3300049580 | Bacteria | 2764 |
| 1663 | Ga0501047_0000033 | 3300049581 | Bacteria | 206961 |
| 1664 | Ga0501047_0000405 | 3300049581 | Bacteria | 48286 |
| 1665 | Ga0501047_0001186 | 3300049581 | Bacteria | 25810 |
| 1666 | Ga0501047_0004112 | 3300049581 | Bacteria | 13691 |
| 1667 | Ga0501047_0011253 | 3300049581 | Bacteria | 8468 |
| 1668 | Ga0501047_0030469 | 3300049581 | Bacteria | 5201 |
| 1669 | Ga0501047_0038344 | 3300049581 | Bacteria | 4637 |
| 1670 | Ga0501047_0058872 | 3300049581 | Bacteria | 3710 |
| 1671 | Ga0501047_0077238 | 3300049581 | Bacteria | 3204 |
| 1672 | Ga0501047_0229502 | 3300049581 | Bacteria | 1710 |
| 1673 | Ga0501047_0274480 | 3300049581 | Bacteria | 1531 |
| 1674 | Ga0501048_0000216 | 3300049582 | Bacteria | 37819 |
| 1675 | Ga0501048_0001561 | 3300049582 | Bacteria | 17399 |
| 1676 | Ga0501048_0004301 | 3300049582 | Bacteria | 10858 |
| 1677 | Ga0501048_0006150 | 3300049582 | Bacteria | 9138 |
| 1678 | Ga0501048_0006447 | 3300049582 | Archaea | 8920 |
| 1679 | Ga0501048_0016662 | 3300049582 | Bacteria | 5418 |
| 1680 | Ga0501067_0000725 | 3300049583 | Bacteria | 17733 |
| 1681 | Ga0501067_0078387 | 3300049583 | Bacteria | 1831 |
| 1682 | Ga0501068_0081071 | 3300049584 | Bacteria | 1992 |
| 1683 | Ga0501069_0028354 | 3300049585 | Bacteria | 3069 |
| 1684 | Ga0501069_0062124 | 3300049585 | Bacteria | 2086 |
| 1685 | Ga0501069_0080869 | 3300049585 | Bacteria | 1830 |
| 1686 | Ga0501069_0099180 | 3300049585 | Bacteria | 1653 |
| 1687 | Ga0501070_0000165 | 3300049586 | Bacteria | 60736 |
| 1688 | Ga0501070_0000181 | 3300049586 | Bacteria | 59005 |
| 1689 | Ga0501070_0002694 | 3300049586 | Bacteria | 15506 |
| 1690 | Ga0501070_0004105 | 3300049586 | Bacteria | 12522 |
| 1691 | Ga0501070_0005678 | 3300049586 | Bacteria | 10639 |
| 1692 | Ga0501070_0010602 | 3300049586 | Bacteria | 7789 |
| 1693 | Ga0501070_0015185 | 3300049586 | Bacteria | 6482 |
| 1694 | Ga0501070_0028759 | 3300049586 | Bacteria | 4660 |
| 1695 | Ga0501070_0033327 | 3300049586 | Bacteria | 4310 |
| 1696 | Ga0501070_0049412 | 3300049586 | Bacteria | 3493 |
| 1697 | Ga0501070_0066146 | 3300049586 | Bacteria | 2993 |
| 1698 | Ga0501070_0095561 | 3300049586 | Bacteria | 2459 |
| 1699 | Ga0501070_0147320 | 3300049586 | Bacteria | 1943 |
| 1700 | Ga0501071_0000275 | 3300049587 | Bacteria | 24403 |
| 1701 | Ga0501071_0000327 | 3300049587 | Bacteria | 22895 |
| 1702 | Ga0501071_0001195 | 3300049587 | Archaea | 14657 |
| 1703 | Ga0501071_0015881 | 3300049587 | Bacteria | 5171 |
| 1704 | Ga0501071_0044267 | 3300049587 | Bacteria | 3192 |
| 1705 | Ga0501071_0063337 | 3300049587 | Bacteria | 2681 |
| 1706 | Ga0501071_0123285 | 3300049587 | Bacteria | 1922 |
| 1707 | Ga0501072_0000093 | 3300049588 | Archaea | 65665 |
| 1708 | Ga0501072_0007441 | 3300049588 | Bacteria | 8305 |
| 1709 | Ga0501072_0063803 | 3300049588 | Bacteria | 2906 |
| 1710 | Ga0501073_0000030 | 3300049589 | Bacteria | 115949 |
| 1711 | Ga0501073_0004926 | 3300049589 | Bacteria | 10021 |
| 1712 | Ga0501073_0019857 | 3300049589 | Bacteria | 4848 |
| 1713 | Ga0501073_0072187 | 3300049589 | Bacteria | 2404 |
| 1714 | Ga0501074_0010064 | 3300049590 | Bacteria | 6865 |
| 1715 | Ga0501074_0025535 | 3300049590 | Archaea | 4289 |
| 1716 | Ga0501074_0025561 | 3300049590 | Bacteria | 4286 |
| 1717 | Ga0501074_0034463 | 3300049590 | Bacteria | 3669 |
| 1718 | Ga0501075_0001636 | 3300049591 | Archaea | 14713 |
| 1719 | Ga0501075_0009734 | 3300049591 | Bacteria | 6735 |
| 1720 | Ga0501075_0045189 | 3300049591 | Bacteria | 3305 |
| 1721 | Ga0501075_0065901 | 3300049591 | Bacteria | 2732 |
| 1722 | Ga0501076_0000260 | 3300049592 | Bacteria | 32510 |
| 1723 | Ga0501076_0000392 | 3300049592 | Archaea | 27398 |
| 1724 | Ga0501076_0013969 | 3300049592 | Bacteria | 6032 |
| 1725 | Ga0501076_0048562 | 3300049592 | Bacteria | 3354 |
| 1726 | Ga0501076_0075672 | 3300049592 | Bacteria | 2699 |
| 1727 | Ga0501077_0000085 | 3300049593 | Bacteria | 46998 |
| 1728 | Ga0501077_0009209 | 3300049593 | Bacteria | 6131 |
| 1729 | Ga0501077_0110649 | 3300049593 | Bacteria | 1740 |
| 1730 | Ga0501243_007284 | 3300049675 | Bacteria | 1690 |
| 1731 | Ga0501079_0000790 | 3300049741 | Archaea | 21566 |
| 1732 | Ga0501079_0001021 | 3300049741 | Bacteria | 19441 |
| 1733 | Ga0501079_0074759 | 3300049741 | Bacteria | 2620 |
| 1734 | Ga0501080_0000023 | 3300049742 | Bacteria | 90345 |
| 1735 | Ga0501080_0005898 | 3300049742 | Bacteria | 10973 |
| 1736 | Ga0501080_0020356 | 3300049742 | Archaea | 6140 |
| 1737 | Ga0501080_0057567 | 3300049742 | Bacteria | 3619 |
| 1738 | Ga0501080_0119618 | 3300049742 | Bacteria | 2442 |
| 1739 | Ga0501080_0203250 | 3300049742 | Bacteria | 1818 |
| 1740 | Ga0501081_0001553 | 3300049743 | Archaea | 14136 |
| 1741 | Ga0501081_0015758 | 3300049743 | Bacteria | 4990 |
| 1742 | Ga0501081_0023093 | 3300049743 | Bacteria | 4167 |
| 1743 | Ga0501081_0029959 | 3300049743 | Bacteria | 3680 |
| 1744 | Ga0501081_0041679 | 3300049743 | Bacteria | 3145 |
| 1745 | Ga0501081_0183740 | 3300049743 | Bacteria | 1513 |
| 1746 | Ga0501083_0000059 | 3300049744 | Bacteria | 78374 |
| 1747 | Ga0501083_0027619 | 3300049744 | Bacteria | 3914 |
| 1748 | Ga0501083_0124905 | 3300049744 | Bacteria | 1687 |
| 1749 | Ga0501035_0000283 | 3300049822 | Bacteria | 60218 |
| 1750 | Ga0501035_0005074 | 3300049822 | Bacteria | 12481 |
| 1751 | Ga0501035_0030333 | 3300049822 | Bacteria | 4930 |
| 1752 | Ga0501035_0038995 | 3300049822 | Bacteria | 4301 |
| 1753 | Ga0501035_0042452 | 3300049822 | Bacteria | 4102 |
| 1754 | Ga0501035_0054167 | 3300049822 | Bacteria | 3584 |
| 1755 | Ga0501035_0063799 | 3300049822 | Bacteria | 3275 |
| 1756 | Ga0501035_0173821 | 3300049822 | Bacteria | 1859 |
| 1757 | Ga0501044_0004205 | 3300049823 | Bacteria | 16172 |
| 1758 | Ga0501044_0005678 | 3300049823 | Bacteria | 13833 |
| 1759 | Ga0501044_0011532 | 3300049823 | Bacteria | 9575 |
| 1760 | Ga0501044_0017369 | 3300049823 | Bacteria | 7717 |
| 1761 | Ga0501044_0076371 | 3300049823 | Bacteria | 3400 |
| 1762 | Ga0501044_0151656 | 3300049823 | Bacteria | 2299 |
| 1763 | Ga0501044_0205585 | 3300049823 | Bacteria | 1926 |
| 1764 | Ga0501045_0000549 | 3300049824 | Archaea | 23515 |
| 1765 | Ga0501045_0000716 | 3300049824 | Bacteria | 21100 |
| 1766 | Ga0501045_0001190 | 3300049824 | Bacteria | 17312 |
| 1767 | Ga0501045_0001314 | 3300049824 | Bacteria | 16480 |
| 1768 | Ga0501045_0003432 | 3300049824 | Bacteria | 10841 |
| 1769 | Ga0501045_0110489 | 3300049824 | Bacteria | 2038 |
| 1770 | nmdc:mga03n38_15428_c1 | 3300050490 | Bacteria | 2950 |
| 1771 | nmdc:mga03n38_32338_c1 | 3300050490 | Bacteria | 2215 |
| 1772 | nmdc:mga03n38_70302_c1 | 3300050490 | Bacteria | 1618 |
| 1773 | nmdc:mga00v17_11230_c1 | 3300050491 | Bacteria | 4919 |
| 1774 | nmdc:mga00v17_177516_c1 | 3300050491 | Bacteria | 1374 |
| 1775 | nmdc:mga00v17_200666_c1 | 3300050491 | Bacteria | 1289 |
| 1776 | nmdc:mga00v17_23683_c1 | 3300050491 | Bacteria | 3554 |
| 1777 | nmdc:mga00v17_26072_c1 | 3300050491 | Bacteria | 3402 |
| 1778 | nmdc:mga00v17_50444_c1 | 3300050491 | Bacteria | 2529 |
| 1779 | nmdc:mga00v17_51330_c1 | 3300050491 | Bacteria | 2508 |
| 1780 | nmdc:mga00v17_56777_c1 | 3300050491 | Bacteria | 2394 |
| 1781 | nmdc:mga00v17_6346_c1 | 3300050491 | Bacteria | 6269 |
| 1782 | nmdc:mga00v17_70360_c1 | 3300050491 | Bacteria | 2167 |
| 1783 | nmdc:mga00v17_7056_c1 | 3300050491 | Bacteria | 5982 |
| 1784 | nmdc:mga00v17_7209_c1 | 3300050491 | Bacteria | 5923 |
| 1785 | nmdc:mga0yw44_100736_c1 | 3300050492 | Bacteria | 1840 |
| 1786 | nmdc:mga0yw44_103064_c1 | 3300050492 | Bacteria | 1820 |
| 1787 | nmdc:mga0yw44_10630_c1 | 3300050492 | Bacteria | 4712 |
| 1788 | nmdc:mga0yw44_12125_c1 | 3300050492 | Bacteria | 4481 |
| 1789 | nmdc:mga0yw44_13350_c1 | 3300050492 | Bacteria | 4322 |
| 1790 | nmdc:mga0yw44_229144_c1 | 3300050492 | Bacteria | 1233 |
| 1791 | nmdc:mga0yw44_27067_c1 | 3300050492 | Bacteria | 3281 |
| 1792 | nmdc:mga0yw44_58784_c1 | 3300050492 | Bacteria | 2350 |
| 1793 | nmdc:mga06z11_145195_c1 | 3300050494 | Bacteria | 1344 |
| 1794 | nmdc:mga07m45_1183_c1 | 3300050496 | Bacteria | 9017 |
| 1795 | nmdc:mga07m45_14273_c1 | 3300050496 | Bacteria | 4228 |
| 1796 | nmdc:mga07m45_62313_c1 | 3300050496 | Bacteria | 2113 |
| 1797 | nmdc:mga07m45_68468_c1 | 3300050496 | Bacteria | 2018 |
| 1798 | nmdc:mga05p37_130627_c1 | 3300050507 | Bacteria | 3082 |
| 1799 | nmdc:mga05p37_147133_c1 | 3300050507 | Bacteria | 2883 |
| 1800 | nmdc:mga05p37_59368_c1 | 3300050507 | Bacteria | 4710 |
| 1801 | nmdc:mga0qj67_16520_c1 | 3300050509 | Bacteria | 5600 |
| 1802 | nmdc:mga0qj67_199461_c1 | 3300050509 | Bacteria | 1626 |
| 1803 | nmdc:mga0qj67_314_c1 | 3300050509 | Bacteria | 33600 |
| 1804 | nmdc:mga0qj67_55011_c1 | 3300050509 | Bacteria | 3152 |
| 1805 | nmdc:mga06r32_66862_c1 | 3300050510 | Bacteria | 3469 |
| 1806 | nmdc:mga06r32_83948_c1 | 3300050510 | Bacteria | 3103 |
| 1807 | nmdc:mga08y16_124196_c1 | 3300050511 | Bacteria | 2685 |
| 1808 | nmdc:mga08y16_407028_c1 | 3300050511 | Bacteria | 1392 |
| 1809 | nmdc:mga0n895_280587_c1 | 3300050512 | Bacteria | 1689 |
| 1810 | nmdc:mga0n895_58260_c1 | 3300050512 | Bacteria | 3808 |
| 1811 | nmdc:mga0rr50_116155_c1 | 3300050513 | Bacteria | 2124 |
| 1812 | nmdc:mga0rr50_54532_c1 | 3300050513 | Unclassified | 2979 |
| 1813 | nmdc:mga0a205_30295_c1 | 3300050515 | Archaea | 5179 |
| 1814 | nmdc:mga0a205_3708_c1 | 3300050515 | Bacteria | 13671 |
| 1815 | nmdc:mga0a205_50884_c1 | 3300050515 | Bacteria | 3999 |
| 1816 | nmdc:mga0sz30_1040_c1 | 3300050516 | Bacteria | 9983 |
| 1817 | nmdc:mga0sz30_1824_c2 | 3300050516 | Bacteria | 6986 |
| 1818 | nmdc:mga0sz30_30283_c1 | 3300050516 | Bacteria | 2235 |
| 1819 | nmdc:mga0sz30_34239_c1 | 3300050516 | Bacteria | 2113 |
| 1820 | nmdc:mga0sz30_50583_c1 | 3300050516 | Bacteria | 1762 |
| 1821 | Ga0495601_0032272 | 3300053077 | Bacteria | 3259 |
| 1822 | Ga0500610_0003294 | 3300053079 | Bacteria | 6163 |
| 1823 | Ga0500635_0000091 | 3300053080 | Bacteria | 55565 |
| 1824 | Ga0500635_0018314 | 3300053080 | Bacteria | 2111 |
| 1825 | Ga0495655_0001696 | 3300053083 | Bacteria | 3409 |
| 1826 | Ga0495619_0000621 | 3300053085 | Bacteria | 23466 |
| 1827 | Ga0495619_0022031 | 3300053085 | Bacteria | 4073 |
| 1828 | Ga0495619_0036805 | 3300053085 | Bacteria | 3188 |
| 1829 | Ga0495619_0072197 | 3300053085 | Bacteria | 2311 |
| 1830 | Ga0495619_0152235 | 3300053085 | Bacteria | 1595 |
| 1831 | Ga0495619_0169713 | 3300053085 | Bacteria | 1508 |
| 1832 | Ga0500643_000086 | 3300053087 | Bacteria | 97106 |
| 1833 | Ga0500643_001082 | 3300053087 | Bacteria | 16404 |
| 1834 | Ga0500643_001466 | 3300053087 | Bacteria | 13548 |
| 1835 | Ga0500646_0019346 | 3300053090 | Bacteria | 1802 |
| 1836 | Ga0500651_0022307 | 3300053093 | Bacteria | 3954 |
| 1837 | Ga0500641_0000526 | 3300053096 | Bacteria | 13777 |
| 1838 | Ga0500556_0000115 | 3300053104 | Bacteria | 69837 |
| 1839 | Ga0500556_0000496 | 3300053104 | Bacteria | 27297 |
| 1840 | Ga0500556_0000626 | 3300053104 | Bacteria | 22358 |
| 1841 | Ga0500562_010403 | 3300053108 | Bacteria | 2358 |
| 1842 | Ga0500593_000731 | 3300053117 | Bacteria | 12438 |
| 1843 | Ga0500642_0036336 | 3300053130 | Bacteria | 2099 |
| 1844 | Ga0500652_000545 | 3300053131 | Bacteria | 13158 |
| 1845 | Ga0500559_0001016 | 3300053136 | Bacteria | 17245 |
| 1846 | Ga0500559_0001057 | 3300053136 | Bacteria | 16725 |
| 1847 | Ga0500559_0009421 | 3300053136 | Bacteria | 4227 |
| 1848 | Ga0500559_0024306 | 3300053136 | Bacteria | 2577 |
| 1849 | Ga0500568_0000038 | 3300053139 | Bacteria | 134267 |
| 1850 | Ga0500568_0000117 | 3300053139 | Bacteria | 71510 |
| 1851 | Ga0500568_0001800 | 3300053139 | Bacteria | 13198 |
| 1852 | Ga0500568_0004560 | 3300053139 | Bacteria | 7384 |
| 1853 | Ga0500568_0017055 | 3300053139 | Bacteria | 3213 |
| 1854 | Ga0500568_0040363 | 3300053139 | Bacteria | 1879 |
| 1855 | Ga0500573_0000014 | 3300053140 | Bacteria | 193353 |
| 1856 | Ga0500573_0000476 | 3300053140 | Bacteria | 17264 |
| 1857 | Ga0500573_0015888 | 3300053140 | Bacteria | 4270 |
| 1858 | Ga0500573_0018692 | 3300053140 | Bacteria | 3955 |
| 1859 | Ga0500573_0018791 | 3300053140 | Bacteria | 3947 |
| 1860 | Ga0500573_0029841 | 3300053140 | Bacteria | 3144 |
| 1861 | Ga0500573_0039403 | 3300053140 | Bacteria | 2729 |
| 1862 | Ga0500577_0001332 | 3300053142 | Bacteria | 6319 |
| 1863 | Ga0500590_006984 | 3300053148 | Bacteria | 5541 |
| 1864 | Ga0500600_0055938 | 3300053149 | Bacteria | 2220 |
| 1865 | Ga0500616_0000027 | 3300053153 | Bacteria | 441053 |
| 1866 | Ga0500616_0000115 | 3300053153 | Bacteria | 147212 |
| 1867 | Ga0500616_0000117 | 3300053153 | Bacteria | 145655 |
| 1868 | Ga0500616_0001308 | 3300053153 | Bacteria | 24623 |
| 1869 | Ga0500616_0001664 | 3300053153 | Bacteria | 20508 |
| 1870 | Ga0500616_0002288 | 3300053153 | Bacteria | 16223 |
| 1871 | Ga0500620_000082 | 3300053155 | Bacteria | 18227 |
| 1872 | Ga0500645_013215 | 3300053730 | Bacteria | 2655 |
| 1873 | Ga0501084_0003669 | 3300054114 | Bacteria | 12458 |
| 1874 | Ga0501084_0006148 | 3300054114 | Bacteria | 9871 |
| 1875 | Ga0501084_0056074 | 3300054114 | Bacteria | 3297 |
| 1876 | Ga0501084_0144759 | 3300054114 | Bacteria | 2002 |
| 1877 | Ga0587084_001354 | 3300059477 | Bacteria | 2303 |
| 1878 | Ga0587066_011832 | 3300059490 | Bacteria | 1288 |
| 1879 | Ga0587077_002512 | 3300059493 | Bacteria | 2185 |
| 1880 | Ga0587083_0013367 | 3300059505 | Bacteria | 1397 |
| 1881 | Ga0587083_0019955 | 3300059505 | Bacteria | 1229 |
| 1882 | Ga0587086_005976 | 3300059507 | Bacteria | 1339 |
| 1883 | Ga0587090_000423 | 3300059510 | Bacteria | 3467 |
| 1884 | Ga0587101_001172 | 3300059623 | Bacteria | 2174 |
| 1885 | Ga0587128_008890 | 3300059630 | Bacteria | 1310 |
| 1886 | Ga0501082_0004627 | 3300060353 | Bacteria | 12011 |
| 1887 | Ga0501082_0009908 | 3300060353 | Archaea | 8213 |
| 1888 | Ga0501082_0208433 | 3300060353 | Bacteria | 1701 |
| 1889 | Ga0466962_0003043 | 3300061719 | Bacteria | 7996 |
| 1890 | Ga0466962_0039612 | 3300061719 | Bacteria | 2256 |
| 1891 | Ga0466962_0058962 | 3300061719 | Bacteria | 1832 |
| 1892 | Ga0466962_0074207 | 3300061719 | Bacteria | 1625 |
| 1893 | Ga0466962_0077614 | 3300061719 | Bacteria | 1588 |
| 1894 | Ga0530510_0000536 | 3300061734 | Bacteria | 24331 |
| 1895 | Ga0530510_0001061 | 3300061734 | Archaea | 18241 |
| 1896 | Ga0530510_0017997 | 3300061734 | Bacteria | 5008 |
| 1897 | Ga0530510_0046250 | 3300061734 | Bacteria | 3144 |
| 1898 | Ga0530510_0122356 | 3300061734 | Bacteria | 1911 |
| 1899 | Ga0530510_0151936 | 3300061734 | Bacteria | 1710 |
| 1900 | 2517762602 | 2517572101 | Bacteria | 6884336 |
| 1901 | 2523386351 | 2523231044 | Bacteria | 6434991 |
| 1902 | 2537898934 | 2537561592 | Bacteria | 4348607 |
| 1903 | 2548699060 | 2547132424 | Bacteria | 8348532 |
| 1904 | 2552110737 | 2551306166 | Bacteria | 9731570 |
| 1905 | 2555229498 | 2554235227 | Bacteria | 3637389 |
| 1906 | 2558909522 | 2558860112 | Bacteria | 9931328 |
| 1907 | 2559428860 | 2558860280 | Bacteria | 11429938 |
| 1908 | 2559430722 | 2558860280 | Bacteria | 11429938 |
| 1909 | 2566992174 | 2565956761 | Bacteria | 6601618 |
| 1910 | 2579853624 | 2579778521 | Bacteria | 7624758 |
| 1911 | 2583149102 | 2582580736 | Bacteria | 5325865 |
| 1912 | 2585298246 | 2582581312 | Bacteria | 7308206 |
| 1913 | 2586060711 | 2585427649 | Bacteria | 9053857 |
| 1914 | 2586064425 | 2585427649 | Bacteria | 9053857 |
| 1915 | 2587863728 | 2585428094 | Bacteria | 3604039 |
| 1916 | 2588106890 | 2585428157 | Bacteria | 3018951 |
| 1917 | 2619853695 | 2619618881 | Bacteria | 7521104 |
| 1918 | 2620349911 | 2619619003 | Bacteria | 7619552 |
| 1919 | 2623497579 | 2622736605 | Bacteria | 4992138 |
| 1920 | 2626636076 | 2626541554 | Bacteria | 7741902 |
| 1921 | 2643734893 | 2643221542 | Bacteria | 3563959 |
| 1922 | 2643753811 | 2643221546 | Bacteria | 2910897 |
| 1923 | 2643768551 | 2643221549 | Bacteria | 4042819 |
| 1924 | 2643783497 | 2643221553 | Bacteria | 3544260 |
| 1925 | 2643847960 | 2643221566 | Bacteria | 3460379 |
| 1926 | 2643876373 | 2643221572 | Bacteria | 3614809 |
| 1927 | 2643888300 | 2643221575 | Bacteria | 4022601 |
| 1928 | 2643994948 | 2643221597 | Bacteria | 3347721 |
| 1929 | 2644082281 | 2643221613 | Bacteria | 4622396 |
| 1930 | 2644096481 | 2643221616 | Bacteria | 4066575 |
| 1931 | 2644111922 | 2643221619 | Bacteria | 4158469 |
| 1932 | 2644173053 | 2643221630 | Bacteria | 3601215 |
| 1933 | 2644182487 | 2643221632 | Bacteria | 3406696 |
| 1934 | 2644197913 | 2643221635 | Bacteria | 2632343 |
| 1935 | 2644277717 | 2643221649 | Bacteria | 3867359 |
| 1936 | 2644383428 | 2643221669 | Bacteria | 3611286 |
| 1937 | 2644445424 | 2643221679 | Bacteria | 3839507 |
| 1938 | 2644490564 | 2643221687 | Bacteria | 6500351 |
| 1939 | 2644502984 | 2643221690 | Bacteria | 4654705 |
| 1940 | 2644513962 | 2643221692 | Bacteria | 7282860 |
| 1941 | 2644525319 | 2643221694 | Bacteria | 4392972 |
| 1942 | 2644538694 | 2643221697 | Bacteria | 3575694 |
| 1943 | 2644610849 | 2643221711 | Bacteria | 4865335 |
| 1944 | 2644637035 | 2643221715 | Bacteria | 6671032 |
| 1945 | 2644664619 | 2643221721 | Bacteria | 4486924 |
| 1946 | 2644669404 | 2643221722 | Bacteria | 4247614 |
| 1947 | 2644679263 | 2643221724 | Bacteria | 3593515 |
| 1948 | 2645720691 | 2643221961 | Bacteria | 3919167 |
| 1949 | 2645723710 | 2643221962 | Bacteria | 3874254 |
| 1950 | 2655031519 | 2654587600 | Bacteria | 3911798 |
| 1951 | 2671835671 | 2671180195 | Bacteria | 9757215 |
| 1952 | 2676199411 | 2675902999 | Bacteria | 9438463 |
| 1953 | 2686539208 | 2684623035 | Bacteria | 8032739 |
| 1954 | 2689960348 | 2687453737 | Bacteria | 11203906 |
| 1955 | 2691512796 | 2690315906 | Bacteria | 4517044 |
| 1956 | 2723641230 | 2721755702 | Bacteria | 4373124 |
| 1957 | 2729907946 | 2728369276 | Bacteria | 5610032 |
| 1958 | 2730228766 | 2728369380 | Bacteria | 3620317 |
| 1959 | 2738668278 | 2738541264 | Bacteria | 5935393 |
| 1960 | 2738693653 | 2738541272 | Bacteria | 6848551 |
| 1961 | 2738707253 | 2738541274 | Bacteria | 6909446 |
| 1962 | 2738888363 | 2738541308 | Bacteria | 7020677 |
| 1963 | 2739147348 | 2738541356 | Bacteria | 5935017 |
| 1964 | 2739204214 | 2738543005 | Bacteria | 5278128 |
| 1965 | 2739240181 | 2738543011 | Bacteria | 5731169 |
| 1966 | 2739322934 | 2738543027 | Bacteria | 6409078 |
| 1967 | 2739328568 | 2738543028 | Bacteria | 6917070 |
| 1968 | 2739604004 | 2739367653 | Bacteria | 2780952 |
| 1969 | 2739607519 | 2739367654 | Bacteria | 6049412 |
| 1970 | 2747952356 | 2747842429 | Bacteria | 3914386 |
| 1971 | 2753070050 | 2751185734 | Bacteria | 8863695 |
| 1972 | 2753303609 | 2751185788 | Bacteria | 4541048 |
| 1973 | 2758224592 | 2757320536 | Bacteria | 3629334 |
| 1974 | 2760304582 | 2758568522 | Bacteria | 5953541 |
| 1975 | 2760621607 | 2758568621 | Bacteria | 5967089 |
| 1976 | 2774378720 | 2773857758 | Bacteria | 3592392 |
| 1977 | 2774383464 | 2773857759 | Bacteria | 2963774 |
| 1978 | 2774394494 | 2773857762 | Bacteria | 5971770 |
| 1979 | 2774400469 | 2773857763 | Bacteria | 4180068 |
| 1980 | 2774843989 | 2773857921 | Bacteria | 9435764 |
| 1981 | 2774853827 | 2773857922 | Bacteria | 9757215 |
| 1982 | 2775658485 | 2775506735 | Bacteria | 4556596 |
| 1983 | 2776373997 | 2775506925 | Bacteria | 7237746 |
| 1984 | 2784472887 | 2784132109 | Bacteria | 3141763 |
| 1985 | 2793982994 | 2791355406 | Bacteria | 11364898 |
| 1986 | 2795795224 | 2795385472 | Bacteria | 6627535 |
| 1987 | 2799184891 | 2799112218 | Bacteria | 4315149 |
| 1988 | 2808628640 | 2808606306 | Bacteria | 3608896 |
| 1989 | 2808830074 | 2808606357 | Bacteria | 4466944 |
| 1990 | 2808851250 | 2808606360 | Bacteria | 4404006 |
| 1991 | 2808875416 | 2808606365 | Bacteria | 4301966 |
| 1992 | 2808876225 | 2808606366 | Bacteria | 4415912 |
| 1993 | 2808884855 | 2808606368 | Bacteria | 3174172 |
| 1994 | 2808894329 | 2808606370 | Bacteria | 4942454 |
| 1995 | 2808897727 | 2808606371 | Bacteria | 4251511 |
| 1996 | 2808901109 | 2808606372 | Bacteria | 4649509 |
| 1997 | 2809026401 | 2808606394 | Bacteria | 6248540 |
| 1998 | 2809194652 | 2808606439 | Bacteria | 5952208 |
| 1999 | 2809226661 | 2808606447 | Bacteria | 3572005 |
| 2000 | 2809586347 | 2808606522 | Bacteria | 9488490 |
| 2001 | 2812318150 | 2811994871 | Bacteria | 4497550 |
| 2002 | 2812322228 | 2811994872 | Bacteria | 4121241 |
| 2003 | 2812349393 | 2811994878 | Bacteria | 5992952 |
| 2004 | 2812375735 | 2811994882 | Bacteria | 4688362 |
| 2005 | 2816424357 | 2816332119 | Bacteria | 8120218 |
| 2006 | 2816505484 | 2816332139 | Bacteria | 9138787 |
| 2007 | 2817509736 | 2816332305 | Bacteria | 2697803 |
| 2008 | 2819424625 | 2818991318 | Bacteria | 5266538 |
| 2009 | 2819666956 | 2818991458 | Bacteria | 4794049 |
| 2010 | 2819690324 | 2818991462 | Bacteria | 4320267 |
| 2011 | 2819728426 | 2818991469 | Bacteria | 4644110 |
| 2012 | 2821269177 | 2821268502 | Bacteria | 3750023 |
| 2013 | 2833710070 | 2833709550 | Bacteria | 4008291 |
| 2014 | 2835191786 | 2835188231 | Bacteria | 3476928 |
| 2015 | 2837270575 | 2837268691 | Bacteria | 7850704 |
| 2016 | 2839986502 | 2839986021 | Bacteria | 3685650 |
| 2017 | 2842140523 | 2842134933 | Bacteria | 5847019 |
| 2018 | 2842891200 | 2842888712 | Bacteria | 4279094 |
| 2019 | 2844843306 | 2844841374 | Bacteria | 3917147 |
| 2020 | 2844851758 | 2844849076 | Bacteria | 4091819 |
| 2021 | 2844854384 | 2844852863 | Bacteria | 3849151 |
| 2022 | 2848551739 | 2848551377 | Bacteria | 3720646 |
| 2023 | 2852632870 | 2852632344 | Bacteria | 3463163 |
| 2024 | 2852644411 | 2852643534 | Bacteria | 3013378 |
| 2025 | 2852646560 | 2852646457 | Bacteria | 3408613 |
| 2026 | 2852665798 | 2852663356 | Bacteria | 4090475 |
| 2027 | 2852678639 | 2852677369 | Bacteria | 3768884 |
| 2028 | 2857479980 | 2857479173 | Bacteria | 2469263 |
| 2029 | 2857633458 | 2857632687 | Bacteria | 2448521 |
| 2030 | 2857711204 | 2857710386 | Bacteria | 3186771 |
| 2031 | 2857722722 | 2857720070 | Bacteria | 3189373 |
| 2032 | 2857724698 | 2857723135 | Bacteria | 4217853 |
| 2033 | 2857728526 | 2857727296 | Bacteria | 2745552 |
| 2034 | 2857730601 | 2857729791 | Bacteria | 4040535 |
| 2035 | 2857734473 | 2857733635 | Bacteria | 3532004 |
| 2036 | 2857739122 | 2857737099 | Bacteria | 3104305 |
| 2037 | 2857740823 | 2857740372 | Bacteria | 4782044 |
| 2038 | 2862993548 | 2862993130 | Bacteria | 3860849 |
| 2039 | 2863070407 | 2863067949 | Bacteria | 8541735 |
| 2040 | 2866555467 | 2866552031 | Bacteria | 5824618 |
| 2041 | 2866616957 | 2866612099 | Bacteria | 7543886 |
| 2042 | 2870622255 | 2870622029 | Bacteria | 3643329 |
| 2043 | 2870629554 | 2870628048 | Bacteria | 3696012 |
| 2044 | 2870727454 | 2870721527 | Bacteria | 9689237 |
| 2045 | 2870730025 | 2870721527 | Bacteria | 9689237 |
| 2046 | 2870788726 | 2870782633 | Bacteria | 9624083 |
| 2047 | 2870803304 | 2870801768 | Bacteria | 2710986 |
| 2048 | 2870805347 | 2870804320 | Bacteria | 2552467 |
| 2049 | 2884766320 | 2884763398 | Bacteria | 4091164 |
| 2050 | 2887447174 | 2887443736 | Bacteria | 4426037 |
| 2051 | 2889303335 | 2889300758 | Bacteria | 5690814 |
| 2052 | 2891331401 | 2891326441 | Bacteria | 6439512 |
| 2053 | 2891972895 | 2891968417 | Bacteria | 5821697 |
| 2054 | 2893686283 | 2893684298 | Bacteria | 2897960 |
| 2055 | 2895428178 | 2895427314 | Bacteria | 13147766 |
| 2056 | 2895660548 | 2895660088 | Bacteria | 3782833 |
| 2057 | 2895884540 | 2895880812 | Bacteria | 11255272 |
| 2058 | 2897562487 | 2897561785 | Bacteria | 3256946 |
| 2059 | 2899364506 | 2899359706 | Bacteria | 10940472 |
| 2060 | 2899376590 | 2899370129 | Bacteria | 6781179 |
| 2061 | 2902797594 | 2902792274 | Bacteria | 7270173 |
| 2062 | 2902799884 | 2902799365 | Bacteria | 5419524 |
| 2063 | 2902814809 | 2902810491 | Bacteria | 6794147 |
| 2064 | 2902843209 | 2902837492 | Bacteria | 6697721 |
| 2065 | 2904432473 | 2904430863 | Bacteria | 3486923 |
| 2066 | 2904501566 | 2904497146 | Bacteria | 4731781 |
| 2067 | 2904501743 | 2904501621 | Bacteria | 3401437 |
| 2068 | 2904510218 | 2904509784 | Bacteria | 3520416 |
| 2069 | 2904538004 | 2904535858 | Bacteria | 6308016 |
| 2070 | 2904778211 | 2904776348 | Bacteria | 4658726 |
| 2071 | 2905928636 | 2905926851 | Bacteria | 4423176 |
| 2072 | 2906801599 | 2906799679 | Bacteria | 4031749 |
| 2073 | 2908676203 | 2908674828 | Bacteria | 3382763 |
| 2074 | 2908678567 | 2908678064 | Bacteria | 3482747 |
| 2075 | 2909077083 | 2909074476 | Bacteria | 3436050 |
| 2076 | 2915364120 | 2915358134 | Bacteria | 6050864 |
| 2077 | 2915774800 | 2915768154 | Bacteria | 8424322 |
| 2078 | 2917736598 | 2917736166 | Bacteria | 9690793 |
| 2079 | 2917737727 | 2917736166 | Bacteria | 9690793 |
| 2080 | 2919035583 | 2919034639 | Bacteria | 4763403 |
| 2081 | 2919041778 | 2919039151 | Bacteria | 3391018 |
| 2082 | 2919043276 | 2919042368 | Bacteria | 3905917 |
| 2083 | 2919054919 | 2919051321 | Bacteria | 4210889 |
| 2084 | 2919058787 | 2919055335 | Bacteria | 3875751 |
| 2085 | 2919060242 | 2919059106 | Bacteria | 4991624 |
| 2086 | 2919070918 | 2919069694 | Bacteria | 3622919 |
| 2087 | 2919395364 | 2919391150 | Bacteria | 4884741 |
| 2088 | 2919398565 | 2919395869 | Bacteria | 3704152 |
| 2089 | 2919445625 | 2919443155 | Bacteria | 4072969 |
| 2090 | 2919525365 | 2919523602 | Bacteria | 3788128 |
| 2091 | 2919539208 | 2919538618 | Bacteria | 4677069 |
| 2092 | 2919717016 | 2919713450 | Bacteria | 7431245 |
| 2093 | 2920883347 | 2920879853 | Bacteria | 4216831 |
| 2094 | 2922557187 | 2922554459 | Bacteria | 6683962 |
| 2095 | 2928091018 | 2928090899 | Bacteria | 3158267 |
| 2096 | 2928105561 | 2928104781 | Bacteria | 3877447 |
| 2097 | 2928121405 | 2928121344 | Bacteria | 3972376 |
| 2098 | 2928145111 | 2928142448 | Bacteria | 5288925 |
| 2099 | 2928153444 | 2928153084 | Bacteria | 4020257 |
| 2100 | 2928500921 | 2928500415 | Bacteria | 3384541 |
| 2101 | 2929217564 | 2929212328 | Bacteria | 7708288 |
| 2102 | 2932400412 | 2932398195 | Bacteria | 3847976 |
| 2103 | 2932427797 | 2932426870 | Bacteria | 4547726 |
| 2104 | 2932432301 | 2932431166 | Bacteria | 4215299 |
| 2105 | 2933418630 | 2933418574 | Bacteria | 4476724 |
| 2106 | 2935410642 | 2935409751 | Bacteria | 4179611 |
| 2107 | 2935894132 | 2935890801 | Bacteria | 4593001 |
| 2108 | 2939584798 | 2939582691 | Bacteria | 7088898 |
| 2109 | 2939599380 | 2939598168 | Bacteria | 4687164 |
| 2110 | 2939650244 | 2939647034 | Bacteria | 4681660 |
| 2111 | 2939659378 | 2939657138 | Bacteria | 3740283 |
| 2112 | 2939662805 | 2939660829 | Bacteria | 3784848 |
| 2113 | 2939677662 | 2939674588 | Bacteria | 4844420 |
| 2114 | 2939748528 | 2939743619 | Bacteria | 5762299 |
| 2115 | 2945920248 | 2945916053 | Bacteria | 4555517 |
| 2116 | 2945923894 | 2945920336 | Bacteria | 4501603 |
| 2117 | 2945944447 | 2945941187 | Bacteria | 4682474 |
| 2118 | 2945957365 | 2945956166 | Bacteria | 5110334 |
| 2119 | 2945970918 | 2945968032 | Bacteria | 4111363 |
| 2120 | 2946003385 | 2946003308 | Bacteria | 3857229 |
| 2121 | 2946024821 | 2946024296 | Bacteria | 3508095 |
| 2122 | 2946034661 | 2946033335 | Bacteria | 3835514 |
| 2123 | 2946040362 | 2946037020 | Bacteria | 4900426 |
| 2124 | 2946043242 | 2946041624 | Bacteria | 4191385 |
| 2125 | 2946063965 | 2946059875 | Bacteria | 4386623 |
| 2126 | 2946081770 | 2946080515 | Bacteria | 4310960 |
| 2127 | 2954001630 | 2953998280 | Bacteria | 4812144 |
| 2128 | 2956941536 | 2956939328 | Bacteria | 3474458 |
| 2129 | 2964328541 | 2964326757 | Bacteria | 3290868 |
| 2130 | 2966922640 | 2966921586 | Bacteria | 3092803 |
| 2131 | 2966926610 | 2966924647 | Bacteria | 3268643 |
| 2132 | 2974298238 | 2974294766 | Bacteria | 3767688 |
| 2133 | 2974303796 | 2974302888 | Bacteria | 4369871 |
| 2134 | 2974325532 | 2974324384 | Bacteria | 3750535 |
| 2135 | 2977230464 | 2977228692 | Bacteria | 3450105 |
| 2136 | 2977239265 | 2977236895 | Bacteria | 3569373 |
| 2137 | 2977252038 | 2977251589 | Bacteria | 2952848 |
| 2138 | 2977265706 | 2977264416 | Bacteria | 3750737 |
| 2139 | 2984542951 | 2984542743 | Bacteria | 3569378 |
| 2140 | 2984551898 | 2984551494 | Bacteria | 3877562 |
| 2141 | 2984579777 | 2984576629 | Bacteria | 4248407 |
| 2142 | 2984582226 | 2984580707 | Bacteria | 3351387 |
| 2143 | 2984593946 | 2984592036 | Bacteria | 3670284 |
| 2144 | 2995728415 | 2995726249 | Bacteria | 3470435 |
| 2145 | 3001892118 | 3001889506 | Bacteria | 2975194 |
| 2146 | 8002791552 | 8002784119 | Bacteria | 9788632 |
| 2147 | 8002811627 | 8002811521 | Bacteria | 2942897 |
| 2148 | 8003321489 | 8003314358 | Bacteria | 10575343 |
| 2149 | 8003323191 | 8003314358 | Bacteria | 10575343 |
| 2150 | 8004022465 | 8004021418 | Bacteria | 4313954 |
| 2151 | 8004026910 | 8004025490 | Bacteria | 4327753 |
| 2152 | 8004183613 | 8004182704 | Bacteria | 3391155 |
| 2153 | 8004213430 | 8004212874 | Bacteria | 2861420 |
| 2154 | 8016254894 | 8016254467 | Bacteria | 3797036 |
| 2155 | 8033684397 | 8033684223 | Bacteria | 6906479 |
| 2156 | 8045832455 | 8045830549 | Bacteria | 4444727 |
| 2157 | 8047717666 | 8047710418 | Bacteria | 11023148 |
| 2158 | 8047719528 | 8047710418 | Bacteria | 11023148 |
| 2159 | 8047895175 | 8047893842 | Bacteria | 11723082 |
| 2160 | 8048136500 | 8048127548 | Bacteria | 11053136 |
| 2161 | 8048363777 | 8048356638 | Bacteria | 11044339 |
| 2162 | 8048372201 | 8048369669 | Bacteria | 11666822 |
| 2163 | 8048381135 | 8048379754 | Bacteria | 11877923 |
| 2164 | 8054109686 | 8054107350 | Bacteria | 5022511 |
| 2165 | 8054475852 | 8054472261 | Bacteria | 7464355 |
| 2166 | 8054613903 | 8054609563 | Bacteria | 5170090 |
| 2167 | 8054917141 | 8054913762 | Bacteria | 7713009 |
| 2168 | 8054925340 | 8054920844 | Bacteria | 7068637 |
| 2169 | 8055035359 | 8055034563 | Bacteria | 3562128 |
| 2170 | 8055038950 | 8055037949 | Bacteria | 3337834 |
| 2171 | 8055160668 | 8055157932 | Bacteria | 6429399 |
| 2172 | 8055177139 | 8055172936 | Bacteria | 9305943 |
| 2173 | 8056039320 | 8056037122 | Bacteria | 3854319 |
| 2174 | 8056208492 | 8056207758 | Bacteria | 8639239 |
| 2175 | 8056583315 | 8056579771 | Bacteria | 5840325 |
| 2176 | 8057347470 | 8057345674 | Bacteria | 4160394 |
| 2177 | Ga0207427_100042 | |||
| 2178 | LJQas_1002745 | |||
| 2179 | LJQas_1002873 | |||
| 2180 | JGI24746J21847_1001377 | |||
| 2181 | JGI24740J21852_10002318 | |||
| 2182 | JGI24740J21852_10013880 | |||
| 2183 | JGI24737J22298_10016258 | |||
| 2184 | JGI24737J22298_10025699 | |||
| 2185 | JGI24735J21928_10005710 | |||
| 2186 | JGI24735J21928_10006707 | |||
| 2187 | JGI24738J21930_10011645 | |||
| 2188 | JGI24744J21845_10006576 | |||
| 2189 | JGI25162J39368_1004740 | |||
| 2190 | JGI25154J39366_1001298 | |||
| 2191 | JGI25164J39214_1001137 | |||
| 2192 | JGI25152J39213_1000379 | |||
| 2193 | JGI25151J46595_10038948 | |||
| 2194 | JGI25406J46586_10002406 | |||
| 2195 | JGI25165J46597_1000061 | |||
| 2196 | JGI25407J50210_10004858 | |||
| 2197 | Ga0006562J51391_1003827 | |||
| 2198 | Ga0006562J51391_1026496 | |||
| 2199 | Ga0006562J51391_1028453 | |||
| 2200 | Ga0006562J51391_1032082 | |||
| 2201 | Ga0055539_1000005 | |||
| 2202 | Ga0055533_1000001 | |||
| 2203 | Ga0055525_1000291 | |||
| 2204 | Ga0055527_1000017 | |||
| 2205 | Ga0055542_1000044 | |||
| 2206 | Ga0055542_1005133 | |||
| 2207 | Ga0055529_1000279 | |||
| 2208 | Ga0055540_1000022 | |||
| 2209 | Ga0055540_1007503 | |||
| 2210 | Ga0055540_1017813 | |||
| 2211 | Ga0055541_1000625 | |||
| 2212 | JGI25405J52794_10000005 | |||
| 2213 | Ga0065714_10099404 | |||
| 2214 | Ga0065704_10073835 | |||
| 2215 | Ga0070658_10000394 | |||
| 2216 | Ga0070658_10000448 | |||
| 2217 | Ga0070676_10180578 | |||
| 2218 | Ga0070683_100008624 | |||
| 2219 | Ga0070683_100029105 | |||
| 2220 | Ga0070683_100032968 | |||
| 2221 | Ga0070683_100034639 | |||
| 2222 | Ga0070683_100054846 | |||
| 2223 | Ga0070683_100061592 | |||
| 2224 | Ga0070683_100078600 | |||
| 2225 | Ga0070677_10078333 | |||
| 2226 | Ga0068869_100034322 | |||
| 2227 | Ga0070666_10144317 | |||
| 2228 | Ga0070682_100006780 | |||
| 2229 | Ga0070682_100014519 | |||
| 2230 | Ga0070682_100016045 | |||
| 2231 | Ga0070682_100041420 | |||
| 2232 | Ga0068868_100005688 | |||
| 2233 | Ga0068868_100005768 | |||
| 2234 | Ga0068868_100024841 | |||
| 2235 | Ga0068868_100054112 | |||
| 2236 | Ga0068868_100259251 | |||
| 2237 | Ga0070660_100018405 | |||
| 2238 | Ga0070660_100028725 | |||
| 2239 | Ga0070660_100031568 | |||
| 2240 | Ga0070660_100035294 | |||
| 2241 | Ga0070660_100078401 | |||
| 2242 | Ga0070660_100086430 | |||
| 2243 | Ga0070660_100097095 | |||
| 2244 | Ga0070691_10106531 | |||
| 2245 | Ga0070687_100008987 | |||
| 2246 | Ga0070661_100075188 | |||
| 2247 | Ga0070692_10020367 | |||
| 2248 | Ga0070668_100004760 | |||
| 2249 | Ga0070668_100004776 | |||
| 2250 | Ga0070668_100005919 | |||
| 2251 | Ga0070669_100000820 | |||
| 2252 | Ga0070669_100031283 | |||
| 2253 | Ga0070669_100057358 | |||
| 2254 | Ga0070669_100120181 | |||
| 2255 | Ga0070675_100071687 | |||
| 2256 | Ga0070675_100094331 | |||
| 2257 | Ga0070675_100162207 | |||
| 2258 | Ga0070671_100000413 | |||
| 2259 | Ga0070671_100016620 | |||
| 2260 | Ga0070671_100138032 | |||
| 2261 | Ga0070671_100199550 | |||
| 2262 | Ga0070671_100237954 | |||
| 2263 | Ga0070674_100020814 | |||
| 2264 | Ga0070674_100065570 | |||
| 2265 | Ga0070674_100139963 | |||
| 2266 | Ga0070688_100020289 | |||
| 2267 | Ga0070659_100001798 | |||
| 2268 | Ga0070659_100005058 | |||
| 2269 | Ga0070659_100007670 | |||
| 2270 | Ga0070659_100028072 | |||
| 2271 | Ga0070659_100071106 | |||
| 2272 | Ga0070659_100091466 | |||
| 2273 | Ga0070659_100182920 | |||
| 2274 | Ga0070667_100000605 | |||
| 2275 | Ga0070667_100000674 | |||
| 2276 | Ga0070667_100001634 | |||
| 2277 | Ga0070667_100010065 | |||
| 2278 | Ga0070667_100023104 | |||
| 2279 | Ga0070709_10012741 | |||
| 2280 | Ga0070709_10024755 | |||
| 2281 | Ga0070714_100046967 | |||
| 2282 | Ga0070714_100051731 | |||
| 2283 | Ga0070714_100065288 | |||
| 2284 | Ga0070714_100066546 | |||
| 2285 | Ga0070714_100160700 | |||
| 2286 | Ga0070714_100164208 | |||
| 2287 | Ga0070714_100207909 | |||
| 2288 | Ga0070713_100003424 | |||
| 2289 | Ga0070713_100049495 | |||
| 2290 | Ga0070710_10001407 | |||
| 2291 | Ga0070710_10016635 | |||
| 2292 | Ga0070701_10003564 | |||
| 2293 | Ga0070711_100006432 | |||
| 2294 | Ga0070711_100043841 | |||
| 2295 | Ga0070700_100000049 | |||
| 2296 | Ga0070700_100017266 | |||
| 2297 | Ga0070700_100026697 | |||
| 2298 | Ga0070700_100034233 | |||
| 2299 | Ga0070700_100196840 | |||
| 2300 | Ga0070694_100014338 | |||
| 2301 | Ga0070663_100047102 | |||
| 2302 | Ga0070663_100059261 | |||
| 2303 | Ga0070663_100126923 | |||
| 2304 | Ga0070678_100001296 | |||
| 2305 | Ga0070678_100031232 | |||
| 2306 | Ga0070678_100177184 | |||
| 2307 | Ga0070678_100185230 | |||
| 2308 | Ga0070662_100014959 | |||
| 2309 | Ga0070681_10009503 | |||
| 2310 | Ga0070681_10310482 | |||
| 2311 | Ga0068867_100002347 | |||
| 2312 | Ga0068867_100044172 | |||
| 2313 | Ga0070685_10043877 | |||
| 2314 | Ga0070706_100006459 | |||
| 2315 | Ga0070706_100012286 | |||
| 2316 | Ga0070706_100064391 | |||
| 2317 | Ga0070707_100006726 | |||
| 2318 | Ga0070707_100011559 | |||
| 2319 | Ga0070707_100019191 | |||
| 2320 | Ga0070707_100091207 | |||
| 2321 | Ga0070707_100188369 | |||
| 2322 | Ga0070698_100007659 | |||
| 2323 | Ga0070698_100012160 | |||
| 2324 | Ga0070698_100018135 | |||
| 2325 | Ga0070698_100117481 | |||
| 2326 | Ga0070679_100011185 | |||
| 2327 | Ga0070679_100157345 | |||
| 2328 | Ga0070679_100195083 | |||
| 2329 | Ga0070679_100388985 | |||
| 2330 | Ga0070684_100008109 | |||
| 2331 | Ga0070684_100010114 | |||
| 2332 | Ga0070684_100010640 | |||
| 2333 | Ga0070684_100056129 | |||
| 2334 | Ga0070684_100071021 | |||
| 2335 | Ga0068853_100003640 | |||
| 2336 | Ga0068853_100017372 | |||
| 2337 | Ga0068853_100022417 | |||
| 2338 | Ga0068853_100029542 | |||
| 2339 | Ga0068853_100062708 | |||
| 2340 | Ga0068853_100089100 | |||
| 2341 | Ga0070672_100011247 | |||
| 2342 | Ga0070672_100044260 | |||
| 2343 | Ga0070672_100060413 | |||
| 2344 | Ga0070686_100044352 | |||
| 2345 | Ga0070695_100016540 | |||
| 2346 | Ga0070696_100001265 | |||
| 2347 | Ga0070665_100000450 | |||
| 2348 | Ga0070665_100003803 | |||
| 2349 | Ga0070665_100004177 | |||
| 2350 | Ga0070665_100029488 | |||
| 2351 | Ga0070665_100042334 | |||
| 2352 | Ga0070665_100128311 | |||
| 2353 | Ga0070665_100287046 | |||
| 2354 | Ga0070704_100000144 | |||
| 2355 | Ga0070704_100027059 | |||
| 2356 | Ga0070704_100041179 | |||
| 2357 | Ga0070704_100070886 | |||
| 2358 | Ga0068855_100026886 | |||
| 2359 | Ga0068855_100034488 | |||
| 2360 | Ga0068855_100046784 | |||
| 2361 | Ga0068855_100066766 | |||
| 2362 | Ga0068855_100081308 | |||
| 2363 | Ga0068855_100090254 | |||
| 2364 | Ga0068855_100163748 | |||
| 2365 | Ga0068857_100005690 | |||
| 2366 | Ga0068857_100035843 | |||
| 2367 | Ga0068857_100266979 | |||
| 2368 | Ga0068854_100003304 | |||
| 2369 | Ga0068854_100140557 | |||
| 2370 | Ga0068856_100022435 | |||
| 2371 | Ga0068856_100025251 | |||
| 2372 | Ga0068856_100026637 | |||
| 2373 | Ga0068856_100046003 | |||
| 2374 | Ga0068856_100048666 | |||
| 2375 | Ga0068856_100092229 | |||
| 2376 | Ga0068856_100230588 | |||
| 2377 | Ga0070702_100007562 | |||
| 2378 | Ga0070702_100021808 | |||
| 2379 | Ga0070702_100022733 | |||
| 2380 | Ga0068852_100006651 | |||
| 2381 | Ga0068852_100031767 | |||
| 2382 | Ga0068852_100032864 | |||
| 2383 | Ga0068852_100042387 | |||
| 2384 | Ga0068852_100058986 | |||
| 2385 | Ga0068852_100219404 | |||
| 2386 | Ga0068859_100001784 | |||
| 2387 | Ga0068859_100002254 | |||
| 2388 | Ga0068859_100012347 | |||
| 2389 | Ga0068859_100144251 | |||
| 2390 | Ga0068864_100025782 | |||
| 2391 | Ga0068864_100075408 | |||
| 2392 | Ga0068866_10000517 | |||
| 2393 | Ga0068866_10041100 | |||
| 2394 | Ga0068866_10058969 | |||
| 2395 | Ga0068861_100001353 | |||
| 2396 | Ga0068861_100055079 | |||
| 2397 | Ga0068861_100132503 | |||
| 2398 | Ga0068851_10000022 | |||
| 2399 | Ga0068870_10006332 | |||
| 2400 | Ga0068863_100003048 | |||
| 2401 | Ga0068863_100035553 | |||
| 2402 | Ga0068858_100000016 | |||
| 2403 | Ga0068858_100000179 | |||
| 2404 | Ga0068858_100005465 | |||
| 2405 | Ga0068858_100012390 | |||
| 2406 | Ga0068858_100081802 | |||
| 2407 | Ga0068860_100000087 | |||
| 2408 | Ga0068860_100000154 | |||
| 2409 | Ga0068860_100017715 | |||
| 2410 | Ga0068860_100170998 | |||
| 2411 | Ga0068862_100000190 | |||
| 2412 | Ga0068862_100000312 | |||
| 2413 | Ga0068862_100004977 | |||
| 2414 | Ga0081455_10000082 | |||
| 2415 | Ga0081455_10010276 | |||
| 2416 | Ga0081455_10079007 | |||
| 2417 | Ga0081455_10098153 | |||
| 2418 | Ga0081455_10121819 | |||
| 2419 | Ga0081538_10001382 | |||
| 2420 | Ga0081538_10001794 | |||
| 2421 | Ga0081540_1003861 | |||
| 2422 | Ga0081540_1004047 | |||
| 2423 | Ga0081539_10000467 | |||
| 2424 | Ga0081539_10027400 | |||
| 2425 | Ga0081539_10072469 | |||
| 2426 | Ga0070717_10007764 | |||
| 2427 | Ga0070717_10081630 | |||
| 2428 | Ga0075365_10002456 | |||
| 2429 | Ga0075365_10028961 | |||
| 2430 | Ga0075365_10033360 | |||
| 2431 | Ga0075365_10034198 | |||
| 2432 | Ga0075365_10058458 | |||
| 2433 | Ga0075365_10065175 | |||
| 2434 | Ga0075363_100000201 | |||
| 2435 | Ga0075363_100003979 | |||
| 2436 | Ga0075363_100009777 | |||
| 2437 | Ga0075363_100065368 | |||
| 2438 | Ga0075363_100067724 | |||
| 2439 | Ga0075364_10000723 | |||
| 2440 | Ga0075364_10003104 | |||
| 2441 | Ga0075364_10010199 | |||
| 2442 | Ga0075364_10024783 | |||
| 2443 | Ga0075364_10034632 | |||
| 2444 | Ga0075364_10037917 | |||
| 2445 | Ga0075364_10126099 | |||
| 2446 | Ga0075364_10133480 | |||
| 2447 | Ga0070715_10001150 | |||
| 2448 | Ga0070715_10055444 | |||
| 2449 | Ga0070716_100007290 | |||
| 2450 | Ga0070712_100002802 | |||
| 2451 | Ga0070712_100012929 | |||
| 2452 | Ga0070712_100032414 | |||
| 2453 | Ga0070712_100036549 | |||
| 2454 | Ga0070712_100117682 | |||
| 2455 | Ga0075362_10029281 | |||
| 2456 | Ga0075367_10031724 | |||
| 2457 | Ga0075367_10032134 | |||
| 2458 | Ga0075367_10177514 | |||
| 2459 | Ga0075369_10002730 | |||
| 2460 | Ga0075369_10004308 | |||
| 2461 | Ga0075369_10004998 | |||
| 2462 | Ga0075369_10005608 | |||
| 2463 | Ga0075369_10085197 | |||
| 2464 | Ga0097621_100151492 | |||
| 2465 | Ga0075370_10044515 | |||
| 2466 | Ga0075370_10061384 | |||
| 2467 | Ga0075370_10074977 | |||
| 2468 | Ga0075428_100005250 | |||
| 2469 | Ga0075428_100031735 | |||
| 2470 | Ga0075430_100000294 | |||
| 2471 | Ga0075430_100062808 | |||
| 2472 | Ga0075431_100062538 | |||
| 2473 | Ga0075431_100075899 | |||
| 2474 | Ga0075431_100360363 | |||
| 2475 | Ga0075433_10122858 | |||
| 2476 | Ga0075433_10300617 | |||
| 2477 | Ga0075434_100007636 | |||
| 2478 | Ga0075429_100023377 | |||
| 2479 | Ga0075429_100070519 | |||
| 2480 | Ga0068865_100002468 | |||
| 2481 | Ga0068865_100044021 | |||
| 2482 | Ga0068865_100066192 | |||
| 2483 | Ga0068865_100278411 | |||
| 2484 | Ga0097620_100000049 | |||
| 2485 | Ga0097620_100001784 | |||
| 2486 | Ga0097620_100002254 | |||
| 2487 | Ga0097620_100012347 | |||
| 2488 | Ga0097620_100144244 | |||
| 2489 | Ga0075435_100011202 | |||
| 2490 | Ga0099794_10000314 | |||
| 2491 | Ga0105244_10033017 | |||
| 2492 | Ga0105244_10033778 | |||
| 2493 | Ga0105244_10112258 | |||
| 2494 | Ga0105240_10005015 | |||
| 2495 | Ga0105240_10051407 | |||
| 2496 | Ga0105240_10085563 | |||
| 2497 | Ga0105240_10313825 | |||
| 2498 | Ga0111539_10094250 | |||
| 2499 | Ga0105245_10004537 | |||
| 2500 | Ga0105245_10006332 | |||
| 2501 | Ga0105245_10025093 | |||
| 2502 | Ga0105245_10111351 | |||
| 2503 | Ga0105245_10126199 | |||
| 2504 | Ga0105245_10149353 | |||
| 2505 | Ga0105247_10000159 | |||
| 2506 | Ga0105247_10000376 | |||
| 2507 | Ga0105247_10004231 | |||
| 2508 | Ga0105247_10043655 | |||
| 2509 | Ga0114129_10025993 | |||
| 2510 | Ga0114129_10043021 | |||
| 2511 | Ga0114129_10063215 | |||
| 2512 | Ga0105243_10012483 | |||
| 2513 | Ga0105243_10029324 | |||
| 2514 | Ga0105243_10069791 | |||
| 2515 | Ga0105243_10201321 | |||
| 2516 | Ga0105241_10007128 | |||
| 2517 | Ga0105241_10023785 | |||
| 2518 | Ga0105242_10000880 | |||
| 2519 | Ga0105242_10018500 | |||
| 2520 | Ga0105242_10135002 | |||
| 2521 | Ga0105242_10196341 | |||
| 2522 | Ga0105248_10000050 | |||
| 2523 | Ga0105248_10015100 | |||
| 2524 | Ga0105248_10058631 | |||
| 2525 | Ga0105248_10071820 | |||
| 2526 | Ga0105248_10085325 | |||
| 2527 | Ga0105248_10093820 | |||
| 2528 | Ga0105248_10102045 | |||
| 2529 | Ga0105248_10139647 | |||
| 2530 | Ga0105237_10000302 | |||
| 2531 | Ga0105237_10001065 | |||
| 2532 | Ga0105237_10004166 | |||
| 2533 | Ga0105237_10005434 | |||
| 2534 | Ga0105237_10035167 | |||
| 2535 | Ga0105237_10059928 | |||
| 2536 | Ga0105237_10139560 | |||
| 2537 | Ga0105237_10140579 | |||
| 2538 | Ga0105238_10026434 | |||
| 2539 | Ga0105238_10053225 | |||
| 2540 | Ga0105238_10133069 | |||
| 2541 | Ga0105249_10000042 | |||
| 2542 | Ga0105249_10010531 | |||
| 2543 | Ga0105249_10048212 | |||
| 2544 | Ga0105249_10082403 | |||
| 2545 | Ga0105249_10128286 | |||
| 2546 | Ga0105249_10172445 | |||
| 2547 | Ga0105249_10267898 | |||
| 2548 | Ga0105239_10004010 | |||
| 2549 | Ga0105239_10012785 | |||
| 2550 | Ga0105239_10100347 | |||
| 2551 | Ga0105246_10003745 | |||
| 2552 | Ga0105246_10073964 | |||
| 2553 | Ga0105246_10094175 | |||
| 2554 | Ga0105246_10096186 | |||
| 2555 | Ga0105246_10130680 | |||
| 2556 | Ga0157373_10035357 | |||
| 2557 | Ga0157371_10041403 | |||
| 2558 | Ga0157371_10066105 | |||
| 2559 | Ga0157371_10069843 | |||
| 2560 | Ga0157370_10002163 | |||
| 2561 | Ga0157370_10007445 | |||
| 2562 | Ga0157370_10027650 | |||
| 2563 | Ga0157370_10034752 | |||
| 2564 | Ga0157370_10046918 | |||
| 2565 | Ga0157370_10293017 | |||
| 2566 | Ga0157369_10000230 | |||
| 2567 | Ga0157369_10002312 | |||
| 2568 | Ga0157369_10010811 | |||
| 2569 | Ga0157369_10012349 | |||
| 2570 | Ga0157369_10014343 | |||
| 2571 | Ga0157369_10022758 | |||
| 2572 | Ga0157369_10067879 | |||
| 2573 | Ga0157369_10132655 | |||
| 2574 | Ga0157369_10149419 | |||
| 2575 | Ga0157369_10199267 | |||
| 2576 | Ga0171462_1001 | |||
| 2577 | Ga0157374_10011242 | |||
| 2578 | Ga0157374_10041552 | |||
| 2579 | Ga0157378_10003787 | |||
| 2580 | Ga0157378_10033544 | |||
| 2581 | Ga0157378_10085185 | |||
| 2582 | Ga0163162_10029817 | |||
| 2583 | Ga0163162_10046065 | |||
| 2584 | Ga0163162_10084959 | |||
| 2585 | Ga0163162_10195861 | |||
| 2586 | Ga0157372_10001405 | |||
| 2587 | Ga0157372_10022392 | |||
| 2588 | Ga0157372_10069659 | |||
| 2589 | Ga0157372_10079284 | |||
| 2590 | Ga0157372_10088253 | |||
| 2591 | Ga0157372_10092930 | |||
| 2592 | Ga0157372_10222180 | |||
| 2593 | Ga0157375_10013718 | |||
| 2594 | Ga0157375_10016612 | |||
| 2595 | Ga0157375_10076311 | |||
| 2596 | Ga0157375_10087739 | |||
| 2597 | Ga0157375_10102159 | |||
| 2598 | Ga0157375_10236263 | |||
| 2599 | Ga0163163_10004486 | |||
| 2600 | Ga0163163_10056964 | |||
| 2601 | Ga0163163_10072366 | |||
| 2602 | Ga0163163_10104359 | |||
| 2603 | Ga0163163_10235044 | |||
| 2604 | Ga0163163_10342163 | |||
| 2605 | Ga0157380_10192700 | |||
| 2606 | Ga0157377_10024809 | |||
| 2607 | Ga0157379_10002686 | |||
| 2608 | Ga0157379_10004386 | |||
| 2609 | Ga0157379_10008257 | |||
| 2610 | Ga0157379_10016792 | |||
| 2611 | Ga0157379_10051898 | |||
| 2612 | Ga0157379_10219592 | |||
| 2613 | Ga0163161_10010839 | |||
| 2614 | Ga0163161_10031311 | |||
| 2615 | Ga0163161_10039383 | |||
| 2616 | Ga0163161_10116809 | |||
| 2617 | Ga0197907_10127029 | |||
| 2618 | Ga0197907_10587311 | |||
| 2619 | Ga0206356_10558971 | |||
| 2620 | Ga0206351_10127684 | |||
| 2621 | Ga0206351_10456609 | |||
| 2622 | Ga0206350_10025198 | |||
| 2623 | Ga0206350_11148788 | |||
| 2624 | Ga0206354_11217485 | |||
| 2625 | Ga0206354_11437303 | |||
| 2626 | Ga0206353_11101538 | |||
| 2627 | Ga0213875_10011668 | |||
| 2628 | Ga0213871_10015809 | |||
| 2629 | Ga0224712_10010230 | |||
| 2630 | Ga0224712_10020419 | |||
| 2631 | Ga0224712_10023129 | |||
| 2632 | Ga0224712_10042451 | |||
| 2633 | Ga0224572_1006386 | |||
| 2634 | Ga0209566_100053 | |||
| 2635 | Ga0209674_100001 | |||
| 2636 | Ga0209672_100039 | |||
| 2637 | Ga0209147_100507 | |||
| 2638 | Ga0209563_100001 | |||
| 2639 | Ga0209437_100369 | |||
| 2640 | Ga0207425_1009908 | |||
| 2641 | Ga0209646_1000088 | |||
| 2642 | Ga0209677_100001 | |||
| 2643 | Ga0209677_100448 | |||
| 2644 | Ga0209148_1000004 | |||
| 2645 | Ga0209148_1002289 | |||
| 2646 | Ga0209148_1010632 | |||
| 2647 | Ga0209129_1000109 | |||
| 2648 | Ga0209233_1000001 | |||
| 2649 | Ga0209455_1000117 | |||
| 2650 | Ga0209455_1001874 | |||
| 2651 | Ga0209673_1017529 | |||
| 2652 | Ga0209025_1000984 | |||
| 2653 | Ga0209051_1000033 | |||
| 2654 | Ga0209051_1000633 | |||
| 2655 | Ga0209051_1002844 | |||
| 2656 | Ga0209051_1015719 | |||
| 2657 | Ga0209051_1029411 | |||
| 2658 | Ga0207697_10077557 | |||
| 2659 | Ga0207656_10000005 | |||
| 2660 | Ga0207655_1021163 | |||
| 2661 | Ga0207655_1025368 | |||
| 2662 | Ga0207655_1062958 | |||
| 2663 | Ga0207713_1034408 | |||
| 2664 | Ga0207682_10005955 | |||
| 2665 | Ga0207692_10026792 | |||
| 2666 | Ga0207642_10000166 | |||
| 2667 | Ga0207642_10067166 | |||
| 2668 | Ga0207642_10085016 | |||
| 2669 | Ga0207710_10000017 | |||
| 2670 | Ga0207710_10000019 | |||
| 2671 | Ga0207710_10000173 | |||
| 2672 | Ga0207688_10008958 | |||
| 2673 | Ga0207688_10114156 | |||
| 2674 | Ga0207647_10009465 | |||
| 2675 | Ga0207647_10023826 | |||
| 2676 | Ga0207647_10027988 | |||
| 2677 | Ga0207647_10046699 | |||
| 2678 | Ga0207685_10000910 | |||
| 2679 | Ga0207685_10056806 | |||
| 2680 | Ga0207645_10029223 | |||
| 2681 | Ga0207643_10065259 | |||
| 2682 | Ga0207705_10000001 | |||
| 2683 | Ga0207705_10054377 | |||
| 2684 | Ga0207705_10063392 | |||
| 2685 | Ga0207705_10150677 | |||
| 2686 | Ga0207684_10012433 | |||
| 2687 | Ga0207654_10000001 | |||
| 2688 | Ga0207707_10008370 | |||
| 2689 | Ga0207707_10008629 | |||
| 2690 | Ga0207707_10142229 | |||
| 2691 | Ga0207695_10004239 | |||
| 2692 | Ga0207695_10011642 | |||
| 2693 | Ga0207671_10000016 | |||
| 2694 | Ga0207671_10002478 | |||
| 2695 | Ga0207671_10018148 | |||
| 2696 | Ga0207671_10097567 | |||
| 2697 | Ga0207671_10126529 | |||
| 2698 | Ga0207693_10000366 | |||
| 2699 | Ga0207693_10000550 | |||
| 2700 | Ga0207693_10004959 | |||
| 2701 | Ga0207693_10005203 | |||
| 2702 | Ga0207693_10015176 | |||
| 2703 | Ga0207693_10019113 | |||
| 2704 | Ga0207693_10127422 | |||
| 2705 | Ga0207693_10227148 | |||
| 2706 | Ga0207663_10019629 | |||
| 2707 | Ga0207660_10017090 | |||
| 2708 | Ga0207660_10111176 | |||
| 2709 | Ga0207660_10200760 | |||
| 2710 | Ga0207662_10014650 | |||
| 2711 | Ga0207657_10005602 | |||
| 2712 | Ga0207657_10010726 | |||
| 2713 | Ga0207657_10012581 | |||
| 2714 | Ga0207657_10035747 | |||
| 2715 | Ga0207657_10041968 | |||
| 2716 | Ga0207657_10068982 | |||
| 2717 | Ga0207657_10080923 | |||
| 2718 | Ga0207657_10090348 | |||
| 2719 | Ga0207652_10006710 | |||
| 2720 | Ga0207652_10033838 | |||
| 2721 | Ga0207652_10205567 | |||
| 2722 | Ga0207652_10208365 | |||
| 2723 | Ga0207652_10230134 | |||
| 2724 | Ga0207646_10000477 | |||
| 2725 | Ga0207646_10000516 | |||
| 2726 | Ga0207646_10000701 | |||
| 2727 | Ga0207646_10004516 | |||
| 2728 | Ga0207646_10005407 | |||
| 2729 | Ga0207646_10006235 | |||
| 2730 | Ga0207646_10032861 | |||
| 2731 | Ga0207646_10302369 | |||
| 2732 | Ga0207681_10003622 | |||
| 2733 | Ga0207681_10012735 | |||
| 2734 | Ga0207681_10124519 | |||
| 2735 | Ga0207694_10000057 | |||
| 2736 | Ga0207694_10011213 | |||
| 2737 | Ga0207650_10050965 | |||
| 2738 | Ga0207650_10090769 | |||
| 2739 | Ga0207650_10278000 | |||
| 2740 | Ga0207650_10339941 | |||
| 2741 | Ga0207659_10071749 | |||
| 2742 | Ga0207659_10102824 | |||
| 2743 | Ga0207687_10001986 | |||
| 2744 | Ga0207687_10002057 | |||
| 2745 | Ga0207687_10006572 | |||
| 2746 | Ga0207687_10028962 | |||
| 2747 | Ga0207687_10051744 | |||
| 2748 | Ga0207687_10057739 | |||
| 2749 | Ga0207687_10111857 | |||
| 2750 | Ga0207700_10028709 | |||
| 2751 | Ga0207700_10040797 | |||
| 2752 | Ga0207700_10126325 | |||
| 2753 | Ga0207664_10011215 | |||
| 2754 | Ga0207664_10017974 | |||
| 2755 | Ga0207664_10031585 | |||
| 2756 | Ga0207664_10056316 | |||
| 2757 | Ga0207664_10109584 | |||
| 2758 | Ga0207664_10124094 | |||
| 2759 | Ga0207664_10217091 | |||
| 2760 | Ga0207644_10000533 | |||
| 2761 | Ga0207644_10156728 | |||
| 2762 | Ga0207690_10023284 | |||
| 2763 | Ga0207690_10043003 | |||
| 2764 | Ga0207690_10046233 | |||
| 2765 | Ga0207706_10004090 | |||
| 2766 | Ga0207706_10023329 | |||
| 2767 | Ga0207706_10098926 | |||
| 2768 | Ga0207686_10013657 | |||
| 2769 | Ga0207686_10039601 | |||
| 2770 | Ga0207686_10163127 | |||
| 2771 | Ga0207709_10003392 | |||
| 2772 | Ga0207709_10013839 | |||
| 2773 | Ga0207709_10030200 | |||
| 2774 | Ga0207709_10041889 | |||
| 2775 | Ga0207709_10086590 | |||
| 2776 | Ga0207709_10090833 | |||
| 2777 | Ga0207709_10102032 | |||
| 2778 | Ga0207709_10120608 | |||
| 2779 | Ga0207709_10206581 | |||
| 2780 | Ga0207670_10045463 | |||
| 2781 | Ga0207669_10000321 | |||
| 2782 | Ga0207669_10051938 | |||
| 2783 | Ga0207669_10091373 | |||
| 2784 | Ga0207669_10093143 | |||
| 2785 | Ga0207669_10135214 | |||
| 2786 | Ga0207669_10135649 | |||
| 2787 | Ga0207704_10043537 | |||
| 2788 | Ga0207704_10074438 | |||
| 2789 | Ga0207665_10018374 | |||
| 2790 | Ga0207665_10042074 | |||
| 2791 | Ga0207691_10004828 | |||
| 2792 | Ga0207691_10019669 | |||
| 2793 | Ga0207691_10020522 | |||
| 2794 | Ga0207691_10145476 | |||
| 2795 | Ga0207711_10000988 | |||
| 2796 | Ga0207711_10005023 | |||
| 2797 | Ga0207711_10032150 | |||
| 2798 | Ga0207711_10053676 | |||
| 2799 | Ga0207711_10094465 | |||
| 2800 | Ga0207711_10100070 | |||
| 2801 | Ga0207711_10180181 | |||
| 2802 | Ga0207689_10050492 | |||
| 2803 | Ga0207661_10000257 | |||
| 2804 | Ga0207661_10011892 | |||
| 2805 | Ga0207661_10029811 | |||
| 2806 | Ga0207661_10039576 | |||
| 2807 | Ga0207661_10063407 | |||
| 2808 | Ga0207679_10297567 | |||
| 2809 | Ga0207667_10005061 | |||
| 2810 | Ga0207667_10020001 | |||
| 2811 | Ga0207667_10027633 | |||
| 2812 | Ga0207667_10045682 | |||
| 2813 | Ga0207667_10047897 | |||
| 2814 | Ga0207667_10083612 | |||
| 2815 | Ga0207667_10084614 | |||
| 2816 | Ga0207667_10129403 | |||
| 2817 | Ga0207667_10154487 | |||
| 2818 | Ga0207667_10182780 | |||
| 2819 | Ga0207667_10193446 | |||
| 2820 | Ga0207651_10192083 | |||
| 2821 | Ga0207712_10000010 | |||
| 2822 | Ga0207712_10012828 | |||
| 2823 | Ga0207712_10044673 | |||
| 2824 | Ga0207712_10074694 | |||
| 2825 | Ga0207712_10077306 | |||
| 2826 | Ga0207712_10177215 | |||
| 2827 | Ga0207668_10009380 | |||
| 2828 | Ga0207668_10025670 | |||
| 2829 | Ga0207668_10069477 | |||
| 2830 | Ga0207668_10079801 | |||
| 2831 | Ga0207668_10141430 | |||
| 2832 | Ga0207640_10272808 | |||
| 2833 | Ga0207658_10000278 | |||
| 2834 | Ga0207658_10070698 | |||
| 2835 | Ga0207658_10193554 | |||
| 2836 | Ga0207677_10046959 | |||
| 2837 | Ga0207677_10071358 | |||
| 2838 | Ga0207677_10082134 | |||
| 2839 | Ga0207703_10000013 | |||
| 2840 | Ga0207703_10000345 | |||
| 2841 | Ga0207703_10008645 | |||
| 2842 | Ga0207703_10011120 | |||
| 2843 | Ga0207703_10076268 | |||
| 2844 | Ga0207639_10016458 | |||
| 2845 | Ga0207639_10022472 | |||
| 2846 | Ga0207639_10035803 | |||
| 2847 | Ga0207639_10094180 | |||
| 2848 | Ga0207639_10152400 | |||
| 2849 | Ga0207678_10000229 | |||
| 2850 | Ga0207678_10019579 | |||
| 2851 | Ga0207678_10023067 | |||
| 2852 | Ga0207678_10029378 | |||
| 2853 | Ga0207678_10053285 | |||
| 2854 | Ga0207678_10084801 | |||
| 2855 | Ga0207678_10140891 | |||
| 2856 | Ga0207678_10203261 | |||
| 2857 | Ga0207678_10219045 | |||
| 2858 | Ga0207708_10000029 | |||
| 2859 | Ga0207708_10047044 | |||
| 2860 | Ga0207708_10067474 | |||
| 2861 | Ga0207708_10091878 | |||
| 2862 | Ga0207708_10226059 | |||
| 2863 | Ga0207702_10022503 | |||
| 2864 | Ga0207702_10032719 | |||
| 2865 | Ga0207702_10074804 | |||
| 2866 | Ga0207702_10094243 | |||
| 2867 | Ga0207702_10160339 | |||
| 2868 | Ga0207702_10215120 | |||
| 2869 | Ga0207702_10221456 | |||
| 2870 | Ga0207702_10236734 | |||
| 2871 | Ga0207641_10000784 | |||
| 2872 | Ga0207641_10001715 | |||
| 2873 | Ga0207641_10003875 | |||
| 2874 | Ga0207641_10169662 | |||
| 2875 | Ga0207648_10001482 | |||
| 2876 | Ga0207648_10017928 | |||
| 2877 | Ga0207648_10051302 | |||
| 2878 | Ga0207676_10208626 | |||
| 2879 | Ga0207674_10006801 | |||
| 2880 | Ga0207674_10009792 | |||
| 2881 | Ga0207674_10064434 | |||
| 2882 | Ga0207674_10127782 | |||
| 2883 | Ga0207674_10134200 | |||
| 2884 | Ga0207675_100003809 | |||
| 2885 | Ga0207675_100062849 | |||
| 2886 | Ga0207675_100127813 | |||
| 2887 | Ga0207675_100142217 | |||
| 2888 | Ga0207675_100174383 | |||
| 2889 | Ga0207683_10001283 | |||
| 2890 | Ga0207683_10003164 | |||
| 2891 | Ga0207683_10066126 | |||
| 2892 | Ga0207683_10186624 | |||
| 2893 | Ga0207683_10377498 | |||
| 2894 | Ga0207698_10062658 | |||
| 2895 | Ga0207698_10108734 | |||
| 2896 | Ga0207698_10157060 | |||
| 2897 | Ga0207698_10173142 | |||
| 2898 | Ga0207698_10217215 | |||
| 2899 | Ga0207698_10275758 | |||
| 2900 | Ga0207428_10010654 | |||
| 2901 | Ga0268266_10001660 | |||
| 2902 | Ga0268266_10004579 | |||
| 2903 | Ga0268266_10006280 | |||
| 2904 | Ga0268266_10012115 | |||
| 2905 | Ga0268266_10016431 | |||
| 2906 | Ga0268266_10044774 | |||
| 2907 | Ga0268266_10065440 | |||
| 2908 | Ga0268265_10000014 | |||
| 2909 | Ga0268265_10000041 | |||
| 2910 | Ga0268265_10043944 | |||
| 2911 | Ga0268265_10186334 | |||
| 2912 | Ga0268264_10000150 | |||
| 2913 | Ga0268264_10000210 | |||
| 2914 | Ga0268264_10000498 | |||
| 2915 | Ga0268264_10001010 | |||
| 2916 | Ga0268264_10491113 | |||
| 2917 | Ga0265337_1000861 | |||
| 2918 | Ga0265326_10001260 | |||
| 2919 | Ga0265319_1000828 | |||
| 2920 | Ga0265334_10000237 | |||
| 2921 | Ga0265318_10008654 | |||
| 2922 | Ga0265323_10005269 | |||
| 2923 | Ga0265322_10010118 | |||
| 2924 | Ga0265336_10002720 | |||
| 2925 | Ga0307515_10022361 | |||
| 2926 | Ga0307515_10037313 | |||
| 2927 | Ga0307515_10175114 | |||
| 2928 | Ga0265338_10000376 | |||
| 2929 | Ga0265338_10001480 | |||
| 2930 | Ga0265338_10015126 | |||
| 2931 | Ga0265324_10008950 | |||
| 2932 | Ga0307512_10004160 | |||
| 2933 | Ga0316177_1181774 | |||
| 2934 | Ga0316176_1121577 | |||
| 2935 | Ga0316176_1187053 | |||
| 2936 | Ga0314311_1118439 | |||
| 2937 | Ga0314311_1132449 | |||
| 2938 | Ga0316181_1233539 | |||
| 2939 | Ga0265332_10002532 | |||
| 2940 | Ga0265320_10000532 | |||
| 2941 | Ga0265340_10004583 | |||
| 2942 | Ga0265339_10030866 | |||
| 2943 | Ga0265331_10042159 | |||
| 2944 | Ga0265327_10003399 | |||
| 2945 | Ga0265316_10006104 | |||
| 2946 | Ga0265316_10050856 | |||
| 2947 | Ga0307513_10004729 | |||
| 2948 | Ga0307513_10006259 | |||
| 2949 | Ga0307513_10016777 | |||
| 2950 | Ga0307513_10202081 | |||
| 2951 | Ga0307408_100171077 | |||
| 2952 | Ga0307408_100191933 | |||
| 2953 | Ga0307408_100246721 | |||
| 2954 | Ga0307408_100281850 | |||
| 2955 | Ga0265313_10006611 | |||
| 2956 | Ga0307508_10135401 | |||
| 2957 | Ga0307514_10002631 | |||
| 2958 | Ga0307514_10011079 | |||
| 2959 | Ga0316575_10001074 | |||
| 2960 | Ga0316579_10006667 | |||
| 2961 | Ga0316579_10006821 | |||
| 2962 | Ga0316579_10039363 | |||
| 2963 | Ga0265314_10016241 | |||
| 2964 | Ga0265342_10022810 | |||
| 2965 | Ga0316576_10001380 | |||
| 2966 | Ga0316576_10003072 | |||
| 2967 | Ga0316576_10017375 | |||
| 2968 | Ga0316576_10040477 | |||
| 2969 | Ga0316576_10112338 | |||
| 2970 | Ga0316578_10002012 | |||
| 2971 | Ga0316578_10003078 | |||
| 2972 | Ga0316578_10017612 | |||
| 2973 | Ga0307405_10034091 | |||
| 2974 | Ga0307405_10039590 | |||
| 2975 | Ga0307405_10058979 | |||
| 2976 | Ga0307405_10164076 | |||
| 2977 | Ga0307405_10196397 | |||
| 2978 | Ga0316577_10023806 | |||
| 2979 | Ga0316577_10026975 | |||
| 2980 | Ga0307413_10039726 | |||
| 2981 | Ga0307413_10117076 | |||
| 2982 | Ga0307518_10000445 | |||
| 2983 | Ga0307518_10001456 | |||
| 2984 | Ga0307410_10005711 | |||
| 2985 | Ga0307410_10007860 | |||
| 2986 | Ga0307410_10059763 | |||
| 2987 | Ga0307410_10099559 | |||
| 2988 | Ga0307410_10161920 | |||
| 2989 | Ga0307410_10172421 | |||
| 2990 | Ga0307406_10000520 | |||
| 2991 | Ga0307406_10002180 | |||
| 2992 | Ga0307406_10007260 | |||
| 2993 | Ga0307406_10046164 | |||
| 2994 | Ga0307406_10069841 | |||
| 2995 | Ga0307406_10075032 | |||
| 2996 | Ga0307406_10082055 | |||
| 2997 | Ga0307406_10109972 | |||
| 2998 | Ga0307407_10037797 | |||
| 2999 | Ga0307407_10080214 | |||
| 3000 | Ga0307412_10010775 | |||
| 3001 | Ga0307412_10078687 | |||
| 3002 | Ga0307412_10109312 | |||
| 3003 | Ga0307409_100002130 | |||
| 3004 | Ga0307409_100002984 | |||
| 3005 | Ga0307409_100010167 | |||
| 3006 | Ga0307409_100021286 | |||
| 3007 | Ga0307409_100035071 | |||
| 3008 | Ga0307409_100075439 | |||
| 3009 | Ga0307409_100151170 | |||
| 3010 | Ga0307409_100168606 | |||
| 3011 | Ga0307416_100098400 | |||
| 3012 | Ga0307416_100100882 | |||
| 3013 | Ga0307416_100103395 | |||
| 3014 | Ga0307416_100121442 | |||
| 3015 | Ga0307416_100140122 | |||
| 3016 | Ga0307416_100176682 | |||
| 3017 | Ga0307416_100180815 | |||
| 3018 | Ga0307416_100495966 | |||
| 3019 | Ga0307414_10018011 | |||
| 3020 | Ga0307414_10023359 | |||
| 3021 | Ga0307414_10032644 | |||
| 3022 | Ga0307414_10040079 | |||
| 3023 | Ga0307414_10062940 | |||
| 3024 | Ga0307414_10086547 | |||
| 3025 | Ga0307414_10173992 | |||
| 3026 | Ga0307411_10043938 | |||
| 3027 | Ga0307411_10082429 | |||
| 3028 | Ga0307415_100002009 | |||
| 3029 | Ga0307415_100046464 | |||
| 3030 | Ga0307415_100064299 | |||
| 3031 | Ga0307415_100113327 | |||
| 3032 | Ga0316583_10020853 | |||
| 3033 | Ga0316585_10006425 | |||
| 3034 | Ga0316585_10012405 | |||
| 3035 | Ga0316585_10034867 | |||
| 3036 | Ga0316580_10004313 | |||
| 3037 | Ga0307507_10014085 | |||
| 3038 | Ga0307507_10045062 | |||
| 3039 | Ga0307507_10045348 | |||
| 3040 | Ga0307510_10037636 | |||
| 3041 | Ga0373926_0000004 | |||
| 3042 | Ga0373926_0003287 | |||
| 3043 | Ga0373926_0005331 | |||
| 3044 | Ga0373934_0004066 | |||
| 3045 | Ga0373934_0005307 | |||
| 3046 | Ga0373944_0000024 | |||
| 3047 | Ga0373944_0002808 | |||
| 3048 | Ga0373923_0009922 | |||
| 3049 | Ga0373936_0000240 | |||
| 3050 | Ga0373936_0000251 | |||
| 3051 | Ga0373936_0048159 | |||
| 3052 | Ga0373939_0026080 | |||
| 3053 | Ga0373945_0000140 | |||
| 3054 | Ga0373953_0033415 | |||
| 3055 | Ga0373954_0008715 | |||
| 3056 | Ga0373956_0002606 | |||
| 3057 | Ga0373956_0011366 | |||
| 3058 | Ga0373957_0031735 | |||
| 3059 | Ga0373943_0001314 | |||
| 3060 | Ga0373943_0007804 | |||
| 3061 | Ga0373946_0000089 | |||
| 3062 | Ga0373946_0000252 | |||
| 3063 | Ga0373946_0043766 | |||
| 3064 | Ga0373955_0004750 | |||
| 3065 | Ga0373955_0071397 | |||
| 3066 | Ga0373955_0120938 | |||
| 3067 | Ga0373942_0007025 | |||
| 3068 | Ga0316574_0000415 | |||
| 3069 | Ga0316574_0012915 | |||
| 3070 | Ga0316574_0025924 | |||
| 3071 | Ga0316574_0033681 | |||
| 3072 | Ga0316574_0136805 | |||
| 3073 | Ga0373924_0023755 | |||
| 3074 | Ga0373924_0039200 | |||
| 3075 | Ga0373931_0009909 | |||
| 3076 | Ga0373931_0017982 | |||
| 3077 | Ga0373935_0000586 | |||
| 3078 | Ga0373935_0000834 | |||
| 3079 | Ga0373935_0012962 | |||
| 3080 | Ga0373935_0064795 | |||
| 3081 | Ga0373927_0001993 | |||
| 3082 | Ga0373927_0001996 | |||
| 3083 | Ga0373927_0049873 | |||
| 3084 | Ga0373933_0020579 | |||
| 3085 | Ga0373933_0066690 | |||
| 3086 | Ga0373947_0000007 | |||
| 3087 | Ga0373947_0007154 | |||
| 3088 | Ga0373947_0007697 | |||
| 3089 | Ga0373937_0013695 | |||
| 3090 | Ga0373937_0206334 | |||
| 3091 | Ga0316582_0078006 | |||
| 3092 | Ga0316584_0000383 | |||
| 3093 | Ga0316584_0058602 | |||
| 3094 | Ga0316584_0082555 | |||
| 3095 | Ga0316584_0116975 | |||
| 3096 | Ga0373925_0000004 | |||
| 3097 | Ga0373925_0003736 | |||
| 3098 | Ga0373925_0012813 | |||
| 3099 | Ga0395899_0008790 | |||
| 3100 | Ga0395899_0015761 | |||
| 3101 | Ga0395899_0039667 | |||
| 3102 | Ga0395899_0070232 | |||
| 3103 | Ga0395899_0071152 | |||
| 3104 | Ga0395899_0123009 | |||
| 3105 | Ga0395900_0015052 | |||
| 3106 | Ga0395900_0035372 | |||
| 3107 | Ga0395900_0040502 | |||
| 3108 | Ga0395900_0074598 | |||
| 3109 | Ga0395900_0101893 | |||
| 3110 | Ga0395900_0112660 | |||
| 3111 | Ga0395900_0137294 | |||
| 3112 | Ga0395900_0140005 | |||
| 3113 | Ga0395900_0243208 | |||
| 3114 | Ga0395898_0000381 | |||
| 3115 | Ga0395898_0005576 | |||
| 3116 | Ga0395898_0011069 | |||
| 3117 | Ga0395898_0080616 | |||
| 3118 | Ga0395898_0115294 | |||
| 3119 | Ga0395905_0039073 | |||
| 3120 | Ga0395905_0056411 | |||
| 3121 | Ga0436364_0010700 | |||
| 3122 | Ga0436364_0048623 | |||
| 3123 | Ga0436364_1071680 | |||
| 3124 | Ga0436364_1508399 | |||
| 3125 | Ga0395901_0050485 | |||
| 3126 | Ga0395901_0064601 | |||
| 3127 | Ga0395901_0066733 | |||
| 3128 | Ga0395901_0076931 | |||
| 3129 | Ga0395901_0124894 | |||
| 3130 | Ga0395901_0133959 | |||
| 3131 | Ga0395901_0222281 | |||
| 3132 | Ga0395901_0257884 | |||
| 3133 | Ga0436365_1474856 | |||
| 3134 | Ga0436365_1712156 | |||
| 3135 | Ga0436360_0167640 | |||
| 3136 | Ga0436361_0615022 | |||
| 3137 | Ga0436362_0365102 | |||
| 3138 | Ga0439438_012377 | |||
| 3139 | Ga0439438_025400 | |||
| 3140 | Ga0439461_0000541 | |||
| 3141 | Ga0439461_0001042 | |||
| 3142 | Ga0439461_0006688 | |||
| 3143 | Ga0439461_0010106 | |||
| 3144 | Ga0439466_0001530 | |||
| 3145 | Ga0439466_0006330 | |||
| 3146 | Ga0439466_0008648 | |||
| 3147 | Ga0439466_0009136 | |||
| 3148 | Ga0439465_0003293 | |||
| 3149 | Ga0439465_0047901 | |||
| 3150 | Ga0439431_0000277 | |||
| 3151 | Ga0439431_0009936 | |||
| 3152 | Ga0439431_0013210 | |||
| 3153 | Ga0439431_0016012 | |||
| 3154 | Ga0439433_0000286 | |||
| 3155 | Ga0439433_0000832 | |||
| 3156 | Ga0439442_001243 | |||
| 3157 | Ga0439442_026371 | |||
| 3158 | Ga0439445_0000717 | |||
| 3159 | Ga0439448_0013319 | |||
| 3160 | Ga0439449_0001566 | |||
| 3161 | Ga0439449_0002451 | |||
| 3162 | Ga0439449_0014860 | |||
| 3163 | Ga0439451_004531 | |||
| 3164 | Ga0439452_005887 | |||
| 3165 | Ga0439454_002842 | |||
| 3166 | Ga0439457_000878 | |||
| 3167 | Ga0439457_002559 | |||
| 3168 | Ga0439462_0017634 | |||
| 3169 | Ga0450919_000123 | |||
| 3170 | Ga0450920_006112 | |||
| 3171 | Ga0439446_0008839 | |||
| 3172 | Ga0450908_002157 | |||
| 3173 | Ga0450909_001471 | |||
| 3174 | Ga0439434_0001620 | |||
| 3175 | Ga0439434_0002886 | |||
| 3176 | Ga0439460_0003464 | |||
| 3177 | Ga0450918_003166 | |||
| 3178 | Ga0466969_0014150 | |||
| 3179 | Ga0466969_0015497 | |||
| 3180 | Ga0466972_0002008 | |||
| 3181 | Ga0466972_0003353 | |||
| 3182 | Ga0466972_0006242 | |||
| 3183 | Ga0466972_0008483 | |||
| 3184 | Ga0466972_0016501 | |||
| 3185 | Ga0466972_0024952 | |||
| 3186 | Ga0466972_0025150 | |||
| 3187 | Ga0466972_0031016 | |||
| 3188 | Ga0466972_0095998 | |||
| 3189 | Ga0466965_0003901 | |||
| 3190 | Ga0466965_0005424 | |||
| 3191 | Ga0466965_0016410 | |||
| 3192 | Ga0466965_0025571 | |||
| 3193 | Ga0466965_0028877 | |||
| 3194 | Ga0466965_0031824 | |||
| 3195 | Ga0466965_0033743 | |||
| 3196 | Ga0466965_0047425 | |||
| 3197 | Ga0466965_0056670 | |||
| 3198 | Ga0466965_0066948 | |||
| 3199 | Ga0466965_0068084 | |||
| 3200 | Ga0466966_0002623 | |||
| 3201 | Ga0466966_0030855 | |||
| 3202 | Ga0466966_0037815 | |||
| 3203 | Ga0466966_0138687 | |||
| 3204 | Ga0466961_0031408 | |||
| 3205 | Ga0466961_0032806 | |||
| 3206 | Ga0466961_0038494 | |||
| 3207 | Ga0466961_0067481 | |||
| 3208 | Ga0466961_0087585 | |||
| 3209 | Ga0466961_0093599 | |||
| 3210 | Ga0466961_0119605 | |||
| 3211 | Ga0466961_0209194 | |||
| 3212 | Ga0466963_0002223 | |||
| 3213 | Ga0466963_0004617 | |||
| 3214 | Ga0466963_0009504 | |||
| 3215 | Ga0466963_0030660 | |||
| 3216 | Ga0466963_0053339 | |||
| 3217 | Ga0466963_0076175 | |||
| 3218 | Ga0466963_0079949 | |||
| 3219 | Ga0466963_0204422 | |||
| 3220 | Ga0466963_0222462 | |||
| 3221 | Ga0466964_0025463 | |||
| 3222 | Ga0466964_0027290 | |||
| 3223 | Ga0466964_0051855 | |||
| 3224 | Ga0466964_0095766 | |||
| 3225 | Ga0466971_0004615 | |||
| 3226 | Ga0466971_0044965 | |||
| 3227 | Ga0466971_0062121 | |||
| 3228 | Ga0466968_0007642 | |||
| 3229 | Ga0466968_0019763 | |||
| 3230 | Ga0466968_0051487 | |||
| 3231 | Ga0466970_0000093 | |||
| 3232 | Ga0466970_0004325 | |||
| 3233 | Ga0466970_0005681 | |||
| 3234 | Ga0466970_0006545 | |||
| 3235 | Ga0466970_0010125 | |||
| 3236 | Ga0466970_0013655 | |||
| 3237 | Ga0466970_0020060 | |||
| 3238 | Ga0466970_0034709 | |||
| 3239 | Ga0466970_0051568 | |||
| 3240 | Ga0466970_0052244 | |||
| 3241 | Ga0466970_0054498 | |||
| 3242 | Ga0466970_0100357 | |||
| 3243 | Ga0466957_0003409 | |||
| 3244 | Ga0466957_0027743 | |||
| 3245 | Ga0466957_0036044 | |||
| 3246 | Ga0466957_0050466 | |||
| 3247 | Ga0466957_0075158 | |||
| 3248 | Ga0466957_0111467 | |||
| 3249 | Ga0466960_0002117 | |||
| 3250 | Ga0466960_0002276 | |||
| 3251 | Ga0466960_0004115 | |||
| 3252 | Ga0466960_0009803 | |||
| 3253 | Ga0466960_0009870 | |||
| 3254 | Ga0466960_0010324 | |||
| 3255 | Ga0466960_0021256 | |||
| 3256 | Ga0466960_0028067 | |||
| 3257 | Ga0466960_0037032 | |||
| 3258 | Ga0466959_0001664 | |||
| 3259 | Ga0466959_0003675 | |||
| 3260 | Ga0466959_0006267 | |||
| 3261 | Ga0466959_0016450 | |||
| 3262 | Ga0466959_0019389 | |||
| 3263 | Ga0466959_0032967 | |||
| 3264 | Ga0466959_0059074 | |||
| 3265 | Ga0466959_0067718 | |||
| 3266 | Ga0466958_0001497 | |||
| 3267 | Ga0466958_0005259 | |||
| 3268 | Ga0466958_0018627 | |||
| 3269 | Ga0466958_0034064 | |||
| 3270 | Ga0466958_0034141 | |||
| 3271 | Ga0466958_0056887 | |||
| 3272 | Ga0466958_0135562 | |||
| 3273 | Ga0466967_0005159 | |||
| 3274 | Ga0466967_0005915 | |||
| 3275 | Ga0466967_0013641 | |||
| 3276 | Ga0466967_0026874 | |||
| 3277 | Ga0466967_0029449 | |||
| 3278 | Ga0466967_0030435 | |||
| 3279 | Ga0466967_0031939 | |||
| 3280 | Ga0466967_0037879 | |||
| 3281 | Ga0466967_0050474 | |||
| 3282 | Ga0466967_0062509 | |||
| 3283 | Ga0466967_0064440 | |||
| 3284 | Ga0466967_0073397 | |||
| 3285 | Ga0466967_0084129 | |||
| 3286 | Ga0466967_0089613 | |||
| 3287 | Ga0466967_0119981 | |||
| 3288 | Ga0466967_0124268 | |||
| 3289 | Ga0466967_0143959 | |||
| 3290 | Ga0466967_0163864 | |||
| 3291 | Ga0466967_0257291 | |||
| 3292 | Ga0466967_0273131 | |||
| 3293 | Ga0495627_001142 | |||
| 3294 | Ga0495592_0038444 | |||
| 3295 | Ga0495603_0000513 | |||
| 3296 | Ga0495603_0005295 | |||
| 3297 | Ga0495603_0008346 | |||
| 3298 | Ga0495603_0051227 | |||
| 3299 | Ga0495603_0096202 | |||
| 3300 | Ga0495590_0000413 | |||
| 3301 | Ga0495629_0007624 | |||
| 3302 | Ga0495629_0021240 | |||
| 3303 | Ga0495629_0022859 | |||
| 3304 | Ga0495638_0014114 | |||
| 3305 | Ga0495638_0029044 | |||
| 3306 | Ga0495638_0078942 | |||
| 3307 | Ga0495641_0006042 | |||
| 3308 | Ga0495641_0022516 | |||
| 3309 | Ga0495651_0017310 | |||
| 3310 | Ga0495653_0060532 | |||
| 3311 | Ga0495653_0073595 | |||
| 3312 | Ga0495653_0103440 | |||
| 3313 | Ga0495650_0000130 | |||
| 3314 | Ga0495650_0084504 | |||
| 3315 | Ga0495580_0016410 | |||
| 3316 | Ga0495580_0021278 | |||
| 3317 | Ga0495582_0000875 | |||
| 3318 | Ga0495582_0019590 | |||
| 3319 | Ga0495582_0050291 | |||
| 3320 | Ga0495639_0004796 | |||
| 3321 | Ga0495662_0000821 | |||
| 3322 | Ga0495662_0018450 | |||
| 3323 | Ga0495662_0076855 | |||
| 3324 | Ga0495664_0001916 | |||
| 3325 | Ga0495664_0004512 | |||
| 3326 | Ga0495594_0003942 | |||
| 3327 | Ga0495594_0003955 | |||
| 3328 | Ga0495608_0028759 | |||
| 3329 | Ga0495608_0044556 | |||
| 3330 | Ga0495618_0007805 | |||
| 3331 | Ga0495618_0073876 | |||
| 3332 | Ga0495630_0001272 | |||
| 3333 | Ga0495630_0009755 | |||
| 3334 | Ga0495630_0137601 | |||
| 3335 | Ga0495630_0196151 | |||
| 3336 | Ga0495643_0077189 | |||
| 3337 | Ga0495644_0013017 | |||
| 3338 | Ga0495648_0002340 | |||
| 3339 | Ga0495648_0014540 | |||
| 3340 | Ga0495663_0021342 | |||
| 3341 | Ga0495663_0045978 | |||
| 3342 | Ga0495666_0000235 | |||
| 3343 | Ga0495666_0041008 | |||
| 3344 | Ga0495642_0048447 | |||
| 3345 | Ga0495652_0013787 | |||
| 3346 | Ga0495654_0057629 | |||
| 3347 | Ga0495665_0000915 | |||
| 3348 | Ga0495665_0008383 | |||
| 3349 | Ga0495640_0001181 | |||
| 3350 | Ga0495640_0029616 | |||
| 3351 | Ga0495640_0076097 | |||
| 3352 | Ga0495586_0000409 | |||
| 3353 | Ga0495586_0011384 | |||
| 3354 | Ga0495587_0018456 | |||
| 3355 | Ga0495587_0036249 | |||
| 3356 | Ga0495598_0032263 | |||
| 3357 | Ga0495645_0063671 | |||
| 3358 | Ga0495667_0000837 | |||
| 3359 | Ga0495667_0006229 | |||
| 3360 | Ga0495667_0031962 | |||
| 3361 | Ga0495656_0071703 | |||
| 3362 | Ga0495668_0000505 | |||
| 3363 | Ga0495634_0003288 | |||
| 3364 | Ga0495634_0046259 | |||
| 3365 | Ga0495634_0051142 | |||
| 3366 | Ga0495611_0028770 | |||
| 3367 | Ga0495635_0000906 | |||
| 3368 | Ga0495635_0001201 | |||
| 3369 | Ga0495635_0006925 | |||
| 3370 | Ga0495635_0055240 | |||
| 3371 | Ga0495659_0008125 | |||
| 3372 | Ga0495661_0054323 | |||
| 3373 | Ga0495588_0000268 | |||
| 3374 | Ga0495588_0010400 | |||
| 3375 | Ga0495588_0011453 | |||
| 3376 | Ga0495588_0017198 | |||
| 3377 | Ga0495588_0027537 | |||
| 3378 | Ga0495588_0129165 | |||
| 3379 | Ga0495657_0013583 | |||
| 3380 | Ga0495657_0015029 | |||
| 3381 | Ga0495599_0007443 | |||
| 3382 | Ga0495623_0063776 | |||
| 3383 | Ga0495646_0037868 | |||
| 3384 | Ga0495647_0047038 | |||
| 3385 | Ga0495658_0000153 | |||
| 3386 | Ga0495658_0018789 | |||
| 3387 | Ga0495658_0049811 | |||
| 3388 | Ga0495658_0064346 | |||
| 3389 | Ga0495669_0047978 | |||
| 3390 | Ga0495613_0001237 | |||
| 3391 | Ga0495613_0038133 | |||
| 3392 | Ga0495613_0077661 | |||
| 3393 | Ga0495613_0230058 | |||
| 3394 | Ga0495624_0000364 | |||
| 3395 | Ga0495624_0002578 | |||
| 3396 | Ga0495670_0044085 | |||
| 3397 | Ga0495581_0000789 | |||
| 3398 | Ga0495581_0045150 | |||
| 3399 | Ga0495581_0053428 | |||
| 3400 | Ga0495581_0078280 | |||
| 3401 | Ga0495581_0079686 | |||
| 3402 | Ga0495604_0034564 | |||
| 3403 | Ga0495604_0088785 | |||
| 3404 | Ga0495604_0131629 | |||
| 3405 | Ga0495604_0178944 | |||
| 3406 | Ga0495636_0013480 | |||
| 3407 | Ga0495674_0000640 | |||
| 3408 | Ga0495674_0009189 | |||
| 3409 | Ga0495674_0034201 | |||
| 3410 | Ga0495674_0043532 | |||
| 3411 | Ga0495672_0002784 | |||
| 3412 | Ga0495672_0011138 | |||
| 3413 | Ga0495672_0086173 | |||
| 3414 | Ga0495676_0015473 | |||
| 3415 | Ga0495676_0019442 | |||
| 3416 | Ga0495676_0019639 | |||
| 3417 | Ga0495676_0098413 | |||
| 3418 | Ga0495680_0004541 | |||
| 3419 | Ga0495680_0012084 | |||
| 3420 | Ga0495680_0110904 | |||
| 3421 | Ga0495683_0001180 | |||
| 3422 | Ga0495677_0042011 | |||
| 3423 | Ga0495673_0045644 | |||
| 3424 | Ga0495684_0008105 | |||
| 3425 | Ga0495684_0034970 | |||
| 3426 | Ga0495684_0049619 | |||
| 3427 | Ga0495686_0008844 | |||
| 3428 | Ga0495686_0058772 | |||
| 3429 | Ga0495593_0003161 | |||
| 3430 | Ga0495593_0109889 | |||
| 3431 | Ga0495602_0054850 | |||
| 3432 | Ga0495602_0131483 | |||
| 3433 | Ga0495614_0000110 | |||
| 3434 | Ga0495614_0000222 | |||
| 3435 | Ga0495615_0018625 | |||
| 3436 | Ga0496100_0000097 | |||
| 3437 | Ga0496100_0001715 | |||
| 3438 | Ga0496100_0002885 | |||
| 3439 | Ga0496100_0007957 | |||
| 3440 | Ga0496100_0021361 | |||
| 3441 | Ga0496100_0182178 | |||
| 3442 | Ga0496101_0000032 | |||
| 3443 | Ga0496101_0000178 | |||
| 3444 | Ga0496101_0002214 | |||
| 3445 | Ga0496101_0002271 | |||
| 3446 | Ga0496101_0015250 | |||
| 3447 | Ga0496101_0016940 | |||
| 3448 | Ga0496101_0019798 | |||
| 3449 | Ga0496101_0022334 | |||
| 3450 | Ga0496101_0033514 | |||
| 3451 | Ga0496101_0071443 | |||
| 3452 | Ga0496101_0127472 | |||
| 3453 | Ga0496102_0000011 | |||
| 3454 | Ga0496102_0000235 | |||
| 3455 | Ga0496102_0000236 | |||
| 3456 | Ga0496102_0002707 | |||
| 3457 | Ga0496102_0004544 | |||
| 3458 | Ga0496102_0007433 | |||
| 3459 | Ga0496102_0024381 | |||
| 3460 | Ga0496102_0028244 | |||
| 3461 | Ga0496102_0042950 | |||
| 3462 | Ga0496102_0057352 | |||
| 3463 | Ga0496102_0067913 | |||
| 3464 | Ga0496102_0071661 | |||
| 3465 | Ga0496102_0077190 | |||
| 3466 | Ga0496102_0079158 | |||
| 3467 | Ga0496102_0107025 | |||
| 3468 | Ga0496102_0129236 | |||
| 3469 | Ga0496102_0131604 | |||
| 3470 | Ga0496102_0268364 | |||
| 3471 | Ga0496102_0300459 | |||
| 3472 | Ga0496102_0346132 | |||
| 3473 | Ga0496103_0000032 | |||
| 3474 | Ga0496103_0000185 | |||
| 3475 | Ga0496103_0000460 | |||
| 3476 | Ga0496103_0000624 | |||
| 3477 | Ga0496103_0001651 | |||
| 3478 | Ga0496103_0007239 | |||
| 3479 | Ga0496103_0008384 | |||
| 3480 | Ga0496103_0071566 | |||
| 3481 | Ga0496103_0071855 | |||
| 3482 | Ga0496103_0102378 | |||
| 3483 | Ga0496103_0146301 | |||
| 3484 | Ga0496103_0158986 | |||
| 3485 | Ga0496104_0003431 | |||
| 3486 | Ga0496104_0004891 | |||
| 3487 | Ga0496104_0031350 | |||
| 3488 | Ga0496104_0068187 | |||
| 3489 | Ga0496104_0072889 | |||
| 3490 | Ga0496104_0075539 | |||
| 3491 | Ga0496104_0089024 | |||
| 3492 | Ga0496104_0092303 | |||
| 3493 | Ga0496104_0135208 | |||
| 3494 | Ga0496104_0140953 | |||
| 3495 | Ga0496104_0170360 | |||
| 3496 | Ga0496104_0434350 | |||
| 3497 | Ga0496105_0004208 | |||
| 3498 | Ga0496105_0004455 | |||
| 3499 | Ga0496105_0009001 | |||
| 3500 | Ga0496105_0014439 | |||
| 3501 | Ga0496105_0018442 | |||
| 3502 | Ga0496105_0020815 | |||
| 3503 | Ga0496105_0036703 | |||
| 3504 | Ga0496105_0105827 | |||
| 3505 | Ga0496105_0157242 | |||
| 3506 | Ga0496105_0227897 | |||
| 3507 | Ga0496105_0233856 | |||
| 3508 | Ga0496106_0000417 | |||
| 3509 | Ga0496106_0000768 | |||
| 3510 | Ga0496106_0039704 | |||
| 3511 | Ga0496106_0054231 | |||
| 3512 | Ga0496106_0072794 | |||
| 3513 | Ga0496106_0077479 | |||
| 3514 | Ga0496106_0115837 | |||
| 3515 | Ga0496106_0120446 | |||
| 3516 | Ga0496106_0160339 | |||
| 3517 | Ga0496106_0202541 | |||
| 3518 | Ga0496106_0305993 | |||
| 3519 | Ga0496107_0001611 | |||
| 3520 | Ga0496107_0002827 | |||
| 3521 | Ga0496107_0022212 | |||
| 3522 | Ga0496107_0027443 | |||
| 3523 | Ga0496107_0030297 | |||
| 3524 | Ga0496107_0114477 | |||
| 3525 | Ga0496108_0001698 | |||
| 3526 | Ga0496108_0015334 | |||
| 3527 | Ga0496108_0020224 | |||
| 3528 | Ga0496108_0026361 | |||
| 3529 | Ga0496108_0039938 | |||
| 3530 | Ga0496108_0043103 | |||
| 3531 | Ga0496108_0064850 | |||
| 3532 | Ga0496108_0075778 | |||
| 3533 | Ga0496108_0088604 | |||
| 3534 | Ga0496108_0113673 | |||
| 3535 | Ga0496108_0313142 | |||
| 3536 | Ga0496108_0362172 | |||
| 3537 | Ga0496109_0000305 | |||
| 3538 | Ga0496109_0005372 | |||
| 3539 | Ga0496109_0011265 | |||
| 3540 | Ga0496109_0013718 | |||
| 3541 | Ga0496109_0014775 | |||
| 3542 | Ga0496109_0023643 | |||
| 3543 | Ga0496109_0041162 | |||
| 3544 | Ga0496109_0045826 | |||
| 3545 | Ga0496109_0071036 | |||
| 3546 | Ga0496109_0091869 | |||
| 3547 | Ga0496109_0221244 | |||
| 3548 | Ga0496109_0226132 | |||
| 3549 | Ga0496110_0002915 | |||
| 3550 | Ga0496110_0006568 | |||
| 3551 | Ga0496110_0023163 | |||
| 3552 | Ga0496110_0023479 | |||
| 3553 | Ga0496110_0049961 | |||
| 3554 | Ga0496110_0068720 | |||
| 3555 | Ga0496110_0112705 | |||
| 3556 | Ga0496110_0112870 | |||
| 3557 | Ga0496110_0113775 | |||
| 3558 | Ga0496110_0134866 | |||
| 3559 | Ga0496110_0185899 | |||
| 3560 | Ga0496111_0005153 | |||
| 3561 | Ga0496111_0016859 | |||
| 3562 | Ga0496111_0047481 | |||
| 3563 | Ga0496111_0063129 | |||
| 3564 | Ga0496111_0090424 | |||
| 3565 | Ga0496111_0160860 | |||
| 3566 | Ga0496111_0186655 | |||
| 3567 | Ga0496112_0013235 | |||
| 3568 | Ga0496112_0038767 | |||
| 3569 | Ga0496112_0063842 | |||
| 3570 | Ga0496112_0070088 | |||
| 3571 | Ga0496112_0099862 | |||
| 3572 | Ga0496112_0113579 | |||
| 3573 | Ga0496112_0320244 | |||
| 3574 | Ga0496113_0004384 | |||
| 3575 | Ga0496113_0032886 | |||
| 3576 | Ga0496113_0048809 | |||
| 3577 | Ga0496113_0117004 | |||
| 3578 | Ga0496113_0145554 | |||
| 3579 | Ga0496113_0160149 | |||
| 3580 | Ga0496113_0161097 | |||
| 3581 | Ga0496113_0176928 | |||
| 3582 | Ga0496113_0242173 | |||
| 3583 | Ga0496113_0293049 | |||
| 3584 | Ga0496114_0000856 | |||
| 3585 | Ga0496114_0002897 | |||
| 3586 | Ga0496114_0003794 | |||
| 3587 | Ga0496114_0004945 | |||
| 3588 | Ga0496114_0005170 | |||
| 3589 | Ga0496114_0008988 | |||
| 3590 | Ga0496114_0010173 | |||
| 3591 | Ga0496114_0010762 | |||
| 3592 | Ga0496114_0024643 | |||
| 3593 | Ga0496114_0026758 | |||
| 3594 | Ga0496114_0159077 | |||
| 3595 | Ga0496114_0207769 | |||
| 3596 | Ga0496114_0266356 | |||
| 3597 | Ga0496114_0296868 | |||
| 3598 | Ga0496115_0008488 | |||
| 3599 | Ga0496115_0011413 | |||
| 3600 | Ga0496115_0012370 | |||
| 3601 | Ga0496115_0014232 | |||
| 3602 | Ga0496115_0024138 | |||
| 3603 | Ga0496115_0025689 | |||
| 3604 | Ga0496115_0030427 | |||
| 3605 | Ga0496115_0107161 | |||
| 3606 | Ga0496115_0109880 | |||
| 3607 | Ga0496116_0000072 | |||
| 3608 | Ga0496116_0000192 | |||
| 3609 | Ga0496116_0000340 | |||
| 3610 | Ga0496116_0004507 | |||
| 3611 | Ga0496116_0006124 | |||
| 3612 | Ga0496116_0040697 | |||
| 3613 | Ga0496116_0044629 | |||
| 3614 | Ga0496116_0077370 | |||
| 3615 | Ga0496117_0000039 | |||
| 3616 | Ga0496117_0000273 | |||
| 3617 | Ga0496117_0000387 | |||
| 3618 | Ga0496117_0000603 | |||
| 3619 | Ga0496117_0001092 | |||
| 3620 | Ga0496117_0001118 | |||
| 3621 | Ga0496117_0003783 | |||
| 3622 | Ga0496117_0011201 | |||
| 3623 | Ga0496117_0026526 | |||
| 3624 | Ga0496117_0029438 | |||
| 3625 | Ga0496117_0082135 | |||
| 3626 | Ga0496117_0104653 | |||
| 3627 | Ga0496118_0000035 | |||
| 3628 | Ga0496118_0000096 | |||
| 3629 | Ga0496118_0000455 | |||
| 3630 | Ga0496118_0000610 | |||
| 3631 | Ga0496118_0005126 | |||
| 3632 | Ga0496118_0006081 | |||
| 3633 | Ga0496118_0012779 | |||
| 3634 | Ga0496118_0013007 | |||
| 3635 | Ga0496118_0042972 | |||
| 3636 | Ga0496118_0056178 | |||
| 3637 | Ga0496118_0089622 | |||
| 3638 | Ga0496119_0000035 | |||
| 3639 | Ga0496119_0000340 | |||
| 3640 | Ga0496119_0000437 | |||
| 3641 | Ga0496119_0000617 | |||
| 3642 | Ga0496119_0002053 | |||
| 3643 | Ga0496119_0006039 | |||
| 3644 | Ga0496119_0007359 | |||
| 3645 | Ga0496119_0009886 | |||
| 3646 | Ga0496119_0013009 | |||
| 3647 | Ga0496119_0014900 | |||
| 3648 | Ga0496119_0015958 | |||
| 3649 | Ga0496119_0032105 | |||
| 3650 | Ga0496119_0032848 | |||
| 3651 | Ga0496119_0037248 | |||
| 3652 | Ga0496119_0050977 | |||
| 3653 | Ga0496119_0085588 | |||
| 3654 | Ga0496120_0000079 | |||
| 3655 | Ga0496120_0000372 | |||
| 3656 | Ga0496120_0001715 | |||
| 3657 | Ga0496120_0002620 | |||
| 3658 | Ga0496120_0008527 | |||
| 3659 | Ga0496120_0011616 | |||
| 3660 | Ga0496120_0019430 | |||
| 3661 | Ga0496120_0095399 | |||
| 3662 | Ga0496121_0000004 | |||
| 3663 | Ga0496121_0000015 | |||
| 3664 | Ga0496121_0000546 | |||
| 3665 | Ga0496121_0002237 | |||
| 3666 | Ga0496121_0004937 | |||
| 3667 | Ga0496121_0013057 | |||
| 3668 | Ga0496121_0022488 | |||
| 3669 | Ga0496121_0037750 | |||
| 3670 | Ga0496121_0066703 | |||
| 3671 | Ga0496122_0000020 | |||
| 3672 | Ga0496122_0000795 | |||
| 3673 | Ga0496122_0001425 | |||
| 3674 | Ga0496122_0004303 | |||
| 3675 | Ga0496122_0015517 | |||
| 3676 | Ga0496122_0016794 | |||
| 3677 | Ga0496122_0017673 | |||
| 3678 | Ga0496122_0028074 | |||
| 3679 | Ga0496122_0045039 | |||
| 3680 | Ga0496122_0105451 | |||
| 3681 | Ga0496122_0143312 | |||
| 3682 | Ga0496123_0000003 | |||
| 3683 | Ga0496123_0000951 | |||
| 3684 | Ga0496123_0007387 | |||
| 3685 | Ga0496123_0011837 | |||
| 3686 | Ga0496123_0015631 | |||
| 3687 | Ga0496123_0022138 | |||
| 3688 | Ga0496123_0025167 | |||
| 3689 | Ga0496124_0000012 | |||
| 3690 | Ga0496124_0000135 | |||
| 3691 | Ga0496124_0002749 | |||
| 3692 | Ga0496124_0008894 | |||
| 3693 | Ga0496124_0009299 | |||
| 3694 | Ga0496124_0035580 | |||
| 3695 | Ga0496124_0043473 | |||
| 3696 | Ga0496124_0090835 | |||
| 3697 | Ga0496124_0107082 | |||
| 3698 | Ga0496124_0144633 | |||
| 3699 | Ga0496125_0000003 | |||
| 3700 | Ga0496125_0000128 | |||
| 3701 | Ga0496125_0000209 | |||
| 3702 | Ga0496125_0000859 | |||
| 3703 | Ga0496125_0002332 | |||
| 3704 | Ga0496125_0002425 | |||
| 3705 | Ga0496125_0016465 | |||
| 3706 | Ga0496125_0024752 | |||
| 3707 | Ga0496125_0034370 | |||
| 3708 | Ga0496125_0055163 | |||
| 3709 | Ga0496125_0058704 | |||
| 3710 | Ga0496125_0061796 | |||
| 3711 | Ga0496125_0103900 | |||
| 3712 | Ga0496126_0000001 | |||
| 3713 | Ga0496126_0000123 | |||
| 3714 | Ga0496126_0000246 | |||
| 3715 | Ga0496126_0000547 | |||
| 3716 | Ga0496126_0004322 | |||
| 3717 | Ga0496126_0005415 | |||
| 3718 | Ga0496126_0005422 | |||
| 3719 | Ga0496126_0006761 | |||
| 3720 | Ga0496126_0009000 | |||
| 3721 | Ga0496126_0033062 | |||
| 3722 | Ga0496126_0033726 | |||
| 3723 | Ga0496126_0035255 | |||
| 3724 | Ga0496126_0035799 | |||
| 3725 | Ga0496126_0058035 | |||
| 3726 | Ga0496126_0061064 | |||
| 3727 | Ga0496126_0068695 | |||
| 3728 | Ga0496126_0084657 | |||
| 3729 | Ga0496126_0088878 | |||
| 3730 | Ga0496126_0090950 | |||
| 3731 | Ga0496126_0098562 | |||
| 3732 | Ga0496126_0121614 | |||
| 3733 | Ga0496126_0246344 | |||
| 3734 | Ga0501309_003333 | |||
| 3735 | Ga0501305_008308 | |||
| 3736 | Ga0501307_005589 | |||
| 3737 | Ga0501311_006846 | |||
| 3738 | Ga0501312_001617 | |||
| 3739 | Ga0501313_005060 | |||
| 3740 | Ga0501315_005844 | |||
| 3741 | Ga0501315_006619 | |||
| 3742 | Ga0501316_000498 | |||
| 3743 | Ga0501318_005390 | |||
| 3744 | Ga0501321_003486 | |||
| 3745 | Ga0501321_004061 | |||
| 3746 | Ga0501323_004697 | |||
| 3747 | Ga0501324_002466 | |||
| 3748 | Ga0501325_001168 | |||
| 3749 | Ga0501335_000889 | |||
| 3750 | Ga0501031_0000870 | |||
| 3751 | Ga0501031_0007030 | |||
| 3752 | Ga0501031_0010393 | |||
| 3753 | Ga0501031_0012245 | |||
| 3754 | Ga0501031_0045672 | |||
| 3755 | Ga0501031_0089772 | |||
| 3756 | Ga0501031_0090382 | |||
| 3757 | Ga0501032_0001154 | |||
| 3758 | Ga0501032_0001277 | |||
| 3759 | Ga0501032_0002711 | |||
| 3760 | Ga0501032_0008178 | |||
| 3761 | Ga0501032_0033588 | |||
| 3762 | Ga0501032_0071221 | |||
| 3763 | Ga0501032_0102712 | |||
| 3764 | Ga0501033_0003100 | |||
| 3765 | Ga0501033_0007412 | |||
| 3766 | Ga0501033_0044237 | |||
| 3767 | Ga0501033_0060294 | |||
| 3768 | Ga0501033_0060590 | |||
| 3769 | Ga0501033_0070028 | |||
| 3770 | Ga0501034_0000112 | |||
| 3771 | Ga0501034_0000672 | |||
| 3772 | Ga0501034_0008588 | |||
| 3773 | Ga0501034_0013440 | |||
| 3774 | Ga0501034_0017156 | |||
| 3775 | Ga0501034_0023234 | |||
| 3776 | Ga0501034_0025497 | |||
| 3777 | Ga0501034_0034048 | |||
| 3778 | Ga0501034_0046877 | |||
| 3779 | Ga0501034_0076870 | |||
| 3780 | Ga0501034_0114513 | |||
| 3781 | Ga0501034_0142301 | |||
| 3782 | Ga0501036_0002900 | |||
| 3783 | Ga0501036_0004295 | |||
| 3784 | Ga0501036_0013420 | |||
| 3785 | Ga0501036_0016775 | |||
| 3786 | Ga0501036_0325757 | |||
| 3787 | Ga0501037_0000110 | |||
| 3788 | Ga0501037_0004426 | |||
| 3789 | Ga0501037_0006221 | |||
| 3790 | Ga0501037_0010166 | |||
| 3791 | Ga0501037_0012462 | |||
| 3792 | Ga0501037_0056202 | |||
| 3793 | Ga0501037_0082702 | |||
| 3794 | Ga0501037_0176832 | |||
| 3795 | Ga0501038_0003260 | |||
| 3796 | Ga0501038_0010528 | |||
| 3797 | Ga0501038_0014550 | |||
| 3798 | Ga0501038_0024701 | |||
| 3799 | Ga0501038_0032164 | |||
| 3800 | Ga0501038_0051802 | |||
| 3801 | Ga0501038_0190298 | |||
| 3802 | Ga0501039_0000736 | |||
| 3803 | Ga0501039_0000850 | |||
| 3804 | Ga0501039_0001189 | |||
| 3805 | Ga0501039_0009621 | |||
| 3806 | Ga0501039_0016611 | |||
| 3807 | Ga0501039_0026165 | |||
| 3808 | Ga0501039_0047333 | |||
| 3809 | Ga0501039_0053386 | |||
| 3810 | Ga0501040_0000341 | |||
| 3811 | Ga0501040_0000580 | |||
| 3812 | Ga0501040_0003562 | |||
| 3813 | Ga0501040_0006598 | |||
| 3814 | Ga0501041_0000246 | |||
| 3815 | Ga0501041_0009959 | |||
| 3816 | Ga0501041_0030224 | |||
| 3817 | Ga0501041_0071012 | |||
| 3818 | Ga0501041_0087092 | |||
| 3819 | Ga0501042_0000686 | |||
| 3820 | Ga0501042_0005870 | |||
| 3821 | Ga0501042_0006117 | |||
| 3822 | Ga0501042_0015173 | |||
| 3823 | Ga0501042_0021443 | |||
| 3824 | Ga0501042_0092887 | |||
| 3825 | Ga0501043_0001848 | |||
| 3826 | Ga0501043_0013658 | |||
| 3827 | Ga0501043_0017486 | |||
| 3828 | Ga0501043_0028591 | |||
| 3829 | Ga0501043_0071980 | |||
| 3830 | Ga0501043_0112879 | |||
| 3831 | Ga0501043_0156350 | |||
| 3832 | Ga0501043_0192190 | |||
| 3833 | Ga0501043_0218664 | |||
| 3834 | Ga0501046_0002303 | |||
| 3835 | Ga0501046_0003132 | |||
| 3836 | Ga0501046_0006458 | |||
| 3837 | Ga0501046_0016573 | |||
| 3838 | Ga0501046_0068395 | |||
| 3839 | Ga0501047_0000033 | |||
| 3840 | Ga0501047_0000405 | |||
| 3841 | Ga0501047_0001186 | |||
| 3842 | Ga0501047_0004112 | |||
| 3843 | Ga0501047_0011253 | |||
| 3844 | Ga0501047_0030469 | |||
| 3845 | Ga0501047_0038344 | |||
| 3846 | Ga0501047_0058872 | |||
| 3847 | Ga0501047_0077238 | |||
| 3848 | Ga0501047_0229502 | |||
| 3849 | Ga0501047_0274480 | |||
| 3850 | Ga0501048_0000216 | |||
| 3851 | Ga0501048_0001561 | |||
| 3852 | Ga0501048_0004301 | |||
| 3853 | Ga0501048_0006150 | |||
| 3854 | Ga0501048_0006447 | |||
| 3855 | Ga0501048_0016662 | |||
| 3856 | Ga0501067_0000725 | |||
| 3857 | Ga0501067_0078387 | |||
| 3858 | Ga0501068_0081071 | |||
| 3859 | Ga0501069_0028354 | |||
| 3860 | Ga0501069_0062124 | |||
| 3861 | Ga0501069_0080869 | |||
| 3862 | Ga0501069_0099180 | |||
| 3863 | Ga0501070_0000165 | |||
| 3864 | Ga0501070_0000181 | |||
| 3865 | Ga0501070_0002694 | |||
| 3866 | Ga0501070_0004105 | |||
| 3867 | Ga0501070_0005678 | |||
| 3868 | Ga0501070_0010602 | |||
| 3869 | Ga0501070_0015185 | |||
| 3870 | Ga0501070_0028759 | |||
| 3871 | Ga0501070_0033327 | |||
| 3872 | Ga0501070_0049412 | |||
| 3873 | Ga0501070_0066146 | |||
| 3874 | Ga0501070_0095561 | |||
| 3875 | Ga0501070_0147320 | |||
| 3876 | Ga0501071_0000275 | |||
| 3877 | Ga0501071_0000327 | |||
| 3878 | Ga0501071_0001195 | |||
| 3879 | Ga0501071_0015881 | |||
| 3880 | Ga0501071_0044267 | |||
| 3881 | Ga0501071_0063337 | |||
| 3882 | Ga0501071_0123285 | |||
| 3883 | Ga0501072_0000093 | |||
| 3884 | Ga0501072_0007441 | |||
| 3885 | Ga0501072_0063803 | |||
| 3886 | Ga0501073_0000030 | |||
| 3887 | Ga0501073_0004926 | |||
| 3888 | Ga0501073_0019857 | |||
| 3889 | Ga0501073_0072187 | |||
| 3890 | Ga0501074_0010064 | |||
| 3891 | Ga0501074_0025535 | |||
| 3892 | Ga0501074_0025561 | |||
| 3893 | Ga0501074_0034463 | |||
| 3894 | Ga0501075_0001636 | |||
| 3895 | Ga0501075_0009734 | |||
| 3896 | Ga0501075_0045189 | |||
| 3897 | Ga0501075_0065901 | |||
| 3898 | Ga0501076_0000260 | |||
| 3899 | Ga0501076_0000392 | |||
| 3900 | Ga0501076_0013969 | |||
| 3901 | Ga0501076_0048562 | |||
| 3902 | Ga0501076_0075672 | |||
| 3903 | Ga0501077_0000085 | |||
| 3904 | Ga0501077_0009209 | |||
| 3905 | Ga0501077_0110649 | |||
| 3906 | Ga0501243_007284 | |||
| 3907 | Ga0501079_0000790 | |||
| 3908 | Ga0501079_0001021 | |||
| 3909 | Ga0501079_0074759 | |||
| 3910 | Ga0501080_0000023 | |||
| 3911 | Ga0501080_0005898 | |||
| 3912 | Ga0501080_0020356 | |||
| 3913 | Ga0501080_0057567 | |||
| 3914 | Ga0501080_0119618 | |||
| 3915 | Ga0501080_0203250 | |||
| 3916 | Ga0501081_0001553 | |||
| 3917 | Ga0501081_0015758 | |||
| 3918 | Ga0501081_0023093 | |||
| 3919 | Ga0501081_0029959 | |||
| 3920 | Ga0501081_0041679 | |||
| 3921 | Ga0501081_0183740 | |||
| 3922 | Ga0501083_0000059 | |||
| 3923 | Ga0501083_0027619 | |||
| 3924 | Ga0501083_0124905 | |||
| 3925 | Ga0501035_0000283 | |||
| 3926 | Ga0501035_0005074 | |||
| 3927 | Ga0501035_0030333 | |||
| 3928 | Ga0501035_0038995 | |||
| 3929 | Ga0501035_0042452 | |||
| 3930 | Ga0501035_0054167 | |||
| 3931 | Ga0501035_0063799 | |||
| 3932 | Ga0501035_0173821 | |||
| 3933 | Ga0501044_0004205 | |||
| 3934 | Ga0501044_0005678 | |||
| 3935 | Ga0501044_0011532 | |||
| 3936 | Ga0501044_0017369 | |||
| 3937 | Ga0501044_0076371 | |||
| 3938 | Ga0501044_0151656 | |||
| 3939 | Ga0501044_0205585 | |||
| 3940 | Ga0501045_0000549 | |||
| 3941 | Ga0501045_0000716 | |||
| 3942 | Ga0501045_0001190 | |||
| 3943 | Ga0501045_0001314 | |||
| 3944 | Ga0501045_0003432 | |||
| 3945 | Ga0501045_0110489 | |||
| 3946 | nmdc:mga03n38_15428_c1 | |||
| 3947 | nmdc:mga03n38_32338_c1 | |||
| 3948 | nmdc:mga03n38_70302_c1 | |||
| 3949 | nmdc:mga00v17_11230_c1 | |||
| 3950 | nmdc:mga00v17_177516_c1 | |||
| 3951 | nmdc:mga00v17_200666_c1 | |||
| 3952 | nmdc:mga00v17_23683_c1 | |||
| 3953 | nmdc:mga00v17_26072_c1 | |||
| 3954 | nmdc:mga00v17_50444_c1 | |||
| 3955 | nmdc:mga00v17_51330_c1 | |||
| 3956 | nmdc:mga00v17_56777_c1 | |||
| 3957 | nmdc:mga00v17_6346_c1 | |||
| 3958 | nmdc:mga00v17_70360_c1 | |||
| 3959 | nmdc:mga00v17_7056_c1 | |||
| 3960 | nmdc:mga00v17_7209_c1 | |||
| 3961 | nmdc:mga0yw44_100736_c1 | |||
| 3962 | nmdc:mga0yw44_103064_c1 | |||
| 3963 | nmdc:mga0yw44_10630_c1 | |||
| 3964 | nmdc:mga0yw44_12125_c1 | |||
| 3965 | nmdc:mga0yw44_13350_c1 | |||
| 3966 | nmdc:mga0yw44_229144_c1 | |||
| 3967 | nmdc:mga0yw44_27067_c1 | |||
| 3968 | nmdc:mga0yw44_58784_c1 | |||
| 3969 | nmdc:mga06z11_145195_c1 | |||
| 3970 | nmdc:mga07m45_1183_c1 | |||
| 3971 | nmdc:mga07m45_14273_c1 | |||
| 3972 | nmdc:mga07m45_62313_c1 | |||
| 3973 | nmdc:mga07m45_68468_c1 | |||
| 3974 | nmdc:mga05p37_130627_c1 | |||
| 3975 | nmdc:mga05p37_147133_c1 | |||
| 3976 | nmdc:mga05p37_59368_c1 | |||
| 3977 | nmdc:mga0qj67_16520_c1 | |||
| 3978 | nmdc:mga0qj67_199461_c1 | |||
| 3979 | nmdc:mga0qj67_314_c1 | |||
| 3980 | nmdc:mga0qj67_55011_c1 | |||
| 3981 | nmdc:mga06r32_66862_c1 | |||
| 3982 | nmdc:mga06r32_83948_c1 | |||
| 3983 | nmdc:mga08y16_124196_c1 | |||
| 3984 | nmdc:mga08y16_407028_c1 | |||
| 3985 | nmdc:mga0n895_280587_c1 | |||
| 3986 | nmdc:mga0n895_58260_c1 | |||
| 3987 | nmdc:mga0rr50_116155_c1 | |||
| 3988 | nmdc:mga0rr50_54532_c1 | |||
| 3989 | nmdc:mga0a205_30295_c1 | |||
| 3990 | nmdc:mga0a205_3708_c1 | |||
| 3991 | nmdc:mga0a205_50884_c1 | |||
| 3992 | nmdc:mga0sz30_1040_c1 | |||
| 3993 | nmdc:mga0sz30_1824_c2 | |||
| 3994 | nmdc:mga0sz30_30283_c1 | |||
| 3995 | nmdc:mga0sz30_34239_c1 | |||
| 3996 | nmdc:mga0sz30_50583_c1 | |||
| 3997 | Ga0495601_0032272 | |||
| 3998 | Ga0500610_0003294 | |||
| 3999 | Ga0500635_0000091 | |||
| 4000 | Ga0500635_0018314 | |||
| 4001 | Ga0495655_0001696 | |||
| 4002 | Ga0495619_0000621 | |||
| 4003 | Ga0495619_0022031 | |||
| 4004 | Ga0495619_0036805 | |||
| 4005 | Ga0495619_0072197 | |||
| 4006 | Ga0495619_0152235 | |||
| 4007 | Ga0495619_0169713 | |||
| 4008 | Ga0500643_000086 | |||
| 4009 | Ga0500643_001082 | |||
| 4010 | Ga0500643_001466 | |||
| 4011 | Ga0500646_0019346 | |||
| 4012 | Ga0500651_0022307 | |||
| 4013 | Ga0500641_0000526 | |||
| 4014 | Ga0500556_0000115 | |||
| 4015 | Ga0500556_0000496 | |||
| 4016 | Ga0500556_0000626 | |||
| 4017 | Ga0500562_010403 | |||
| 4018 | Ga0500593_000731 | |||
| 4019 | Ga0500642_0036336 | |||
| 4020 | Ga0500652_000545 | |||
| 4021 | Ga0500559_0001016 | |||
| 4022 | Ga0500559_0001057 | |||
| 4023 | Ga0500559_0009421 | |||
| 4024 | Ga0500559_0024306 | |||
| 4025 | Ga0500568_0000038 | |||
| 4026 | Ga0500568_0000117 | |||
| 4027 | Ga0500568_0001800 | |||
| 4028 | Ga0500568_0004560 | |||
| 4029 | Ga0500568_0017055 | |||
| 4030 | Ga0500568_0040363 | |||
| 4031 | Ga0500573_0000014 | |||
| 4032 | Ga0500573_0000476 | |||
| 4033 | Ga0500573_0015888 | |||
| 4034 | Ga0500573_0018692 | |||
| 4035 | Ga0500573_0018791 | |||
| 4036 | Ga0500573_0029841 | |||
| 4037 | Ga0500573_0039403 | |||
| 4038 | Ga0500577_0001332 | |||
| 4039 | Ga0500590_006984 | |||
| 4040 | Ga0500600_0055938 | |||
| 4041 | Ga0500616_0000027 | |||
| 4042 | Ga0500616_0000115 | |||
| 4043 | Ga0500616_0000117 | |||
| 4044 | Ga0500616_0001308 | |||
| 4045 | Ga0500616_0001664 | |||
| 4046 | Ga0500616_0002288 | |||
| 4047 | Ga0500620_000082 | |||
| 4048 | Ga0500645_013215 | |||
| 4049 | Ga0501084_0003669 | |||
| 4050 | Ga0501084_0006148 | |||
| 4051 | Ga0501084_0056074 | |||
| 4052 | Ga0501084_0144759 | |||
| 4053 | Ga0587084_001354 | |||
| 4054 | Ga0587066_011832 | |||
| 4055 | Ga0587077_002512 | |||
| 4056 | Ga0587083_0013367 | |||
| 4057 | Ga0587083_0019955 | |||
| 4058 | Ga0587086_005976 | |||
| 4059 | Ga0587090_000423 | |||
| 4060 | Ga0587101_001172 | |||
| 4061 | Ga0587128_008890 | |||
| 4062 | Ga0501082_0004627 | |||
| 4063 | Ga0501082_0009908 | |||
| 4064 | Ga0501082_0208433 | |||
| 4065 | Ga0466962_0003043 | |||
| 4066 | Ga0466962_0039612 | |||
| 4067 | Ga0466962_0058962 | |||
| 4068 | Ga0466962_0074207 | |||
| 4069 | Ga0466962_0077614 | |||
| 4070 | Ga0530510_0000536 | |||
| 4071 | Ga0530510_0001061 | |||
| 4072 | Ga0530510_0017997 | |||
| 4073 | Ga0530510_0046250 | |||
| 4074 | Ga0530510_0122356 | |||
| 4075 | Ga0530510_0151936 | |||
| 4076 | 2517762602 | |||
| 4077 | 2523386351 | |||
| 4078 | 2537898934 | |||
| 4079 | 2548699060 | |||
| 4080 | 2552110737 | |||
| 4081 | 2555229498 | |||
| 4082 | 2558909522 | |||
| 4083 | 2559428860 | |||
| 4084 | 2559430722 | |||
| 4085 | 2566992174 | |||
| 4086 | 2579853624 | |||
| 4087 | 2583149102 | |||
| 4088 | 2585298246 | |||
| 4089 | 2586060711 | |||
| 4090 | 2586064425 | |||
| 4091 | 2587863728 | |||
| 4092 | 2588106890 | |||
| 4093 | 2619853695 | |||
| 4094 | 2620349911 | |||
| 4095 | 2623497579 | |||
| 4096 | 2626636076 | |||
| 4097 | 2643734893 | |||
| 4098 | 2643753811 | |||
| 4099 | 2643768551 | |||
| 4100 | 2643783497 | |||
| 4101 | 2643847960 | |||
| 4102 | 2643876373 | |||
| 4103 | 2643888300 | |||
| 4104 | 2643994948 | |||
| 4105 | 2644082281 | |||
| 4106 | 2644096481 | |||
| 4107 | 2644111922 | |||
| 4108 | 2644173053 | |||
| 4109 | 2644182487 | |||
| 4110 | 2644197913 | |||
| 4111 | 2644277717 | |||
| 4112 | 2644383428 | |||
| 4113 | 2644445424 | |||
| 4114 | 2644490564 | |||
| 4115 | 2644502984 | |||
| 4116 | 2644513962 | |||
| 4117 | 2644525319 | |||
| 4118 | 2644538694 | |||
| 4119 | 2644610849 | |||
| 4120 | 2644637035 | |||
| 4121 | 2644664619 | |||
| 4122 | 2644669404 | |||
| 4123 | 2644679263 | |||
| 4124 | 2645720691 | |||
| 4125 | 2645723710 | |||
| 4126 | 2655031519 | |||
| 4127 | 2671835671 | |||
| 4128 | 2676199411 | |||
| 4129 | 2686539208 | |||
| 4130 | 2689960348 | |||
| 4131 | 2691512796 | |||
| 4132 | 2723641230 | |||
| 4133 | 2729907946 | |||
| 4134 | 2730228766 | |||
| 4135 | 2738668278 | |||
| 4136 | 2738693653 | |||
| 4137 | 2738707253 | |||
| 4138 | 2738888363 | |||
| 4139 | 2739147348 | |||
| 4140 | 2739204214 | |||
| 4141 | 2739240181 | |||
| 4142 | 2739322934 | |||
| 4143 | 2739328568 | |||
| 4144 | 2739604004 | |||
| 4145 | 2739607519 | |||
| 4146 | 2747952356 | |||
| 4147 | 2753070050 | |||
| 4148 | 2753303609 | |||
| 4149 | 2758224592 | |||
| 4150 | 2760304582 | |||
| 4151 | 2760621607 | |||
| 4152 | 2774378720 | |||
| 4153 | 2774383464 | |||
| 4154 | 2774394494 | |||
| 4155 | 2774400469 | |||
| 4156 | 2774843989 | |||
| 4157 | 2774853827 | |||
| 4158 | 2775658485 | |||
| 4159 | 2776373997 | |||
| 4160 | 2784472887 | |||
| 4161 | 2793982994 | |||
| 4162 | 2795795224 | |||
| 4163 | 2799184891 | |||
| 4164 | 2808628640 | |||
| 4165 | 2808830074 | |||
| 4166 | 2808851250 | |||
| 4167 | 2808875416 | |||
| 4168 | 2808876225 | |||
| 4169 | 2808884855 | |||
| 4170 | 2808894329 | |||
| 4171 | 2808897727 | |||
| 4172 | 2808901109 | |||
| 4173 | 2809026401 | |||
| 4174 | 2809194652 | |||
| 4175 | 2809226661 | |||
| 4176 | 2809586347 | |||
| 4177 | 2812318150 | |||
| 4178 | 2812322228 | |||
| 4179 | 2812349393 | |||
| 4180 | 2812375735 | |||
| 4181 | 2816424357 | |||
| 4182 | 2816505484 | |||
| 4183 | 2817509736 | |||
| 4184 | 2819424625 | |||
| 4185 | 2819666956 | |||
| 4186 | 2819690324 | |||
| 4187 | 2819728426 | |||
| 4188 | 2821269177 | |||
| 4189 | 2833710070 | |||
| 4190 | 2835191786 | |||
| 4191 | 2837270575 | |||
| 4192 | 2839986502 | |||
| 4193 | 2842140523 | |||
| 4194 | 2842891200 | |||
| 4195 | 2844843306 | |||
| 4196 | 2844851758 | |||
| 4197 | 2844854384 | |||
| 4198 | 2848551739 | |||
| 4199 | 2852632870 | |||
| 4200 | 2852644411 | |||
| 4201 | 2852646560 | |||
| 4202 | 2852665798 | |||
| 4203 | 2852678639 | |||
| 4204 | 2857479980 | |||
| 4205 | 2857633458 | |||
| 4206 | 2857711204 | |||
| 4207 | 2857722722 | |||
| 4208 | 2857724698 | |||
| 4209 | 2857728526 | |||
| 4210 | 2857730601 | |||
| 4211 | 2857734473 | |||
| 4212 | 2857739122 | |||
| 4213 | 2857740823 | |||
| 4214 | 2862993548 | |||
| 4215 | 2863070407 | |||
| 4216 | 2866555467 | |||
| 4217 | 2866616957 | |||
| 4218 | 2870622255 | |||
| 4219 | 2870629554 | |||
| 4220 | 2870727454 | |||
| 4221 | 2870730025 | |||
| 4222 | 2870788726 | |||
| 4223 | 2870803304 | |||
| 4224 | 2870805347 | |||
| 4225 | 2884766320 | |||
| 4226 | 2887447174 | |||
| 4227 | 2889303335 | |||
| 4228 | 2891331401 | |||
| 4229 | 2891972895 | |||
| 4230 | 2893686283 | |||
| 4231 | 2895428178 | |||
| 4232 | 2895660548 | |||
| 4233 | 2895884540 | |||
| 4234 | 2897562487 | |||
| 4235 | 2899364506 | |||
| 4236 | 2899376590 | |||
| 4237 | 2902797594 | |||
| 4238 | 2902799884 | |||
| 4239 | 2902814809 | |||
| 4240 | 2902843209 | |||
| 4241 | 2904432473 | |||
| 4242 | 2904501566 | |||
| 4243 | 2904501743 | |||
| 4244 | 2904510218 | |||
| 4245 | 2904538004 | |||
| 4246 | 2904778211 | |||
| 4247 | 2905928636 | |||
| 4248 | 2906801599 | |||
| 4249 | 2908676203 | |||
| 4250 | 2908678567 | |||
| 4251 | 2909077083 | |||
| 4252 | 2915364120 | |||
| 4253 | 2915774800 | |||
| 4254 | 2917736598 | |||
| 4255 | 2917737727 | |||
| 4256 | 2919035583 | |||
| 4257 | 2919041778 | |||
| 4258 | 2919043276 | |||
| 4259 | 2919054919 | |||
| 4260 | 2919058787 | |||
| 4261 | 2919060242 | |||
| 4262 | 2919070918 | |||
| 4263 | 2919395364 | |||
| 4264 | 2919398565 | |||
| 4265 | 2919445625 | |||
| 4266 | 2919525365 | |||
| 4267 | 2919539208 | |||
| 4268 | 2919717016 | |||
| 4269 | 2920883347 | |||
| 4270 | 2922557187 | |||
| 4271 | 2928091018 | |||
| 4272 | 2928105561 | |||
| 4273 | 2928121405 | |||
| 4274 | 2928145111 | |||
| 4275 | 2928153444 | |||
| 4276 | 2928500921 | |||
| 4277 | 2929217564 | |||
| 4278 | 2932400412 | |||
| 4279 | 2932427797 | |||
| 4280 | 2932432301 | |||
| 4281 | 2933418630 | |||
| 4282 | 2935410642 | |||
| 4283 | 2935894132 | |||
| 4284 | 2939584798 | |||
| 4285 | 2939599380 | |||
| 4286 | 2939650244 | |||
| 4287 | 2939659378 | |||
| 4288 | 2939662805 | |||
| 4289 | 2939677662 | |||
| 4290 | 2939748528 | |||
| 4291 | 2945920248 | |||
| 4292 | 2945923894 | |||
| 4293 | 2945944447 | |||
| 4294 | 2945957365 | |||
| 4295 | 2945970918 | |||
| 4296 | 2946003385 | |||
| 4297 | 2946024821 | |||
| 4298 | 2946034661 | |||
| 4299 | 2946040362 | |||
| 4300 | 2946043242 | |||
| 4301 | 2946063965 | |||
| 4302 | 2946081770 | |||
| 4303 | 2954001630 | |||
| 4304 | 2956941536 | |||
| 4305 | 2964328541 | |||
| 4306 | 2966922640 | |||
| 4307 | 2966926610 | |||
| 4308 | 2974298238 | |||
| 4309 | 2974303796 | |||
| 4310 | 2974325532 | |||
| 4311 | 2977230464 | |||
| 4312 | 2977239265 | |||
| 4313 | 2977252038 | |||
| 4314 | 2977265706 | |||
| 4315 | 2984542951 | |||
| 4316 | 2984551898 | |||
| 4317 | 2984579777 | |||
| 4318 | 2984582226 | |||
| 4319 | 2984593946 | |||
| 4320 | 2995728415 | |||
| 4321 | 3001892118 | |||
| 4322 | 8002791552 | |||
| 4323 | 8002811627 | |||
| 4324 | 8003321489 | |||
| 4325 | 8003323191 | |||
| 4326 | 8004022465 | |||
| 4327 | 8004026910 | |||
| 4328 | 8004183613 | |||
| 4329 | 8004213430 | |||
| 4330 | 8016254894 | |||
| 4331 | 8033684397 | |||
| 4332 | 8045832455 | |||
| 4333 | 8047717666 | |||
| 4334 | 8047719528 | |||
| 4335 | 8047895175 | |||
| 4336 | 8048136500 | |||
| 4337 | 8048363777 | |||
| 4338 | 8048372201 | |||
| 4339 | 8048381135 | |||
| 4340 | 8054109686 | |||
| 4341 | 8054475852 | |||
| 4342 | 8054613903 | |||
| 4343 | 8054917141 | |||
| 4344 | 8054925340 | |||
| 4345 | 8055035359 | |||
| 4346 | 8055038950 | |||
| 4347 | 8055160668 | |||
| 4348 | 8055177139 | |||
| 4349 | 8056039320 | |||
| 4350 | 8056208492 | |||
| 4351 | 8056583315 | |||
| 4352 | 8057347470 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ufx-assembly5.cif.gz_G | thermus aquaticus succinyl-coa synthetase in complex with gdp-mn2+ | 0.9031 | 1 | 370 |
| 6no6-assembly1.cif.gz_B | k46be&k114bd mutant atp-grasp fold of blastocystis hominis succinyl-coa synthetase | 0.9017 | 1 | 205 |
| 3ufx-assembly1.cif.gz_B | thermus aquaticus succinyl-coa synthetase in complex with gdp-mn2+ | 0.8975 | 1 | 370 |
| 3ufx-assembly5.cif.gz_G | thermus aquaticus succinyl-coa synthetase in complex with gdp-mn2+ | 0.8962 | 1 | 370 |
| 6no5-assembly2.cif.gz_D | adp bound to k46be&k114bd mutant atp-grasp fold of blastocystis hominis succinyl-coa synthetase | 0.8932 | 1 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ufxE01 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9501 | 1 | 225 | 3.30.470.20 |
| 3ufxE01 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9442 | 1 | 225 | 3.30.470.20 |
| 3ufxB02 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain | 0.9411 | 21 | 90 | 3.30.1490.20 |
| 1jkjB01 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9383 | 1 | 225 | 3.30.470.20 |
| 1jkjB01 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9326 | 1 | 225 | 3.30.470.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6J6TU45-F1-model_v4 | Unannotated protein | 0.98 | 237 | 376 |
GO:0000166
GO:0004775 GO:0005829 GO:0006099 GO:0006104 GO:0042709 |
| AF-A0A1I5CT77-F1-model_v4 | Succinyl-CoA synthetase beta subunit | 0.979 | 1 | 222 |
GO:0004775
GO:0005524 GO:0005829 GO:0006099 GO:0006104 GO:0042709 GO:0046872 |
| AF-A0A6B3E9J2-F1-model_v4 | Succinate--CoA ligase subunit beta | 0.9737 | 75 | 185 |
GO:0004775
GO:0005524 GO:0005829 GO:0006099 GO:0006104 GO:0042709 |
| AF-A0A6B3E9J2-F1-model_v4 | Succinate--CoA ligase subunit beta | 0.9652 | 75 | 185 |
GO:0004775
GO:0005524 GO:0005829 GO:0006099 GO:0006104 GO:0042709 |
| AF-A0A3C1L3G6-F1-model_v4 | Succinate--CoA ligase subunit beta | 0.9593 | 1 | 210 |
GO:0004775
GO:0005524 GO:0005829 GO:0006099 GO:0006104 GO:0042709 GO:0046872 |