F496512

General Info

Members Datasets Scaffolds Average Seq Length
2176 831 4352 383

Family's Representative Sequence

Representative Sequence 3300025231|Ga0207427_100042|Ga0207427_100042108
Length 448
Sequence VEGASTIAVDFAARFAGVQQDALEFFLAKFISASSYSPAELPRRNRPASATSVPEPADWITVDLYEYQARDLFEQYGVPVLPGIVADTPEEVRAAAEKLGGVVVVKAQVKVGGRGKAGGVKVAKNPDEAEEAAKAILGLDIKGHIVRRVMVAGGARIAKEFYFSVLLDRANRSYLSLTSVEGGMEIEQLAVEKPEALARIEVDPITGVDAAKAAEIAKAAGFPDDLADKVADVFVKLYEVYKGEDATLVEVNPLVLTEEGDIIALDGKVTLDENAGFRHPNHEALEDKAAADPLEAKAKASDLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHKGVKPANFLDIGGGASAAVMAAGLDVILNDPQVKSVFVNVFGGITACDAVANGIVKALEILGDEANKPLVVRLDGNNVDEGRRILTEAAHPLVTLALTMDEGADKAAELAAK

Samples

Sample ID Description Type Environment
1 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
12 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
18 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
19 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
65 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
66 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
87 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
93 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
94 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
95 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
96 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
97 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
100 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
101 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
102 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
103 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
104 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
105 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
106 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
111 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
112 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
113 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
117 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
118 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
122 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
123 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
130 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
133 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
134 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
135 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
136 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
137 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
138 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
139 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
140 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
141 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
142 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
143 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
144 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
145 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
146 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
147 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
148 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
155 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
156 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
158 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
164 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
165 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
166 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
169 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
170 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
173 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
241 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
245 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
246 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
247 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
248 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
249 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
250 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
251 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
252 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
253 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
254 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
255 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
256 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
257 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
258 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
259 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
260 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
261 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
262 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
263 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
264 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
265 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
266 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
267 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
268 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
269 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
270 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
271 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
272 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
273 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
274 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
275 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
276 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
277 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
278 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
279 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
280 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
281 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
282 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
283 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
284 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
285 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
286 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
287 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
288 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
289 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
290 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
291 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
292 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
293 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
294 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
295 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
296 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
297 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
298 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
299 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
300 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
301 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
302 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
303 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
304 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
305 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
306 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
307 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
308 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
309 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
310 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
311 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
312 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
313 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
314 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
315 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
316 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
317 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
318 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
319 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
320 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
321 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
322 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
323 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
324 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
325 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
326 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
327 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
328 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
329 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
330 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
331 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
332 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
333 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
334 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
335 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
336 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
337 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
338 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
339 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
340 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
341 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
342 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
343 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
344 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
345 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
346 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
347 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
348 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
349 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
350 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
351 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
352 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
353 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
354 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
355 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
356 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
357 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
358 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
359 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
360 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
361 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
362 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
363 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
364 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
365 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
366 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
367 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
368 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
369 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
370 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
371 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
372 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
373 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
374 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
375 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
376 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
377 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
378 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
379 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
380 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
381 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
382 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
383 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
384 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
385 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
386 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
387 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
388 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
389 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
390 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
391 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
392 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
393 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
394 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
395 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
396 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
397 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
398 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
399 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
400 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
401 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
402 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
403 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
404 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
405 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
406 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
407 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
408 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
409 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
410 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
411 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
412 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
413 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
414 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
415 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
416 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
417 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
418 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
419 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
420 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
421 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
422 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
423 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
424 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
425 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
426 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
427 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
428 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
429 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
430 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
431 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
432 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
433 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
434 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
435 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
436 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
437 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
438 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
439 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
440 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
441 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
442 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
443 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
444 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
445 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
446 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
447 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
448 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
449 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
450 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
451 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
452 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
453 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
454 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
455 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
456 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
457 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
458 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
459 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
460 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
461 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
462 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
463 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
464 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
465 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
480 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
481 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
482 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
483 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
484 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
485 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
486 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
487 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
488 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
489 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
490 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
491 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
492 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
493 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
494 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
495 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
496 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
497 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
498 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
499 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
500 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
501 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
502 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
503 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
504 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
505 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
506 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
507 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
508 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
509 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
510 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
511 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
512 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
513 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
514 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
515 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
516 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
517 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
518 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
519 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
520 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
521 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
522 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
523 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
524 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
525 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
526 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
527 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
528 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
529 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
530 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
531 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
532 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
533 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
534 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
535 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
536 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
537 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
538 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
539 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
540 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
541 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
542 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
543 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
544 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
545 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
546 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
547 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
548 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
549 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
550 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
551 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
552 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
553 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
554 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
555 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
556 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
557 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
558 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
559 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
560 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
561 2517572101 Frankia sp. DC12 Isolate Nodule
562 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
563 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
564 2547132424 Nocardia nova SH22a Isolate Unclassified
565 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
566 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
567 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
568 2558860280 Kutzneria sp. 744 Isolate Unclassified
569 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
570 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
571 2582580736 Prauserella sp. Am3 Isolate Unclassified
572 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
573 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
574 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
575 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
576 2619618881 Frankia sp. ACN1ag Isolate Unclassified
577 2619619003 Frankia sp. CpI1-P Isolate Nodule
578 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
579 2626541554 Frankia sp. AvcI.1 Isolate Nodule
580 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
581 2643221546 Microbacterium sp. Root53 Isolate Unclassified
582 2643221549 Agromyces sp. Root1464 Isolate Unclassified
583 2643221553 Microbacterium sp. Root553 Isolate Unclassified
584 2643221566 Microbacterium sp. Root166 Isolate Unclassified
585 2643221572 Leifsonia sp. Root60 Isolate Unclassified
586 2643221575 Microbacterium sp. Root61 Isolate Unclassified
587 2643221597 Microbacterium sp. Root180 Isolate Unclassified
588 2643221613 Oerskovia sp. Root22 Isolate Unclassified
589 2643221616 Leifsonia sp. Root227 Isolate Unclassified
590 2643221619 Agromyces sp. Root81 Isolate Unclassified
591 2643221630 Microbacterium sp. Root322 Isolate Unclassified
592 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
593 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
594 2643221649 Leifsonia sp. Root4 Isolate Unclassified
595 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
596 2643221679 Angustibacter sp. Root456 Isolate Unclassified
597 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
598 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
599 2643221692 Nocardia sp. Root136 Isolate Unclassified
600 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
601 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
602 2643221711 Terrabacter sp. Root85 Isolate Unclassified
603 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
604 2643221721 Oerskovia sp. Root918 Isolate Unclassified
605 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
606 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
607 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
608 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
609 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
610 2671180195 Frankia sp. CcI49 Isolate Nodule
611 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
612 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
613 2687453737 Frankia sp. BMG5.36 Isolate Nodule
614 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
615 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
616 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
617 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
618 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
619 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
620 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
621 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
622 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
623 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
624 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
625 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
626 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
627 2739367653 Kocuria sp. OV113 Isolate Unclassified
628 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
629 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
630 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
631 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
632 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
633 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
634 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
635 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
636 2773857759 Microbacterium sp. 1294 Isolate Unclassified
637 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
638 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
639 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
640 2773857922 Frankia sp. CcI49 Isolate Nodule
641 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
642 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
643 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
644 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
645 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
646 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
647 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
648 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
649 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
650 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
651 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
652 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
653 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
654 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
655 2808606372 Agromyces sp. 23-23 Isolate Unclassified
656 2808606394 Promicromonospora sp. C35 Isolate Unclassified
657 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
658 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
659 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
660 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
661 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
662 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
663 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
664 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
665 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
666 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
667 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
668 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
669 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
670 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
671 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
672 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
673 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
674 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
675 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
676 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
677 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
678 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
679 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
680 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
681 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
682 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
683 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
684 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
685 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
686 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
687 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
688 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
689 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
690 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
691 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
692 2857727296 Kocuria sp. R-72562 Isolate Unclassified
693 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
694 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
695 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
696 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
697 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
698 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
699 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
700 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
701 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
702 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
703 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
704 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
705 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
706 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
707 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
708 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
709 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
710 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
711 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
712 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
713 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
714 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
715 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
716 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
717 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
718 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
719 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
720 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
721 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
722 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
723 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
724 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
725 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
726 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
727 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
728 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
729 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
730 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
731 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
732 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
733 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
734 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
735 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
736 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
737 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
738 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
739 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
740 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
741 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
742 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
743 2919069694 Microbacterium sp. 1154 Isolate Unclassified
744 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
745 2919395869 Microbacterium resistens 2980 Isolate Unclassified
746 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
747 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
748 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
749 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
750 2920879853 Kocuria salina CV6 Isolate Unclassified
751 2922554459 Rhodococcus sp. 66b Isolate Unclassified
752 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
753 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
754 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
755 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
756 2928153084 Leifsonia sp. 563 Isolate Unclassified
757 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
758 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
759 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
760 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
761 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
762 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
763 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
764 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
765 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
766 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
767 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
768 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
769 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
770 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
771 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
772 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
773 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
774 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
775 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
776 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
777 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
778 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
779 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
780 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
781 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
782 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
783 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
784 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
785 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
786 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
787 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
788 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
789 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
790 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
791 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
792 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
793 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
794 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
795 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
796 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
797 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
798 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
799 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
800 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
801 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
802 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
803 8002784119 Frankia sp. AgB1.9 Isolate Nodule
804 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
805 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
806 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
807 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
808 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
809 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
810 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
811 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
812 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
813 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
814 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
815 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
816 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
817 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
818 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
819 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
820 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
821 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
822 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
823 8054920844 Frankia tisae Agncl-8 Isolate Nodule
824 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
825 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
826 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
827 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
828 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
829 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
830 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
831 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.29
Metatranscriptomes 1.98
Isolates 12.73

Biome Distribution

Category Percentage (%)
Aerial Root 0.23
Bulb 0
Endosphere 6.8
Nodule 0.64
Rhizoplane 7.9
Rhizosphere 70.4
Stem 0
Stem Tuber 0.09
Unclassified 0.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207427_100042 3300025231 Bacteria 254170
2 LJQas_1002745 3300000549 Bacteria 2421
3 LJQas_1002873 3300000549 Bacteria 2346
4 JGI24746J21847_1001377 3300001977 Bacteria 3876
5 JGI24740J21852_10002318 3300001979 Bacteria 8656
6 JGI24740J21852_10013880 3300001979 Bacteria 2990
7 JGI24737J22298_10016258 3300001990 Bacteria 2402
8 JGI24737J22298_10025699 3300001990 Bacteria 1861
9 JGI24735J21928_10005710 3300002067 Bacteria 4113
10 JGI24735J21928_10006707 3300002067 Bacteria 3779
11 JGI24738J21930_10011645 3300002075 Bacteria 1931
12 JGI24744J21845_10006576 3300002077 Bacteria 2410
13 JGI25162J39368_1004740 3300002737 Bacteria 2998
14 JGI25154J39366_1001298 3300002738 Bacteria 9277
15 JGI25164J39214_1001137 3300002772 Bacteria 7544
16 JGI25152J39213_1000379 3300002773 Bacteria 27322
17 JGI25151J46595_10038948 3300003187 Bacteria 1762
18 JGI25406J46586_10002406 3300003203 Bacteria 8846
19 JGI25165J46597_1000061 3300003214 Bacteria 208362
20 JGI25407J50210_10004858 3300003373 Bacteria 3281
21 Ga0006562J51391_1003827 3300003578 Bacteria 12434
22 Ga0006562J51391_1026496 3300003578 Bacteria 3190
23 Ga0006562J51391_1028453 3300003578 Bacteria 7090
24 Ga0006562J51391_1032082 3300003578 Bacteria 2253
25 Ga0055539_1000005 3300003752 Bacteria 609598
26 Ga0055533_1000001 3300003756 Bacteria 1863437
27 Ga0055525_1000291 3300003759 Bacteria 45088
28 Ga0055527_1000017 3300003760 Bacteria 242362
29 Ga0055542_1000044 3300003762 Bacteria 206982
30 Ga0055542_1005133 3300003762 Bacteria 3017
31 Ga0055529_1000279 3300003763 Bacteria 60946
32 Ga0055540_1000022 3300003792 Bacteria 201257
33 Ga0055540_1007503 3300003792 Bacteria 4100
34 Ga0055540_1017813 3300003792 Bacteria 1968
35 Ga0055541_1000625 3300003841 Bacteria 9362
36 JGI25405J52794_10000005 3300003911 Archaea 32830
37 Ga0065714_10099404 3300005288 Bacteria 1681
38 Ga0065704_10073835 3300005289 Bacteria 6749
39 Ga0070658_10000394 3300005327 Bacteria 37936
40 Ga0070658_10000448 3300005327 Bacteria 35674
41 Ga0070676_10180578 3300005328 Bacteria 1372
42 Ga0070683_100008624 3300005329 Bacteria 8662
43 Ga0070683_100029105 3300005329 Bacteria 4998
44 Ga0070683_100032968 3300005329 Bacteria 4720
45 Ga0070683_100034639 3300005329 Bacteria 4613
46 Ga0070683_100054846 3300005329 Bacteria 3696
47 Ga0070683_100061592 3300005329 Bacteria 3489
48 Ga0070683_100078600 3300005329 Bacteria 3087
49 Ga0070677_10078333 3300005333 Bacteria 1408
50 Ga0068869_100034322 3300005334 Bacteria 3588
51 Ga0070666_10144317 3300005335 Bacteria 1659
52 Ga0070682_100006780 3300005337 Bacteria 6426
53 Ga0070682_100014519 3300005337 Bacteria 4553
54 Ga0070682_100016045 3300005337 Bacteria 4350
55 Ga0070682_100041420 3300005337 Bacteria 2838
56 Ga0068868_100005688 3300005338 Bacteria 8777
57 Ga0068868_100005768 3300005338 Bacteria 8720
58 Ga0068868_100024841 3300005338 Bacteria 4549
59 Ga0068868_100054112 3300005338 Bacteria 3162
60 Ga0068868_100259251 3300005338 Bacteria 1465
61 Ga0070660_100018405 3300005339 Bacteria 5105
62 Ga0070660_100028725 3300005339 Bacteria 4163
63 Ga0070660_100031568 3300005339 Bacteria 3980
64 Ga0070660_100035294 3300005339 Bacteria 3784
65 Ga0070660_100078401 3300005339 Bacteria 2590
66 Ga0070660_100086430 3300005339 Bacteria 2467
67 Ga0070660_100097095 3300005339 Bacteria 2331
68 Ga0070691_10106531 3300005341 Bacteria 1398
69 Ga0070687_100008987 3300005343 Bacteria 4258
70 Ga0070661_100075188 3300005344 Bacteria 2488
71 Ga0070692_10020367 3300005345 Bacteria 3216
72 Ga0070668_100004760 3300005347 Bacteria 10070
73 Ga0070668_100004776 3300005347 Bacteria 10049
74 Ga0070668_100005919 3300005347 Bacteria 9060
75 Ga0070669_100000820 3300005353 Bacteria 22620
76 Ga0070669_100031283 3300005353 Bacteria 3845
77 Ga0070669_100057358 3300005353 Bacteria 2857
78 Ga0070669_100120181 3300005353 Bacteria 2003
79 Ga0070675_100071687 3300005354 Bacteria 2875
80 Ga0070675_100094331 3300005354 Bacteria 2511
81 Ga0070675_100162207 3300005354 Bacteria 1923
82 Ga0070671_100000413 3300005355 Bacteria 29605
83 Ga0070671_100016620 3300005355 Bacteria 5948
84 Ga0070671_100138032 3300005355 Bacteria 2056
85 Ga0070671_100199550 3300005355 Bacteria 1696
86 Ga0070671_100237954 3300005355 Bacteria 1545
87 Ga0070674_100020814 3300005356 Bacteria 4200
88 Ga0070674_100065570 3300005356 Bacteria 2549
89 Ga0070674_100139963 3300005356 Bacteria 1815
90 Ga0070688_100020289 3300005365 Bacteria 3862
91 Ga0070659_100001798 3300005366 Bacteria 15428
92 Ga0070659_100005058 3300005366 Bacteria 9455
93 Ga0070659_100007670 3300005366 Bacteria 7847
94 Ga0070659_100028072 3300005366 Bacteria 4343
95 Ga0070659_100071106 3300005366 Bacteria 2766
96 Ga0070659_100091466 3300005366 Bacteria 2439
97 Ga0070659_100182920 3300005366 Bacteria 1721
98 Ga0070667_100000605 3300005367 Bacteria 34996
99 Ga0070667_100000674 3300005367 Bacteria 33136
100 Ga0070667_100001634 3300005367 Bacteria 20056
101 Ga0070667_100010065 3300005367 Bacteria 7832
102 Ga0070667_100023104 3300005367 Bacteria 5158
103 Ga0070709_10012741 3300005434 Bacteria 4711
104 Ga0070709_10024755 3300005434 Bacteria 3537
105 Ga0070714_100046967 3300005435 Bacteria 3665
106 Ga0070714_100051731 3300005435 Bacteria 3503
107 Ga0070714_100065288 3300005435 Bacteria 3134
108 Ga0070714_100066546 3300005435 Bacteria 3105
109 Ga0070714_100160700 3300005435 Bacteria 2032
110 Ga0070714_100164208 3300005435 Bacteria 2011
111 Ga0070714_100207909 3300005435 Bacteria 1793
112 Ga0070713_100003424 3300005436 Bacteria 10477
113 Ga0070713_100049495 3300005436 Bacteria 3467
114 Ga0070710_10001407 3300005437 Bacteria 11356
115 Ga0070710_10016635 3300005437 Bacteria 3747
116 Ga0070701_10003564 3300005438 Bacteria 6181
117 Ga0070711_100006432 3300005439 Bacteria 7085
118 Ga0070711_100043841 3300005439 Bacteria 3032
119 Ga0070700_100000049 3300005441 Bacteria 89497
120 Ga0070700_100017266 3300005441 Bacteria 4122
121 Ga0070700_100026697 3300005441 Bacteria 3414
122 Ga0070700_100034233 3300005441 Bacteria 3067
123 Ga0070700_100196840 3300005441 Bacteria 1413
124 Ga0070694_100014338 3300005444 Bacteria 4960
125 Ga0070663_100047102 3300005455 Bacteria 3053
126 Ga0070663_100059261 3300005455 Bacteria 2752
127 Ga0070663_100126923 3300005455 Bacteria 1933
128 Ga0070678_100001296 3300005456 Bacteria 13268
129 Ga0070678_100031232 3300005456 Bacteria 3671
130 Ga0070678_100177184 3300005456 Bacteria 1742
131 Ga0070678_100185230 3300005456 Bacteria 1708
132 Ga0070662_100014959 3300005457 Bacteria 5188
133 Ga0070681_10009503 3300005458 Bacteria 9573
134 Ga0070681_10310482 3300005458 Bacteria 1486
135 Ga0068867_100002347 3300005459 Bacteria 13325
136 Ga0068867_100044172 3300005459 Bacteria 3264
137 Ga0070685_10043877 3300005466 Bacteria 2558
138 Ga0070706_100006459 3300005467 Bacteria 11069
139 Ga0070706_100012286 3300005467 Bacteria 7935
140 Ga0070706_100064391 3300005467 Bacteria 3389
141 Ga0070707_100006726 3300005468 Bacteria 10657
142 Ga0070707_100011559 3300005468 Bacteria 8234
143 Ga0070707_100019191 3300005468 Bacteria 6441
144 Ga0070707_100091207 3300005468 Bacteria 2950
145 Ga0070707_100188369 3300005468 Bacteria 2011
146 Ga0070698_100007659 3300005471 Bacteria 11684
147 Ga0070698_100012160 3300005471 Bacteria 9118
148 Ga0070698_100018135 3300005471 Bacteria 7408
149 Ga0070698_100117481 3300005471 Bacteria 2622
150 Ga0070679_100011185 3300005530 Bacteria 8551
151 Ga0070679_100157345 3300005530 Bacteria 2247
152 Ga0070679_100195083 3300005530 Bacteria 1993
153 Ga0070679_100388985 3300005530 Bacteria 1341
154 Ga0070684_100008109 3300005535 Bacteria 8198
155 Ga0070684_100010114 3300005535 Bacteria 7460
156 Ga0070684_100010640 3300005535 Bacteria 7295
157 Ga0070684_100056129 3300005535 Bacteria 3436
158 Ga0070684_100071021 3300005535 Bacteria 3064
159 Ga0068853_100003640 3300005539 Bacteria 11814
160 Ga0068853_100017372 3300005539 Bacteria 5941
161 Ga0068853_100022417 3300005539 Bacteria 5274
162 Ga0068853_100029542 3300005539 Bacteria 4622
163 Ga0068853_100062708 3300005539 Bacteria 3218
164 Ga0068853_100089100 3300005539 Bacteria 2710
165 Ga0070672_100011247 3300005543 Bacteria 6241
166 Ga0070672_100044260 3300005543 Bacteria 3437
167 Ga0070672_100060413 3300005543 Bacteria 2984
168 Ga0070686_100044352 3300005544 Bacteria 2795
169 Ga0070695_100016540 3300005545 Bacteria 4465
170 Ga0070696_100001265 3300005546 Bacteria 16421
171 Ga0070665_100000450 3300005548 Bacteria 59867
172 Ga0070665_100003803 3300005548 Bacteria 15980
173 Ga0070665_100004177 3300005548 Bacteria 15190
174 Ga0070665_100029488 3300005548 Bacteria 5522
175 Ga0070665_100042334 3300005548 Bacteria 4577
176 Ga0070665_100128311 3300005548 Bacteria 2539
177 Ga0070665_100287046 3300005548 Bacteria 1648
178 Ga0070704_100000144 3300005549 Bacteria 26925
179 Ga0070704_100027059 3300005549 Bacteria 3797
180 Ga0070704_100041179 3300005549 Archaea 3186
181 Ga0070704_100070886 3300005549 Bacteria 2530
182 Ga0068855_100026886 3300005563 Bacteria 6884
183 Ga0068855_100034488 3300005563 Bacteria 6035
184 Ga0068855_100046784 3300005563 Bacteria 5113
185 Ga0068855_100066766 3300005563 Bacteria 4193
186 Ga0068855_100081308 3300005563 Bacteria 3756
187 Ga0068855_100090254 3300005563 Bacteria 3537
188 Ga0068855_100163748 3300005563 Bacteria 2522
189 Ga0068857_100005690 3300005577 Bacteria 10655
190 Ga0068857_100035843 3300005577 Bacteria 4395
191 Ga0068857_100266979 3300005577 Bacteria 1572
192 Ga0068854_100003304 3300005578 Bacteria 10052
193 Ga0068854_100140557 3300005578 Bacteria 1852
194 Ga0068856_100022435 3300005614 Bacteria 6138
195 Ga0068856_100025251 3300005614 Bacteria 5790
196 Ga0068856_100026637 3300005614 Bacteria 5637
197 Ga0068856_100046003 3300005614 Bacteria 4298
198 Ga0068856_100048666 3300005614 Bacteria 4178
199 Ga0068856_100092229 3300005614 Bacteria 3014
200 Ga0068856_100230588 3300005614 Bacteria 1867
201 Ga0070702_100007562 3300005615 Bacteria 5205
202 Ga0070702_100021808 3300005615 Bacteria 3377
203 Ga0070702_100022733 3300005615 Bacteria 3321
204 Ga0068852_100006651 3300005616 Bacteria 8377
205 Ga0068852_100031767 3300005616 Bacteria 4363
206 Ga0068852_100032864 3300005616 Bacteria 4301
207 Ga0068852_100042387 3300005616 Bacteria 3853
208 Ga0068852_100058986 3300005616 Bacteria 3327
209 Ga0068852_100219404 3300005616 Bacteria 1808
210 Ga0068859_100001784 3300005617 Bacteria 21903
211 Ga0068859_100002254 3300005617 Bacteria 19564
212 Ga0068859_100012347 3300005617 Bacteria 8592
213 Ga0068859_100144251 3300005617 Bacteria 2455
214 Ga0068864_100025782 3300005618 Bacteria 4956
215 Ga0068864_100075408 3300005618 Bacteria 2945
216 Ga0068866_10000517 3300005718 Bacteria 17836
217 Ga0068866_10041100 3300005718 Bacteria 2293
218 Ga0068866_10058969 3300005718 Bacteria 1984
219 Ga0068861_100001353 3300005719 Bacteria 15407
220 Ga0068861_100055079 3300005719 Bacteria 3031
221 Ga0068861_100132503 3300005719 Bacteria 2024
222 Ga0068851_10000022 3300005834 Bacteria 129607
223 Ga0068870_10006332 3300005840 Bacteria 5213
224 Ga0068863_100003048 3300005841 Bacteria 16555
225 Ga0068863_100035553 3300005841 Bacteria 4745
226 Ga0068858_100000016 3300005842 Bacteria 193130
227 Ga0068858_100000179 3300005842 Bacteria 66961
228 Ga0068858_100005465 3300005842 Bacteria 12444
229 Ga0068858_100012390 3300005842 Bacteria 8040
230 Ga0068858_100081802 3300005842 Bacteria 3002
231 Ga0068860_100000087 3300005843 Bacteria 158242
232 Ga0068860_100000154 3300005843 Bacteria 111793
233 Ga0068860_100017715 3300005843 Bacteria 6938
234 Ga0068860_100170998 3300005843 Bacteria 2099
235 Ga0068862_100000190 3300005844 Bacteria 67924
236 Ga0068862_100000312 3300005844 Bacteria 53263
237 Ga0068862_100004977 3300005844 Bacteria 11184
238 Ga0081455_10000082 3300005937 Bacteria 103704
239 Ga0081455_10010276 3300005937 Bacteria 9517
240 Ga0081455_10079007 3300005937 Bacteria 2702
241 Ga0081455_10098153 3300005937 Bacteria 2359
242 Ga0081455_10121819 3300005937 Bacteria 2054
243 Ga0081538_10001382 3300005981 Bacteria 24879
244 Ga0081538_10001794 3300005981 Bacteria 21673
245 Ga0081540_1003861 3300005983 Bacteria 11697
246 Ga0081540_1004047 3300005983 Bacteria 11355
247 Ga0081539_10000467 3300005985 Bacteria 85390
248 Ga0081539_10027400 3300005985 Bacteria 3610
249 Ga0081539_10072469 3300005985 Bacteria 1841
250 Ga0070717_10007764 3300006028 Bacteria 7983
251 Ga0070717_10081630 3300006028 Bacteria 2715
252 Ga0075365_10002456 3300006038 Bacteria 9101
253 Ga0075365_10028961 3300006038 Bacteria 3535
254 Ga0075365_10033360 3300006038 Bacteria 3316
255 Ga0075365_10034198 3300006038 Bacteria 3281
256 Ga0075365_10058458 3300006038 Bacteria 2567
257 Ga0075365_10065175 3300006038 Bacteria 2441
258 Ga0075363_100000201 3300006048 Bacteria 16359
259 Ga0075363_100003979 3300006048 Bacteria 6389
260 Ga0075363_100009777 3300006048 Bacteria 4520
261 Ga0075363_100065368 3300006048 Bacteria 1966
262 Ga0075363_100067724 3300006048 Bacteria 1935
263 Ga0075364_10000723 3300006051 Bacteria 17264
264 Ga0075364_10003104 3300006051 Bacteria 9396
265 Ga0075364_10010199 3300006051 Bacteria 5665
266 Ga0075364_10024783 3300006051 Bacteria 3812
267 Ga0075364_10034632 3300006051 Bacteria 3259
268 Ga0075364_10037917 3300006051 Bacteria 3122
269 Ga0075364_10126099 3300006051 Bacteria 1716
270 Ga0075364_10133480 3300006051 Bacteria 1667
271 Ga0070715_10001150 3300006163 Bacteria 7570
272 Ga0070715_10055444 3300006163 Bacteria 1720
273 Ga0070716_100007290 3300006173 Bacteria 5440
274 Ga0070712_100002802 3300006175 Bacteria 10778
275 Ga0070712_100012929 3300006175 Bacteria 5318
276 Ga0070712_100032414 3300006175 Bacteria 3529
277 Ga0070712_100036549 3300006175 Bacteria 3343
278 Ga0070712_100117682 3300006175 Bacteria 1995
279 Ga0075362_10029281 3300006177 Bacteria 2372
280 Ga0075367_10031724 3300006178 Bacteria 3036
281 Ga0075367_10032134 3300006178 Bacteria 3017
282 Ga0075367_10177514 3300006178 Bacteria 1327
283 Ga0075369_10002730 3300006186 Bacteria 6330
284 Ga0075369_10004308 3300006186 Bacteria 5244
285 Ga0075369_10004998 3300006186 Bacteria 4935
286 Ga0075369_10005608 3300006186 Bacteria 4699
287 Ga0075369_10085197 3300006186 Bacteria 1405
288 Ga0097621_100151492 3300006237 Bacteria 1989
289 Ga0075370_10044515 3300006353 Bacteria 2509
290 Ga0075370_10061384 3300006353 Bacteria 2141
291 Ga0075370_10074977 3300006353 Bacteria 1939
292 Ga0075428_100005250 3300006844 Bacteria 14401
293 Ga0075428_100031735 3300006844 Bacteria 5835
294 Ga0075430_100000294 3300006846 Bacteria 35128
295 Ga0075430_100062808 3300006846 Bacteria 3119
296 Ga0075431_100062538 3300006847 Bacteria 3841
297 Ga0075431_100075899 3300006847 Bacteria 3468
298 Ga0075431_100360363 3300006847 Bacteria 1461
299 Ga0075433_10122858 3300006852 Unclassified 2306
300 Ga0075433_10300617 3300006852 Bacteria 1421
301 Ga0075434_100007636 3300006871 Archaea 10007
302 Ga0075429_100023377 3300006880 Bacteria 5364
303 Ga0075429_100070519 3300006880 Bacteria 3043
304 Ga0068865_100002468 3300006881 Bacteria 10946
305 Ga0068865_100044021 3300006881 Bacteria 3053
306 Ga0068865_100066192 3300006881 Bacteria 2548
307 Ga0068865_100278411 3300006881 Bacteria 1331
308 Ga0097620_100000049 3300006931 Bacteria 137619
309 Ga0097620_100001784 3300006931 Bacteria 21903
310 Ga0097620_100002254 3300006931 Bacteria 19564
311 Ga0097620_100012347 3300006931 Bacteria 8592
312 Ga0097620_100144244 3300006931 Bacteria 2455
313 Ga0075435_100011202 3300007076 Bacteria 6581
314 Ga0099794_10000314 3300007265 Bacteria 16524
315 Ga0105244_10033017 3300009036 Bacteria 2733
316 Ga0105244_10033778 3300009036 Bacteria 2695
317 Ga0105244_10112258 3300009036 Bacteria 1325
318 Ga0105240_10005015 3300009093 Bacteria 19863
319 Ga0105240_10051407 3300009093 Bacteria 5185
320 Ga0105240_10085563 3300009093 Bacteria 3863
321 Ga0105240_10313825 3300009093 Bacteria 1789
322 Ga0111539_10094250 3300009094 Bacteria 3517
323 Ga0105245_10004537 3300009098 Bacteria 12260
324 Ga0105245_10006332 3300009098 Bacteria 10414
325 Ga0105245_10025093 3300009098 Bacteria 5241
326 Ga0105245_10111351 3300009098 Bacteria 2546
327 Ga0105245_10126199 3300009098 Bacteria 2396
328 Ga0105245_10149353 3300009098 Bacteria 2208
329 Ga0105247_10000159 3300009101 Bacteria 66013
330 Ga0105247_10000376 3300009101 Bacteria 37966
331 Ga0105247_10004231 3300009101 Bacteria 9201
332 Ga0105247_10043655 3300009101 Bacteria 2747
333 Ga0114129_10025993 3300009147 Bacteria 8290
334 Ga0114129_10043021 3300009147 Bacteria 6357
335 Ga0114129_10063215 3300009147 Bacteria 5170
336 Ga0105243_10012483 3300009148 Bacteria 6424
337 Ga0105243_10029324 3300009148 Bacteria 4230
338 Ga0105243_10069791 3300009148 Bacteria 2835
339 Ga0105243_10201321 3300009148 Bacteria 1746
340 Ga0105241_10007128 3300009174 Bacteria 8229
341 Ga0105241_10023785 3300009174 Bacteria 4546
342 Ga0105242_10000880 3300009176 Bacteria 23297
343 Ga0105242_10018500 3300009176 Bacteria 5448
344 Ga0105242_10135002 3300009176 Bacteria 2134
345 Ga0105242_10196341 3300009176 Bacteria 1790
346 Ga0105248_10000050 3300009177 Bacteria 152667
347 Ga0105248_10015100 3300009177 Bacteria 8506
348 Ga0105248_10058631 3300009177 Bacteria 4324
349 Ga0105248_10071820 3300009177 Bacteria 3889
350 Ga0105248_10085325 3300009177 Bacteria 3553
351 Ga0105248_10093820 3300009177 Bacteria 3380
352 Ga0105248_10102045 3300009177 Bacteria 3233
353 Ga0105248_10139647 3300009177 Bacteria 2733
354 Ga0105237_10000302 3300009545 Bacteria 68290
355 Ga0105237_10001065 3300009545 Bacteria 36852
356 Ga0105237_10004166 3300009545 Bacteria 16835
357 Ga0105237_10005434 3300009545 Bacteria 14389
358 Ga0105237_10035167 3300009545 Bacteria 5071
359 Ga0105237_10059928 3300009545 Bacteria 3808
360 Ga0105237_10139560 3300009545 Bacteria 2418
361 Ga0105237_10140579 3300009545 Bacteria 2408
362 Ga0105238_10026434 3300009551 Bacteria 5918
363 Ga0105238_10053225 3300009551 Bacteria 4068
364 Ga0105238_10133069 3300009551 Bacteria 2465
365 Ga0105249_10000042 3300009553 Bacteria 195242
366 Ga0105249_10010531 3300009553 Bacteria 8123
367 Ga0105249_10048212 3300009553 Bacteria 3884
368 Ga0105249_10082403 3300009553 Bacteria 2993
369 Ga0105249_10128286 3300009553 Bacteria 2418
370 Ga0105249_10172445 3300009553 Bacteria 2099
371 Ga0105249_10267898 3300009553 Bacteria 1700
372 Ga0105239_10004010 3300010375 Bacteria 17835
373 Ga0105239_10012785 3300010375 Bacteria 9339
374 Ga0105239_10100347 3300010375 Bacteria 3202
375 Ga0105246_10003745 3300011119 Bacteria 9219
376 Ga0105246_10073964 3300011119 Bacteria 2407
377 Ga0105246_10094175 3300011119 Bacteria 2166
378 Ga0105246_10096186 3300011119 Bacteria 2146
379 Ga0105246_10130680 3300011119 Bacteria 1875
380 Ga0157373_10035357 3300013100 Bacteria 3587
381 Ga0157371_10041403 3300013102 Bacteria 3287
382 Ga0157371_10066105 3300013102 Bacteria 2561
383 Ga0157371_10069843 3300013102 Bacteria 2487
384 Ga0157370_10002163 3300013104 Bacteria 23996
385 Ga0157370_10007445 3300013104 Bacteria 11901
386 Ga0157370_10027650 3300013104 Bacteria 5591
387 Ga0157370_10034752 3300013104 Bacteria 4904
388 Ga0157370_10046918 3300013104 Bacteria 4141
389 Ga0157370_10293017 3300013104 Bacteria 1503
390 Ga0157369_10000230 3300013105 Bacteria 77399
391 Ga0157369_10002312 3300013105 Bacteria 22937
392 Ga0157369_10010811 3300013105 Bacteria 10392
393 Ga0157369_10012349 3300013105 Bacteria 9697
394 Ga0157369_10014343 3300013105 Bacteria 8948
395 Ga0157369_10022758 3300013105 Bacteria 6988
396 Ga0157369_10067879 3300013105 Bacteria 3832
397 Ga0157369_10132655 3300013105 Bacteria 2639
398 Ga0157369_10149419 3300013105 Bacteria 2469
399 Ga0157369_10199267 3300013105 Bacteria 2102
400 Ga0171462_1001 3300013250 Bacteria 1135406
401 Ga0157374_10011242 3300013296 Bacteria 7742
402 Ga0157374_10041552 3300013296 Bacteria 4238
403 Ga0157378_10003787 3300013297 Bacteria 13406
404 Ga0157378_10033544 3300013297 Bacteria 4540
405 Ga0157378_10085185 3300013297 Bacteria 2863
406 Ga0163162_10029817 3300013306 Bacteria 5401
407 Ga0163162_10046065 3300013306 Bacteria 4371
408 Ga0163162_10084959 3300013306 Bacteria 3241
409 Ga0163162_10195861 3300013306 Bacteria 2149
410 Ga0157372_10001405 3300013307 Bacteria 25975
411 Ga0157372_10022392 3300013307 Bacteria 6836
412 Ga0157372_10069659 3300013307 Bacteria 3956
413 Ga0157372_10079284 3300013307 Bacteria 3713
414 Ga0157372_10088253 3300013307 Bacteria 3521
415 Ga0157372_10092930 3300013307 Bacteria 3432
416 Ga0157372_10222180 3300013307 Bacteria 2189
417 Ga0157375_10013718 3300013308 Bacteria 7223
418 Ga0157375_10016612 3300013308 Bacteria 6618
419 Ga0157375_10076311 3300013308 Bacteria 3378
420 Ga0157375_10087739 3300013308 Bacteria 3164
421 Ga0157375_10102159 3300013308 Bacteria 2952
422 Ga0157375_10236263 3300013308 Bacteria 1987
423 Ga0163163_10004486 3300014325 Bacteria 11910
424 Ga0163163_10056964 3300014325 Bacteria 3864
425 Ga0163163_10072366 3300014325 Bacteria 3436
426 Ga0163163_10104359 3300014325 Bacteria 2860
427 Ga0163163_10235044 3300014325 Bacteria 1882
428 Ga0163163_10342163 3300014325 Bacteria 1551
429 Ga0157380_10192700 3300014326 Bacteria 1801
430 Ga0157377_10024809 3300014745 Bacteria 3191
431 Ga0157379_10002686 3300014968 Bacteria 14987
432 Ga0157379_10004386 3300014968 Bacteria 12078
433 Ga0157379_10008257 3300014968 Bacteria 9047
434 Ga0157379_10016792 3300014968 Bacteria 6442
435 Ga0157379_10051898 3300014968 Bacteria 3661
436 Ga0157379_10219592 3300014968 Bacteria 1722
437 Ga0163161_10010839 3300017792 Bacteria 6319
438 Ga0163161_10031311 3300017792 Bacteria 3789
439 Ga0163161_10039383 3300017792 Bacteria 3393
440 Ga0163161_10116809 3300017792 Bacteria 2000
441 Ga0197907_10127029 3300020069 Bacteria 2971
442 Ga0197907_10587311 3300020069 Bacteria 1293
443 Ga0206356_10558971 3300020070 Bacteria 1253
444 Ga0206351_10127684 3300020077 Bacteria 1806
445 Ga0206351_10456609 3300020077 Bacteria 1899
446 Ga0206350_10025198 3300020080 Bacteria 1647
447 Ga0206350_11148788 3300020080 Bacteria 1296
448 Ga0206354_11217485 3300020081 Bacteria 4008
449 Ga0206354_11437303 3300020081 Bacteria 1245
450 Ga0206353_11101538 3300020082 Bacteria 2505
451 Ga0213875_10011668 3300021388 Bacteria 4364
452 Ga0213871_10015809 3300021441 Bacteria 1810
453 Ga0224712_10010230 3300022467 Bacteria 2862
454 Ga0224712_10020419 3300022467 Bacteria 2249
455 Ga0224712_10023129 3300022467 Bacteria 2153
456 Ga0224712_10042451 3300022467 Bacteria 1723
457 Ga0224572_1006386 3300024225 Bacteria 2132
458 Ga0209566_100053 3300025225 Bacteria 224436
459 Ga0209674_100001 3300025226 Bacteria 4013750
460 Ga0209672_100039 3300025228 Bacteria 283064
461 Ga0209147_100507 3300025229 Bacteria 22670
462 Ga0209563_100001 3300025230 Bacteria 4013775
463 Ga0209437_100369 3300025233 Bacteria 47150
464 Ga0207425_1009908 3300025245 Bacteria 2343
465 Ga0209646_1000088 3300025246 Bacteria 192345
466 Ga0209677_100001 3300025253 Bacteria 4013787
467 Ga0209677_100448 3300025253 Bacteria 23936
468 Ga0209148_1000004 3300025254 Bacteria 1844481
469 Ga0209148_1002289 3300025254 Bacteria 6896
470 Ga0209148_1010632 3300025254 Bacteria 1737
471 Ga0209129_1000109 3300025258 Bacteria 153068
472 Ga0209233_1000001 3300025261 Bacteria 2992747
473 Ga0209455_1000117 3300025272 Bacteria 176940
474 Ga0209455_1001874 3300025272 Bacteria 8783
475 Ga0209673_1017529 3300025273 Bacteria 2638
476 Ga0209025_1000984 3300025294 Bacteria 42427
477 Ga0209051_1000033 3300025303 Bacteria 380540
478 Ga0209051_1000633 3300025303 Bacteria 40448
479 Ga0209051_1002844 3300025303 Bacteria 11927
480 Ga0209051_1015719 3300025303 Bacteria 3467
481 Ga0209051_1029411 3300025303 Bacteria 2151
482 Ga0207697_10077557 3300025315 Bacteria 1397
483 Ga0207656_10000005 3300025321 Bacteria 490514
484 Ga0207655_1021163 3300025728 Bacteria 3312
485 Ga0207655_1025368 3300025728 Bacteria 2880
486 Ga0207655_1062958 3300025728 Bacteria 1424
487 Ga0207713_1034408 3300025735 Bacteria 2201
488 Ga0207682_10005955 3300025893 Bacteria 4932
489 Ga0207692_10026792 3300025898 Bacteria 2707
490 Ga0207642_10000166 3300025899 Bacteria 18838
491 Ga0207642_10067166 3300025899 Bacteria 1691
492 Ga0207642_10085016 3300025899 Bacteria 1547
493 Ga0207710_10000017 3300025900 Bacteria 370962
494 Ga0207710_10000019 3300025900 Bacteria 339682
495 Ga0207710_10000173 3300025900 Bacteria 66353
496 Ga0207688_10008958 3300025901 Bacteria 5447
497 Ga0207688_10114156 3300025901 Bacteria 1571
498 Ga0207647_10009465 3300025904 Bacteria 6921
499 Ga0207647_10023826 3300025904 Bacteria 4043
500 Ga0207647_10027988 3300025904 Bacteria 3669
501 Ga0207647_10046699 3300025904 Bacteria 2697
502 Ga0207685_10000910 3300025905 Bacteria 5637
503 Ga0207685_10056806 3300025905 Bacteria 1533
504 Ga0207645_10029223 3300025907 Bacteria 3554
505 Ga0207643_10065259 3300025908 Bacteria 2085
506 Ga0207705_10000001 3300025909 Bacteria 2061880
507 Ga0207705_10054377 3300025909 Bacteria 2885
508 Ga0207705_10063392 3300025909 Bacteria 2670
509 Ga0207705_10150677 3300025909 Bacteria 1743
510 Ga0207684_10012433 3300025910 Bacteria 7405
511 Ga0207654_10000001 3300025911 Bacteria 1816198
512 Ga0207707_10008370 3300025912 Bacteria 8976
513 Ga0207707_10008629 3300025912 Bacteria 8841
514 Ga0207707_10142229 3300025912 Bacteria 2098
515 Ga0207695_10004239 3300025913 Bacteria 19705
516 Ga0207695_10011642 3300025913 Bacteria 10631
517 Ga0207671_10000016 3300025914 Bacteria 435413
518 Ga0207671_10002478 3300025914 Bacteria 19723
519 Ga0207671_10018148 3300025914 Bacteria 5406
520 Ga0207671_10097567 3300025914 Bacteria 2222
521 Ga0207671_10126529 3300025914 Bacteria 1958
522 Ga0207693_10000366 3300025915 Bacteria 41351
523 Ga0207693_10000550 3300025915 Bacteria 33865
524 Ga0207693_10004959 3300025915 Bacteria 11185
525 Ga0207693_10005203 3300025915 Bacteria 10890
526 Ga0207693_10015176 3300025915 Bacteria 6182
527 Ga0207693_10019113 3300025915 Bacteria 5453
528 Ga0207693_10127422 3300025915 Bacteria 2001
529 Ga0207693_10227148 3300025915 Bacteria 1466
530 Ga0207663_10019629 3300025916 Bacteria 3813
531 Ga0207660_10017090 3300025917 Bacteria 4814
532 Ga0207660_10111176 3300025917 Bacteria 2062
533 Ga0207660_10200760 3300025917 Bacteria 1557
534 Ga0207662_10014650 3300025918 Bacteria 4402
535 Ga0207657_10005602 3300025919 Bacteria 13110
536 Ga0207657_10010726 3300025919 Bacteria 9124
537 Ga0207657_10012581 3300025919 Bacteria 8341
538 Ga0207657_10035747 3300025919 Bacteria 4452
539 Ga0207657_10041968 3300025919 Bacteria 4040
540 Ga0207657_10068982 3300025919 Bacteria 3002
541 Ga0207657_10080923 3300025919 Bacteria 2729
542 Ga0207657_10090348 3300025919 Bacteria 2556
543 Ga0207652_10006710 3300025921 Bacteria 9274
544 Ga0207652_10033838 3300025921 Bacteria 4305
545 Ga0207652_10205567 3300025921 Bacteria 1772
546 Ga0207652_10208365 3300025921 Bacteria 1760
547 Ga0207652_10230134 3300025921 Bacteria 1671
548 Ga0207646_10000477 3300025922 Bacteria 53501
549 Ga0207646_10000516 3300025922 Bacteria 51539
550 Ga0207646_10000701 3300025922 Bacteria 43458
551 Ga0207646_10004516 3300025922 Bacteria 15070
552 Ga0207646_10005407 3300025922 Bacteria 13435
553 Ga0207646_10006235 3300025922 Bacteria 12393
554 Ga0207646_10032861 3300025922 Bacteria 4693
555 Ga0207646_10302369 3300025922 Bacteria 1445
556 Ga0207681_10003622 3300025923 Bacteria 9604
557 Ga0207681_10012735 3300025923 Bacteria 5195
558 Ga0207681_10124519 3300025923 Bacteria 1895
559 Ga0207694_10000057 3300025924 Bacteria 146441
560 Ga0207694_10011213 3300025924 Bacteria 6767
561 Ga0207650_10050965 3300025925 Bacteria 3062
562 Ga0207650_10090769 3300025925 Bacteria 2333
563 Ga0207650_10278000 3300025925 Bacteria 1362
564 Ga0207650_10339941 3300025925 Bacteria 1233
565 Ga0207659_10071749 3300025926 Bacteria 2529
566 Ga0207659_10102824 3300025926 Bacteria 2157
567 Ga0207687_10001986 3300025927 Bacteria 14051
568 Ga0207687_10002057 3300025927 Bacteria 13776
569 Ga0207687_10006572 3300025927 Bacteria 7670
570 Ga0207687_10028962 3300025927 Bacteria 3722
571 Ga0207687_10051744 3300025927 Bacteria 2864
572 Ga0207687_10057739 3300025927 Bacteria 2728
573 Ga0207687_10111857 3300025927 Bacteria 2028
574 Ga0207700_10028709 3300025928 Bacteria 3916
575 Ga0207700_10040797 3300025928 Bacteria 3390
576 Ga0207700_10126325 3300025928 Bacteria 2081
577 Ga0207664_10011215 3300025929 Bacteria 6354
578 Ga0207664_10017974 3300025929 Bacteria 5195
579 Ga0207664_10031585 3300025929 Bacteria 4053
580 Ga0207664_10056316 3300025929 Bacteria 3122
581 Ga0207664_10109584 3300025929 Bacteria 2294
582 Ga0207664_10124094 3300025929 Bacteria 2166
583 Ga0207664_10217091 3300025929 Bacteria 1657
584 Ga0207644_10000533 3300025931 Bacteria 24656
585 Ga0207644_10156728 3300025931 Bacteria 1766
586 Ga0207690_10023284 3300025932 Bacteria 3864
587 Ga0207690_10043003 3300025932 Bacteria 2971
588 Ga0207690_10046233 3300025932 Bacteria 2882
589 Ga0207706_10004090 3300025933 Bacteria 13781
590 Ga0207706_10023329 3300025933 Bacteria 5557
591 Ga0207706_10098926 3300025933 Bacteria 2566
592 Ga0207686_10013657 3300025934 Bacteria 4498
593 Ga0207686_10039601 3300025934 Bacteria 2860
594 Ga0207686_10163127 3300025934 Bacteria 1564
595 Ga0207709_10003392 3300025935 Bacteria 9517
596 Ga0207709_10013839 3300025935 Bacteria 4454
597 Ga0207709_10030200 3300025935 Bacteria 3151
598 Ga0207709_10041889 3300025935 Bacteria 2751
599 Ga0207709_10086590 3300025935 Bacteria 2034
600 Ga0207709_10090833 3300025935 Bacteria 1996
601 Ga0207709_10102032 3300025935 Bacteria 1899
602 Ga0207709_10120608 3300025935 Bacteria 1770
603 Ga0207709_10206581 3300025935 Bacteria 1406
604 Ga0207670_10045463 3300025936 Bacteria 2911
605 Ga0207669_10000321 3300025937 Bacteria 21927
606 Ga0207669_10051938 3300025937 Bacteria 2459
607 Ga0207669_10091373 3300025937 Bacteria 1983
608 Ga0207669_10093143 3300025937 Bacteria 1968
609 Ga0207669_10135214 3300025937 Bacteria 1701
610 Ga0207669_10135649 3300025937 Bacteria 1699
611 Ga0207704_10043537 3300025938 Bacteria 2652
612 Ga0207704_10074438 3300025938 Bacteria 2167
613 Ga0207665_10018374 3300025939 Bacteria 4595
614 Ga0207665_10042074 3300025939 Bacteria 3053
615 Ga0207691_10004828 3300025940 Bacteria 13038
616 Ga0207691_10019669 3300025940 Bacteria 6387
617 Ga0207691_10020522 3300025940 Bacteria 6247
618 Ga0207691_10145476 3300025940 Bacteria 2087
619 Ga0207711_10000988 3300025941 Bacteria 27253
620 Ga0207711_10005023 3300025941 Bacteria 11222
621 Ga0207711_10032150 3300025941 Bacteria 4436
622 Ga0207711_10053676 3300025941 Bacteria 3456
623 Ga0207711_10094465 3300025941 Bacteria 2635
624 Ga0207711_10100070 3300025941 Bacteria 2564
625 Ga0207711_10180181 3300025941 Bacteria 1921
626 Ga0207689_10050492 3300025942 Bacteria 3429
627 Ga0207661_10000257 3300025944 Bacteria 34367
628 Ga0207661_10011892 3300025944 Bacteria 6320
629 Ga0207661_10029811 3300025944 Bacteria 4194
630 Ga0207661_10039576 3300025944 Bacteria 3701
631 Ga0207661_10063407 3300025944 Bacteria 2993
632 Ga0207679_10297567 3300025945 Bacteria 1390
633 Ga0207667_10005061 3300025949 Bacteria 16105
634 Ga0207667_10020001 3300025949 Bacteria 7457
635 Ga0207667_10027633 3300025949 Bacteria 6172
636 Ga0207667_10045682 3300025949 Bacteria 4638
637 Ga0207667_10047897 3300025949 Bacteria 4521
638 Ga0207667_10083612 3300025949 Bacteria 3305
639 Ga0207667_10084614 3300025949 Bacteria 3283
640 Ga0207667_10129403 3300025949 Bacteria 2600
641 Ga0207667_10154487 3300025949 Bacteria 2361
642 Ga0207667_10182780 3300025949 Bacteria 2153
643 Ga0207667_10193446 3300025949 Bacteria 2087
644 Ga0207651_10192083 3300025960 Bacteria 1629
645 Ga0207712_10000010 3300025961 Bacteria 455972
646 Ga0207712_10012828 3300025961 Bacteria 5359
647 Ga0207712_10044673 3300025961 Bacteria 3063
648 Ga0207712_10074694 3300025961 Bacteria 2448
649 Ga0207712_10077306 3300025961 Bacteria 2412
650 Ga0207712_10177215 3300025961 Bacteria 1671
651 Ga0207668_10009380 3300025972 Bacteria 5862
652 Ga0207668_10025670 3300025972 Bacteria 3815
653 Ga0207668_10069477 3300025972 Bacteria 2508
654 Ga0207668_10079801 3300025972 Bacteria 2368
655 Ga0207668_10141430 3300025972 Bacteria 1851
656 Ga0207640_10272808 3300025981 Bacteria 1324
657 Ga0207658_10000278 3300025986 Bacteria 53527
658 Ga0207658_10070698 3300025986 Bacteria 2641
659 Ga0207658_10193554 3300025986 Bacteria 1693
660 Ga0207677_10046959 3300026023 Bacteria 2895
661 Ga0207677_10071358 3300026023 Bacteria 2451
662 Ga0207677_10082134 3300026023 Bacteria 2315
663 Ga0207703_10000013 3300026035 Bacteria 305126
664 Ga0207703_10000345 3300026035 Bacteria 49953
665 Ga0207703_10008645 3300026035 Bacteria 8035
666 Ga0207703_10011120 3300026035 Bacteria 7008
667 Ga0207703_10076268 3300026035 Bacteria 2780
668 Ga0207639_10016458 3300026041 Bacteria 5233
669 Ga0207639_10022472 3300026041 Bacteria 4543
670 Ga0207639_10035803 3300026041 Bacteria 3674
671 Ga0207639_10094180 3300026041 Bacteria 2404
672 Ga0207639_10152400 3300026041 Bacteria 1938
673 Ga0207678_10000229 3300026067 Bacteria 49946
674 Ga0207678_10019579 3300026067 Bacteria 5949
675 Ga0207678_10023067 3300026067 Bacteria 5446
676 Ga0207678_10029378 3300026067 Bacteria 4797
677 Ga0207678_10053285 3300026067 Bacteria 3487
678 Ga0207678_10084801 3300026067 Bacteria 2709
679 Ga0207678_10140891 3300026067 Bacteria 2058
680 Ga0207678_10203261 3300026067 Bacteria 1694
681 Ga0207678_10219045 3300026067 Bacteria 1629
682 Ga0207708_10000029 3300026075 Bacteria 161861
683 Ga0207708_10047044 3300026075 Bacteria 3286
684 Ga0207708_10067474 3300026075 Bacteria 2736
685 Ga0207708_10091878 3300026075 Bacteria 2341
686 Ga0207708_10226059 3300026075 Bacteria 1501
687 Ga0207702_10022503 3300026078 Bacteria 5225
688 Ga0207702_10032719 3300026078 Bacteria 4339
689 Ga0207702_10074804 3300026078 Bacteria 2924
690 Ga0207702_10094243 3300026078 Bacteria 2628
691 Ga0207702_10160339 3300026078 Bacteria 2054
692 Ga0207702_10215120 3300026078 Bacteria 1788
693 Ga0207702_10221456 3300026078 Bacteria 1763
694 Ga0207702_10236734 3300026078 Bacteria 1709
695 Ga0207641_10000784 3300026088 Bacteria 33944
696 Ga0207641_10001715 3300026088 Bacteria 21243
697 Ga0207641_10003875 3300026088 Bacteria 13095
698 Ga0207641_10169662 3300026088 Bacteria 1990
699 Ga0207648_10001482 3300026089 Bacteria 25825
700 Ga0207648_10017928 3300026089 Bacteria 6421
701 Ga0207648_10051302 3300026089 Bacteria 3605
702 Ga0207676_10208626 3300026095 Bacteria 1732
703 Ga0207674_10006801 3300026116 Bacteria 13418
704 Ga0207674_10009792 3300026116 Bacteria 10916
705 Ga0207674_10064434 3300026116 Bacteria 3696
706 Ga0207674_10127782 3300026116 Bacteria 2506
707 Ga0207674_10134200 3300026116 Bacteria 2438
708 Ga0207675_100003809 3300026118 Bacteria 14698
709 Ga0207675_100062849 3300026118 Bacteria 3469
710 Ga0207675_100127813 3300026118 Bacteria 2408
711 Ga0207675_100142217 3300026118 Bacteria 2280
712 Ga0207675_100174383 3300026118 Bacteria 2057
713 Ga0207683_10001283 3300026121 Bacteria 22741
714 Ga0207683_10003164 3300026121 Bacteria 14369
715 Ga0207683_10066126 3300026121 Bacteria 3188
716 Ga0207683_10186624 3300026121 Bacteria 1881
717 Ga0207683_10377498 3300026121 Bacteria 1303
718 Ga0207698_10062658 3300026142 Bacteria 2905
719 Ga0207698_10108734 3300026142 Bacteria 2318
720 Ga0207698_10157060 3300026142 Bacteria 1983
721 Ga0207698_10173142 3300026142 Bacteria 1903
722 Ga0207698_10217215 3300026142 Bacteria 1725
723 Ga0207698_10275758 3300026142 Bacteria 1553
724 Ga0207428_10010654 3300027907 Bacteria 8202
725 Ga0268266_10001660 3300028379 Bacteria 25696
726 Ga0268266_10004579 3300028379 Bacteria 13206
727 Ga0268266_10006280 3300028379 Bacteria 10903
728 Ga0268266_10012115 3300028379 Bacteria 7464
729 Ga0268266_10016431 3300028379 Bacteria 6326
730 Ga0268266_10044774 3300028379 Bacteria 3783
731 Ga0268266_10065440 3300028379 Bacteria 3143
732 Ga0268265_10000014 3300028380 Bacteria 330186
733 Ga0268265_10000041 3300028380 Bacteria 189918
734 Ga0268265_10043944 3300028380 Bacteria 3324
735 Ga0268265_10186334 3300028380 Bacteria 1788
736 Ga0268264_10000150 3300028381 Bacteria 158263
737 Ga0268264_10000210 3300028381 Bacteria 118222
738 Ga0268264_10000498 3300028381 Bacteria 51440
739 Ga0268264_10001010 3300028381 Bacteria 28549
740 Ga0268264_10491113 3300028381 Bacteria 1196
741 Ga0265337_1000861 3300028556 Bacteria 15952
742 Ga0265326_10001260 3300028558 Bacteria 9015
743 Ga0265319_1000828 3300028563 Bacteria 19683
744 Ga0265334_10000237 3300028573 Bacteria 31781
745 Ga0265318_10008654 3300028577 Bacteria 4513
746 Ga0265323_10005269 3300028653 Bacteria 5495
747 Ga0265322_10010118 3300028654 Bacteria 2734
748 Ga0265336_10002720 3300028666 Bacteria 7155
749 Ga0307515_10022361 3300028794 Bacteria 11146
750 Ga0307515_10037313 3300028794 Bacteria 7819
751 Ga0307515_10175114 3300028794 Bacteria 2119
752 Ga0265338_10000376 3300028800 Bacteria 79928
753 Ga0265338_10001480 3300028800 Bacteria 38067
754 Ga0265338_10015126 3300028800 Bacteria 8512
755 Ga0265324_10008950 3300029957 Bacteria 3939
756 Ga0307512_10004160 3300030522 Bacteria 16050
757 Ga0316177_1181774 3300030731 Bacteria 1669
758 Ga0316176_1121577 3300030732 Bacteria 2280
759 Ga0316176_1187053 3300030732 Bacteria 1347
760 Ga0314311_1118439 3300030733 Bacteria 5825
761 Ga0314311_1132449 3300030733 Bacteria 2662
762 Ga0316181_1233539 3300030744 Bacteria 1738
763 Ga0265332_10002532 3300031238 Bacteria 9274
764 Ga0265320_10000532 3300031240 Bacteria 29415
765 Ga0265340_10004583 3300031247 Bacteria 7694
766 Ga0265339_10030866 3300031249 Bacteria 3033
767 Ga0265331_10042159 3300031250 Bacteria 2215
768 Ga0265327_10003399 3300031251 Bacteria 15275
769 Ga0265316_10006104 3300031344 Bacteria 11560
770 Ga0265316_10050856 3300031344 Bacteria 3258
771 Ga0307513_10004729 3300031456 Bacteria 18102
772 Ga0307513_10006259 3300031456 Bacteria 15592
773 Ga0307513_10016777 3300031456 Bacteria 8812
774 Ga0307513_10202081 3300031456 Bacteria 1827
775 Ga0307408_100171077 3300031548 Bacteria 1734
776 Ga0307408_100191933 3300031548 Bacteria 1646
777 Ga0307408_100246721 3300031548 Bacteria 1470
778 Ga0307408_100281850 3300031548 Bacteria 1384
779 Ga0265313_10006611 3300031595 Bacteria 8146
780 Ga0307508_10135401 3300031616 Bacteria 2067
781 Ga0307514_10002631 3300031649 Bacteria 18347
782 Ga0307514_10011079 3300031649 Bacteria 7511
783 Ga0316575_10001074 3300031665 Bacteria 8520
784 Ga0316579_10006667 3300031691 Bacteria 4722
785 Ga0316579_10006821 3300031691 Bacteria 4679
786 Ga0316579_10039363 3300031691 Unclassified 2190
787 Ga0265314_10016241 3300031711 Bacteria 5890
788 Ga0265342_10022810 3300031712 Bacteria 3973
789 Ga0316576_10001380 3300031727 Bacteria 12959
790 Ga0316576_10003072 3300031727 Bacteria 9720
791 Ga0316576_10017375 3300031727 Bacteria 4885
792 Ga0316576_10040477 3300031727 Bacteria 3350
793 Ga0316576_10112338 3300031727 Bacteria 2043
794 Ga0316578_10002012 3300031728 Bacteria 8648
795 Ga0316578_10003078 3300031728 Bacteria 7531
796 Ga0316578_10017612 3300031728 Bacteria 3892
797 Ga0307405_10034091 3300031731 Bacteria 3026
798 Ga0307405_10039590 3300031731 Bacteria 2850
799 Ga0307405_10058979 3300031731 Bacteria 2417
800 Ga0307405_10164076 3300031731 Bacteria 1577
801 Ga0307405_10196397 3300031731 Bacteria 1461
802 Ga0316577_10023806 3300031733 Bacteria 3399
803 Ga0316577_10026975 3300031733 Bacteria 3201
804 Ga0307413_10039726 3300031824 Bacteria 2739
805 Ga0307413_10117076 3300031824 Bacteria 1796
806 Ga0307518_10000445 3300031838 Bacteria 31568
807 Ga0307518_10001456 3300031838 Bacteria 17573
808 Ga0307410_10005711 3300031852 Bacteria 6627
809 Ga0307410_10007860 3300031852 Bacteria 5872
810 Ga0307410_10059763 3300031852 Bacteria 2603
811 Ga0307410_10099559 3300031852 Bacteria 2081
812 Ga0307410_10161920 3300031852 Bacteria 1677
813 Ga0307410_10172421 3300031852 Bacteria 1631
814 Ga0307406_10000520 3300031901 Bacteria 22113
815 Ga0307406_10002180 3300031901 Bacteria 10659
816 Ga0307406_10007260 3300031901 Bacteria 6137
817 Ga0307406_10046164 3300031901 Bacteria 2740
818 Ga0307406_10069841 3300031901 Bacteria 2298
819 Ga0307406_10075032 3300031901 Bacteria 2229
820 Ga0307406_10082055 3300031901 Bacteria 2146
821 Ga0307406_10109972 3300031901 Bacteria 1895
822 Ga0307407_10037797 3300031903 Bacteria 2670
823 Ga0307407_10080214 3300031903 Bacteria 1971
824 Ga0307412_10010775 3300031911 Bacteria 5275
825 Ga0307412_10078687 3300031911 Bacteria 2272
826 Ga0307412_10109312 3300031911 Bacteria 1971
827 Ga0307409_100002130 3300031995 Bacteria 10199
828 Ga0307409_100002984 3300031995 Bacteria 9018
829 Ga0307409_100010167 3300031995 Bacteria 5831
830 Ga0307409_100021286 3300031995 Bacteria 4442
831 Ga0307409_100035071 3300031995 Bacteria 3672
832 Ga0307409_100075439 3300031995 Bacteria 2700
833 Ga0307409_100151170 3300031995 Bacteria 2016
834 Ga0307409_100168606 3300031995 Bacteria 1924
835 Ga0307416_100098400 3300032002 Bacteria 2537
836 Ga0307416_100100882 3300032002 Bacteria 2512
837 Ga0307416_100103395 3300032002 Bacteria 2487
838 Ga0307416_100121442 3300032002 Bacteria 2329
839 Ga0307416_100140122 3300032002 Bacteria 2196
840 Ga0307416_100176682 3300032002 Bacteria 1996
841 Ga0307416_100180815 3300032002 Bacteria 1976
842 Ga0307416_100495966 3300032002 Bacteria 1284
843 Ga0307414_10018011 3300032004 Bacteria 4335
844 Ga0307414_10023359 3300032004 Bacteria 3921
845 Ga0307414_10032644 3300032004 Bacteria 3431
846 Ga0307414_10040079 3300032004 Bacteria 3161
847 Ga0307414_10062940 3300032004 Bacteria 2635
848 Ga0307414_10086547 3300032004 Bacteria 2313
849 Ga0307414_10173992 3300032004 Bacteria 1724
850 Ga0307411_10043938 3300032005 Bacteria 2862
851 Ga0307411_10082429 3300032005 Bacteria 2218
852 Ga0307415_100002009 3300032126 Bacteria 10023
853 Ga0307415_100046464 3300032126 Bacteria 2917
854 Ga0307415_100064299 3300032126 Bacteria 2552
855 Ga0307415_100113327 3300032126 Bacteria 2016
856 Ga0316583_10020853 3300032133 Bacteria 2349
857 Ga0316585_10006425 3300032137 Bacteria 3361
858 Ga0316585_10012405 3300032137 Bacteria 2524
859 Ga0316585_10034867 3300032137 Bacteria 1592
860 Ga0316580_10004313 3300032139 Bacteria 4118
861 Ga0307507_10014085 3300033179 Bacteria 9590
862 Ga0307507_10045062 3300033179 Bacteria 4346
863 Ga0307507_10045348 3300033179 Bacteria 4326
864 Ga0307510_10037636 3300033180 Bacteria 5365
865 Ga0373926_0000004 3300035083 Bacteria 40904
866 Ga0373926_0003287 3300035083 Bacteria 5194
867 Ga0373926_0005331 3300035083 Bacteria 4233
868 Ga0373934_0004066 3300035086 Bacteria 5389
869 Ga0373934_0005307 3300035086 Bacteria 4766
870 Ga0373944_0000024 3300035089 Bacteria 26949
871 Ga0373944_0002808 3300035089 Bacteria 4455
872 Ga0373923_0009922 3300035111 Bacteria 3449
873 Ga0373936_0000240 3300035113 Bacteria 18113
874 Ga0373936_0000251 3300035113 Bacteria 17775
875 Ga0373936_0048159 3300035113 Bacteria 1720
876 Ga0373939_0026080 3300035114 Bacteria 1644
877 Ga0373945_0000140 3300035116 Bacteria 18218
878 Ga0373953_0033415 3300035117 Bacteria 2012
879 Ga0373954_0008715 3300035118 Bacteria 4458
880 Ga0373956_0002606 3300035119 Bacteria 7312
881 Ga0373956_0011366 3300035119 Bacteria 3666
882 Ga0373957_0031735 3300035120 Bacteria 1942
883 Ga0373943_0001314 3300035170 Bacteria 11168
884 Ga0373943_0007804 3300035170 Bacteria 4805
885 Ga0373946_0000089 3300035171 Bacteria 25208
886 Ga0373946_0000252 3300035171 Bacteria 16973
887 Ga0373946_0043766 3300035171 Bacteria 1846
888 Ga0373955_0004750 3300035172 Bacteria 6044
889 Ga0373955_0071397 3300035172 Bacteria 1942
890 Ga0373955_0120938 3300035172 Bacteria 1522
891 Ga0373942_0007025 3300035207 Bacteria 2602
892 Ga0316574_0000415 3300035398 Bacteria 16875
893 Ga0316574_0012915 3300035398 Bacteria 4789
894 Ga0316574_0025924 3300035398 Bacteria 3523
895 Ga0316574_0033681 3300035398 Bacteria 3118
896 Ga0316574_0136805 3300035398 Bacteria 1577
897 Ga0373924_0023755 3300035410 Bacteria 2409
898 Ga0373924_0039200 3300035410 Bacteria 1935
899 Ga0373931_0009909 3300035691 Bacteria 4565
900 Ga0373931_0017982 3300035691 Bacteria 3507
901 Ga0373935_0000586 3300035692 Bacteria 18964
902 Ga0373935_0000834 3300035692 Bacteria 16581
903 Ga0373935_0012962 3300035692 Bacteria 5024
904 Ga0373935_0064795 3300035692 Bacteria 2343
905 Ga0373927_0001993 3300035695 Bacteria 15054
906 Ga0373927_0001996 3300035695 Bacteria 15042
907 Ga0373927_0049873 3300035695 Bacteria 2706
908 Ga0373933_0020579 3300035724 Bacteria 3741
909 Ga0373933_0066690 3300035724 Bacteria 2181
910 Ga0373947_0000007 3300035725 Bacteria 192259
911 Ga0373947_0007154 3300035725 Bacteria 6469
912 Ga0373947_0007697 3300035725 Bacteria 6225
913 Ga0373937_0013695 3300036401 Bacteria 7144
914 Ga0373937_0206334 3300036401 Bacteria 1848
915 Ga0316582_0078006 3300036647 Bacteria 2157
916 Ga0316584_0000383 3300036712 Bacteria 22877
917 Ga0316584_0058602 3300036712 Bacteria 2883
918 Ga0316584_0082555 3300036712 Bacteria 2407
919 Ga0316584_0116975 3300036712 Bacteria 1993
920 Ga0373925_0000004 3300037068 Bacteria 361597
921 Ga0373925_0003736 3300037068 Bacteria 11690
922 Ga0373925_0012813 3300037068 Bacteria 6074
923 Ga0395899_0008790 3300037312 Bacteria 7771
924 Ga0395899_0015761 3300037312 Bacteria 5763
925 Ga0395899_0039667 3300037312 Bacteria 3523
926 Ga0395899_0070232 3300037312 Bacteria 2563
927 Ga0395899_0071152 3300037312 Bacteria 2545
928 Ga0395899_0123009 3300037312 Bacteria 1857
929 Ga0395900_0015052 3300037418 Bacteria 7884
930 Ga0395900_0035372 3300037418 Bacteria 5144
931 Ga0395900_0040502 3300037418 Bacteria 4801
932 Ga0395900_0074598 3300037418 Bacteria 3487
933 Ga0395900_0101893 3300037418 Bacteria 2949
934 Ga0395900_0112660 3300037418 Bacteria 2793
935 Ga0395900_0137294 3300037418 Bacteria 2505
936 Ga0395900_0140005 3300037418 Bacteria 2478
937 Ga0395900_0243208 3300037418 Bacteria 1804
938 Ga0395898_0000381 3300037466 Bacteria 97274
939 Ga0395898_0005576 3300037466 Bacteria 13569
940 Ga0395898_0011069 3300037466 Bacteria 9393
941 Ga0395898_0080616 3300037466 Bacteria 3139
942 Ga0395898_0115294 3300037466 Bacteria 2574
943 Ga0395905_0039073 3300037471 Bacteria 4452
944 Ga0395905_0056411 3300037471 Bacteria 3675
945 Ga0436364_0010700 3300037853 Bacteria 115369
946 Ga0436364_0048623 3300037853 Bacteria 9076
947 Ga0436364_1071680 3300037853 Bacteria 1719
948 Ga0436364_1508399 3300037853 Bacteria 1852
949 Ga0395901_0050485 3300038443 Bacteria 4321
950 Ga0395901_0064601 3300038443 Bacteria 3810
951 Ga0395901_0066733 3300038443 Bacteria 3747
952 Ga0395901_0076931 3300038443 Bacteria 3482
953 Ga0395901_0124894 3300038443 Bacteria 2704
954 Ga0395901_0133959 3300038443 Bacteria 2604
955 Ga0395901_0222281 3300038443 Bacteria 1974
956 Ga0395901_0257884 3300038443 Bacteria 1815
957 Ga0436365_1474856 3300039437 Bacteria 28836
958 Ga0436365_1712156 3300039437 Bacteria 11498
959 Ga0436360_0167640 3300039438 Bacteria 2739
960 Ga0436361_0615022 3300039447 Bacteria 7070
961 Ga0436362_0365102 3300039453 Bacteria 4965
962 Ga0439438_012377 3300041405 Bacteria 2617
963 Ga0439438_025400 3300041405 Bacteria 1615
964 Ga0439461_0000541 3300041410 Bacteria 5469
965 Ga0439461_0001042 3300041410 Bacteria 4185
966 Ga0439461_0006688 3300041410 Bacteria 2015
967 Ga0439461_0010106 3300041410 Bacteria 1727
968 Ga0439466_0001530 3300041411 Bacteria 9040
969 Ga0439466_0006330 3300041411 Bacteria 4506
970 Ga0439466_0008648 3300041411 Bacteria 3836
971 Ga0439466_0009136 3300041411 Bacteria 3715
972 Ga0439465_0003293 3300041413 Bacteria 5275
973 Ga0439465_0047901 3300041413 Bacteria 1394
974 Ga0439431_0000277 3300041997 Bacteria 10573
975 Ga0439431_0009936 3300041997 Bacteria 2155
976 Ga0439431_0013210 3300041997 Bacteria 1903
977 Ga0439431_0016012 3300041997 Bacteria 1751
978 Ga0439433_0000286 3300041999 Bacteria 8654
979 Ga0439433_0000832 3300041999 Bacteria 6098
980 Ga0439442_001243 3300042002 Bacteria 5059
981 Ga0439442_026371 3300042002 Bacteria 1209
982 Ga0439445_0000717 3300042004 Bacteria 6918
983 Ga0439448_0013319 3300042005 Bacteria 2469
984 Ga0439449_0001566 3300042007 Bacteria 8965
985 Ga0439449_0002451 3300042007 Bacteria 7252
986 Ga0439449_0014860 3300042007 Bacteria 2926
987 Ga0439451_004531 3300042009 Bacteria 2827
988 Ga0439452_005887 3300042010 Bacteria 3896
989 Ga0439454_002842 3300042011 Bacteria 1870
990 Ga0439457_000878 3300042014 Bacteria 9076
991 Ga0439457_002559 3300042014 Bacteria 5154
992 Ga0439462_0017634 3300042015 Bacteria 1849
993 Ga0450919_000123 3300042121 Bacteria 7838
994 Ga0450920_006112 3300042122 Bacteria 2156
995 Ga0439446_0008839 3300042156 Bacteria 2685
996 Ga0450908_002157 3300042184 Bacteria 3855
997 Ga0450909_001471 3300042185 Bacteria 3287
998 Ga0439434_0001620 3300042435 Bacteria 6500
999 Ga0439434_0002886 3300042435 Bacteria 5015
1000 Ga0439460_0003464 3300042461 Archaea 3819
1001 Ga0450918_003166 3300042531 Bacteria 3067
1002 Ga0466969_0014150 3300044656 Bacteria 4196
1003 Ga0466969_0015497 3300044656 Bacteria 3995
1004 Ga0466972_0002008 3300044658 Bacteria 9968
1005 Ga0466972_0003353 3300044658 Bacteria 7937
1006 Ga0466972_0006242 3300044658 Bacteria 5986
1007 Ga0466972_0008483 3300044658 Bacteria 5154
1008 Ga0466972_0016501 3300044658 Bacteria 3692
1009 Ga0466972_0024952 3300044658 Bacteria 2966
1010 Ga0466972_0025150 3300044658 Bacteria 2953
1011 Ga0466972_0031016 3300044658 Bacteria 2631
1012 Ga0466972_0095998 3300044658 Bacteria 1404
1013 Ga0466965_0003901 3300044683 Bacteria 6596
1014 Ga0466965_0005424 3300044683 Bacteria 5746
1015 Ga0466965_0016410 3300044683 Bacteria 3525
1016 Ga0466965_0025571 3300044683 Bacteria 2857
1017 Ga0466965_0028877 3300044683 Bacteria 2696
1018 Ga0466965_0031824 3300044683 Bacteria 2574
1019 Ga0466965_0033743 3300044683 Bacteria 2502
1020 Ga0466965_0047425 3300044683 Bacteria 2127
1021 Ga0466965_0056670 3300044683 Bacteria 1952
1022 Ga0466965_0066948 3300044683 Bacteria 1802
1023 Ga0466965_0068084 3300044683 Bacteria 1787
1024 Ga0466966_0002623 3300044684 Bacteria 11780
1025 Ga0466966_0030855 3300044684 Bacteria 3477
1026 Ga0466966_0037815 3300044684 Bacteria 3110
1027 Ga0466966_0138687 3300044684 Bacteria 1487
1028 Ga0466961_0031408 3300044693 Bacteria 3414
1029 Ga0466961_0032806 3300044693 Bacteria 3336
1030 Ga0466961_0038494 3300044693 Bacteria 3067
1031 Ga0466961_0067481 3300044693 Bacteria 2272
1032 Ga0466961_0087585 3300044693 Bacteria 1967
1033 Ga0466961_0093599 3300044693 Bacteria 1896
1034 Ga0466961_0119605 3300044693 Bacteria 1654
1035 Ga0466961_0209194 3300044693 Bacteria 1205
1036 Ga0466963_0002223 3300044694 Bacteria 10749
1037 Ga0466963_0004617 3300044694 Bacteria 8028
1038 Ga0466963_0009504 3300044694 Bacteria 5856
1039 Ga0466963_0030660 3300044694 Bacteria 3472
1040 Ga0466963_0053339 3300044694 Bacteria 2685
1041 Ga0466963_0076175 3300044694 Bacteria 2265
1042 Ga0466963_0079949 3300044694 Bacteria 2212
1043 Ga0466963_0204422 3300044694 Bacteria 1381
1044 Ga0466963_0222462 3300044694 Bacteria 1322
1045 Ga0466964_0025463 3300044706 Bacteria 2310
1046 Ga0466964_0027290 3300044706 Bacteria 2242
1047 Ga0466964_0051855 3300044706 Bacteria 1685
1048 Ga0466964_0095766 3300044706 Bacteria 1300
1049 Ga0466971_0004615 3300044719 Bacteria 5949
1050 Ga0466971_0044965 3300044719 Bacteria 1983
1051 Ga0466971_0062121 3300044719 Bacteria 1690
1052 Ga0466968_0007642 3300044735 Bacteria 4117
1053 Ga0466968_0019763 3300044735 Bacteria 2714
1054 Ga0466968_0051487 3300044735 Bacteria 1759
1055 Ga0466970_0000093 3300044765 Bacteria 37847
1056 Ga0466970_0004325 3300044765 Bacteria 6989
1057 Ga0466970_0005681 3300044765 Bacteria 6195
1058 Ga0466970_0006545 3300044765 Bacteria 5822
1059 Ga0466970_0010125 3300044765 Bacteria 4777
1060 Ga0466970_0013655 3300044765 Bacteria 4167
1061 Ga0466970_0020060 3300044765 Bacteria 3469
1062 Ga0466970_0034709 3300044765 Bacteria 2671
1063 Ga0466970_0051568 3300044765 Bacteria 2196
1064 Ga0466970_0052244 3300044765 Bacteria 2181
1065 Ga0466970_0054498 3300044765 Bacteria 2135
1066 Ga0466970_0100357 3300044765 Bacteria 1576
1067 Ga0466957_0003409 3300044842 Bacteria 8725
1068 Ga0466957_0027743 3300044842 Bacteria 3366
1069 Ga0466957_0036044 3300044842 Bacteria 2971
1070 Ga0466957_0050466 3300044842 Bacteria 2532
1071 Ga0466957_0075158 3300044842 Bacteria 2096
1072 Ga0466957_0111467 3300044842 Bacteria 1735
1073 Ga0466960_0002117 3300044901 Bacteria 7395
1074 Ga0466960_0002276 3300044901 Bacteria 7183
1075 Ga0466960_0004115 3300044901 Bacteria 5656
1076 Ga0466960_0009803 3300044901 Bacteria 3960
1077 Ga0466960_0009870 3300044901 Bacteria 3947
1078 Ga0466960_0010324 3300044901 Bacteria 3875
1079 Ga0466960_0021256 3300044901 Bacteria 2886
1080 Ga0466960_0028067 3300044901 Bacteria 2573
1081 Ga0466960_0037032 3300044901 Bacteria 2287
1082 Ga0466959_0001664 3300045049 Bacteria 13767
1083 Ga0466959_0003675 3300045049 Bacteria 10116
1084 Ga0466959_0006267 3300045049 Bacteria 8217
1085 Ga0466959_0016450 3300045049 Bacteria 5405
1086 Ga0466959_0019389 3300045049 Bacteria 5002
1087 Ga0466959_0032967 3300045049 Bacteria 3833
1088 Ga0466959_0059074 3300045049 Bacteria 2793
1089 Ga0466959_0067718 3300045049 Bacteria 2588
1090 Ga0466958_0001497 3300045836 Bacteria 11166
1091 Ga0466958_0005259 3300045836 Bacteria 6936
1092 Ga0466958_0018627 3300045836 Bacteria 4032
1093 Ga0466958_0034064 3300045836 Bacteria 3037
1094 Ga0466958_0034141 3300045836 Bacteria 3033
1095 Ga0466958_0056887 3300045836 Bacteria 2377
1096 Ga0466958_0135562 3300045836 Bacteria 1548
1097 Ga0466967_0005159 3300045976 Bacteria 8986
1098 Ga0466967_0005915 3300045976 Bacteria 8574
1099 Ga0466967_0013641 3300045976 Bacteria 6290
1100 Ga0466967_0026874 3300045976 Bacteria 4777
1101 Ga0466967_0029449 3300045976 Bacteria 4595
1102 Ga0466967_0030435 3300045976 Bacteria 4530
1103 Ga0466967_0031939 3300045976 Bacteria 4440
1104 Ga0466967_0037879 3300045976 Bacteria 4131
1105 Ga0466967_0050474 3300045976 Bacteria 3643
1106 Ga0466967_0062509 3300045976 Bacteria 3305
1107 Ga0466967_0064440 3300045976 Bacteria 3259
1108 Ga0466967_0073397 3300045976 Bacteria 3070
1109 Ga0466967_0084129 3300045976 Bacteria 2878
1110 Ga0466967_0089613 3300045976 Bacteria 2793
1111 Ga0466967_0119981 3300045976 Bacteria 2428
1112 Ga0466967_0124268 3300045976 Bacteria 2388
1113 Ga0466967_0143959 3300045976 Bacteria 2222
1114 Ga0466967_0163864 3300045976 Bacteria 2088
1115 Ga0466967_0257291 3300045976 Bacteria 1669
1116 Ga0466967_0273131 3300045976 Bacteria 1620
1117 Ga0495627_001142 3300046453 Bacteria 17148
1118 Ga0495592_0038444 3300046454 Bacteria 3601
1119 Ga0495603_0000513 3300046455 Bacteria 21575
1120 Ga0495603_0005295 3300046455 Bacteria 7690
1121 Ga0495603_0008346 3300046455 Bacteria 6262
1122 Ga0495603_0051227 3300046455 Bacteria 2453
1123 Ga0495603_0096202 3300046455 Bacteria 1730
1124 Ga0495590_0000413 3300046457 Bacteria 21560
1125 Ga0495629_0007624 3300046459 Bacteria 7968
1126 Ga0495629_0021240 3300046459 Bacteria 4633
1127 Ga0495629_0022859 3300046459 Bacteria 4455
1128 Ga0495638_0014114 3300046460 Bacteria 5410
1129 Ga0495638_0029044 3300046460 Bacteria 3566
1130 Ga0495638_0078942 3300046460 Bacteria 2002
1131 Ga0495641_0006042 3300046461 Bacteria 7967
1132 Ga0495641_0022516 3300046461 Bacteria 3151
1133 Ga0495651_0017310 3300046462 Bacteria 5583
1134 Ga0495653_0060532 3300046463 Bacteria 2868
1135 Ga0495653_0073595 3300046463 Bacteria 2549
1136 Ga0495653_0103440 3300046463 Bacteria 2059
1137 Ga0495650_0000130 3300046471 Bacteria 175669
1138 Ga0495650_0084504 3300046471 Bacteria 1218
1139 Ga0495580_0016410 3300046472 Bacteria 5557
1140 Ga0495580_0021278 3300046472 Bacteria 4786
1141 Ga0495582_0000875 3300046473 Bacteria 16684
1142 Ga0495582_0019590 3300046473 Bacteria 3701
1143 Ga0495582_0050291 3300046473 Bacteria 2297
1144 Ga0495639_0004796 3300046475 Bacteria 5815
1145 Ga0495662_0000821 3300046476 Bacteria 15101
1146 Ga0495662_0018450 3300046476 Bacteria 3377
1147 Ga0495662_0076855 3300046476 Bacteria 1621
1148 Ga0495664_0001916 3300046477 Bacteria 11072
1149 Ga0495664_0004512 3300046477 Bacteria 7615
1150 Ga0495594_0003942 3300046499 Bacteria 7636
1151 Ga0495594_0003955 3300046499 Bacteria 7627
1152 Ga0495608_0028759 3300046511 Bacteria 3777
1153 Ga0495608_0044556 3300046511 Bacteria 2960
1154 Ga0495618_0007805 3300046514 Bacteria 6477
1155 Ga0495618_0073876 3300046514 Bacteria 2171
1156 Ga0495630_0001272 3300046517 Bacteria 17379
1157 Ga0495630_0009755 3300046517 Bacteria 6908
1158 Ga0495630_0137601 3300046517 Bacteria 1856
1159 Ga0495630_0196151 3300046517 Bacteria 1540
1160 Ga0495643_0077189 3300046522 Bacteria 1741
1161 Ga0495644_0013017 3300046523 Bacteria 3197
1162 Ga0495648_0002340 3300046524 Bacteria 17589
1163 Ga0495648_0014540 3300046524 Bacteria 5756
1164 Ga0495663_0021342 3300046525 Bacteria 1865
1165 Ga0495663_0045978 3300046525 Bacteria 1340
1166 Ga0495666_0000235 3300046526 Bacteria 23700
1167 Ga0495666_0041008 3300046526 Bacteria 2243
1168 Ga0495642_0048447 3300046528 Bacteria 1743
1169 Ga0495652_0013787 3300046529 Bacteria 7272
1170 Ga0495654_0057629 3300046530 Bacteria 1876
1171 Ga0495665_0000915 3300046531 Bacteria 15550
1172 Ga0495665_0008383 3300046531 Bacteria 5607
1173 Ga0495640_0001181 3300046533 Bacteria 20480
1174 Ga0495640_0029616 3300046533 Bacteria 3928
1175 Ga0495640_0076097 3300046533 Bacteria 2240
1176 Ga0495586_0000409 3300046535 Bacteria 26099
1177 Ga0495586_0011384 3300046535 Bacteria 4731
1178 Ga0495587_0018456 3300046536 Bacteria 4326
1179 Ga0495587_0036249 3300046536 Bacteria 2967
1180 Ga0495598_0032263 3300046537 Bacteria 1479
1181 Ga0495645_0063671 3300046543 Bacteria 2669
1182 Ga0495667_0000837 3300046559 Bacteria 19854
1183 Ga0495667_0006229 3300046559 Bacteria 8086
1184 Ga0495667_0031962 3300046559 Bacteria 3529
1185 Ga0495656_0071703 3300046615 Bacteria 1540
1186 Ga0495668_0000505 3300046616 Bacteria 48713
1187 Ga0495634_0003288 3300046642 Bacteria 13028
1188 Ga0495634_0046259 3300046642 Bacteria 2938
1189 Ga0495634_0051142 3300046642 Bacteria 2773
1190 Ga0495611_0028770 3300046648 Bacteria 2435
1191 Ga0495635_0000906 3300046663 Bacteria 19421
1192 Ga0495635_0001201 3300046663 Bacteria 17274
1193 Ga0495635_0006925 3300046663 Bacteria 7918
1194 Ga0495635_0055240 3300046663 Bacteria 2735
1195 Ga0495659_0008125 3300046664 Bacteria 3335
1196 Ga0495661_0054323 3300046665 Bacteria 2405
1197 Ga0495588_0000268 3300046674 Bacteria 40423
1198 Ga0495588_0010400 3300046674 Bacteria 4328
1199 Ga0495588_0011453 3300046674 Bacteria 4164
1200 Ga0495588_0017198 3300046674 Bacteria 3506
1201 Ga0495588_0027537 3300046674 Bacteria 2840
1202 Ga0495588_0129165 3300046674 Bacteria 1333
1203 Ga0495657_0013583 3300046675 Bacteria 6003
1204 Ga0495657_0015029 3300046675 Bacteria 5677
1205 Ga0495599_0007443 3300046678 Bacteria 6641
1206 Ga0495623_0063776 3300046679 Bacteria 2306
1207 Ga0495646_0037868 3300046680 Bacteria 2981
1208 Ga0495647_0047038 3300046681 Bacteria 1664
1209 Ga0495658_0000153 3300046683 Bacteria 38350
1210 Ga0495658_0018789 3300046683 Bacteria 3600
1211 Ga0495658_0049811 3300046683 Bacteria 2367
1212 Ga0495658_0064346 3300046683 Bacteria 2113
1213 Ga0495669_0047978 3300046684 Bacteria 1909
1214 Ga0495613_0001237 3300046689 Bacteria 19529
1215 Ga0495613_0038133 3300046689 Bacteria 3562
1216 Ga0495613_0077661 3300046689 Bacteria 2415
1217 Ga0495613_0230058 3300046689 Bacteria 1299
1218 Ga0495624_0000364 3300046690 Bacteria 36044
1219 Ga0495624_0002578 3300046690 Bacteria 13698
1220 Ga0495670_0044085 3300046691 Bacteria 2227
1221 Ga0495581_0000789 3300047315 Bacteria 16798
1222 Ga0495581_0045150 3300047315 Bacteria 2547
1223 Ga0495581_0053428 3300047315 Bacteria 2333
1224 Ga0495581_0078280 3300047315 Bacteria 1913
1225 Ga0495581_0079686 3300047315 Bacteria 1895
1226 Ga0495604_0034564 3300047317 Bacteria 3998
1227 Ga0495604_0088785 3300047317 Bacteria 2299
1228 Ga0495604_0131629 3300047317 Bacteria 1797
1229 Ga0495604_0178944 3300047317 Bacteria 1485
1230 Ga0495636_0013480 3300047318 Bacteria 3245
1231 Ga0495674_0000640 3300047319 Bacteria 32750
1232 Ga0495674_0009189 3300047319 Bacteria 9392
1233 Ga0495674_0034201 3300047319 Bacteria 4597
1234 Ga0495674_0043532 3300047319 Bacteria 3996
1235 Ga0495672_0002784 3300047320 Bacteria 15622
1236 Ga0495672_0011138 3300047320 Bacteria 6362
1237 Ga0495672_0086173 3300047320 Bacteria 1738
1238 Ga0495676_0015473 3300047321 Bacteria 6791
1239 Ga0495676_0019442 3300047321 Bacteria 5973
1240 Ga0495676_0019639 3300047321 Bacteria 5941
1241 Ga0495676_0098413 3300047321 Bacteria 2170
1242 Ga0495680_0004541 3300047322 Bacteria 13263
1243 Ga0495680_0012084 3300047322 Bacteria 7617
1244 Ga0495680_0110904 3300047322 Bacteria 2033
1245 Ga0495683_0001180 3300047323 Bacteria 17826
1246 Ga0495677_0042011 3300047445 Bacteria 1674
1247 Ga0495673_0045644 3300047469 Bacteria 1946
1248 Ga0495684_0008105 3300047471 Bacteria 8121
1249 Ga0495684_0034970 3300047471 Bacteria 3854
1250 Ga0495684_0049619 3300047471 Bacteria 3206
1251 Ga0495686_0008844 3300047472 Bacteria 7332
1252 Ga0495686_0058772 3300047472 Bacteria 2396
1253 Ga0495593_0003161 3300047673 Bacteria 9884
1254 Ga0495593_0109889 3300047673 Bacteria 1408
1255 Ga0495602_0054850 3300048088 Bacteria 3515
1256 Ga0495602_0131483 3300048088 Bacteria 1995
1257 Ga0495614_0000110 3300048089 Bacteria 27971
1258 Ga0495614_0000222 3300048089 Bacteria 22134
1259 Ga0495615_0018625 3300048090 Bacteria 1531
1260 Ga0496100_0000097 3300048903 Bacteria 50092
1261 Ga0496100_0001715 3300048903 Bacteria 10911
1262 Ga0496100_0002885 3300048903 Bacteria 8817
1263 Ga0496100_0007957 3300048903 Bacteria 5888
1264 Ga0496100_0021361 3300048903 Bacteria 3896
1265 Ga0496100_0182178 3300048903 Bacteria 1519
1266 Ga0496101_0000032 3300048904 Bacteria 186783
1267 Ga0496101_0000178 3300048904 Bacteria 50994
1268 Ga0496101_0002214 3300048904 Bacteria 11871
1269 Ga0496101_0002271 3300048904 Bacteria 11737
1270 Ga0496101_0015250 3300048904 Bacteria 5173
1271 Ga0496101_0016940 3300048904 Bacteria 4933
1272 Ga0496101_0019798 3300048904 Bacteria 4601
1273 Ga0496101_0022334 3300048904 Bacteria 4354
1274 Ga0496101_0033514 3300048904 Bacteria 3623
1275 Ga0496101_0071443 3300048904 Bacteria 2544
1276 Ga0496101_0127472 3300048904 Bacteria 1930
1277 Ga0496102_0000011 3300048905 Bacteria 321716
1278 Ga0496102_0000235 3300048905 Bacteria 72616
1279 Ga0496102_0000236 3300048905 Bacteria 72601
1280 Ga0496102_0002707 3300048905 Bacteria 15075
1281 Ga0496102_0004544 3300048905 Bacteria 11734
1282 Ga0496102_0007433 3300048905 Bacteria 9359
1283 Ga0496102_0024381 3300048905 Bacteria 5378
1284 Ga0496102_0028244 3300048905 Bacteria 5009
1285 Ga0496102_0042950 3300048905 Bacteria 4097
1286 Ga0496102_0057352 3300048905 Bacteria 3556
1287 Ga0496102_0067913 3300048905 Bacteria 3270
1288 Ga0496102_0071661 3300048905 Bacteria 3182
1289 Ga0496102_0077190 3300048905 Bacteria 3065
1290 Ga0496102_0079158 3300048905 Bacteria 3026
1291 Ga0496102_0107025 3300048905 Bacteria 2603
1292 Ga0496102_0129236 3300048905 Bacteria 2363
1293 Ga0496102_0131604 3300048905 Bacteria 2342
1294 Ga0496102_0268364 3300048905 Bacteria 1609
1295 Ga0496102_0300459 3300048905 Bacteria 1513
1296 Ga0496102_0346132 3300048905 Bacteria 1399
1297 Ga0496103_0000032 3300048906 Bacteria 201453
1298 Ga0496103_0000185 3300048906 Bacteria 62838
1299 Ga0496103_0000460 3300048906 Bacteria 34689
1300 Ga0496103_0000624 3300048906 Bacteria 27194
1301 Ga0496103_0001651 3300048906 Bacteria 14614
1302 Ga0496103_0007239 3300048906 Bacteria 6614
1303 Ga0496103_0008384 3300048906 Bacteria 6141
1304 Ga0496103_0071566 3300048906 Bacteria 2170
1305 Ga0496103_0071855 3300048906 Bacteria 2166
1306 Ga0496103_0102378 3300048906 Bacteria 1813
1307 Ga0496103_0146301 3300048906 Bacteria 1512
1308 Ga0496103_0158986 3300048906 Bacteria 1449
1309 Ga0496104_0003431 3300048907 Bacteria 13673
1310 Ga0496104_0004891 3300048907 Bacteria 11682
1311 Ga0496104_0031350 3300048907 Bacteria 4943
1312 Ga0496104_0068187 3300048907 Bacteria 3380
1313 Ga0496104_0072889 3300048907 Bacteria 3266
1314 Ga0496104_0075539 3300048907 Bacteria 3209
1315 Ga0496104_0089024 3300048907 Bacteria 2949
1316 Ga0496104_0092303 3300048907 Bacteria 2895
1317 Ga0496104_0135208 3300048907 Bacteria 2368
1318 Ga0496104_0140953 3300048907 Bacteria 2316
1319 Ga0496104_0170360 3300048907 Bacteria 2088
1320 Ga0496104_0434350 3300048907 Bacteria 1225
1321 Ga0496105_0004208 3300048908 Bacteria 10809
1322 Ga0496105_0004455 3300048908 Bacteria 10546
1323 Ga0496105_0009001 3300048908 Bacteria 7788
1324 Ga0496105_0014439 3300048908 Bacteria 6287
1325 Ga0496105_0018442 3300048908 Bacteria 5609
1326 Ga0496105_0020815 3300048908 Bacteria 5304
1327 Ga0496105_0036703 3300048908 Bacteria 4038
1328 Ga0496105_0105827 3300048908 Bacteria 2322
1329 Ga0496105_0157242 3300048908 Bacteria 1866
1330 Ga0496105_0227897 3300048908 Bacteria 1515
1331 Ga0496105_0233856 3300048908 Bacteria 1493
1332 Ga0496106_0000417 3300048909 Bacteria 30205
1333 Ga0496106_0000768 3300048909 Bacteria 23207
1334 Ga0496106_0039704 3300048909 Bacteria 3525
1335 Ga0496106_0054231 3300048909 Bacteria 3029
1336 Ga0496106_0072794 3300048909 Bacteria 2628
1337 Ga0496106_0077479 3300048909 Bacteria 2549
1338 Ga0496106_0115837 3300048909 Bacteria 2090
1339 Ga0496106_0120446 3300048909 Bacteria 2051
1340 Ga0496106_0160339 3300048909 Bacteria 1779
1341 Ga0496106_0202541 3300048909 Bacteria 1580
1342 Ga0496106_0305993 3300048909 Bacteria 1275
1343 Ga0496107_0001611 3300048910 Bacteria 14062
1344 Ga0496107_0002827 3300048910 Bacteria 11456
1345 Ga0496107_0022212 3300048910 Bacteria 4483
1346 Ga0496107_0027443 3300048910 Bacteria 4043
1347 Ga0496107_0030297 3300048910 Bacteria 3856
1348 Ga0496107_0114477 3300048910 Bacteria 1984
1349 Ga0496108_0001698 3300048911 Bacteria 17460
1350 Ga0496108_0015334 3300048911 Bacteria 6252
1351 Ga0496108_0020224 3300048911 Bacteria 5470
1352 Ga0496108_0026361 3300048911 Bacteria 4794
1353 Ga0496108_0039938 3300048911 Bacteria 3911
1354 Ga0496108_0043103 3300048911 Bacteria 3769
1355 Ga0496108_0064850 3300048911 Bacteria 3078
1356 Ga0496108_0075778 3300048911 Bacteria 2843
1357 Ga0496108_0088604 3300048911 Bacteria 2630
1358 Ga0496108_0113673 3300048911 Bacteria 2317
1359 Ga0496108_0313142 3300048911 Bacteria 1368
1360 Ga0496108_0362172 3300048911 Bacteria 1266
1361 Ga0496109_0000305 3300048912 Bacteria 46298
1362 Ga0496109_0005372 3300048912 Bacteria 10708
1363 Ga0496109_0011265 3300048912 Bacteria 7680
1364 Ga0496109_0013718 3300048912 Bacteria 7039
1365 Ga0496109_0014775 3300048912 Bacteria 6793
1366 Ga0496109_0023643 3300048912 Bacteria 5455
1367 Ga0496109_0041162 3300048912 Bacteria 4187
1368 Ga0496109_0045826 3300048912 Bacteria 3970
1369 Ga0496109_0071036 3300048912 Bacteria 3195
1370 Ga0496109_0091869 3300048912 Bacteria 2807
1371 Ga0496109_0221244 3300048912 Bacteria 1780
1372 Ga0496109_0226132 3300048912 Bacteria 1760
1373 Ga0496110_0002915 3300048913 Bacteria 12950
1374 Ga0496110_0006568 3300048913 Bacteria 9234
1375 Ga0496110_0023163 3300048913 Bacteria 5281
1376 Ga0496110_0023479 3300048913 Bacteria 5246
1377 Ga0496110_0049961 3300048913 Bacteria 3671
1378 Ga0496110_0068720 3300048913 Bacteria 3136
1379 Ga0496110_0112705 3300048913 Bacteria 2445
1380 Ga0496110_0112870 3300048913 Bacteria 2443
1381 Ga0496110_0113775 3300048913 Bacteria 2434
1382 Ga0496110_0134866 3300048913 Bacteria 2230
1383 Ga0496110_0185899 3300048913 Bacteria 1887
1384 Ga0496111_0005153 3300048914 Bacteria 8333
1385 Ga0496111_0016859 3300048914 Bacteria 5041
1386 Ga0496111_0047481 3300048914 Bacteria 3092
1387 Ga0496111_0063129 3300048914 Bacteria 2686
1388 Ga0496111_0090424 3300048914 Bacteria 2242
1389 Ga0496111_0160860 3300048914 Bacteria 1667
1390 Ga0496111_0186655 3300048914 Bacteria 1541
1391 Ga0496112_0013235 3300048915 Bacteria 7612
1392 Ga0496112_0038767 3300048915 Bacteria 4655
1393 Ga0496112_0063842 3300048915 Bacteria 3633
1394 Ga0496112_0070088 3300048915 Bacteria 3464
1395 Ga0496112_0099862 3300048915 Bacteria 2872
1396 Ga0496112_0113579 3300048915 Bacteria 2679
1397 Ga0496112_0320244 3300048915 Bacteria 1495
1398 Ga0496113_0004384 3300048916 Bacteria 8659
1399 Ga0496113_0032886 3300048916 Bacteria 3771
1400 Ga0496113_0048809 3300048916 Bacteria 3150
1401 Ga0496113_0117004 3300048916 Bacteria 2080
1402 Ga0496113_0145554 3300048916 Bacteria 1866
1403 Ga0496113_0160149 3300048916 Bacteria 1779
1404 Ga0496113_0161097 3300048916 Bacteria 1774
1405 Ga0496113_0176928 3300048916 Bacteria 1691
1406 Ga0496113_0242173 3300048916 Bacteria 1439
1407 Ga0496113_0293049 3300048916 Bacteria 1302
1408 Ga0496114_0000856 3300048917 Bacteria 22807
1409 Ga0496114_0002897 3300048917 Bacteria 13141
1410 Ga0496114_0003794 3300048917 Bacteria 11647
1411 Ga0496114_0004945 3300048917 Bacteria 10389
1412 Ga0496114_0005170 3300048917 Bacteria 10183
1413 Ga0496114_0008988 3300048917 Bacteria 7922
1414 Ga0496114_0010173 3300048917 Bacteria 7483
1415 Ga0496114_0010762 3300048917 Bacteria 7282
1416 Ga0496114_0024643 3300048917 Bacteria 4911
1417 Ga0496114_0026758 3300048917 Bacteria 4724
1418 Ga0496114_0159077 3300048917 Bacteria 1963
1419 Ga0496114_0207769 3300048917 Bacteria 1716
1420 Ga0496114_0266356 3300048917 Bacteria 1509
1421 Ga0496114_0296868 3300048917 Bacteria 1426
1422 Ga0496115_0008488 3300048918 Bacteria 7599
1423 Ga0496115_0011413 3300048918 Bacteria 6660
1424 Ga0496115_0012370 3300048918 Bacteria 6419
1425 Ga0496115_0014232 3300048918 Bacteria 6020
1426 Ga0496115_0024138 3300048918 Bacteria 4724
1427 Ga0496115_0025689 3300048918 Bacteria 4589
1428 Ga0496115_0030427 3300048918 Bacteria 4247
1429 Ga0496115_0107161 3300048918 Bacteria 2294
1430 Ga0496115_0109880 3300048918 Bacteria 2264
1431 Ga0496116_0000072 3300048919 Bacteria 238158
1432 Ga0496116_0000192 3300048919 Bacteria 122270
1433 Ga0496116_0000340 3300048919 Bacteria 74829
1434 Ga0496116_0004507 3300048919 Bacteria 13256
1435 Ga0496116_0006124 3300048919 Bacteria 11002
1436 Ga0496116_0040697 3300048919 Bacteria 3197
1437 Ga0496116_0044629 3300048919 Bacteria 3009
1438 Ga0496116_0077370 3300048919 Bacteria 2079
1439 Ga0496117_0000039 3300048920 Bacteria 322143
1440 Ga0496117_0000273 3300048920 Bacteria 96400
1441 Ga0496117_0000387 3300048920 Bacteria 75589
1442 Ga0496117_0000603 3300048920 Bacteria 58910
1443 Ga0496117_0001092 3300048920 Bacteria 41000
1444 Ga0496117_0001118 3300048920 Bacteria 40433
1445 Ga0496117_0003783 3300048920 Bacteria 17282
1446 Ga0496117_0011201 3300048920 Bacteria 8052
1447 Ga0496117_0026526 3300048920 Bacteria 4532
1448 Ga0496117_0029438 3300048920 Bacteria 4233
1449 Ga0496117_0082135 3300048920 Bacteria 2112
1450 Ga0496117_0104653 3300048920 Bacteria 1780
1451 Ga0496118_0000035 3300048921 Bacteria 322143
1452 Ga0496118_0000096 3300048921 Bacteria 163988
1453 Ga0496118_0000455 3300048921 Bacteria 67720
1454 Ga0496118_0000610 3300048921 Bacteria 58893
1455 Ga0496118_0005126 3300048921 Bacteria 15052
1456 Ga0496118_0006081 3300048921 Bacteria 13430
1457 Ga0496118_0012779 3300048921 Bacteria 8017
1458 Ga0496118_0013007 3300048921 Bacteria 7918
1459 Ga0496118_0042972 3300048921 Bacteria 3558
1460 Ga0496118_0056178 3300048921 Bacteria 2962
1461 Ga0496118_0089622 3300048921 Bacteria 2123
1462 Ga0496119_0000035 3300048922 Bacteria 217007
1463 Ga0496119_0000340 3300048922 Bacteria 65290
1464 Ga0496119_0000437 3300048922 Bacteria 57106
1465 Ga0496119_0000617 3300048922 Bacteria 48028
1466 Ga0496119_0002053 3300048922 Bacteria 22784
1467 Ga0496119_0006039 3300048922 Bacteria 11361
1468 Ga0496119_0007359 3300048922 Bacteria 9945
1469 Ga0496119_0009886 3300048922 Bacteria 8103
1470 Ga0496119_0013009 3300048922 Bacteria 6683
1471 Ga0496119_0014900 3300048922 Bacteria 6044
1472 Ga0496119_0015958 3300048922 Bacteria 5746
1473 Ga0496119_0032105 3300048922 Bacteria 3506
1474 Ga0496119_0032848 3300048922 Bacteria 3453
1475 Ga0496119_0037248 3300048922 Bacteria 3163
1476 Ga0496119_0050977 3300048922 Bacteria 2547
1477 Ga0496119_0085588 3300048922 Bacteria 1804
1478 Ga0496120_0000079 3300048923 Bacteria 160413
1479 Ga0496120_0000372 3300048923 Bacteria 72951
1480 Ga0496120_0001715 3300048923 Bacteria 25001
1481 Ga0496120_0002620 3300048923 Bacteria 17825
1482 Ga0496120_0008527 3300048923 Bacteria 7426
1483 Ga0496120_0011616 3300048923 Bacteria 6043
1484 Ga0496120_0019430 3300048923 Bacteria 4346
1485 Ga0496120_0095399 3300048923 Bacteria 1581
1486 Ga0496121_0000004 3300048924 Bacteria 1139011
1487 Ga0496121_0000015 3300048924 Bacteria 571958
1488 Ga0496121_0000546 3300048924 Bacteria 71177
1489 Ga0496121_0002237 3300048924 Bacteria 30165
1490 Ga0496121_0004937 3300048924 Bacteria 17498
1491 Ga0496121_0013057 3300048924 Bacteria 8969
1492 Ga0496121_0022488 3300048924 Bacteria 6118
1493 Ga0496121_0037750 3300048924 Bacteria 4286
1494 Ga0496121_0066703 3300048924 Bacteria 2920
1495 Ga0496122_0000020 3300048925 Bacteria 401675
1496 Ga0496122_0000795 3300048925 Bacteria 60495
1497 Ga0496122_0001425 3300048925 Bacteria 38734
1498 Ga0496122_0004303 3300048925 Bacteria 17836
1499 Ga0496122_0015517 3300048925 Bacteria 7275
1500 Ga0496122_0016794 3300048925 Bacteria 6895
1501 Ga0496122_0017673 3300048925 Bacteria 6649
1502 Ga0496122_0028074 3300048925 Bacteria 4789
1503 Ga0496122_0045039 3300048925 Bacteria 3433
1504 Ga0496122_0105451 3300048925 Bacteria 1869
1505 Ga0496122_0143312 3300048925 Bacteria 1490
1506 Ga0496123_0000003 3300048926 Bacteria 866556
1507 Ga0496123_0000951 3300048926 Bacteria 45055
1508 Ga0496123_0007387 3300048926 Bacteria 10379
1509 Ga0496123_0011837 3300048926 Bacteria 7506
1510 Ga0496123_0015631 3300048926 Bacteria 6212
1511 Ga0496123_0022138 3300048926 Bacteria 4909
1512 Ga0496123_0025167 3300048926 Bacteria 4496
1513 Ga0496124_0000012 3300048927 Bacteria 512581
1514 Ga0496124_0000135 3300048927 Bacteria 152458
1515 Ga0496124_0002749 3300048927 Bacteria 22432
1516 Ga0496124_0008894 3300048927 Bacteria 10415
1517 Ga0496124_0009299 3300048927 Bacteria 10131
1518 Ga0496124_0035580 3300048927 Bacteria 4355
1519 Ga0496124_0043473 3300048927 Bacteria 3862
1520 Ga0496124_0090835 3300048927 Bacteria 2489
1521 Ga0496124_0107082 3300048927 Bacteria 2256
1522 Ga0496124_0144633 3300048927 Bacteria 1872
1523 Ga0496125_0000003 3300048928 Bacteria 1189767
1524 Ga0496125_0000128 3300048928 Bacteria 163865
1525 Ga0496125_0000209 3300048928 Bacteria 122267
1526 Ga0496125_0000859 3300048928 Bacteria 48719
1527 Ga0496125_0002332 3300048928 Bacteria 24952
1528 Ga0496125_0002425 3300048928 Bacteria 24246
1529 Ga0496125_0016465 3300048928 Bacteria 7097
1530 Ga0496125_0024752 3300048928 Bacteria 5513
1531 Ga0496125_0034370 3300048928 Bacteria 4469
1532 Ga0496125_0055163 3300048928 Bacteria 3240
1533 Ga0496125_0058704 3300048928 Bacteria 3106
1534 Ga0496125_0061796 3300048928 Bacteria 3001
1535 Ga0496125_0103900 3300048928 Bacteria 2083
1536 Ga0496126_0000001 3300048929 Bacteria 1139011
1537 Ga0496126_0000123 3300048929 Bacteria 182726
1538 Ga0496126_0000246 3300048929 Bacteria 116854
1539 Ga0496126_0000547 3300048929 Bacteria 72557
1540 Ga0496126_0004322 3300048929 Bacteria 17045
1541 Ga0496126_0005415 3300048929 Bacteria 14563
1542 Ga0496126_0005422 3300048929 Bacteria 14550
1543 Ga0496126_0006761 3300048929 Bacteria 12730
1544 Ga0496126_0009000 3300048929 Bacteria 10683
1545 Ga0496126_0033062 3300048929 Bacteria 4867
1546 Ga0496126_0033726 3300048929 Bacteria 4815
1547 Ga0496126_0035255 3300048929 Bacteria 4691
1548 Ga0496126_0035799 3300048929 Bacteria 4647
1549 Ga0496126_0058035 3300048929 Bacteria 3490
1550 Ga0496126_0061064 3300048929 Bacteria 3387
1551 Ga0496126_0068695 3300048929 Bacteria 3163
1552 Ga0496126_0084657 3300048929 Bacteria 2796
1553 Ga0496126_0088878 3300048929 Bacteria 2720
1554 Ga0496126_0090950 3300048929 Bacteria 2684
1555 Ga0496126_0098562 3300048929 Bacteria 2560
1556 Ga0496126_0121614 3300048929 Bacteria 2263
1557 Ga0496126_0246344 3300048929 Bacteria 1491
1558 Ga0501309_003333 3300049129 Bacteria 1814
1559 Ga0501305_008308 3300049161 Bacteria 1340
1560 Ga0501307_005589 3300049162 Bacteria 1330
1561 Ga0501311_006846 3300049527 Bacteria 1297
1562 Ga0501312_001617 3300049528 Bacteria 2258
1563 Ga0501313_005060 3300049529 Bacteria 1379
1564 Ga0501315_005844 3300049531 Bacteria 1348
1565 Ga0501315_006619 3300049531 Bacteria 1295
1566 Ga0501316_000498 3300049532 Bacteria 2738
1567 Ga0501318_005390 3300049534 Bacteria 1267
1568 Ga0501321_003486 3300049537 Bacteria 1443
1569 Ga0501321_004061 3300049537 Bacteria 1379
1570 Ga0501323_004697 3300049539 Bacteria 1458
1571 Ga0501324_002466 3300049540 Bacteria 1340
1572 Ga0501325_001168 3300049541 Bacteria 1547
1573 Ga0501335_000889 3300049551 Bacteria 2129
1574 Ga0501031_0000870 3300049568 Bacteria 18185
1575 Ga0501031_0007030 3300049568 Bacteria 7346
1576 Ga0501031_0010393 3300049568 Bacteria 6062
1577 Ga0501031_0012245 3300049568 Archaea 5591
1578 Ga0501031_0045672 3300049568 Bacteria 2858
1579 Ga0501031_0089772 3300049568 Bacteria 2004
1580 Ga0501031_0090382 3300049568 Bacteria 1997
1581 Ga0501032_0001154 3300049569 Bacteria 21164
1582 Ga0501032_0001277 3300049569 Bacteria 20179
1583 Ga0501032_0002711 3300049569 Bacteria 13809
1584 Ga0501032_0008178 3300049569 Bacteria 7627
1585 Ga0501032_0033588 3300049569 Bacteria 3514
1586 Ga0501032_0071221 3300049569 Bacteria 2317
1587 Ga0501032_0102712 3300049569 Bacteria 1894
1588 Ga0501033_0003100 3300049570 Bacteria 13804
1589 Ga0501033_0007412 3300049570 Bacteria 8544
1590 Ga0501033_0044237 3300049570 Bacteria 3315
1591 Ga0501033_0060294 3300049570 Bacteria 2800
1592 Ga0501033_0060590 3300049570 Bacteria 2791
1593 Ga0501033_0070028 3300049570 Archaea 2577
1594 Ga0501034_0000112 3300049571 Bacteria 150146
1595 Ga0501034_0000672 3300049571 Bacteria 51948
1596 Ga0501034_0008588 3300049571 Bacteria 10780
1597 Ga0501034_0013440 3300049571 Bacteria 8425
1598 Ga0501034_0017156 3300049571 Bacteria 7429
1599 Ga0501034_0023234 3300049571 Bacteria 6318
1600 Ga0501034_0025497 3300049571 Bacteria 6020
1601 Ga0501034_0034048 3300049571 Bacteria 5165
1602 Ga0501034_0046877 3300049571 Bacteria 4366
1603 Ga0501034_0076870 3300049571 Bacteria 3345
1604 Ga0501034_0114513 3300049571 Bacteria 2685
1605 Ga0501034_0142301 3300049571 Bacteria 2377
1606 Ga0501036_0002900 3300049572 Bacteria 13613
1607 Ga0501036_0004295 3300049572 Archaea 11515
1608 Ga0501036_0013420 3300049572 Bacteria 6808
1609 Ga0501036_0016775 3300049572 Bacteria 6118
1610 Ga0501036_0325757 3300049572 Bacteria 1283
1611 Ga0501037_0000110 3300049573 Bacteria 77484
1612 Ga0501037_0004426 3300049573 Bacteria 10203
1613 Ga0501037_0006221 3300049573 Archaea 8730
1614 Ga0501037_0010166 3300049573 Bacteria 6904
1615 Ga0501037_0012462 3300049573 Bacteria 6263
1616 Ga0501037_0056202 3300049573 Bacteria 2875
1617 Ga0501037_0082702 3300049573 Bacteria 2326
1618 Ga0501037_0176832 3300049573 Bacteria 1515
1619 Ga0501038_0003260 3300049574 Bacteria 15140
1620 Ga0501038_0010528 3300049574 Bacteria 8459
1621 Ga0501038_0014550 3300049574 Bacteria 7170
1622 Ga0501038_0024701 3300049574 Bacteria 5358
1623 Ga0501038_0032164 3300049574 Bacteria 4630
1624 Ga0501038_0051802 3300049574 Bacteria 3540
1625 Ga0501038_0190298 3300049574 Bacteria 1651
1626 Ga0501039_0000736 3300049575 Bacteria 23619
1627 Ga0501039_0000850 3300049575 Bacteria 22060
1628 Ga0501039_0001189 3300049575 Archaea 19065
1629 Ga0501039_0009621 3300049575 Bacteria 7368
1630 Ga0501039_0016611 3300049575 Bacteria 5638
1631 Ga0501039_0026165 3300049575 Bacteria 4484
1632 Ga0501039_0047333 3300049575 Bacteria 3324
1633 Ga0501039_0053386 3300049575 Bacteria 3127
1634 Ga0501040_0000341 3300049576 Archaea 27311
1635 Ga0501040_0000580 3300049576 Bacteria 22270
1636 Ga0501040_0003562 3300049576 Bacteria 10068
1637 Ga0501040_0006598 3300049576 Bacteria 7532
1638 Ga0501041_0000246 3300049577 Bacteria 25337
1639 Ga0501041_0009959 3300049577 Archaea 5600
1640 Ga0501041_0030224 3300049577 Bacteria 3270
1641 Ga0501041_0071012 3300049577 Bacteria 2138
1642 Ga0501041_0087092 3300049577 Bacteria 1927
1643 Ga0501042_0000686 3300049578 Bacteria 18336
1644 Ga0501042_0005870 3300049578 Bacteria 7935
1645 Ga0501042_0006117 3300049578 Archaea 7799
1646 Ga0501042_0015173 3300049578 Bacteria 5270
1647 Ga0501042_0021443 3300049578 Bacteria 4503
1648 Ga0501042_0092887 3300049578 Bacteria 2166
1649 Ga0501043_0001848 3300049579 Bacteria 18132
1650 Ga0501043_0013658 3300049579 Archaea 6356
1651 Ga0501043_0017486 3300049579 Bacteria 5621
1652 Ga0501043_0028591 3300049579 Bacteria 4377
1653 Ga0501043_0071980 3300049579 Bacteria 2715
1654 Ga0501043_0112879 3300049579 Bacteria 2134
1655 Ga0501043_0156350 3300049579 Bacteria 1783
1656 Ga0501043_0192190 3300049579 Bacteria 1587
1657 Ga0501043_0218664 3300049579 Bacteria 1474
1658 Ga0501046_0002303 3300049580 Archaea 17997
1659 Ga0501046_0003132 3300049580 Bacteria 15274
1660 Ga0501046_0006458 3300049580 Bacteria 10372
1661 Ga0501046_0016573 3300049580 Bacteria 6165
1662 Ga0501046_0068395 3300049580 Bacteria 2764
1663 Ga0501047_0000033 3300049581 Bacteria 206961
1664 Ga0501047_0000405 3300049581 Bacteria 48286
1665 Ga0501047_0001186 3300049581 Bacteria 25810
1666 Ga0501047_0004112 3300049581 Bacteria 13691
1667 Ga0501047_0011253 3300049581 Bacteria 8468
1668 Ga0501047_0030469 3300049581 Bacteria 5201
1669 Ga0501047_0038344 3300049581 Bacteria 4637
1670 Ga0501047_0058872 3300049581 Bacteria 3710
1671 Ga0501047_0077238 3300049581 Bacteria 3204
1672 Ga0501047_0229502 3300049581 Bacteria 1710
1673 Ga0501047_0274480 3300049581 Bacteria 1531
1674 Ga0501048_0000216 3300049582 Bacteria 37819
1675 Ga0501048_0001561 3300049582 Bacteria 17399
1676 Ga0501048_0004301 3300049582 Bacteria 10858
1677 Ga0501048_0006150 3300049582 Bacteria 9138
1678 Ga0501048_0006447 3300049582 Archaea 8920
1679 Ga0501048_0016662 3300049582 Bacteria 5418
1680 Ga0501067_0000725 3300049583 Bacteria 17733
1681 Ga0501067_0078387 3300049583 Bacteria 1831
1682 Ga0501068_0081071 3300049584 Bacteria 1992
1683 Ga0501069_0028354 3300049585 Bacteria 3069
1684 Ga0501069_0062124 3300049585 Bacteria 2086
1685 Ga0501069_0080869 3300049585 Bacteria 1830
1686 Ga0501069_0099180 3300049585 Bacteria 1653
1687 Ga0501070_0000165 3300049586 Bacteria 60736
1688 Ga0501070_0000181 3300049586 Bacteria 59005
1689 Ga0501070_0002694 3300049586 Bacteria 15506
1690 Ga0501070_0004105 3300049586 Bacteria 12522
1691 Ga0501070_0005678 3300049586 Bacteria 10639
1692 Ga0501070_0010602 3300049586 Bacteria 7789
1693 Ga0501070_0015185 3300049586 Bacteria 6482
1694 Ga0501070_0028759 3300049586 Bacteria 4660
1695 Ga0501070_0033327 3300049586 Bacteria 4310
1696 Ga0501070_0049412 3300049586 Bacteria 3493
1697 Ga0501070_0066146 3300049586 Bacteria 2993
1698 Ga0501070_0095561 3300049586 Bacteria 2459
1699 Ga0501070_0147320 3300049586 Bacteria 1943
1700 Ga0501071_0000275 3300049587 Bacteria 24403
1701 Ga0501071_0000327 3300049587 Bacteria 22895
1702 Ga0501071_0001195 3300049587 Archaea 14657
1703 Ga0501071_0015881 3300049587 Bacteria 5171
1704 Ga0501071_0044267 3300049587 Bacteria 3192
1705 Ga0501071_0063337 3300049587 Bacteria 2681
1706 Ga0501071_0123285 3300049587 Bacteria 1922
1707 Ga0501072_0000093 3300049588 Archaea 65665
1708 Ga0501072_0007441 3300049588 Bacteria 8305
1709 Ga0501072_0063803 3300049588 Bacteria 2906
1710 Ga0501073_0000030 3300049589 Bacteria 115949
1711 Ga0501073_0004926 3300049589 Bacteria 10021
1712 Ga0501073_0019857 3300049589 Bacteria 4848
1713 Ga0501073_0072187 3300049589 Bacteria 2404
1714 Ga0501074_0010064 3300049590 Bacteria 6865
1715 Ga0501074_0025535 3300049590 Archaea 4289
1716 Ga0501074_0025561 3300049590 Bacteria 4286
1717 Ga0501074_0034463 3300049590 Bacteria 3669
1718 Ga0501075_0001636 3300049591 Archaea 14713
1719 Ga0501075_0009734 3300049591 Bacteria 6735
1720 Ga0501075_0045189 3300049591 Bacteria 3305
1721 Ga0501075_0065901 3300049591 Bacteria 2732
1722 Ga0501076_0000260 3300049592 Bacteria 32510
1723 Ga0501076_0000392 3300049592 Archaea 27398
1724 Ga0501076_0013969 3300049592 Bacteria 6032
1725 Ga0501076_0048562 3300049592 Bacteria 3354
1726 Ga0501076_0075672 3300049592 Bacteria 2699
1727 Ga0501077_0000085 3300049593 Bacteria 46998
1728 Ga0501077_0009209 3300049593 Bacteria 6131
1729 Ga0501077_0110649 3300049593 Bacteria 1740
1730 Ga0501243_007284 3300049675 Bacteria 1690
1731 Ga0501079_0000790 3300049741 Archaea 21566
1732 Ga0501079_0001021 3300049741 Bacteria 19441
1733 Ga0501079_0074759 3300049741 Bacteria 2620
1734 Ga0501080_0000023 3300049742 Bacteria 90345
1735 Ga0501080_0005898 3300049742 Bacteria 10973
1736 Ga0501080_0020356 3300049742 Archaea 6140
1737 Ga0501080_0057567 3300049742 Bacteria 3619
1738 Ga0501080_0119618 3300049742 Bacteria 2442
1739 Ga0501080_0203250 3300049742 Bacteria 1818
1740 Ga0501081_0001553 3300049743 Archaea 14136
1741 Ga0501081_0015758 3300049743 Bacteria 4990
1742 Ga0501081_0023093 3300049743 Bacteria 4167
1743 Ga0501081_0029959 3300049743 Bacteria 3680
1744 Ga0501081_0041679 3300049743 Bacteria 3145
1745 Ga0501081_0183740 3300049743 Bacteria 1513
1746 Ga0501083_0000059 3300049744 Bacteria 78374
1747 Ga0501083_0027619 3300049744 Bacteria 3914
1748 Ga0501083_0124905 3300049744 Bacteria 1687
1749 Ga0501035_0000283 3300049822 Bacteria 60218
1750 Ga0501035_0005074 3300049822 Bacteria 12481
1751 Ga0501035_0030333 3300049822 Bacteria 4930
1752 Ga0501035_0038995 3300049822 Bacteria 4301
1753 Ga0501035_0042452 3300049822 Bacteria 4102
1754 Ga0501035_0054167 3300049822 Bacteria 3584
1755 Ga0501035_0063799 3300049822 Bacteria 3275
1756 Ga0501035_0173821 3300049822 Bacteria 1859
1757 Ga0501044_0004205 3300049823 Bacteria 16172
1758 Ga0501044_0005678 3300049823 Bacteria 13833
1759 Ga0501044_0011532 3300049823 Bacteria 9575
1760 Ga0501044_0017369 3300049823 Bacteria 7717
1761 Ga0501044_0076371 3300049823 Bacteria 3400
1762 Ga0501044_0151656 3300049823 Bacteria 2299
1763 Ga0501044_0205585 3300049823 Bacteria 1926
1764 Ga0501045_0000549 3300049824 Archaea 23515
1765 Ga0501045_0000716 3300049824 Bacteria 21100
1766 Ga0501045_0001190 3300049824 Bacteria 17312
1767 Ga0501045_0001314 3300049824 Bacteria 16480
1768 Ga0501045_0003432 3300049824 Bacteria 10841
1769 Ga0501045_0110489 3300049824 Bacteria 2038
1770 nmdc:mga03n38_15428_c1 3300050490 Bacteria 2950
1771 nmdc:mga03n38_32338_c1 3300050490 Bacteria 2215
1772 nmdc:mga03n38_70302_c1 3300050490 Bacteria 1618
1773 nmdc:mga00v17_11230_c1 3300050491 Bacteria 4919
1774 nmdc:mga00v17_177516_c1 3300050491 Bacteria 1374
1775 nmdc:mga00v17_200666_c1 3300050491 Bacteria 1289
1776 nmdc:mga00v17_23683_c1 3300050491 Bacteria 3554
1777 nmdc:mga00v17_26072_c1 3300050491 Bacteria 3402
1778 nmdc:mga00v17_50444_c1 3300050491 Bacteria 2529
1779 nmdc:mga00v17_51330_c1 3300050491 Bacteria 2508
1780 nmdc:mga00v17_56777_c1 3300050491 Bacteria 2394
1781 nmdc:mga00v17_6346_c1 3300050491 Bacteria 6269
1782 nmdc:mga00v17_70360_c1 3300050491 Bacteria 2167
1783 nmdc:mga00v17_7056_c1 3300050491 Bacteria 5982
1784 nmdc:mga00v17_7209_c1 3300050491 Bacteria 5923
1785 nmdc:mga0yw44_100736_c1 3300050492 Bacteria 1840
1786 nmdc:mga0yw44_103064_c1 3300050492 Bacteria 1820
1787 nmdc:mga0yw44_10630_c1 3300050492 Bacteria 4712
1788 nmdc:mga0yw44_12125_c1 3300050492 Bacteria 4481
1789 nmdc:mga0yw44_13350_c1 3300050492 Bacteria 4322
1790 nmdc:mga0yw44_229144_c1 3300050492 Bacteria 1233
1791 nmdc:mga0yw44_27067_c1 3300050492 Bacteria 3281
1792 nmdc:mga0yw44_58784_c1 3300050492 Bacteria 2350
1793 nmdc:mga06z11_145195_c1 3300050494 Bacteria 1344
1794 nmdc:mga07m45_1183_c1 3300050496 Bacteria 9017
1795 nmdc:mga07m45_14273_c1 3300050496 Bacteria 4228
1796 nmdc:mga07m45_62313_c1 3300050496 Bacteria 2113
1797 nmdc:mga07m45_68468_c1 3300050496 Bacteria 2018
1798 nmdc:mga05p37_130627_c1 3300050507 Bacteria 3082
1799 nmdc:mga05p37_147133_c1 3300050507 Bacteria 2883
1800 nmdc:mga05p37_59368_c1 3300050507 Bacteria 4710
1801 nmdc:mga0qj67_16520_c1 3300050509 Bacteria 5600
1802 nmdc:mga0qj67_199461_c1 3300050509 Bacteria 1626
1803 nmdc:mga0qj67_314_c1 3300050509 Bacteria 33600
1804 nmdc:mga0qj67_55011_c1 3300050509 Bacteria 3152
1805 nmdc:mga06r32_66862_c1 3300050510 Bacteria 3469
1806 nmdc:mga06r32_83948_c1 3300050510 Bacteria 3103
1807 nmdc:mga08y16_124196_c1 3300050511 Bacteria 2685
1808 nmdc:mga08y16_407028_c1 3300050511 Bacteria 1392
1809 nmdc:mga0n895_280587_c1 3300050512 Bacteria 1689
1810 nmdc:mga0n895_58260_c1 3300050512 Bacteria 3808
1811 nmdc:mga0rr50_116155_c1 3300050513 Bacteria 2124
1812 nmdc:mga0rr50_54532_c1 3300050513 Unclassified 2979
1813 nmdc:mga0a205_30295_c1 3300050515 Archaea 5179
1814 nmdc:mga0a205_3708_c1 3300050515 Bacteria 13671
1815 nmdc:mga0a205_50884_c1 3300050515 Bacteria 3999
1816 nmdc:mga0sz30_1040_c1 3300050516 Bacteria 9983
1817 nmdc:mga0sz30_1824_c2 3300050516 Bacteria 6986
1818 nmdc:mga0sz30_30283_c1 3300050516 Bacteria 2235
1819 nmdc:mga0sz30_34239_c1 3300050516 Bacteria 2113
1820 nmdc:mga0sz30_50583_c1 3300050516 Bacteria 1762
1821 Ga0495601_0032272 3300053077 Bacteria 3259
1822 Ga0500610_0003294 3300053079 Bacteria 6163
1823 Ga0500635_0000091 3300053080 Bacteria 55565
1824 Ga0500635_0018314 3300053080 Bacteria 2111
1825 Ga0495655_0001696 3300053083 Bacteria 3409
1826 Ga0495619_0000621 3300053085 Bacteria 23466
1827 Ga0495619_0022031 3300053085 Bacteria 4073
1828 Ga0495619_0036805 3300053085 Bacteria 3188
1829 Ga0495619_0072197 3300053085 Bacteria 2311
1830 Ga0495619_0152235 3300053085 Bacteria 1595
1831 Ga0495619_0169713 3300053085 Bacteria 1508
1832 Ga0500643_000086 3300053087 Bacteria 97106
1833 Ga0500643_001082 3300053087 Bacteria 16404
1834 Ga0500643_001466 3300053087 Bacteria 13548
1835 Ga0500646_0019346 3300053090 Bacteria 1802
1836 Ga0500651_0022307 3300053093 Bacteria 3954
1837 Ga0500641_0000526 3300053096 Bacteria 13777
1838 Ga0500556_0000115 3300053104 Bacteria 69837
1839 Ga0500556_0000496 3300053104 Bacteria 27297
1840 Ga0500556_0000626 3300053104 Bacteria 22358
1841 Ga0500562_010403 3300053108 Bacteria 2358
1842 Ga0500593_000731 3300053117 Bacteria 12438
1843 Ga0500642_0036336 3300053130 Bacteria 2099
1844 Ga0500652_000545 3300053131 Bacteria 13158
1845 Ga0500559_0001016 3300053136 Bacteria 17245
1846 Ga0500559_0001057 3300053136 Bacteria 16725
1847 Ga0500559_0009421 3300053136 Bacteria 4227
1848 Ga0500559_0024306 3300053136 Bacteria 2577
1849 Ga0500568_0000038 3300053139 Bacteria 134267
1850 Ga0500568_0000117 3300053139 Bacteria 71510
1851 Ga0500568_0001800 3300053139 Bacteria 13198
1852 Ga0500568_0004560 3300053139 Bacteria 7384
1853 Ga0500568_0017055 3300053139 Bacteria 3213
1854 Ga0500568_0040363 3300053139 Bacteria 1879
1855 Ga0500573_0000014 3300053140 Bacteria 193353
1856 Ga0500573_0000476 3300053140 Bacteria 17264
1857 Ga0500573_0015888 3300053140 Bacteria 4270
1858 Ga0500573_0018692 3300053140 Bacteria 3955
1859 Ga0500573_0018791 3300053140 Bacteria 3947
1860 Ga0500573_0029841 3300053140 Bacteria 3144
1861 Ga0500573_0039403 3300053140 Bacteria 2729
1862 Ga0500577_0001332 3300053142 Bacteria 6319
1863 Ga0500590_006984 3300053148 Bacteria 5541
1864 Ga0500600_0055938 3300053149 Bacteria 2220
1865 Ga0500616_0000027 3300053153 Bacteria 441053
1866 Ga0500616_0000115 3300053153 Bacteria 147212
1867 Ga0500616_0000117 3300053153 Bacteria 145655
1868 Ga0500616_0001308 3300053153 Bacteria 24623
1869 Ga0500616_0001664 3300053153 Bacteria 20508
1870 Ga0500616_0002288 3300053153 Bacteria 16223
1871 Ga0500620_000082 3300053155 Bacteria 18227
1872 Ga0500645_013215 3300053730 Bacteria 2655
1873 Ga0501084_0003669 3300054114 Bacteria 12458
1874 Ga0501084_0006148 3300054114 Bacteria 9871
1875 Ga0501084_0056074 3300054114 Bacteria 3297
1876 Ga0501084_0144759 3300054114 Bacteria 2002
1877 Ga0587084_001354 3300059477 Bacteria 2303
1878 Ga0587066_011832 3300059490 Bacteria 1288
1879 Ga0587077_002512 3300059493 Bacteria 2185
1880 Ga0587083_0013367 3300059505 Bacteria 1397
1881 Ga0587083_0019955 3300059505 Bacteria 1229
1882 Ga0587086_005976 3300059507 Bacteria 1339
1883 Ga0587090_000423 3300059510 Bacteria 3467
1884 Ga0587101_001172 3300059623 Bacteria 2174
1885 Ga0587128_008890 3300059630 Bacteria 1310
1886 Ga0501082_0004627 3300060353 Bacteria 12011
1887 Ga0501082_0009908 3300060353 Archaea 8213
1888 Ga0501082_0208433 3300060353 Bacteria 1701
1889 Ga0466962_0003043 3300061719 Bacteria 7996
1890 Ga0466962_0039612 3300061719 Bacteria 2256
1891 Ga0466962_0058962 3300061719 Bacteria 1832
1892 Ga0466962_0074207 3300061719 Bacteria 1625
1893 Ga0466962_0077614 3300061719 Bacteria 1588
1894 Ga0530510_0000536 3300061734 Bacteria 24331
1895 Ga0530510_0001061 3300061734 Archaea 18241
1896 Ga0530510_0017997 3300061734 Bacteria 5008
1897 Ga0530510_0046250 3300061734 Bacteria 3144
1898 Ga0530510_0122356 3300061734 Bacteria 1911
1899 Ga0530510_0151936 3300061734 Bacteria 1710
1900 2517762602 2517572101 Bacteria 6884336
1901 2523386351 2523231044 Bacteria 6434991
1902 2537898934 2537561592 Bacteria 4348607
1903 2548699060 2547132424 Bacteria 8348532
1904 2552110737 2551306166 Bacteria 9731570
1905 2555229498 2554235227 Bacteria 3637389
1906 2558909522 2558860112 Bacteria 9931328
1907 2559428860 2558860280 Bacteria 11429938
1908 2559430722 2558860280 Bacteria 11429938
1909 2566992174 2565956761 Bacteria 6601618
1910 2579853624 2579778521 Bacteria 7624758
1911 2583149102 2582580736 Bacteria 5325865
1912 2585298246 2582581312 Bacteria 7308206
1913 2586060711 2585427649 Bacteria 9053857
1914 2586064425 2585427649 Bacteria 9053857
1915 2587863728 2585428094 Bacteria 3604039
1916 2588106890 2585428157 Bacteria 3018951
1917 2619853695 2619618881 Bacteria 7521104
1918 2620349911 2619619003 Bacteria 7619552
1919 2623497579 2622736605 Bacteria 4992138
1920 2626636076 2626541554 Bacteria 7741902
1921 2643734893 2643221542 Bacteria 3563959
1922 2643753811 2643221546 Bacteria 2910897
1923 2643768551 2643221549 Bacteria 4042819
1924 2643783497 2643221553 Bacteria 3544260
1925 2643847960 2643221566 Bacteria 3460379
1926 2643876373 2643221572 Bacteria 3614809
1927 2643888300 2643221575 Bacteria 4022601
1928 2643994948 2643221597 Bacteria 3347721
1929 2644082281 2643221613 Bacteria 4622396
1930 2644096481 2643221616 Bacteria 4066575
1931 2644111922 2643221619 Bacteria 4158469
1932 2644173053 2643221630 Bacteria 3601215
1933 2644182487 2643221632 Bacteria 3406696
1934 2644197913 2643221635 Bacteria 2632343
1935 2644277717 2643221649 Bacteria 3867359
1936 2644383428 2643221669 Bacteria 3611286
1937 2644445424 2643221679 Bacteria 3839507
1938 2644490564 2643221687 Bacteria 6500351
1939 2644502984 2643221690 Bacteria 4654705
1940 2644513962 2643221692 Bacteria 7282860
1941 2644525319 2643221694 Bacteria 4392972
1942 2644538694 2643221697 Bacteria 3575694
1943 2644610849 2643221711 Bacteria 4865335
1944 2644637035 2643221715 Bacteria 6671032
1945 2644664619 2643221721 Bacteria 4486924
1946 2644669404 2643221722 Bacteria 4247614
1947 2644679263 2643221724 Bacteria 3593515
1948 2645720691 2643221961 Bacteria 3919167
1949 2645723710 2643221962 Bacteria 3874254
1950 2655031519 2654587600 Bacteria 3911798
1951 2671835671 2671180195 Bacteria 9757215
1952 2676199411 2675902999 Bacteria 9438463
1953 2686539208 2684623035 Bacteria 8032739
1954 2689960348 2687453737 Bacteria 11203906
1955 2691512796 2690315906 Bacteria 4517044
1956 2723641230 2721755702 Bacteria 4373124
1957 2729907946 2728369276 Bacteria 5610032
1958 2730228766 2728369380 Bacteria 3620317
1959 2738668278 2738541264 Bacteria 5935393
1960 2738693653 2738541272 Bacteria 6848551
1961 2738707253 2738541274 Bacteria 6909446
1962 2738888363 2738541308 Bacteria 7020677
1963 2739147348 2738541356 Bacteria 5935017
1964 2739204214 2738543005 Bacteria 5278128
1965 2739240181 2738543011 Bacteria 5731169
1966 2739322934 2738543027 Bacteria 6409078
1967 2739328568 2738543028 Bacteria 6917070
1968 2739604004 2739367653 Bacteria 2780952
1969 2739607519 2739367654 Bacteria 6049412
1970 2747952356 2747842429 Bacteria 3914386
1971 2753070050 2751185734 Bacteria 8863695
1972 2753303609 2751185788 Bacteria 4541048
1973 2758224592 2757320536 Bacteria 3629334
1974 2760304582 2758568522 Bacteria 5953541
1975 2760621607 2758568621 Bacteria 5967089
1976 2774378720 2773857758 Bacteria 3592392
1977 2774383464 2773857759 Bacteria 2963774
1978 2774394494 2773857762 Bacteria 5971770
1979 2774400469 2773857763 Bacteria 4180068
1980 2774843989 2773857921 Bacteria 9435764
1981 2774853827 2773857922 Bacteria 9757215
1982 2775658485 2775506735 Bacteria 4556596
1983 2776373997 2775506925 Bacteria 7237746
1984 2784472887 2784132109 Bacteria 3141763
1985 2793982994 2791355406 Bacteria 11364898
1986 2795795224 2795385472 Bacteria 6627535
1987 2799184891 2799112218 Bacteria 4315149
1988 2808628640 2808606306 Bacteria 3608896
1989 2808830074 2808606357 Bacteria 4466944
1990 2808851250 2808606360 Bacteria 4404006
1991 2808875416 2808606365 Bacteria 4301966
1992 2808876225 2808606366 Bacteria 4415912
1993 2808884855 2808606368 Bacteria 3174172
1994 2808894329 2808606370 Bacteria 4942454
1995 2808897727 2808606371 Bacteria 4251511
1996 2808901109 2808606372 Bacteria 4649509
1997 2809026401 2808606394 Bacteria 6248540
1998 2809194652 2808606439 Bacteria 5952208
1999 2809226661 2808606447 Bacteria 3572005
2000 2809586347 2808606522 Bacteria 9488490
2001 2812318150 2811994871 Bacteria 4497550
2002 2812322228 2811994872 Bacteria 4121241
2003 2812349393 2811994878 Bacteria 5992952
2004 2812375735 2811994882 Bacteria 4688362
2005 2816424357 2816332119 Bacteria 8120218
2006 2816505484 2816332139 Bacteria 9138787
2007 2817509736 2816332305 Bacteria 2697803
2008 2819424625 2818991318 Bacteria 5266538
2009 2819666956 2818991458 Bacteria 4794049
2010 2819690324 2818991462 Bacteria 4320267
2011 2819728426 2818991469 Bacteria 4644110
2012 2821269177 2821268502 Bacteria 3750023
2013 2833710070 2833709550 Bacteria 4008291
2014 2835191786 2835188231 Bacteria 3476928
2015 2837270575 2837268691 Bacteria 7850704
2016 2839986502 2839986021 Bacteria 3685650
2017 2842140523 2842134933 Bacteria 5847019
2018 2842891200 2842888712 Bacteria 4279094
2019 2844843306 2844841374 Bacteria 3917147
2020 2844851758 2844849076 Bacteria 4091819
2021 2844854384 2844852863 Bacteria 3849151
2022 2848551739 2848551377 Bacteria 3720646
2023 2852632870 2852632344 Bacteria 3463163
2024 2852644411 2852643534 Bacteria 3013378
2025 2852646560 2852646457 Bacteria 3408613
2026 2852665798 2852663356 Bacteria 4090475
2027 2852678639 2852677369 Bacteria 3768884
2028 2857479980 2857479173 Bacteria 2469263
2029 2857633458 2857632687 Bacteria 2448521
2030 2857711204 2857710386 Bacteria 3186771
2031 2857722722 2857720070 Bacteria 3189373
2032 2857724698 2857723135 Bacteria 4217853
2033 2857728526 2857727296 Bacteria 2745552
2034 2857730601 2857729791 Bacteria 4040535
2035 2857734473 2857733635 Bacteria 3532004
2036 2857739122 2857737099 Bacteria 3104305
2037 2857740823 2857740372 Bacteria 4782044
2038 2862993548 2862993130 Bacteria 3860849
2039 2863070407 2863067949 Bacteria 8541735
2040 2866555467 2866552031 Bacteria 5824618
2041 2866616957 2866612099 Bacteria 7543886
2042 2870622255 2870622029 Bacteria 3643329
2043 2870629554 2870628048 Bacteria 3696012
2044 2870727454 2870721527 Bacteria 9689237
2045 2870730025 2870721527 Bacteria 9689237
2046 2870788726 2870782633 Bacteria 9624083
2047 2870803304 2870801768 Bacteria 2710986
2048 2870805347 2870804320 Bacteria 2552467
2049 2884766320 2884763398 Bacteria 4091164
2050 2887447174 2887443736 Bacteria 4426037
2051 2889303335 2889300758 Bacteria 5690814
2052 2891331401 2891326441 Bacteria 6439512
2053 2891972895 2891968417 Bacteria 5821697
2054 2893686283 2893684298 Bacteria 2897960
2055 2895428178 2895427314 Bacteria 13147766
2056 2895660548 2895660088 Bacteria 3782833
2057 2895884540 2895880812 Bacteria 11255272
2058 2897562487 2897561785 Bacteria 3256946
2059 2899364506 2899359706 Bacteria 10940472
2060 2899376590 2899370129 Bacteria 6781179
2061 2902797594 2902792274 Bacteria 7270173
2062 2902799884 2902799365 Bacteria 5419524
2063 2902814809 2902810491 Bacteria 6794147
2064 2902843209 2902837492 Bacteria 6697721
2065 2904432473 2904430863 Bacteria 3486923
2066 2904501566 2904497146 Bacteria 4731781
2067 2904501743 2904501621 Bacteria 3401437
2068 2904510218 2904509784 Bacteria 3520416
2069 2904538004 2904535858 Bacteria 6308016
2070 2904778211 2904776348 Bacteria 4658726
2071 2905928636 2905926851 Bacteria 4423176
2072 2906801599 2906799679 Bacteria 4031749
2073 2908676203 2908674828 Bacteria 3382763
2074 2908678567 2908678064 Bacteria 3482747
2075 2909077083 2909074476 Bacteria 3436050
2076 2915364120 2915358134 Bacteria 6050864
2077 2915774800 2915768154 Bacteria 8424322
2078 2917736598 2917736166 Bacteria 9690793
2079 2917737727 2917736166 Bacteria 9690793
2080 2919035583 2919034639 Bacteria 4763403
2081 2919041778 2919039151 Bacteria 3391018
2082 2919043276 2919042368 Bacteria 3905917
2083 2919054919 2919051321 Bacteria 4210889
2084 2919058787 2919055335 Bacteria 3875751
2085 2919060242 2919059106 Bacteria 4991624
2086 2919070918 2919069694 Bacteria 3622919
2087 2919395364 2919391150 Bacteria 4884741
2088 2919398565 2919395869 Bacteria 3704152
2089 2919445625 2919443155 Bacteria 4072969
2090 2919525365 2919523602 Bacteria 3788128
2091 2919539208 2919538618 Bacteria 4677069
2092 2919717016 2919713450 Bacteria 7431245
2093 2920883347 2920879853 Bacteria 4216831
2094 2922557187 2922554459 Bacteria 6683962
2095 2928091018 2928090899 Bacteria 3158267
2096 2928105561 2928104781 Bacteria 3877447
2097 2928121405 2928121344 Bacteria 3972376
2098 2928145111 2928142448 Bacteria 5288925
2099 2928153444 2928153084 Bacteria 4020257
2100 2928500921 2928500415 Bacteria 3384541
2101 2929217564 2929212328 Bacteria 7708288
2102 2932400412 2932398195 Bacteria 3847976
2103 2932427797 2932426870 Bacteria 4547726
2104 2932432301 2932431166 Bacteria 4215299
2105 2933418630 2933418574 Bacteria 4476724
2106 2935410642 2935409751 Bacteria 4179611
2107 2935894132 2935890801 Bacteria 4593001
2108 2939584798 2939582691 Bacteria 7088898
2109 2939599380 2939598168 Bacteria 4687164
2110 2939650244 2939647034 Bacteria 4681660
2111 2939659378 2939657138 Bacteria 3740283
2112 2939662805 2939660829 Bacteria 3784848
2113 2939677662 2939674588 Bacteria 4844420
2114 2939748528 2939743619 Bacteria 5762299
2115 2945920248 2945916053 Bacteria 4555517
2116 2945923894 2945920336 Bacteria 4501603
2117 2945944447 2945941187 Bacteria 4682474
2118 2945957365 2945956166 Bacteria 5110334
2119 2945970918 2945968032 Bacteria 4111363
2120 2946003385 2946003308 Bacteria 3857229
2121 2946024821 2946024296 Bacteria 3508095
2122 2946034661 2946033335 Bacteria 3835514
2123 2946040362 2946037020 Bacteria 4900426
2124 2946043242 2946041624 Bacteria 4191385
2125 2946063965 2946059875 Bacteria 4386623
2126 2946081770 2946080515 Bacteria 4310960
2127 2954001630 2953998280 Bacteria 4812144
2128 2956941536 2956939328 Bacteria 3474458
2129 2964328541 2964326757 Bacteria 3290868
2130 2966922640 2966921586 Bacteria 3092803
2131 2966926610 2966924647 Bacteria 3268643
2132 2974298238 2974294766 Bacteria 3767688
2133 2974303796 2974302888 Bacteria 4369871
2134 2974325532 2974324384 Bacteria 3750535
2135 2977230464 2977228692 Bacteria 3450105
2136 2977239265 2977236895 Bacteria 3569373
2137 2977252038 2977251589 Bacteria 2952848
2138 2977265706 2977264416 Bacteria 3750737
2139 2984542951 2984542743 Bacteria 3569378
2140 2984551898 2984551494 Bacteria 3877562
2141 2984579777 2984576629 Bacteria 4248407
2142 2984582226 2984580707 Bacteria 3351387
2143 2984593946 2984592036 Bacteria 3670284
2144 2995728415 2995726249 Bacteria 3470435
2145 3001892118 3001889506 Bacteria 2975194
2146 8002791552 8002784119 Bacteria 9788632
2147 8002811627 8002811521 Bacteria 2942897
2148 8003321489 8003314358 Bacteria 10575343
2149 8003323191 8003314358 Bacteria 10575343
2150 8004022465 8004021418 Bacteria 4313954
2151 8004026910 8004025490 Bacteria 4327753
2152 8004183613 8004182704 Bacteria 3391155
2153 8004213430 8004212874 Bacteria 2861420
2154 8016254894 8016254467 Bacteria 3797036
2155 8033684397 8033684223 Bacteria 6906479
2156 8045832455 8045830549 Bacteria 4444727
2157 8047717666 8047710418 Bacteria 11023148
2158 8047719528 8047710418 Bacteria 11023148
2159 8047895175 8047893842 Bacteria 11723082
2160 8048136500 8048127548 Bacteria 11053136
2161 8048363777 8048356638 Bacteria 11044339
2162 8048372201 8048369669 Bacteria 11666822
2163 8048381135 8048379754 Bacteria 11877923
2164 8054109686 8054107350 Bacteria 5022511
2165 8054475852 8054472261 Bacteria 7464355
2166 8054613903 8054609563 Bacteria 5170090
2167 8054917141 8054913762 Bacteria 7713009
2168 8054925340 8054920844 Bacteria 7068637
2169 8055035359 8055034563 Bacteria 3562128
2170 8055038950 8055037949 Bacteria 3337834
2171 8055160668 8055157932 Bacteria 6429399
2172 8055177139 8055172936 Bacteria 9305943
2173 8056039320 8056037122 Bacteria 3854319
2174 8056208492 8056207758 Bacteria 8639239
2175 8056583315 8056579771 Bacteria 5840325
2176 8057347470 8057345674 Bacteria 4160394
2177 Ga0207427_100042
2178 LJQas_1002745
2179 LJQas_1002873
2180 JGI24746J21847_1001377
2181 JGI24740J21852_10002318
2182 JGI24740J21852_10013880
2183 JGI24737J22298_10016258
2184 JGI24737J22298_10025699
2185 JGI24735J21928_10005710
2186 JGI24735J21928_10006707
2187 JGI24738J21930_10011645
2188 JGI24744J21845_10006576
2189 JGI25162J39368_1004740
2190 JGI25154J39366_1001298
2191 JGI25164J39214_1001137
2192 JGI25152J39213_1000379
2193 JGI25151J46595_10038948
2194 JGI25406J46586_10002406
2195 JGI25165J46597_1000061
2196 JGI25407J50210_10004858
2197 Ga0006562J51391_1003827
2198 Ga0006562J51391_1026496
2199 Ga0006562J51391_1028453
2200 Ga0006562J51391_1032082
2201 Ga0055539_1000005
2202 Ga0055533_1000001
2203 Ga0055525_1000291
2204 Ga0055527_1000017
2205 Ga0055542_1000044
2206 Ga0055542_1005133
2207 Ga0055529_1000279
2208 Ga0055540_1000022
2209 Ga0055540_1007503
2210 Ga0055540_1017813
2211 Ga0055541_1000625
2212 JGI25405J52794_10000005
2213 Ga0065714_10099404
2214 Ga0065704_10073835
2215 Ga0070658_10000394
2216 Ga0070658_10000448
2217 Ga0070676_10180578
2218 Ga0070683_100008624
2219 Ga0070683_100029105
2220 Ga0070683_100032968
2221 Ga0070683_100034639
2222 Ga0070683_100054846
2223 Ga0070683_100061592
2224 Ga0070683_100078600
2225 Ga0070677_10078333
2226 Ga0068869_100034322
2227 Ga0070666_10144317
2228 Ga0070682_100006780
2229 Ga0070682_100014519
2230 Ga0070682_100016045
2231 Ga0070682_100041420
2232 Ga0068868_100005688
2233 Ga0068868_100005768
2234 Ga0068868_100024841
2235 Ga0068868_100054112
2236 Ga0068868_100259251
2237 Ga0070660_100018405
2238 Ga0070660_100028725
2239 Ga0070660_100031568
2240 Ga0070660_100035294
2241 Ga0070660_100078401
2242 Ga0070660_100086430
2243 Ga0070660_100097095
2244 Ga0070691_10106531
2245 Ga0070687_100008987
2246 Ga0070661_100075188
2247 Ga0070692_10020367
2248 Ga0070668_100004760
2249 Ga0070668_100004776
2250 Ga0070668_100005919
2251 Ga0070669_100000820
2252 Ga0070669_100031283
2253 Ga0070669_100057358
2254 Ga0070669_100120181
2255 Ga0070675_100071687
2256 Ga0070675_100094331
2257 Ga0070675_100162207
2258 Ga0070671_100000413
2259 Ga0070671_100016620
2260 Ga0070671_100138032
2261 Ga0070671_100199550
2262 Ga0070671_100237954
2263 Ga0070674_100020814
2264 Ga0070674_100065570
2265 Ga0070674_100139963
2266 Ga0070688_100020289
2267 Ga0070659_100001798
2268 Ga0070659_100005058
2269 Ga0070659_100007670
2270 Ga0070659_100028072
2271 Ga0070659_100071106
2272 Ga0070659_100091466
2273 Ga0070659_100182920
2274 Ga0070667_100000605
2275 Ga0070667_100000674
2276 Ga0070667_100001634
2277 Ga0070667_100010065
2278 Ga0070667_100023104
2279 Ga0070709_10012741
2280 Ga0070709_10024755
2281 Ga0070714_100046967
2282 Ga0070714_100051731
2283 Ga0070714_100065288
2284 Ga0070714_100066546
2285 Ga0070714_100160700
2286 Ga0070714_100164208
2287 Ga0070714_100207909
2288 Ga0070713_100003424
2289 Ga0070713_100049495
2290 Ga0070710_10001407
2291 Ga0070710_10016635
2292 Ga0070701_10003564
2293 Ga0070711_100006432
2294 Ga0070711_100043841
2295 Ga0070700_100000049
2296 Ga0070700_100017266
2297 Ga0070700_100026697
2298 Ga0070700_100034233
2299 Ga0070700_100196840
2300 Ga0070694_100014338
2301 Ga0070663_100047102
2302 Ga0070663_100059261
2303 Ga0070663_100126923
2304 Ga0070678_100001296
2305 Ga0070678_100031232
2306 Ga0070678_100177184
2307 Ga0070678_100185230
2308 Ga0070662_100014959
2309 Ga0070681_10009503
2310 Ga0070681_10310482
2311 Ga0068867_100002347
2312 Ga0068867_100044172
2313 Ga0070685_10043877
2314 Ga0070706_100006459
2315 Ga0070706_100012286
2316 Ga0070706_100064391
2317 Ga0070707_100006726
2318 Ga0070707_100011559
2319 Ga0070707_100019191
2320 Ga0070707_100091207
2321 Ga0070707_100188369
2322 Ga0070698_100007659
2323 Ga0070698_100012160
2324 Ga0070698_100018135
2325 Ga0070698_100117481
2326 Ga0070679_100011185
2327 Ga0070679_100157345
2328 Ga0070679_100195083
2329 Ga0070679_100388985
2330 Ga0070684_100008109
2331 Ga0070684_100010114
2332 Ga0070684_100010640
2333 Ga0070684_100056129
2334 Ga0070684_100071021
2335 Ga0068853_100003640
2336 Ga0068853_100017372
2337 Ga0068853_100022417
2338 Ga0068853_100029542
2339 Ga0068853_100062708
2340 Ga0068853_100089100
2341 Ga0070672_100011247
2342 Ga0070672_100044260
2343 Ga0070672_100060413
2344 Ga0070686_100044352
2345 Ga0070695_100016540
2346 Ga0070696_100001265
2347 Ga0070665_100000450
2348 Ga0070665_100003803
2349 Ga0070665_100004177
2350 Ga0070665_100029488
2351 Ga0070665_100042334
2352 Ga0070665_100128311
2353 Ga0070665_100287046
2354 Ga0070704_100000144
2355 Ga0070704_100027059
2356 Ga0070704_100041179
2357 Ga0070704_100070886
2358 Ga0068855_100026886
2359 Ga0068855_100034488
2360 Ga0068855_100046784
2361 Ga0068855_100066766
2362 Ga0068855_100081308
2363 Ga0068855_100090254
2364 Ga0068855_100163748
2365 Ga0068857_100005690
2366 Ga0068857_100035843
2367 Ga0068857_100266979
2368 Ga0068854_100003304
2369 Ga0068854_100140557
2370 Ga0068856_100022435
2371 Ga0068856_100025251
2372 Ga0068856_100026637
2373 Ga0068856_100046003
2374 Ga0068856_100048666
2375 Ga0068856_100092229
2376 Ga0068856_100230588
2377 Ga0070702_100007562
2378 Ga0070702_100021808
2379 Ga0070702_100022733
2380 Ga0068852_100006651
2381 Ga0068852_100031767
2382 Ga0068852_100032864
2383 Ga0068852_100042387
2384 Ga0068852_100058986
2385 Ga0068852_100219404
2386 Ga0068859_100001784
2387 Ga0068859_100002254
2388 Ga0068859_100012347
2389 Ga0068859_100144251
2390 Ga0068864_100025782
2391 Ga0068864_100075408
2392 Ga0068866_10000517
2393 Ga0068866_10041100
2394 Ga0068866_10058969
2395 Ga0068861_100001353
2396 Ga0068861_100055079
2397 Ga0068861_100132503
2398 Ga0068851_10000022
2399 Ga0068870_10006332
2400 Ga0068863_100003048
2401 Ga0068863_100035553
2402 Ga0068858_100000016
2403 Ga0068858_100000179
2404 Ga0068858_100005465
2405 Ga0068858_100012390
2406 Ga0068858_100081802
2407 Ga0068860_100000087
2408 Ga0068860_100000154
2409 Ga0068860_100017715
2410 Ga0068860_100170998
2411 Ga0068862_100000190
2412 Ga0068862_100000312
2413 Ga0068862_100004977
2414 Ga0081455_10000082
2415 Ga0081455_10010276
2416 Ga0081455_10079007
2417 Ga0081455_10098153
2418 Ga0081455_10121819
2419 Ga0081538_10001382
2420 Ga0081538_10001794
2421 Ga0081540_1003861
2422 Ga0081540_1004047
2423 Ga0081539_10000467
2424 Ga0081539_10027400
2425 Ga0081539_10072469
2426 Ga0070717_10007764
2427 Ga0070717_10081630
2428 Ga0075365_10002456
2429 Ga0075365_10028961
2430 Ga0075365_10033360
2431 Ga0075365_10034198
2432 Ga0075365_10058458
2433 Ga0075365_10065175
2434 Ga0075363_100000201
2435 Ga0075363_100003979
2436 Ga0075363_100009777
2437 Ga0075363_100065368
2438 Ga0075363_100067724
2439 Ga0075364_10000723
2440 Ga0075364_10003104
2441 Ga0075364_10010199
2442 Ga0075364_10024783
2443 Ga0075364_10034632
2444 Ga0075364_10037917
2445 Ga0075364_10126099
2446 Ga0075364_10133480
2447 Ga0070715_10001150
2448 Ga0070715_10055444
2449 Ga0070716_100007290
2450 Ga0070712_100002802
2451 Ga0070712_100012929
2452 Ga0070712_100032414
2453 Ga0070712_100036549
2454 Ga0070712_100117682
2455 Ga0075362_10029281
2456 Ga0075367_10031724
2457 Ga0075367_10032134
2458 Ga0075367_10177514
2459 Ga0075369_10002730
2460 Ga0075369_10004308
2461 Ga0075369_10004998
2462 Ga0075369_10005608
2463 Ga0075369_10085197
2464 Ga0097621_100151492
2465 Ga0075370_10044515
2466 Ga0075370_10061384
2467 Ga0075370_10074977
2468 Ga0075428_100005250
2469 Ga0075428_100031735
2470 Ga0075430_100000294
2471 Ga0075430_100062808
2472 Ga0075431_100062538
2473 Ga0075431_100075899
2474 Ga0075431_100360363
2475 Ga0075433_10122858
2476 Ga0075433_10300617
2477 Ga0075434_100007636
2478 Ga0075429_100023377
2479 Ga0075429_100070519
2480 Ga0068865_100002468
2481 Ga0068865_100044021
2482 Ga0068865_100066192
2483 Ga0068865_100278411
2484 Ga0097620_100000049
2485 Ga0097620_100001784
2486 Ga0097620_100002254
2487 Ga0097620_100012347
2488 Ga0097620_100144244
2489 Ga0075435_100011202
2490 Ga0099794_10000314
2491 Ga0105244_10033017
2492 Ga0105244_10033778
2493 Ga0105244_10112258
2494 Ga0105240_10005015
2495 Ga0105240_10051407
2496 Ga0105240_10085563
2497 Ga0105240_10313825
2498 Ga0111539_10094250
2499 Ga0105245_10004537
2500 Ga0105245_10006332
2501 Ga0105245_10025093
2502 Ga0105245_10111351
2503 Ga0105245_10126199
2504 Ga0105245_10149353
2505 Ga0105247_10000159
2506 Ga0105247_10000376
2507 Ga0105247_10004231
2508 Ga0105247_10043655
2509 Ga0114129_10025993
2510 Ga0114129_10043021
2511 Ga0114129_10063215
2512 Ga0105243_10012483
2513 Ga0105243_10029324
2514 Ga0105243_10069791
2515 Ga0105243_10201321
2516 Ga0105241_10007128
2517 Ga0105241_10023785
2518 Ga0105242_10000880
2519 Ga0105242_10018500
2520 Ga0105242_10135002
2521 Ga0105242_10196341
2522 Ga0105248_10000050
2523 Ga0105248_10015100
2524 Ga0105248_10058631
2525 Ga0105248_10071820
2526 Ga0105248_10085325
2527 Ga0105248_10093820
2528 Ga0105248_10102045
2529 Ga0105248_10139647
2530 Ga0105237_10000302
2531 Ga0105237_10001065
2532 Ga0105237_10004166
2533 Ga0105237_10005434
2534 Ga0105237_10035167
2535 Ga0105237_10059928
2536 Ga0105237_10139560
2537 Ga0105237_10140579
2538 Ga0105238_10026434
2539 Ga0105238_10053225
2540 Ga0105238_10133069
2541 Ga0105249_10000042
2542 Ga0105249_10010531
2543 Ga0105249_10048212
2544 Ga0105249_10082403
2545 Ga0105249_10128286
2546 Ga0105249_10172445
2547 Ga0105249_10267898
2548 Ga0105239_10004010
2549 Ga0105239_10012785
2550 Ga0105239_10100347
2551 Ga0105246_10003745
2552 Ga0105246_10073964
2553 Ga0105246_10094175
2554 Ga0105246_10096186
2555 Ga0105246_10130680
2556 Ga0157373_10035357
2557 Ga0157371_10041403
2558 Ga0157371_10066105
2559 Ga0157371_10069843
2560 Ga0157370_10002163
2561 Ga0157370_10007445
2562 Ga0157370_10027650
2563 Ga0157370_10034752
2564 Ga0157370_10046918
2565 Ga0157370_10293017
2566 Ga0157369_10000230
2567 Ga0157369_10002312
2568 Ga0157369_10010811
2569 Ga0157369_10012349
2570 Ga0157369_10014343
2571 Ga0157369_10022758
2572 Ga0157369_10067879
2573 Ga0157369_10132655
2574 Ga0157369_10149419
2575 Ga0157369_10199267
2576 Ga0171462_1001
2577 Ga0157374_10011242
2578 Ga0157374_10041552
2579 Ga0157378_10003787
2580 Ga0157378_10033544
2581 Ga0157378_10085185
2582 Ga0163162_10029817
2583 Ga0163162_10046065
2584 Ga0163162_10084959
2585 Ga0163162_10195861
2586 Ga0157372_10001405
2587 Ga0157372_10022392
2588 Ga0157372_10069659
2589 Ga0157372_10079284
2590 Ga0157372_10088253
2591 Ga0157372_10092930
2592 Ga0157372_10222180
2593 Ga0157375_10013718
2594 Ga0157375_10016612
2595 Ga0157375_10076311
2596 Ga0157375_10087739
2597 Ga0157375_10102159
2598 Ga0157375_10236263
2599 Ga0163163_10004486
2600 Ga0163163_10056964
2601 Ga0163163_10072366
2602 Ga0163163_10104359
2603 Ga0163163_10235044
2604 Ga0163163_10342163
2605 Ga0157380_10192700
2606 Ga0157377_10024809
2607 Ga0157379_10002686
2608 Ga0157379_10004386
2609 Ga0157379_10008257
2610 Ga0157379_10016792
2611 Ga0157379_10051898
2612 Ga0157379_10219592
2613 Ga0163161_10010839
2614 Ga0163161_10031311
2615 Ga0163161_10039383
2616 Ga0163161_10116809
2617 Ga0197907_10127029
2618 Ga0197907_10587311
2619 Ga0206356_10558971
2620 Ga0206351_10127684
2621 Ga0206351_10456609
2622 Ga0206350_10025198
2623 Ga0206350_11148788
2624 Ga0206354_11217485
2625 Ga0206354_11437303
2626 Ga0206353_11101538
2627 Ga0213875_10011668
2628 Ga0213871_10015809
2629 Ga0224712_10010230
2630 Ga0224712_10020419
2631 Ga0224712_10023129
2632 Ga0224712_10042451
2633 Ga0224572_1006386
2634 Ga0209566_100053
2635 Ga0209674_100001
2636 Ga0209672_100039
2637 Ga0209147_100507
2638 Ga0209563_100001
2639 Ga0209437_100369
2640 Ga0207425_1009908
2641 Ga0209646_1000088
2642 Ga0209677_100001
2643 Ga0209677_100448
2644 Ga0209148_1000004
2645 Ga0209148_1002289
2646 Ga0209148_1010632
2647 Ga0209129_1000109
2648 Ga0209233_1000001
2649 Ga0209455_1000117
2650 Ga0209455_1001874
2651 Ga0209673_1017529
2652 Ga0209025_1000984
2653 Ga0209051_1000033
2654 Ga0209051_1000633
2655 Ga0209051_1002844
2656 Ga0209051_1015719
2657 Ga0209051_1029411
2658 Ga0207697_10077557
2659 Ga0207656_10000005
2660 Ga0207655_1021163
2661 Ga0207655_1025368
2662 Ga0207655_1062958
2663 Ga0207713_1034408
2664 Ga0207682_10005955
2665 Ga0207692_10026792
2666 Ga0207642_10000166
2667 Ga0207642_10067166
2668 Ga0207642_10085016
2669 Ga0207710_10000017
2670 Ga0207710_10000019
2671 Ga0207710_10000173
2672 Ga0207688_10008958
2673 Ga0207688_10114156
2674 Ga0207647_10009465
2675 Ga0207647_10023826
2676 Ga0207647_10027988
2677 Ga0207647_10046699
2678 Ga0207685_10000910
2679 Ga0207685_10056806
2680 Ga0207645_10029223
2681 Ga0207643_10065259
2682 Ga0207705_10000001
2683 Ga0207705_10054377
2684 Ga0207705_10063392
2685 Ga0207705_10150677
2686 Ga0207684_10012433
2687 Ga0207654_10000001
2688 Ga0207707_10008370
2689 Ga0207707_10008629
2690 Ga0207707_10142229
2691 Ga0207695_10004239
2692 Ga0207695_10011642
2693 Ga0207671_10000016
2694 Ga0207671_10002478
2695 Ga0207671_10018148
2696 Ga0207671_10097567
2697 Ga0207671_10126529
2698 Ga0207693_10000366
2699 Ga0207693_10000550
2700 Ga0207693_10004959
2701 Ga0207693_10005203
2702 Ga0207693_10015176
2703 Ga0207693_10019113
2704 Ga0207693_10127422
2705 Ga0207693_10227148
2706 Ga0207663_10019629
2707 Ga0207660_10017090
2708 Ga0207660_10111176
2709 Ga0207660_10200760
2710 Ga0207662_10014650
2711 Ga0207657_10005602
2712 Ga0207657_10010726
2713 Ga0207657_10012581
2714 Ga0207657_10035747
2715 Ga0207657_10041968
2716 Ga0207657_10068982
2717 Ga0207657_10080923
2718 Ga0207657_10090348
2719 Ga0207652_10006710
2720 Ga0207652_10033838
2721 Ga0207652_10205567
2722 Ga0207652_10208365
2723 Ga0207652_10230134
2724 Ga0207646_10000477
2725 Ga0207646_10000516
2726 Ga0207646_10000701
2727 Ga0207646_10004516
2728 Ga0207646_10005407
2729 Ga0207646_10006235
2730 Ga0207646_10032861
2731 Ga0207646_10302369
2732 Ga0207681_10003622
2733 Ga0207681_10012735
2734 Ga0207681_10124519
2735 Ga0207694_10000057
2736 Ga0207694_10011213
2737 Ga0207650_10050965
2738 Ga0207650_10090769
2739 Ga0207650_10278000
2740 Ga0207650_10339941
2741 Ga0207659_10071749
2742 Ga0207659_10102824
2743 Ga0207687_10001986
2744 Ga0207687_10002057
2745 Ga0207687_10006572
2746 Ga0207687_10028962
2747 Ga0207687_10051744
2748 Ga0207687_10057739
2749 Ga0207687_10111857
2750 Ga0207700_10028709
2751 Ga0207700_10040797
2752 Ga0207700_10126325
2753 Ga0207664_10011215
2754 Ga0207664_10017974
2755 Ga0207664_10031585
2756 Ga0207664_10056316
2757 Ga0207664_10109584
2758 Ga0207664_10124094
2759 Ga0207664_10217091
2760 Ga0207644_10000533
2761 Ga0207644_10156728
2762 Ga0207690_10023284
2763 Ga0207690_10043003
2764 Ga0207690_10046233
2765 Ga0207706_10004090
2766 Ga0207706_10023329
2767 Ga0207706_10098926
2768 Ga0207686_10013657
2769 Ga0207686_10039601
2770 Ga0207686_10163127
2771 Ga0207709_10003392
2772 Ga0207709_10013839
2773 Ga0207709_10030200
2774 Ga0207709_10041889
2775 Ga0207709_10086590
2776 Ga0207709_10090833
2777 Ga0207709_10102032
2778 Ga0207709_10120608
2779 Ga0207709_10206581
2780 Ga0207670_10045463
2781 Ga0207669_10000321
2782 Ga0207669_10051938
2783 Ga0207669_10091373
2784 Ga0207669_10093143
2785 Ga0207669_10135214
2786 Ga0207669_10135649
2787 Ga0207704_10043537
2788 Ga0207704_10074438
2789 Ga0207665_10018374
2790 Ga0207665_10042074
2791 Ga0207691_10004828
2792 Ga0207691_10019669
2793 Ga0207691_10020522
2794 Ga0207691_10145476
2795 Ga0207711_10000988
2796 Ga0207711_10005023
2797 Ga0207711_10032150
2798 Ga0207711_10053676
2799 Ga0207711_10094465
2800 Ga0207711_10100070
2801 Ga0207711_10180181
2802 Ga0207689_10050492
2803 Ga0207661_10000257
2804 Ga0207661_10011892
2805 Ga0207661_10029811
2806 Ga0207661_10039576
2807 Ga0207661_10063407
2808 Ga0207679_10297567
2809 Ga0207667_10005061
2810 Ga0207667_10020001
2811 Ga0207667_10027633
2812 Ga0207667_10045682
2813 Ga0207667_10047897
2814 Ga0207667_10083612
2815 Ga0207667_10084614
2816 Ga0207667_10129403
2817 Ga0207667_10154487
2818 Ga0207667_10182780
2819 Ga0207667_10193446
2820 Ga0207651_10192083
2821 Ga0207712_10000010
2822 Ga0207712_10012828
2823 Ga0207712_10044673
2824 Ga0207712_10074694
2825 Ga0207712_10077306
2826 Ga0207712_10177215
2827 Ga0207668_10009380
2828 Ga0207668_10025670
2829 Ga0207668_10069477
2830 Ga0207668_10079801
2831 Ga0207668_10141430
2832 Ga0207640_10272808
2833 Ga0207658_10000278
2834 Ga0207658_10070698
2835 Ga0207658_10193554
2836 Ga0207677_10046959
2837 Ga0207677_10071358
2838 Ga0207677_10082134
2839 Ga0207703_10000013
2840 Ga0207703_10000345
2841 Ga0207703_10008645
2842 Ga0207703_10011120
2843 Ga0207703_10076268
2844 Ga0207639_10016458
2845 Ga0207639_10022472
2846 Ga0207639_10035803
2847 Ga0207639_10094180
2848 Ga0207639_10152400
2849 Ga0207678_10000229
2850 Ga0207678_10019579
2851 Ga0207678_10023067
2852 Ga0207678_10029378
2853 Ga0207678_10053285
2854 Ga0207678_10084801
2855 Ga0207678_10140891
2856 Ga0207678_10203261
2857 Ga0207678_10219045
2858 Ga0207708_10000029
2859 Ga0207708_10047044
2860 Ga0207708_10067474
2861 Ga0207708_10091878
2862 Ga0207708_10226059
2863 Ga0207702_10022503
2864 Ga0207702_10032719
2865 Ga0207702_10074804
2866 Ga0207702_10094243
2867 Ga0207702_10160339
2868 Ga0207702_10215120
2869 Ga0207702_10221456
2870 Ga0207702_10236734
2871 Ga0207641_10000784
2872 Ga0207641_10001715
2873 Ga0207641_10003875
2874 Ga0207641_10169662
2875 Ga0207648_10001482
2876 Ga0207648_10017928
2877 Ga0207648_10051302
2878 Ga0207676_10208626
2879 Ga0207674_10006801
2880 Ga0207674_10009792
2881 Ga0207674_10064434
2882 Ga0207674_10127782
2883 Ga0207674_10134200
2884 Ga0207675_100003809
2885 Ga0207675_100062849
2886 Ga0207675_100127813
2887 Ga0207675_100142217
2888 Ga0207675_100174383
2889 Ga0207683_10001283
2890 Ga0207683_10003164
2891 Ga0207683_10066126
2892 Ga0207683_10186624
2893 Ga0207683_10377498
2894 Ga0207698_10062658
2895 Ga0207698_10108734
2896 Ga0207698_10157060
2897 Ga0207698_10173142
2898 Ga0207698_10217215
2899 Ga0207698_10275758
2900 Ga0207428_10010654
2901 Ga0268266_10001660
2902 Ga0268266_10004579
2903 Ga0268266_10006280
2904 Ga0268266_10012115
2905 Ga0268266_10016431
2906 Ga0268266_10044774
2907 Ga0268266_10065440
2908 Ga0268265_10000014
2909 Ga0268265_10000041
2910 Ga0268265_10043944
2911 Ga0268265_10186334
2912 Ga0268264_10000150
2913 Ga0268264_10000210
2914 Ga0268264_10000498
2915 Ga0268264_10001010
2916 Ga0268264_10491113
2917 Ga0265337_1000861
2918 Ga0265326_10001260
2919 Ga0265319_1000828
2920 Ga0265334_10000237
2921 Ga0265318_10008654
2922 Ga0265323_10005269
2923 Ga0265322_10010118
2924 Ga0265336_10002720
2925 Ga0307515_10022361
2926 Ga0307515_10037313
2927 Ga0307515_10175114
2928 Ga0265338_10000376
2929 Ga0265338_10001480
2930 Ga0265338_10015126
2931 Ga0265324_10008950
2932 Ga0307512_10004160
2933 Ga0316177_1181774
2934 Ga0316176_1121577
2935 Ga0316176_1187053
2936 Ga0314311_1118439
2937 Ga0314311_1132449
2938 Ga0316181_1233539
2939 Ga0265332_10002532
2940 Ga0265320_10000532
2941 Ga0265340_10004583
2942 Ga0265339_10030866
2943 Ga0265331_10042159
2944 Ga0265327_10003399
2945 Ga0265316_10006104
2946 Ga0265316_10050856
2947 Ga0307513_10004729
2948 Ga0307513_10006259
2949 Ga0307513_10016777
2950 Ga0307513_10202081
2951 Ga0307408_100171077
2952 Ga0307408_100191933
2953 Ga0307408_100246721
2954 Ga0307408_100281850
2955 Ga0265313_10006611
2956 Ga0307508_10135401
2957 Ga0307514_10002631
2958 Ga0307514_10011079
2959 Ga0316575_10001074
2960 Ga0316579_10006667
2961 Ga0316579_10006821
2962 Ga0316579_10039363
2963 Ga0265314_10016241
2964 Ga0265342_10022810
2965 Ga0316576_10001380
2966 Ga0316576_10003072
2967 Ga0316576_10017375
2968 Ga0316576_10040477
2969 Ga0316576_10112338
2970 Ga0316578_10002012
2971 Ga0316578_10003078
2972 Ga0316578_10017612
2973 Ga0307405_10034091
2974 Ga0307405_10039590
2975 Ga0307405_10058979
2976 Ga0307405_10164076
2977 Ga0307405_10196397
2978 Ga0316577_10023806
2979 Ga0316577_10026975
2980 Ga0307413_10039726
2981 Ga0307413_10117076
2982 Ga0307518_10000445
2983 Ga0307518_10001456
2984 Ga0307410_10005711
2985 Ga0307410_10007860
2986 Ga0307410_10059763
2987 Ga0307410_10099559
2988 Ga0307410_10161920
2989 Ga0307410_10172421
2990 Ga0307406_10000520
2991 Ga0307406_10002180
2992 Ga0307406_10007260
2993 Ga0307406_10046164
2994 Ga0307406_10069841
2995 Ga0307406_10075032
2996 Ga0307406_10082055
2997 Ga0307406_10109972
2998 Ga0307407_10037797
2999 Ga0307407_10080214
3000 Ga0307412_10010775
3001 Ga0307412_10078687
3002 Ga0307412_10109312
3003 Ga0307409_100002130
3004 Ga0307409_100002984
3005 Ga0307409_100010167
3006 Ga0307409_100021286
3007 Ga0307409_100035071
3008 Ga0307409_100075439
3009 Ga0307409_100151170
3010 Ga0307409_100168606
3011 Ga0307416_100098400
3012 Ga0307416_100100882
3013 Ga0307416_100103395
3014 Ga0307416_100121442
3015 Ga0307416_100140122
3016 Ga0307416_100176682
3017 Ga0307416_100180815
3018 Ga0307416_100495966
3019 Ga0307414_10018011
3020 Ga0307414_10023359
3021 Ga0307414_10032644
3022 Ga0307414_10040079
3023 Ga0307414_10062940
3024 Ga0307414_10086547
3025 Ga0307414_10173992
3026 Ga0307411_10043938
3027 Ga0307411_10082429
3028 Ga0307415_100002009
3029 Ga0307415_100046464
3030 Ga0307415_100064299
3031 Ga0307415_100113327
3032 Ga0316583_10020853
3033 Ga0316585_10006425
3034 Ga0316585_10012405
3035 Ga0316585_10034867
3036 Ga0316580_10004313
3037 Ga0307507_10014085
3038 Ga0307507_10045062
3039 Ga0307507_10045348
3040 Ga0307510_10037636
3041 Ga0373926_0000004
3042 Ga0373926_0003287
3043 Ga0373926_0005331
3044 Ga0373934_0004066
3045 Ga0373934_0005307
3046 Ga0373944_0000024
3047 Ga0373944_0002808
3048 Ga0373923_0009922
3049 Ga0373936_0000240
3050 Ga0373936_0000251
3051 Ga0373936_0048159
3052 Ga0373939_0026080
3053 Ga0373945_0000140
3054 Ga0373953_0033415
3055 Ga0373954_0008715
3056 Ga0373956_0002606
3057 Ga0373956_0011366
3058 Ga0373957_0031735
3059 Ga0373943_0001314
3060 Ga0373943_0007804
3061 Ga0373946_0000089
3062 Ga0373946_0000252
3063 Ga0373946_0043766
3064 Ga0373955_0004750
3065 Ga0373955_0071397
3066 Ga0373955_0120938
3067 Ga0373942_0007025
3068 Ga0316574_0000415
3069 Ga0316574_0012915
3070 Ga0316574_0025924
3071 Ga0316574_0033681
3072 Ga0316574_0136805
3073 Ga0373924_0023755
3074 Ga0373924_0039200
3075 Ga0373931_0009909
3076 Ga0373931_0017982
3077 Ga0373935_0000586
3078 Ga0373935_0000834
3079 Ga0373935_0012962
3080 Ga0373935_0064795
3081 Ga0373927_0001993
3082 Ga0373927_0001996
3083 Ga0373927_0049873
3084 Ga0373933_0020579
3085 Ga0373933_0066690
3086 Ga0373947_0000007
3087 Ga0373947_0007154
3088 Ga0373947_0007697
3089 Ga0373937_0013695
3090 Ga0373937_0206334
3091 Ga0316582_0078006
3092 Ga0316584_0000383
3093 Ga0316584_0058602
3094 Ga0316584_0082555
3095 Ga0316584_0116975
3096 Ga0373925_0000004
3097 Ga0373925_0003736
3098 Ga0373925_0012813
3099 Ga0395899_0008790
3100 Ga0395899_0015761
3101 Ga0395899_0039667
3102 Ga0395899_0070232
3103 Ga0395899_0071152
3104 Ga0395899_0123009
3105 Ga0395900_0015052
3106 Ga0395900_0035372
3107 Ga0395900_0040502
3108 Ga0395900_0074598
3109 Ga0395900_0101893
3110 Ga0395900_0112660
3111 Ga0395900_0137294
3112 Ga0395900_0140005
3113 Ga0395900_0243208
3114 Ga0395898_0000381
3115 Ga0395898_0005576
3116 Ga0395898_0011069
3117 Ga0395898_0080616
3118 Ga0395898_0115294
3119 Ga0395905_0039073
3120 Ga0395905_0056411
3121 Ga0436364_0010700
3122 Ga0436364_0048623
3123 Ga0436364_1071680
3124 Ga0436364_1508399
3125 Ga0395901_0050485
3126 Ga0395901_0064601
3127 Ga0395901_0066733
3128 Ga0395901_0076931
3129 Ga0395901_0124894
3130 Ga0395901_0133959
3131 Ga0395901_0222281
3132 Ga0395901_0257884
3133 Ga0436365_1474856
3134 Ga0436365_1712156
3135 Ga0436360_0167640
3136 Ga0436361_0615022
3137 Ga0436362_0365102
3138 Ga0439438_012377
3139 Ga0439438_025400
3140 Ga0439461_0000541
3141 Ga0439461_0001042
3142 Ga0439461_0006688
3143 Ga0439461_0010106
3144 Ga0439466_0001530
3145 Ga0439466_0006330
3146 Ga0439466_0008648
3147 Ga0439466_0009136
3148 Ga0439465_0003293
3149 Ga0439465_0047901
3150 Ga0439431_0000277
3151 Ga0439431_0009936
3152 Ga0439431_0013210
3153 Ga0439431_0016012
3154 Ga0439433_0000286
3155 Ga0439433_0000832
3156 Ga0439442_001243
3157 Ga0439442_026371
3158 Ga0439445_0000717
3159 Ga0439448_0013319
3160 Ga0439449_0001566
3161 Ga0439449_0002451
3162 Ga0439449_0014860
3163 Ga0439451_004531
3164 Ga0439452_005887
3165 Ga0439454_002842
3166 Ga0439457_000878
3167 Ga0439457_002559
3168 Ga0439462_0017634
3169 Ga0450919_000123
3170 Ga0450920_006112
3171 Ga0439446_0008839
3172 Ga0450908_002157
3173 Ga0450909_001471
3174 Ga0439434_0001620
3175 Ga0439434_0002886
3176 Ga0439460_0003464
3177 Ga0450918_003166
3178 Ga0466969_0014150
3179 Ga0466969_0015497
3180 Ga0466972_0002008
3181 Ga0466972_0003353
3182 Ga0466972_0006242
3183 Ga0466972_0008483
3184 Ga0466972_0016501
3185 Ga0466972_0024952
3186 Ga0466972_0025150
3187 Ga0466972_0031016
3188 Ga0466972_0095998
3189 Ga0466965_0003901
3190 Ga0466965_0005424
3191 Ga0466965_0016410
3192 Ga0466965_0025571
3193 Ga0466965_0028877
3194 Ga0466965_0031824
3195 Ga0466965_0033743
3196 Ga0466965_0047425
3197 Ga0466965_0056670
3198 Ga0466965_0066948
3199 Ga0466965_0068084
3200 Ga0466966_0002623
3201 Ga0466966_0030855
3202 Ga0466966_0037815
3203 Ga0466966_0138687
3204 Ga0466961_0031408
3205 Ga0466961_0032806
3206 Ga0466961_0038494
3207 Ga0466961_0067481
3208 Ga0466961_0087585
3209 Ga0466961_0093599
3210 Ga0466961_0119605
3211 Ga0466961_0209194
3212 Ga0466963_0002223
3213 Ga0466963_0004617
3214 Ga0466963_0009504
3215 Ga0466963_0030660
3216 Ga0466963_0053339
3217 Ga0466963_0076175
3218 Ga0466963_0079949
3219 Ga0466963_0204422
3220 Ga0466963_0222462
3221 Ga0466964_0025463
3222 Ga0466964_0027290
3223 Ga0466964_0051855
3224 Ga0466964_0095766
3225 Ga0466971_0004615
3226 Ga0466971_0044965
3227 Ga0466971_0062121
3228 Ga0466968_0007642
3229 Ga0466968_0019763
3230 Ga0466968_0051487
3231 Ga0466970_0000093
3232 Ga0466970_0004325
3233 Ga0466970_0005681
3234 Ga0466970_0006545
3235 Ga0466970_0010125
3236 Ga0466970_0013655
3237 Ga0466970_0020060
3238 Ga0466970_0034709
3239 Ga0466970_0051568
3240 Ga0466970_0052244
3241 Ga0466970_0054498
3242 Ga0466970_0100357
3243 Ga0466957_0003409
3244 Ga0466957_0027743
3245 Ga0466957_0036044
3246 Ga0466957_0050466
3247 Ga0466957_0075158
3248 Ga0466957_0111467
3249 Ga0466960_0002117
3250 Ga0466960_0002276
3251 Ga0466960_0004115
3252 Ga0466960_0009803
3253 Ga0466960_0009870
3254 Ga0466960_0010324
3255 Ga0466960_0021256
3256 Ga0466960_0028067
3257 Ga0466960_0037032
3258 Ga0466959_0001664
3259 Ga0466959_0003675
3260 Ga0466959_0006267
3261 Ga0466959_0016450
3262 Ga0466959_0019389
3263 Ga0466959_0032967
3264 Ga0466959_0059074
3265 Ga0466959_0067718
3266 Ga0466958_0001497
3267 Ga0466958_0005259
3268 Ga0466958_0018627
3269 Ga0466958_0034064
3270 Ga0466958_0034141
3271 Ga0466958_0056887
3272 Ga0466958_0135562
3273 Ga0466967_0005159
3274 Ga0466967_0005915
3275 Ga0466967_0013641
3276 Ga0466967_0026874
3277 Ga0466967_0029449
3278 Ga0466967_0030435
3279 Ga0466967_0031939
3280 Ga0466967_0037879
3281 Ga0466967_0050474
3282 Ga0466967_0062509
3283 Ga0466967_0064440
3284 Ga0466967_0073397
3285 Ga0466967_0084129
3286 Ga0466967_0089613
3287 Ga0466967_0119981
3288 Ga0466967_0124268
3289 Ga0466967_0143959
3290 Ga0466967_0163864
3291 Ga0466967_0257291
3292 Ga0466967_0273131
3293 Ga0495627_001142
3294 Ga0495592_0038444
3295 Ga0495603_0000513
3296 Ga0495603_0005295
3297 Ga0495603_0008346
3298 Ga0495603_0051227
3299 Ga0495603_0096202
3300 Ga0495590_0000413
3301 Ga0495629_0007624
3302 Ga0495629_0021240
3303 Ga0495629_0022859
3304 Ga0495638_0014114
3305 Ga0495638_0029044
3306 Ga0495638_0078942
3307 Ga0495641_0006042
3308 Ga0495641_0022516
3309 Ga0495651_0017310
3310 Ga0495653_0060532
3311 Ga0495653_0073595
3312 Ga0495653_0103440
3313 Ga0495650_0000130
3314 Ga0495650_0084504
3315 Ga0495580_0016410
3316 Ga0495580_0021278
3317 Ga0495582_0000875
3318 Ga0495582_0019590
3319 Ga0495582_0050291
3320 Ga0495639_0004796
3321 Ga0495662_0000821
3322 Ga0495662_0018450
3323 Ga0495662_0076855
3324 Ga0495664_0001916
3325 Ga0495664_0004512
3326 Ga0495594_0003942
3327 Ga0495594_0003955
3328 Ga0495608_0028759
3329 Ga0495608_0044556
3330 Ga0495618_0007805
3331 Ga0495618_0073876
3332 Ga0495630_0001272
3333 Ga0495630_0009755
3334 Ga0495630_0137601
3335 Ga0495630_0196151
3336 Ga0495643_0077189
3337 Ga0495644_0013017
3338 Ga0495648_0002340
3339 Ga0495648_0014540
3340 Ga0495663_0021342
3341 Ga0495663_0045978
3342 Ga0495666_0000235
3343 Ga0495666_0041008
3344 Ga0495642_0048447
3345 Ga0495652_0013787
3346 Ga0495654_0057629
3347 Ga0495665_0000915
3348 Ga0495665_0008383
3349 Ga0495640_0001181
3350 Ga0495640_0029616
3351 Ga0495640_0076097
3352 Ga0495586_0000409
3353 Ga0495586_0011384
3354 Ga0495587_0018456
3355 Ga0495587_0036249
3356 Ga0495598_0032263
3357 Ga0495645_0063671
3358 Ga0495667_0000837
3359 Ga0495667_0006229
3360 Ga0495667_0031962
3361 Ga0495656_0071703
3362 Ga0495668_0000505
3363 Ga0495634_0003288
3364 Ga0495634_0046259
3365 Ga0495634_0051142
3366 Ga0495611_0028770
3367 Ga0495635_0000906
3368 Ga0495635_0001201
3369 Ga0495635_0006925
3370 Ga0495635_0055240
3371 Ga0495659_0008125
3372 Ga0495661_0054323
3373 Ga0495588_0000268
3374 Ga0495588_0010400
3375 Ga0495588_0011453
3376 Ga0495588_0017198
3377 Ga0495588_0027537
3378 Ga0495588_0129165
3379 Ga0495657_0013583
3380 Ga0495657_0015029
3381 Ga0495599_0007443
3382 Ga0495623_0063776
3383 Ga0495646_0037868
3384 Ga0495647_0047038
3385 Ga0495658_0000153
3386 Ga0495658_0018789
3387 Ga0495658_0049811
3388 Ga0495658_0064346
3389 Ga0495669_0047978
3390 Ga0495613_0001237
3391 Ga0495613_0038133
3392 Ga0495613_0077661
3393 Ga0495613_0230058
3394 Ga0495624_0000364
3395 Ga0495624_0002578
3396 Ga0495670_0044085
3397 Ga0495581_0000789
3398 Ga0495581_0045150
3399 Ga0495581_0053428
3400 Ga0495581_0078280
3401 Ga0495581_0079686
3402 Ga0495604_0034564
3403 Ga0495604_0088785
3404 Ga0495604_0131629
3405 Ga0495604_0178944
3406 Ga0495636_0013480
3407 Ga0495674_0000640
3408 Ga0495674_0009189
3409 Ga0495674_0034201
3410 Ga0495674_0043532
3411 Ga0495672_0002784
3412 Ga0495672_0011138
3413 Ga0495672_0086173
3414 Ga0495676_0015473
3415 Ga0495676_0019442
3416 Ga0495676_0019639
3417 Ga0495676_0098413
3418 Ga0495680_0004541
3419 Ga0495680_0012084
3420 Ga0495680_0110904
3421 Ga0495683_0001180
3422 Ga0495677_0042011
3423 Ga0495673_0045644
3424 Ga0495684_0008105
3425 Ga0495684_0034970
3426 Ga0495684_0049619
3427 Ga0495686_0008844
3428 Ga0495686_0058772
3429 Ga0495593_0003161
3430 Ga0495593_0109889
3431 Ga0495602_0054850
3432 Ga0495602_0131483
3433 Ga0495614_0000110
3434 Ga0495614_0000222
3435 Ga0495615_0018625
3436 Ga0496100_0000097
3437 Ga0496100_0001715
3438 Ga0496100_0002885
3439 Ga0496100_0007957
3440 Ga0496100_0021361
3441 Ga0496100_0182178
3442 Ga0496101_0000032
3443 Ga0496101_0000178
3444 Ga0496101_0002214
3445 Ga0496101_0002271
3446 Ga0496101_0015250
3447 Ga0496101_0016940
3448 Ga0496101_0019798
3449 Ga0496101_0022334
3450 Ga0496101_0033514
3451 Ga0496101_0071443
3452 Ga0496101_0127472
3453 Ga0496102_0000011
3454 Ga0496102_0000235
3455 Ga0496102_0000236
3456 Ga0496102_0002707
3457 Ga0496102_0004544
3458 Ga0496102_0007433
3459 Ga0496102_0024381
3460 Ga0496102_0028244
3461 Ga0496102_0042950
3462 Ga0496102_0057352
3463 Ga0496102_0067913
3464 Ga0496102_0071661
3465 Ga0496102_0077190
3466 Ga0496102_0079158
3467 Ga0496102_0107025
3468 Ga0496102_0129236
3469 Ga0496102_0131604
3470 Ga0496102_0268364
3471 Ga0496102_0300459
3472 Ga0496102_0346132
3473 Ga0496103_0000032
3474 Ga0496103_0000185
3475 Ga0496103_0000460
3476 Ga0496103_0000624
3477 Ga0496103_0001651
3478 Ga0496103_0007239
3479 Ga0496103_0008384
3480 Ga0496103_0071566
3481 Ga0496103_0071855
3482 Ga0496103_0102378
3483 Ga0496103_0146301
3484 Ga0496103_0158986
3485 Ga0496104_0003431
3486 Ga0496104_0004891
3487 Ga0496104_0031350
3488 Ga0496104_0068187
3489 Ga0496104_0072889
3490 Ga0496104_0075539
3491 Ga0496104_0089024
3492 Ga0496104_0092303
3493 Ga0496104_0135208
3494 Ga0496104_0140953
3495 Ga0496104_0170360
3496 Ga0496104_0434350
3497 Ga0496105_0004208
3498 Ga0496105_0004455
3499 Ga0496105_0009001
3500 Ga0496105_0014439
3501 Ga0496105_0018442
3502 Ga0496105_0020815
3503 Ga0496105_0036703
3504 Ga0496105_0105827
3505 Ga0496105_0157242
3506 Ga0496105_0227897
3507 Ga0496105_0233856
3508 Ga0496106_0000417
3509 Ga0496106_0000768
3510 Ga0496106_0039704
3511 Ga0496106_0054231
3512 Ga0496106_0072794
3513 Ga0496106_0077479
3514 Ga0496106_0115837
3515 Ga0496106_0120446
3516 Ga0496106_0160339
3517 Ga0496106_0202541
3518 Ga0496106_0305993
3519 Ga0496107_0001611
3520 Ga0496107_0002827
3521 Ga0496107_0022212
3522 Ga0496107_0027443
3523 Ga0496107_0030297
3524 Ga0496107_0114477
3525 Ga0496108_0001698
3526 Ga0496108_0015334
3527 Ga0496108_0020224
3528 Ga0496108_0026361
3529 Ga0496108_0039938
3530 Ga0496108_0043103
3531 Ga0496108_0064850
3532 Ga0496108_0075778
3533 Ga0496108_0088604
3534 Ga0496108_0113673
3535 Ga0496108_0313142
3536 Ga0496108_0362172
3537 Ga0496109_0000305
3538 Ga0496109_0005372
3539 Ga0496109_0011265
3540 Ga0496109_0013718
3541 Ga0496109_0014775
3542 Ga0496109_0023643
3543 Ga0496109_0041162
3544 Ga0496109_0045826
3545 Ga0496109_0071036
3546 Ga0496109_0091869
3547 Ga0496109_0221244
3548 Ga0496109_0226132
3549 Ga0496110_0002915
3550 Ga0496110_0006568
3551 Ga0496110_0023163
3552 Ga0496110_0023479
3553 Ga0496110_0049961
3554 Ga0496110_0068720
3555 Ga0496110_0112705
3556 Ga0496110_0112870
3557 Ga0496110_0113775
3558 Ga0496110_0134866
3559 Ga0496110_0185899
3560 Ga0496111_0005153
3561 Ga0496111_0016859
3562 Ga0496111_0047481
3563 Ga0496111_0063129
3564 Ga0496111_0090424
3565 Ga0496111_0160860
3566 Ga0496111_0186655
3567 Ga0496112_0013235
3568 Ga0496112_0038767
3569 Ga0496112_0063842
3570 Ga0496112_0070088
3571 Ga0496112_0099862
3572 Ga0496112_0113579
3573 Ga0496112_0320244
3574 Ga0496113_0004384
3575 Ga0496113_0032886
3576 Ga0496113_0048809
3577 Ga0496113_0117004
3578 Ga0496113_0145554
3579 Ga0496113_0160149
3580 Ga0496113_0161097
3581 Ga0496113_0176928
3582 Ga0496113_0242173
3583 Ga0496113_0293049
3584 Ga0496114_0000856
3585 Ga0496114_0002897
3586 Ga0496114_0003794
3587 Ga0496114_0004945
3588 Ga0496114_0005170
3589 Ga0496114_0008988
3590 Ga0496114_0010173
3591 Ga0496114_0010762
3592 Ga0496114_0024643
3593 Ga0496114_0026758
3594 Ga0496114_0159077
3595 Ga0496114_0207769
3596 Ga0496114_0266356
3597 Ga0496114_0296868
3598 Ga0496115_0008488
3599 Ga0496115_0011413
3600 Ga0496115_0012370
3601 Ga0496115_0014232
3602 Ga0496115_0024138
3603 Ga0496115_0025689
3604 Ga0496115_0030427
3605 Ga0496115_0107161
3606 Ga0496115_0109880
3607 Ga0496116_0000072
3608 Ga0496116_0000192
3609 Ga0496116_0000340
3610 Ga0496116_0004507
3611 Ga0496116_0006124
3612 Ga0496116_0040697
3613 Ga0496116_0044629
3614 Ga0496116_0077370
3615 Ga0496117_0000039
3616 Ga0496117_0000273
3617 Ga0496117_0000387
3618 Ga0496117_0000603
3619 Ga0496117_0001092
3620 Ga0496117_0001118
3621 Ga0496117_0003783
3622 Ga0496117_0011201
3623 Ga0496117_0026526
3624 Ga0496117_0029438
3625 Ga0496117_0082135
3626 Ga0496117_0104653
3627 Ga0496118_0000035
3628 Ga0496118_0000096
3629 Ga0496118_0000455
3630 Ga0496118_0000610
3631 Ga0496118_0005126
3632 Ga0496118_0006081
3633 Ga0496118_0012779
3634 Ga0496118_0013007
3635 Ga0496118_0042972
3636 Ga0496118_0056178
3637 Ga0496118_0089622
3638 Ga0496119_0000035
3639 Ga0496119_0000340
3640 Ga0496119_0000437
3641 Ga0496119_0000617
3642 Ga0496119_0002053
3643 Ga0496119_0006039
3644 Ga0496119_0007359
3645 Ga0496119_0009886
3646 Ga0496119_0013009
3647 Ga0496119_0014900
3648 Ga0496119_0015958
3649 Ga0496119_0032105
3650 Ga0496119_0032848
3651 Ga0496119_0037248
3652 Ga0496119_0050977
3653 Ga0496119_0085588
3654 Ga0496120_0000079
3655 Ga0496120_0000372
3656 Ga0496120_0001715
3657 Ga0496120_0002620
3658 Ga0496120_0008527
3659 Ga0496120_0011616
3660 Ga0496120_0019430
3661 Ga0496120_0095399
3662 Ga0496121_0000004
3663 Ga0496121_0000015
3664 Ga0496121_0000546
3665 Ga0496121_0002237
3666 Ga0496121_0004937
3667 Ga0496121_0013057
3668 Ga0496121_0022488
3669 Ga0496121_0037750
3670 Ga0496121_0066703
3671 Ga0496122_0000020
3672 Ga0496122_0000795
3673 Ga0496122_0001425
3674 Ga0496122_0004303
3675 Ga0496122_0015517
3676 Ga0496122_0016794
3677 Ga0496122_0017673
3678 Ga0496122_0028074
3679 Ga0496122_0045039
3680 Ga0496122_0105451
3681 Ga0496122_0143312
3682 Ga0496123_0000003
3683 Ga0496123_0000951
3684 Ga0496123_0007387
3685 Ga0496123_0011837
3686 Ga0496123_0015631
3687 Ga0496123_0022138
3688 Ga0496123_0025167
3689 Ga0496124_0000012
3690 Ga0496124_0000135
3691 Ga0496124_0002749
3692 Ga0496124_0008894
3693 Ga0496124_0009299
3694 Ga0496124_0035580
3695 Ga0496124_0043473
3696 Ga0496124_0090835
3697 Ga0496124_0107082
3698 Ga0496124_0144633
3699 Ga0496125_0000003
3700 Ga0496125_0000128
3701 Ga0496125_0000209
3702 Ga0496125_0000859
3703 Ga0496125_0002332
3704 Ga0496125_0002425
3705 Ga0496125_0016465
3706 Ga0496125_0024752
3707 Ga0496125_0034370
3708 Ga0496125_0055163
3709 Ga0496125_0058704
3710 Ga0496125_0061796
3711 Ga0496125_0103900
3712 Ga0496126_0000001
3713 Ga0496126_0000123
3714 Ga0496126_0000246
3715 Ga0496126_0000547
3716 Ga0496126_0004322
3717 Ga0496126_0005415
3718 Ga0496126_0005422
3719 Ga0496126_0006761
3720 Ga0496126_0009000
3721 Ga0496126_0033062
3722 Ga0496126_0033726
3723 Ga0496126_0035255
3724 Ga0496126_0035799
3725 Ga0496126_0058035
3726 Ga0496126_0061064
3727 Ga0496126_0068695
3728 Ga0496126_0084657
3729 Ga0496126_0088878
3730 Ga0496126_0090950
3731 Ga0496126_0098562
3732 Ga0496126_0121614
3733 Ga0496126_0246344
3734 Ga0501309_003333
3735 Ga0501305_008308
3736 Ga0501307_005589
3737 Ga0501311_006846
3738 Ga0501312_001617
3739 Ga0501313_005060
3740 Ga0501315_005844
3741 Ga0501315_006619
3742 Ga0501316_000498
3743 Ga0501318_005390
3744 Ga0501321_003486
3745 Ga0501321_004061
3746 Ga0501323_004697
3747 Ga0501324_002466
3748 Ga0501325_001168
3749 Ga0501335_000889
3750 Ga0501031_0000870
3751 Ga0501031_0007030
3752 Ga0501031_0010393
3753 Ga0501031_0012245
3754 Ga0501031_0045672
3755 Ga0501031_0089772
3756 Ga0501031_0090382
3757 Ga0501032_0001154
3758 Ga0501032_0001277
3759 Ga0501032_0002711
3760 Ga0501032_0008178
3761 Ga0501032_0033588
3762 Ga0501032_0071221
3763 Ga0501032_0102712
3764 Ga0501033_0003100
3765 Ga0501033_0007412
3766 Ga0501033_0044237
3767 Ga0501033_0060294
3768 Ga0501033_0060590
3769 Ga0501033_0070028
3770 Ga0501034_0000112
3771 Ga0501034_0000672
3772 Ga0501034_0008588
3773 Ga0501034_0013440
3774 Ga0501034_0017156
3775 Ga0501034_0023234
3776 Ga0501034_0025497
3777 Ga0501034_0034048
3778 Ga0501034_0046877
3779 Ga0501034_0076870
3780 Ga0501034_0114513
3781 Ga0501034_0142301
3782 Ga0501036_0002900
3783 Ga0501036_0004295
3784 Ga0501036_0013420
3785 Ga0501036_0016775
3786 Ga0501036_0325757
3787 Ga0501037_0000110
3788 Ga0501037_0004426
3789 Ga0501037_0006221
3790 Ga0501037_0010166
3791 Ga0501037_0012462
3792 Ga0501037_0056202
3793 Ga0501037_0082702
3794 Ga0501037_0176832
3795 Ga0501038_0003260
3796 Ga0501038_0010528
3797 Ga0501038_0014550
3798 Ga0501038_0024701
3799 Ga0501038_0032164
3800 Ga0501038_0051802
3801 Ga0501038_0190298
3802 Ga0501039_0000736
3803 Ga0501039_0000850
3804 Ga0501039_0001189
3805 Ga0501039_0009621
3806 Ga0501039_0016611
3807 Ga0501039_0026165
3808 Ga0501039_0047333
3809 Ga0501039_0053386
3810 Ga0501040_0000341
3811 Ga0501040_0000580
3812 Ga0501040_0003562
3813 Ga0501040_0006598
3814 Ga0501041_0000246
3815 Ga0501041_0009959
3816 Ga0501041_0030224
3817 Ga0501041_0071012
3818 Ga0501041_0087092
3819 Ga0501042_0000686
3820 Ga0501042_0005870
3821 Ga0501042_0006117
3822 Ga0501042_0015173
3823 Ga0501042_0021443
3824 Ga0501042_0092887
3825 Ga0501043_0001848
3826 Ga0501043_0013658
3827 Ga0501043_0017486
3828 Ga0501043_0028591
3829 Ga0501043_0071980
3830 Ga0501043_0112879
3831 Ga0501043_0156350
3832 Ga0501043_0192190
3833 Ga0501043_0218664
3834 Ga0501046_0002303
3835 Ga0501046_0003132
3836 Ga0501046_0006458
3837 Ga0501046_0016573
3838 Ga0501046_0068395
3839 Ga0501047_0000033
3840 Ga0501047_0000405
3841 Ga0501047_0001186
3842 Ga0501047_0004112
3843 Ga0501047_0011253
3844 Ga0501047_0030469
3845 Ga0501047_0038344
3846 Ga0501047_0058872
3847 Ga0501047_0077238
3848 Ga0501047_0229502
3849 Ga0501047_0274480
3850 Ga0501048_0000216
3851 Ga0501048_0001561
3852 Ga0501048_0004301
3853 Ga0501048_0006150
3854 Ga0501048_0006447
3855 Ga0501048_0016662
3856 Ga0501067_0000725
3857 Ga0501067_0078387
3858 Ga0501068_0081071
3859 Ga0501069_0028354
3860 Ga0501069_0062124
3861 Ga0501069_0080869
3862 Ga0501069_0099180
3863 Ga0501070_0000165
3864 Ga0501070_0000181
3865 Ga0501070_0002694
3866 Ga0501070_0004105
3867 Ga0501070_0005678
3868 Ga0501070_0010602
3869 Ga0501070_0015185
3870 Ga0501070_0028759
3871 Ga0501070_0033327
3872 Ga0501070_0049412
3873 Ga0501070_0066146
3874 Ga0501070_0095561
3875 Ga0501070_0147320
3876 Ga0501071_0000275
3877 Ga0501071_0000327
3878 Ga0501071_0001195
3879 Ga0501071_0015881
3880 Ga0501071_0044267
3881 Ga0501071_0063337
3882 Ga0501071_0123285
3883 Ga0501072_0000093
3884 Ga0501072_0007441
3885 Ga0501072_0063803
3886 Ga0501073_0000030
3887 Ga0501073_0004926
3888 Ga0501073_0019857
3889 Ga0501073_0072187
3890 Ga0501074_0010064
3891 Ga0501074_0025535
3892 Ga0501074_0025561
3893 Ga0501074_0034463
3894 Ga0501075_0001636
3895 Ga0501075_0009734
3896 Ga0501075_0045189
3897 Ga0501075_0065901
3898 Ga0501076_0000260
3899 Ga0501076_0000392
3900 Ga0501076_0013969
3901 Ga0501076_0048562
3902 Ga0501076_0075672
3903 Ga0501077_0000085
3904 Ga0501077_0009209
3905 Ga0501077_0110649
3906 Ga0501243_007284
3907 Ga0501079_0000790
3908 Ga0501079_0001021
3909 Ga0501079_0074759
3910 Ga0501080_0000023
3911 Ga0501080_0005898
3912 Ga0501080_0020356
3913 Ga0501080_0057567
3914 Ga0501080_0119618
3915 Ga0501080_0203250
3916 Ga0501081_0001553
3917 Ga0501081_0015758
3918 Ga0501081_0023093
3919 Ga0501081_0029959
3920 Ga0501081_0041679
3921 Ga0501081_0183740
3922 Ga0501083_0000059
3923 Ga0501083_0027619
3924 Ga0501083_0124905
3925 Ga0501035_0000283
3926 Ga0501035_0005074
3927 Ga0501035_0030333
3928 Ga0501035_0038995
3929 Ga0501035_0042452
3930 Ga0501035_0054167
3931 Ga0501035_0063799
3932 Ga0501035_0173821
3933 Ga0501044_0004205
3934 Ga0501044_0005678
3935 Ga0501044_0011532
3936 Ga0501044_0017369
3937 Ga0501044_0076371
3938 Ga0501044_0151656
3939 Ga0501044_0205585
3940 Ga0501045_0000549
3941 Ga0501045_0000716
3942 Ga0501045_0001190
3943 Ga0501045_0001314
3944 Ga0501045_0003432
3945 Ga0501045_0110489
3946 nmdc:mga03n38_15428_c1
3947 nmdc:mga03n38_32338_c1
3948 nmdc:mga03n38_70302_c1
3949 nmdc:mga00v17_11230_c1
3950 nmdc:mga00v17_177516_c1
3951 nmdc:mga00v17_200666_c1
3952 nmdc:mga00v17_23683_c1
3953 nmdc:mga00v17_26072_c1
3954 nmdc:mga00v17_50444_c1
3955 nmdc:mga00v17_51330_c1
3956 nmdc:mga00v17_56777_c1
3957 nmdc:mga00v17_6346_c1
3958 nmdc:mga00v17_70360_c1
3959 nmdc:mga00v17_7056_c1
3960 nmdc:mga00v17_7209_c1
3961 nmdc:mga0yw44_100736_c1
3962 nmdc:mga0yw44_103064_c1
3963 nmdc:mga0yw44_10630_c1
3964 nmdc:mga0yw44_12125_c1
3965 nmdc:mga0yw44_13350_c1
3966 nmdc:mga0yw44_229144_c1
3967 nmdc:mga0yw44_27067_c1
3968 nmdc:mga0yw44_58784_c1
3969 nmdc:mga06z11_145195_c1
3970 nmdc:mga07m45_1183_c1
3971 nmdc:mga07m45_14273_c1
3972 nmdc:mga07m45_62313_c1
3973 nmdc:mga07m45_68468_c1
3974 nmdc:mga05p37_130627_c1
3975 nmdc:mga05p37_147133_c1
3976 nmdc:mga05p37_59368_c1
3977 nmdc:mga0qj67_16520_c1
3978 nmdc:mga0qj67_199461_c1
3979 nmdc:mga0qj67_314_c1
3980 nmdc:mga0qj67_55011_c1
3981 nmdc:mga06r32_66862_c1
3982 nmdc:mga06r32_83948_c1
3983 nmdc:mga08y16_124196_c1
3984 nmdc:mga08y16_407028_c1
3985 nmdc:mga0n895_280587_c1
3986 nmdc:mga0n895_58260_c1
3987 nmdc:mga0rr50_116155_c1
3988 nmdc:mga0rr50_54532_c1
3989 nmdc:mga0a205_30295_c1
3990 nmdc:mga0a205_3708_c1
3991 nmdc:mga0a205_50884_c1
3992 nmdc:mga0sz30_1040_c1
3993 nmdc:mga0sz30_1824_c2
3994 nmdc:mga0sz30_30283_c1
3995 nmdc:mga0sz30_34239_c1
3996 nmdc:mga0sz30_50583_c1
3997 Ga0495601_0032272
3998 Ga0500610_0003294
3999 Ga0500635_0000091
4000 Ga0500635_0018314
4001 Ga0495655_0001696
4002 Ga0495619_0000621
4003 Ga0495619_0022031
4004 Ga0495619_0036805
4005 Ga0495619_0072197
4006 Ga0495619_0152235
4007 Ga0495619_0169713
4008 Ga0500643_000086
4009 Ga0500643_001082
4010 Ga0500643_001466
4011 Ga0500646_0019346
4012 Ga0500651_0022307
4013 Ga0500641_0000526
4014 Ga0500556_0000115
4015 Ga0500556_0000496
4016 Ga0500556_0000626
4017 Ga0500562_010403
4018 Ga0500593_000731
4019 Ga0500642_0036336
4020 Ga0500652_000545
4021 Ga0500559_0001016
4022 Ga0500559_0001057
4023 Ga0500559_0009421
4024 Ga0500559_0024306
4025 Ga0500568_0000038
4026 Ga0500568_0000117
4027 Ga0500568_0001800
4028 Ga0500568_0004560
4029 Ga0500568_0017055
4030 Ga0500568_0040363
4031 Ga0500573_0000014
4032 Ga0500573_0000476
4033 Ga0500573_0015888
4034 Ga0500573_0018692
4035 Ga0500573_0018791
4036 Ga0500573_0029841
4037 Ga0500573_0039403
4038 Ga0500577_0001332
4039 Ga0500590_006984
4040 Ga0500600_0055938
4041 Ga0500616_0000027
4042 Ga0500616_0000115
4043 Ga0500616_0000117
4044 Ga0500616_0001308
4045 Ga0500616_0001664
4046 Ga0500616_0002288
4047 Ga0500620_000082
4048 Ga0500645_013215
4049 Ga0501084_0003669
4050 Ga0501084_0006148
4051 Ga0501084_0056074
4052 Ga0501084_0144759
4053 Ga0587084_001354
4054 Ga0587066_011832
4055 Ga0587077_002512
4056 Ga0587083_0013367
4057 Ga0587083_0019955
4058 Ga0587086_005976
4059 Ga0587090_000423
4060 Ga0587101_001172
4061 Ga0587128_008890
4062 Ga0501082_0004627
4063 Ga0501082_0009908
4064 Ga0501082_0208433
4065 Ga0466962_0003043
4066 Ga0466962_0039612
4067 Ga0466962_0058962
4068 Ga0466962_0074207
4069 Ga0466962_0077614
4070 Ga0530510_0000536
4071 Ga0530510_0001061
4072 Ga0530510_0017997
4073 Ga0530510_0046250
4074 Ga0530510_0122356
4075 Ga0530510_0151936
4076 2517762602
4077 2523386351
4078 2537898934
4079 2548699060
4080 2552110737
4081 2555229498
4082 2558909522
4083 2559428860
4084 2559430722
4085 2566992174
4086 2579853624
4087 2583149102
4088 2585298246
4089 2586060711
4090 2586064425
4091 2587863728
4092 2588106890
4093 2619853695
4094 2620349911
4095 2623497579
4096 2626636076
4097 2643734893
4098 2643753811
4099 2643768551
4100 2643783497
4101 2643847960
4102 2643876373
4103 2643888300
4104 2643994948
4105 2644082281
4106 2644096481
4107 2644111922
4108 2644173053
4109 2644182487
4110 2644197913
4111 2644277717
4112 2644383428
4113 2644445424
4114 2644490564
4115 2644502984
4116 2644513962
4117 2644525319
4118 2644538694
4119 2644610849
4120 2644637035
4121 2644664619
4122 2644669404
4123 2644679263
4124 2645720691
4125 2645723710
4126 2655031519
4127 2671835671
4128 2676199411
4129 2686539208
4130 2689960348
4131 2691512796
4132 2723641230
4133 2729907946
4134 2730228766
4135 2738668278
4136 2738693653
4137 2738707253
4138 2738888363
4139 2739147348
4140 2739204214
4141 2739240181
4142 2739322934
4143 2739328568
4144 2739604004
4145 2739607519
4146 2747952356
4147 2753070050
4148 2753303609
4149 2758224592
4150 2760304582
4151 2760621607
4152 2774378720
4153 2774383464
4154 2774394494
4155 2774400469
4156 2774843989
4157 2774853827
4158 2775658485
4159 2776373997
4160 2784472887
4161 2793982994
4162 2795795224
4163 2799184891
4164 2808628640
4165 2808830074
4166 2808851250
4167 2808875416
4168 2808876225
4169 2808884855
4170 2808894329
4171 2808897727
4172 2808901109
4173 2809026401
4174 2809194652
4175 2809226661
4176 2809586347
4177 2812318150
4178 2812322228
4179 2812349393
4180 2812375735
4181 2816424357
4182 2816505484
4183 2817509736
4184 2819424625
4185 2819666956
4186 2819690324
4187 2819728426
4188 2821269177
4189 2833710070
4190 2835191786
4191 2837270575
4192 2839986502
4193 2842140523
4194 2842891200
4195 2844843306
4196 2844851758
4197 2844854384
4198 2848551739
4199 2852632870
4200 2852644411
4201 2852646560
4202 2852665798
4203 2852678639
4204 2857479980
4205 2857633458
4206 2857711204
4207 2857722722
4208 2857724698
4209 2857728526
4210 2857730601
4211 2857734473
4212 2857739122
4213 2857740823
4214 2862993548
4215 2863070407
4216 2866555467
4217 2866616957
4218 2870622255
4219 2870629554
4220 2870727454
4221 2870730025
4222 2870788726
4223 2870803304
4224 2870805347
4225 2884766320
4226 2887447174
4227 2889303335
4228 2891331401
4229 2891972895
4230 2893686283
4231 2895428178
4232 2895660548
4233 2895884540
4234 2897562487
4235 2899364506
4236 2899376590
4237 2902797594
4238 2902799884
4239 2902814809
4240 2902843209
4241 2904432473
4242 2904501566
4243 2904501743
4244 2904510218
4245 2904538004
4246 2904778211
4247 2905928636
4248 2906801599
4249 2908676203
4250 2908678567
4251 2909077083
4252 2915364120
4253 2915774800
4254 2917736598
4255 2917737727
4256 2919035583
4257 2919041778
4258 2919043276
4259 2919054919
4260 2919058787
4261 2919060242
4262 2919070918
4263 2919395364
4264 2919398565
4265 2919445625
4266 2919525365
4267 2919539208
4268 2919717016
4269 2920883347
4270 2922557187
4271 2928091018
4272 2928105561
4273 2928121405
4274 2928145111
4275 2928153444
4276 2928500921
4277 2929217564
4278 2932400412
4279 2932427797
4280 2932432301
4281 2933418630
4282 2935410642
4283 2935894132
4284 2939584798
4285 2939599380
4286 2939650244
4287 2939659378
4288 2939662805
4289 2939677662
4290 2939748528
4291 2945920248
4292 2945923894
4293 2945944447
4294 2945957365
4295 2945970918
4296 2946003385
4297 2946024821
4298 2946034661
4299 2946040362
4300 2946043242
4301 2946063965
4302 2946081770
4303 2954001630
4304 2956941536
4305 2964328541
4306 2966922640
4307 2966926610
4308 2974298238
4309 2974303796
4310 2974325532
4311 2977230464
4312 2977239265
4313 2977252038
4314 2977265706
4315 2984542951
4316 2984551898
4317 2984579777
4318 2984582226
4319 2984593946
4320 2995728415
4321 3001892118
4322 8002791552
4323 8002811627
4324 8003321489
4325 8003323191
4326 8004022465
4327 8004026910
4328 8004183613
4329 8004213430
4330 8016254894
4331 8033684397
4332 8045832455
4333 8047717666
4334 8047719528
4335 8047895175
4336 8048136500
4337 8048363777
4338 8048372201
4339 8048381135
4340 8054109686
4341 8054475852
4342 8054613903
4343 8054917141
4344 8054925340
4345 8055035359
4346 8055038950
4347 8055160668
4348 8055177139
4349 8056039320
4350 8056208492
4351 8056583315
4352 8057347470

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08442

ATP-grasp_2

ATP-grasp domain

63

256

0.99

PF00549

Ligase_CoA

CoA-ligase

315

446

0.91

PF13549

ATP-grasp_5

ATP-grasp domain

61

271

0.84

PF02786

CPSase_L_D2

Carbamoyl-phosphate synthase L chain, ATP binding domain

66

188

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ufx-assembly5.cif.gz_G thermus aquaticus succinyl-coa synthetase in complex with gdp-mn2+ 0.9031 1 370
6no6-assembly1.cif.gz_B k46be&k114bd mutant atp-grasp fold of blastocystis hominis succinyl-coa synthetase 0.9017 1 205
3ufx-assembly1.cif.gz_B thermus aquaticus succinyl-coa synthetase in complex with gdp-mn2+ 0.8975 1 370
3ufx-assembly5.cif.gz_G thermus aquaticus succinyl-coa synthetase in complex with gdp-mn2+ 0.8962 1 370
6no5-assembly2.cif.gz_D adp bound to k46be&k114bd mutant atp-grasp fold of blastocystis hominis succinyl-coa synthetase 0.8932 1 205
ID Description Score Start End Superfamily
3ufxE01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9501 1 225 3.30.470.20
3ufxE01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9442 1 225 3.30.470.20
3ufxB02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.9411 21 90 3.30.1490.20
1jkjB01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9383 1 225 3.30.470.20
1jkjB01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9326 1 225 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A6J6TU45-F1-model_v4 Unannotated protein 0.98 237 376 GO:0000166
GO:0004775
GO:0005829
GO:0006099
GO:0006104
GO:0042709
AF-A0A1I5CT77-F1-model_v4 Succinyl-CoA synthetase beta subunit 0.979 1 222 GO:0004775
GO:0005524
GO:0005829
GO:0006099
GO:0006104
GO:0042709
GO:0046872
AF-A0A6B3E9J2-F1-model_v4 Succinate--CoA ligase subunit beta 0.9737 75 185 GO:0004775
GO:0005524
GO:0005829
GO:0006099
GO:0006104
GO:0042709
AF-A0A6B3E9J2-F1-model_v4 Succinate--CoA ligase subunit beta 0.9652 75 185 GO:0004775
GO:0005524
GO:0005829
GO:0006099
GO:0006104
GO:0042709
AF-A0A3C1L3G6-F1-model_v4 Succinate--CoA ligase subunit beta 0.9593 1 210 GO:0004775
GO:0005524
GO:0005829
GO:0006099
GO:0006104
GO:0042709
GO:0046872

Map