F496502

General Info

Members Datasets Scaffolds Average Seq Length
2170 1463 1194 361

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2840764183|2840769232
Length 439
Sequence VREFWPVRWILLKYFLVISNDSMATPPLSLHVLDLDKRVCMVIPEIGRPGHNCPVIWAEELSSIVFGGELMDRRSFITKAGFAGVGAAAAATTLAAPAIAQSLPKVTWRCASSFPKSLDTIYGGAEVLSKYLKEATDGNFTIQPFAAGEIVPGLQAADATAAGTVELCHTVAYYYWGKDPTWALGAAVPFALNARGMNAWQYHGGGIDLMNEFFNKQGLQAYPGGNTGVQMGGWFRKEIKTVDDLKGLKMRVGGFAGKVLEKLGVVPQQIAGGDIYPSLEKGTIDAAEWVGPYDDEKLGFQKVAPFYYYPGWWEGGPTVSFMVNKEKWDSLPPAYQSLFRTAAQATDADMLQKYDSLNPAAIKRLVAGGAQLRPFSPEILNACFEAANGVYAEMEANNPAFKKIWESIKAFRNEHFLYAQVAEYSFDTFMMIQQRNGKL

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
6 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
7 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
8 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
9 2509276019 Ensifer aridi TW10 Isolate Nodule
10 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
11 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
12 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
13 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
14 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
15 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
16 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
17 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
18 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
19 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
20 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
21 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
22 2512875024 Mesorhizobium loti R88b Isolate Nodule
23 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
24 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
25 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
26 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
27 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
28 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
29 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
30 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
31 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
32 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
33 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
34 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
35 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
36 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
37 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
38 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
39 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
40 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
41 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
42 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
43 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
44 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
45 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
46 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
47 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
48 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
49 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
50 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
51 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
52 2516143018 Ensifer sp. BR816 Isolate Nodule
53 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
54 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
55 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
56 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
57 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
58 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
59 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
60 2519899620 Rhizobium sp. Pop5 Isolate Nodule
61 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
62 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
63 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
64 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
65 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
66 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
67 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
68 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
69 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
70 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
71 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
72 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
73 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
74 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
75 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
76 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
77 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
78 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
79 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
80 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
81 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
82 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
83 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
84 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
85 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
86 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
87 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
88 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
89 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
90 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
91 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
92 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
93 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
94 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
95 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
96 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
97 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
98 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
99 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
100 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
101 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
102 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
103 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
104 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
105 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
106 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
107 2643221557 Ensifer sp. Root558 Isolate Unclassified
108 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
109 2643221568 Rhizobium sp. Root564 Isolate Unclassified
110 2643221582 Rhizobium sp. Root651 Isolate Unclassified
111 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
112 2643221607 Rhizobium sp. Root73 Isolate Unclassified
113 2643221610 Ensifer sp. Root74 Isolate Unclassified
114 2643221618 Ensifer sp. Root231 Isolate Unclassified
115 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
116 2643221626 Ensifer sp. Root31 Isolate Unclassified
117 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
118 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
119 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
120 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
121 2643221655 Ensifer sp. Root1252 Isolate Unclassified
122 2643221659 Ensifer sp. Root127 Isolate Unclassified
123 2643221668 Ensifer sp. Root423 Isolate Unclassified
124 2643221675 Ensifer sp. Root1298 Isolate Unclassified
125 2643221680 Ensifer sp. Root1312 Isolate Unclassified
126 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
127 2643221688 Rhizobium sp. Root482 Isolate Unclassified
128 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
129 2643221693 Rhizobium sp. Root491 Isolate Unclassified
130 2643221698 Ensifer sp. Root142 Isolate Unclassified
131 2643221712 Ensifer sp. Root258 Isolate Unclassified
132 2643221718 Rhizobium sp. Root268 Isolate Unclassified
133 2643221719 Rhizobium sp. Root274 Isolate Unclassified
134 2643221723 Ensifer sp. Root278 Isolate Unclassified
135 2643221726 Ensifer sp. Root954 Isolate Unclassified
136 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
137 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
138 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
139 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
140 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
141 2718217927 Rhizobium sp. N324 Isolate Nodule
142 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
143 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
144 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
145 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
146 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
147 2718218423 Rhizobium sp. N941 Isolate Nodule
148 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
149 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
150 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
151 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
152 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
153 2721755809 Rhizobium sp. N541 Isolate Nodule
154 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
155 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
156 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
157 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
158 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
159 2738541293 Rhizobium sp. GV031 Isolate Unclassified
160 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
161 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
162 2738543024 Aminobacter sp. AP02 Isolate Unclassified
163 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
164 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
165 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
166 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
167 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
168 2773857925 Microvirga vignae BR3299 Isolate Unclassified
169 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
170 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
171 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
172 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
173 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
174 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
175 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
176 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
177 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
178 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
179 2791355256 Rhizobium sp. M10 Isolate Nodule
180 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
181 2791355261 Rhizobium sp. J15 Isolate Nodule
182 2791355262 Rhizobium sp. M1 Isolate Nodule
183 2791355265 Rhizobium sp. H4 Isolate Nodule
184 2791355266 Rhizobium sp. L43 Isolate Nodule
185 2791355267 Rhizobium sp. L18 Isolate Nodule
186 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
187 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
188 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
189 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
190 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
191 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
192 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
193 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
194 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
195 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
196 2802429633 Rhizobium anhuiense J3 Isolate Nodule
197 2802429634 Rhizobium anhuiense S10 Isolate Nodule
198 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
199 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
200 2802429637 Rhizobium anhuiense C15 Isolate Nodule
201 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
202 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
203 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
204 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
205 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
206 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
207 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
208 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
209 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
210 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
211 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
212 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
213 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
214 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
215 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
216 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
217 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
218 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
219 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
220 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
221 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
222 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
223 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
224 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
225 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
226 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
227 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
228 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
229 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
230 2838048938 Rhizobium pisi 27/80 Isolate Nodule
231 2838061910 Rhizobium phaseoli L15 Isolate Nodule
232 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
233 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
234 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
235 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
236 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
237 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
238 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
239 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
240 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
241 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
242 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
243 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
244 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
245 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
246 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
247 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
248 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
249 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
250 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
251 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
252 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
253 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
254 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
255 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
256 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
257 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
258 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
259 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
260 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
261 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
262 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
263 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
264 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
265 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
266 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
267 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
268 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
269 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
270 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
271 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
272 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
273 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
274 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
275 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
276 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
277 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
278 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
279 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
280 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
281 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
282 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
283 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
284 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
285 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
286 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
287 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
288 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
289 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
290 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
291 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
292 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
293 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
294 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
295 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
296 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
297 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
298 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
299 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
300 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
301 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
302 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
303 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
304 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
305 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
306 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
307 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
308 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
309 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
310 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
311 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
312 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
313 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
314 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
315 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
316 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
317 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
318 2844163670 Ensifer sp. 1H6 Isolate Unclassified
319 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
320 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
321 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
322 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
323 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
324 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
325 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
326 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
327 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
328 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
329 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
330 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
331 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
332 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
333 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
334 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
335 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
336 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
337 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
338 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
339 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
340 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
341 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
342 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
343 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
344 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
345 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
346 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
347 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
348 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
349 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
350 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
351 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
352 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
353 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
354 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
355 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
356 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
357 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
358 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
359 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
360 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
361 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
362 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
363 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
364 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
365 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
366 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
367 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
368 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
369 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
370 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
371 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
372 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
373 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
374 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
375 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
376 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
377 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
378 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
379 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
380 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
381 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
382 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
383 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
384 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
385 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
386 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
387 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
388 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
389 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
390 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
391 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
392 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
393 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
394 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
395 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
396 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
397 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
398 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
399 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
400 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
401 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
402 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
403 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
404 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
405 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
406 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
407 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
408 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
409 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
410 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
411 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
412 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
413 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
414 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
415 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
416 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
417 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
418 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
419 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
420 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
421 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
422 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
423 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
424 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
425 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
426 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
427 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
428 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
429 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
430 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
431 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
432 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
433 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
434 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
435 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
436 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
437 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
438 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
439 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
440 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
441 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
442 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
443 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
444 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
445 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
446 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
447 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
448 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
449 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
450 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
451 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
452 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
453 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
454 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
455 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
456 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
457 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
458 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
459 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
460 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
461 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
462 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
463 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
464 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
465 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
466 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
467 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
468 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
469 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
470 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
471 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
472 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
473 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
474 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
475 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
476 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
477 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
478 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
479 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
480 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
481 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
482 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
483 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
484 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
485 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
486 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
487 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
488 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
489 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
490 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
491 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
492 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
493 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
494 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
495 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
496 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
497 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
498 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
499 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
500 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
501 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
502 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
503 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
504 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
505 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
506 2922368715
507 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
508 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
509 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
510 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
511 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
512 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
513 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
514 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
515 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
516 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
517 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
518 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
519 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
520 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
521 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
522 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
523 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
524 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
525 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
526 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
527 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
528 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
529 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
530 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
531 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
532 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
533 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
534 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
535 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
536 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
537 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
538 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
539 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
540 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
541 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
542 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
543 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
544 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
545 2933599457 Rhizobium phaseoli M3 Isolate Nodule
546 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
547 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
548 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
549 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
550 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
551 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
552 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
553 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
554 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
555 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
556 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
557 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
558 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
559 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
560 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
561 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
562 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
563 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
564 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
565 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
566 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
567 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
568 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
569 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
570 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
571 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
572 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
573 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
574 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
575 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
576 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
577 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
578 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
579 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
580 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
581 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
582 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
583 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
584 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
585 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
586 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
587 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
588 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
589 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
590 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
591 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
592 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
593 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
594 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
595 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
596 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
597 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
598 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
599 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
600 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
601 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
602 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
603 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
604 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
605 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
606 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
607 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
608 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
609 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
610 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
611 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
612 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
613 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
614 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
615 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
616 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
617 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
618 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
619 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
620 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
621 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
622 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
623 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
624 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
625 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
626 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
627 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
628 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
629 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
630 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
631 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
632 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
633 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
634 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
635 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
636 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
637 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
638 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
639 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
640 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
641 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
642 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
643 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
644 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
645 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
646 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
647 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
648 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
649 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
650 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
651 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
652 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
653 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
654 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
655 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
656 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
657 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
658 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
659 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
660 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
661 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
662 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
663 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
664 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
665 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
666 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
667 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
668 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
669 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
670 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
671 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
672 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
673 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
674 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
675 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
676 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
677 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
678 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
679 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
680 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
681 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
682 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
683 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
684 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
685 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
686 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
687 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
688 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
689 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
690 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
691 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
692 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
693 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
694 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
695 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
696 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
697 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
698 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
699 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
700 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
701 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
702 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
703 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
704 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
705 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
706 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
707 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
708 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
709 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
710 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
711 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
712 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
713 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
714 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
715 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
716 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
717 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
718 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
719 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
720 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
721 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
722 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
723 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
724 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
725 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
726 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
727 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
728 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
729 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
730 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
731 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
732 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
733 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
734 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
735 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
736 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
737 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
738 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
739 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
740 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
741 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
742 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
743 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
744 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
745 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
746 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
747 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
748 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
749 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
750 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
751 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
752 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
753 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
754 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
755 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
756 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
757 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
758 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
759 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
760 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
761 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
762 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
763 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
764 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
765 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
766 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
767 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
768 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
769 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
770 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
771 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
772 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
773 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
774 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
775 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
776 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
777 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
778 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
779 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
780 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
781 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
782 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
783 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
784 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
785 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
786 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
787 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
788 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
789 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
790 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
791 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
792 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
793 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
794 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
795 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
796 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
797 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
798 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
799 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
800 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
801 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
802 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
803 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
804 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
805 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
806 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
807 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
808 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
809 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
810 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
811 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
812 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
813 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
814 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
815 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
816 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
817 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
818 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
819 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
820 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
821 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
822 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
823 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
824 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
825 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
826 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
827 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
828 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
829 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
830 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
831 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
832 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
833 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
834 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
835 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
836 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
837 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
838 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
839 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
840 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
841 2996887358 Rhizobium sp. R711 Isolate Nodule
842 2996893221 Rhizobium sp. R635 Isolate Nodule
843 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
844 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
845 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
846 3004167301 Mesorhizobium loti 582 Isolate Unclassified
847 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
848 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
849 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
850 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
851 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
852 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
853 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
854 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
855 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
856 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
857 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
858 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
859 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
860 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
861 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
862 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
863 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
864 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
865 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
866 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
867 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
868 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
869 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
870 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
871 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
872 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
873 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
874 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
875 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
876 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
877 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
878 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
879 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
880 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
881 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
882 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
883 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
884 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
885 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
886 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
887 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
888 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
889 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
890 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
891 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
892 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
893 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
894 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
895 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
896 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
897 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
898 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
899 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
900 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
901 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
902 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
903 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
904 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
905 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
906 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
907 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
908 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
909 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
910 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
911 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
912 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
913 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
914 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
915 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
916 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
917 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
918 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
919 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
920 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
921 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
922 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
923 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
924 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
925 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
926 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
927 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
928 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
929 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
930 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
931 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
932 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
933 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
934 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
935 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
936 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
937 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
938 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
939 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
940 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
941 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
942 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
943 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
944 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
945 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
946 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
947 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
948 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
949 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
950 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
951 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
952 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
953 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
954 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
955 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
956 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
957 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
958 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
959 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
960 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
961 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
962 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
963 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
964 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
965 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
966 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
967 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
968 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
969 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
970 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
971 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
972 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
973 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
974 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
975 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
976 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
977 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
978 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
979 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
980 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
981 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
982 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
983 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
984 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
985 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
986 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
987 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
988 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
989 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
990 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
991 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
992 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
993 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
994 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
995 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
996 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
997 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
998 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
999 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
1000 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
1001 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
1002 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
1003 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
1004 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
1005 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
1006 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
1007 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
1008 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
1009 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
1010 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
1011 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
1012 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
1013 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
1014 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
1015 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
1016 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
1017 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
1018 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
1019 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
1020 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
1021 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
1022 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
1023 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
1024 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
1025 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
1026 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
1027 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
1028 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
1029 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
1030 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
1031 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
1032 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
1033 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
1034 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
1035 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
1036 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
1037 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
1038 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
1039 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
1040 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
1041 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
1042 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
1043 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
1044 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
1045 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
1046 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
1047 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
1048 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
1049 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
1050 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
1051 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
1052 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
1053 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
1054 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
1055 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
1056 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
1057 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
1058 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
1059 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
1060 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
1061 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
1062 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
1063 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1064 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1065 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1066 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
1067 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1068 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
1069 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1070 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
1071 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1072 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1073 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1074 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1075 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1076 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1077 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1078 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1079 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1080 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1081 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1082 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
1083 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1084 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1085 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1086 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1087 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1088 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1089 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1090 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1091 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1092 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1093 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1094 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1095 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1096 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1097 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1098 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
1099 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
1106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
1122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
1123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
1126 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
1127 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
1128 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
1129 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
1130 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
1131 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
1132 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
1133 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
1134 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
1135 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
1136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
1137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
1141 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
1142 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
1143 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
1144 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
1145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
1146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
1147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
1148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
1149 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
1150 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
1151 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
1152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
1153 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
1154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
1155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
1156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
1157 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
1158 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
1159 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
1160 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
1161 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
1162 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
1163 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
1164 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
1165 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
1166 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
1167 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
1168 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
1169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
1170 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
1171 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
1172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
1173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
1174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
1175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
1176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
1177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
1178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
1179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
1180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
1181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
1182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
1183 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
1184 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
1185 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
1186 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
1187 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
1188 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
1189 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
1190 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
1191 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
1192 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
1193 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
1194 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
1195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
1196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
1197 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
1198 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
1199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
1200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
1201 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
1202 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
1203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
1204 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
1205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
1206 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
1207 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
1208 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
1209 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
1210 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
1211 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
1212 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
1213 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
1214 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
1215 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
1216 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
1217 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
1218 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
1219 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
1220 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
1221 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
1222 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
1223 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
1224 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
1225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
1226 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
1227 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
1228 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
1229 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
1230 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
1231 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
1232 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
1233 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
1234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
1235 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
1236 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
1237 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
1238 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
1239 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
1240 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
1241 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
1242 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
1243 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
1244 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
1245 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
1246 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
1247 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
1248 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
1249 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
1250 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
1251 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
1252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
1253 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
1254 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
1255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
1256 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
1257 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
1258 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
1259 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
1260 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
1261 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
1262 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
1263 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
1264 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
1265 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
1266 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1267 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
1268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1269 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1271 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
1272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
1273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
1274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1275 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
1276 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1277 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
1278 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1279 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1280 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1281 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1282 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1283 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1284 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1285 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1286 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1287 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1288 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1289 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1290 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1291 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
1292 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
1293 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1294 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1295 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1296 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1297 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1298 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1299 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1300 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1301 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1302 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
1303 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1304 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1305 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1306 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1307 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1308 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
1309 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1310 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
1311 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1312 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1313 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
1314 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1315 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1316 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1317 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1318 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
1319 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1320 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1321 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1322 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1323 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
1324 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1325 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
1326 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
1327 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
1328 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
1329 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
1330 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
1331 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
1332 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
1333 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1334 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
1335 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
1336 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
1337 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
1338 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
1339 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
1340 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
1341 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
1342 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
1343 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
1344 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
1345 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
1346 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
1347 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
1348 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
1349 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
1350 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
1351 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
1352 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1353 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
1354 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
1355 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1356 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
1357 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
1358 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1359 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1360 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1361 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
1362 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
1363 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1364 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1365 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
1366 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
1367 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
1368 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
1369 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
1370 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1371 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1372 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1373 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
1374 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1375 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1376 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1377 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1378 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1379 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1380 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1381 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1382 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1383 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1384 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1385 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1386 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1387 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1388 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1389 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1390 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1391 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1392 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1393 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1394 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1395 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1396 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1397 8005258706 Rhizobium sp. R693 Isolate Nodule
1398 8005275841 Rhizobium sp. N4311 Isolate Nodule
1399 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1400 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1401 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1402 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1403 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1404 8005321885 Rhizobium sp. R72 Isolate Nodule
1405 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1406 8005382845 Rhizobium sp. R634 Isolate Nodule
1407 8005395548 Rhizobium sp. R339 Isolate Nodule
1408 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1409 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1410 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1411 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1412 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1413 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1414 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1415 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1416 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1417 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1418 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1419 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1420 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1421 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1422 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1423 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
1424 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
1425 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
1426 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
1427 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
1428 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
1429 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
1430 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
1431 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
1432 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
1433 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
1434 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
1435 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
1436 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1437 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1438 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1439 8018176218 Rhizobium sp. N122 Isolate Nodule
1440 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
1441 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
1442 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
1443 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
1444 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
1445 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
1446 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
1447 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
1448 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
1449 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
1450 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
1451 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1452 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1453 8024501048 Rhizobium sp. H4 Isolate Nodule
1454 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1455 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1456 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1457 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1458 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
1459 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1460 8056382006 Rhizobium croatiense 13T Isolate Nodule
1461 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1462 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
1463 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 55.51
Metatranscriptomes 0.23
Isolates 44.26

Biome Distribution

Category Percentage (%)
Aerial Root 0.23
Bulb 0
Endosphere 13.09
Nodule 35.25
Rhizoplane 4.15
Rhizosphere 36.82
Stem 0
Stem Tuber 0
Unclassified 10.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1007941 3300001915 Bacteria 2028
2 JGI24746J21847_1000755 3300001977 Bacteria 4961
3 JGI24740J21852_10006190 3300001979 Bacteria 4984
4 JGI24740J21852_10007518 3300001979 Bacteria 4422
5 JGI24739J22299_10000344 3300001989 Bacteria 15875
6 JGI24739J22299_10043423 3300001989 Bacteria 1487
7 JGI24737J22298_10001079 3300001990 Bacteria 9595
8 JGI24750J21931_1000255 3300002070 Bacteria 9058
9 JGI24745J21846_1000003 3300002073 Bacteria 15974
10 JGI24035J26624_1000595 3300002126 Bacteria 3360
11 JGI24033J26618_1000489 3300002155 Bacteria 3895
12 JGI24034J26672_10000322 3300002239 Bacteria 6170
13 JGI24742J22300_10002875 3300002244 Bacteria 2782
14 JGI24751J29686_10004924 3300002459 Bacteria 2720
15 JGI24751J29686_10010970 3300002459 Bacteria 1868
16 JGI25156J39149_1004063 3300002705 Bacteria 4574
17 JGI25162J39368_1001169 3300002737 Bacteria 15592
18 JGI25158J39367_1000393 3300002739 Bacteria 9201
19 JGI25157J39369_1000738 3300002741 Bacteria 17379
20 JGI25152J39213_1003706 3300002773 Bacteria 5121
21 JGI25159J45721_1000508 3300002987 Bacteria 17749
22 JGI25151J46595_10000585 3300003187 Bacteria 32381
23 JGI25151J46595_10001084 3300003187 Bacteria 20208
24 JGI25151J46595_10036025 3300003187 Bacteria 1871
25 JGI25165J46597_1000147 3300003214 Bacteria 116564
26 JGI25165J46597_1000630 3300003214 Bacteria 29232
27 JGI25153J46596_10000428 3300003215 Bacteria 27370
28 JGI25153J46596_10001318 3300003215 Bacteria 14872
29 JGI25153J46596_10004290 3300003215 Bacteria 7708
30 JGI25153J46596_10017933 3300003215 Bacteria 2768
31 JGI25153J46596_10026971 3300003215 Bacteria 2022
32 JGI25160J50197_1000015 3300003354 Bacteria 250902
33 JGI25160J50197_1000216 3300003354 Bacteria 46708
34 JGI25160J50197_1000438 3300003354 Bacteria 26112
35 JGI25160J50197_1000463 3300003354 Bacteria 25108
36 JGI25160J50197_1001146 3300003354 Bacteria 13557
37 JGI25160J50197_1001518 3300003354 Bacteria 11518
38 JGI25160J50197_1002737 3300003354 Bacteria 8089
39 JGI25160J50197_1005355 3300003354 Bacteria 5357
40 JGI25161J50226_1000005 3300003374 Bacteria 292548
41 JGI25161J50226_1000120 3300003374 Bacteria 57896
42 JGI25161J50226_1000412 3300003374 Bacteria 20844
43 JGI25161J50226_1005409 3300003374 Bacteria 2482
44 Ga0055542_1000252 3300003762 Bacteria 61157
45 Ga0055526_1000594 3300003771 Bacteria 28489
46 Ga0055526_1001753 3300003771 Bacteria 15048
47 Ga0055526_1002151 3300003771 Bacteria 13515
48 Ga0055524_1011640 3300003775 Bacteria 3426
49 Ga0055524_1019832 3300003775 Bacteria 2285
50 Ga0055524_1021731 3300003775 Bacteria 2116
51 Ga0055536_1002870 3300003781 Bacteria 9487
52 Ga0055536_1013021 3300003781 Bacteria 3034
53 Ga0055528_1000693 3300003790 Bacteria 24016
54 Ga0055528_1001185 3300003790 Bacteria 16837
55 Ga0055528_1005562 3300003790 Bacteria 5836
56 Ga0055530_10011385 3300003791 Bacteria 3196
57 Ga0055530_10012693 3300003791 Bacteria 2920
58 Ga0055540_1001134 3300003792 Bacteria 16613
59 Ga0055540_1002011 3300003792 Bacteria 11312
60 Ga0055540_1002353 3300003792 Bacteria 10116
61 Ga0055540_1014218 3300003792 Bacteria 2384
62 Ga0055531_10002835 3300003794 Bacteria 11346
63 Ga0055531_10007059 3300003794 Bacteria 6214
64 Ga0055531_10007361 3300003794 Bacteria 6029
65 Ga0058692_1000689 3300003856 Bacteria 13918
66 Ga0055543_1000012 3300004625 Bacteria 186581
67 Ga0055543_1000155 3300004625 Bacteria 57253
68 Ga0055543_1000301 3300004625 Bacteria 35189
69 Ga0055543_1000631 3300004625 Bacteria 18905
70 Ga0055543_1002832 3300004625 Bacteria 5481
71 Ga0065165_1000125 3300005262 Bacteria 130283
72 Ga0065165_1000717 3300005262 Bacteria 46746
73 Ga0065165_1000780 3300005262 Bacteria 42673
74 Ga0065165_1000826 3300005262 Bacteria 40863
75 Ga0065165_1001465 3300005262 Bacteria 25288
76 Ga0065165_1003182 3300005262 Bacteria 12014
77 Ga0065165_1013609 3300005262 Bacteria 3221
78 Ga0065712_10003725 3300005290 Bacteria 4760
79 Ga0065712_10070614 3300005290 Bacteria 5849
80 Ga0065712_10111484 3300005290 Bacteria 1817
81 Ga0065715_10093037 3300005293 Bacteria 4831
82 Ga0070658_10205856 3300005327 Bacteria 1661
83 Ga0070676_10000784 3300005328 Bacteria 15682
84 Ga0070683_100000114 3300005329 Bacteria 52980
85 Ga0070683_100057598 3300005329 Bacteria 3610
86 Ga0070690_100000064 3300005330 Bacteria 53027
87 Ga0070690_100022010 3300005330 Bacteria 3897
88 Ga0070670_100002373 3300005331 Bacteria 15518
89 Ga0070677_10000193 3300005333 Bacteria 20923
90 Ga0070677_10022088 3300005333 Bacteria 2339
91 Ga0068869_100000020 3300005334 Bacteria 66561
92 Ga0068869_100006431 3300005334 Bacteria 7452
93 Ga0070666_10030214 3300005335 Bacteria 3568
94 Ga0070680_100000242 3300005336 Bacteria 36144
95 Ga0070682_100000224 3300005337 Bacteria 41040
96 Ga0068868_100001773 3300005338 Bacteria 14779
97 Ga0068868_100009208 3300005338 Bacteria 7095
98 Ga0068868_100186489 3300005338 Bacteria 1724
99 Ga0070660_100000123 3300005339 Bacteria 48796
100 Ga0070660_100084487 3300005339 Bacteria 2495
101 Ga0070689_100000685 3300005340 Bacteria 20556
102 Ga0070689_100076641 3300005340 Bacteria 2620
103 Ga0070689_100153949 3300005340 Bacteria 1855
104 Ga0070691_10013336 3300005341 Bacteria 3764
105 Ga0070687_100000351 3300005343 Bacteria 15646
106 Ga0070687_100039459 3300005343 Bacteria 2373
107 Ga0070661_100026596 3300005344 Bacteria 4162
108 Ga0070661_100046186 3300005344 Bacteria 3186
109 Ga0070661_100111987 3300005344 Bacteria 2039
110 Ga0070692_10000108 3300005345 Bacteria 18900
111 Ga0070668_100003586 3300005347 Bacteria 11452
112 Ga0070668_100021775 3300005347 Bacteria 4843
113 Ga0070668_100180266 3300005347 Bacteria 1725
114 Ga0070669_100000176 3300005353 Bacteria 55540
115 Ga0070669_100062083 3300005353 Bacteria 2747
116 Ga0070675_100000259 3300005354 Bacteria 34661
117 Ga0070675_100099529 3300005354 Bacteria 2448
118 Ga0070675_100193875 3300005354 Bacteria 1761
119 Ga0070671_100004849 3300005355 Bacteria 10694
120 Ga0070671_100006467 3300005355 Bacteria 9367
121 Ga0070671_100098198 3300005355 Bacteria 2456
122 Ga0070671_100129759 3300005355 Bacteria 2123
123 Ga0070671_100153294 3300005355 Bacteria 1946
124 Ga0070674_100000099 3300005356 Bacteria 40231
125 Ga0070674_100026259 3300005356 Bacteria 3801
126 Ga0070674_100184190 3300005356 Bacteria 1602
127 Ga0070673_100000042 3300005364 Bacteria 52952
128 Ga0070673_100084549 3300005364 Bacteria 2581
129 Ga0070673_100112291 3300005364 Bacteria 2262
130 Ga0070688_100000329 3300005365 Bacteria 24316
131 Ga0070688_100074173 3300005365 Bacteria 2184
132 Ga0070659_100000348 3300005366 Bacteria 35172
133 Ga0070667_100001075 3300005367 Bacteria 24994
134 Ga0070667_100019257 3300005367 Bacteria 5662
135 Ga0070667_100042027 3300005367 Bacteria 3834
136 Ga0070703_10000878 3300005406 Bacteria 9648
137 Ga0070709_10032295 3300005434 Bacteria 3155
138 Ga0070709_10129479 3300005434 Bacteria 1721
139 Ga0070714_100152101 3300005435 Bacteria 2086
140 Ga0070713_100030475 3300005436 Bacteria 4284
141 Ga0070713_100183785 3300005436 Bacteria 1880
142 Ga0070710_10024016 3300005437 Bacteria 3211
143 Ga0070710_10083034 3300005437 Bacteria 1874
144 Ga0070701_10000025 3300005438 Bacteria 38966
145 Ga0070711_100032827 3300005439 Bacteria 3454
146 Ga0070705_100003281 3300005440 Bacteria 7960
147 Ga0070705_100170695 3300005440 Bacteria 1464
148 Ga0070694_100003777 3300005444 Bacteria 9035
149 Ga0070694_100100151 3300005444 Bacteria 2049
150 Ga0070708_100257647 3300005445 Bacteria 1640
151 Ga0070663_100000064 3300005455 Bacteria 45232
152 Ga0070663_100113712 3300005455 Bacteria 2037
153 Ga0070678_100002536 3300005456 Bacteria 10015
154 Ga0070662_100073373 3300005457 Bacteria 2528
155 Ga0070662_100303483 3300005457 Bacteria 1298
156 Ga0070681_10000435 3300005458 Bacteria 33975
157 Ga0070681_10182879 3300005458 Bacteria 2017
158 Ga0070681_10236072 3300005458 Bacteria 1742
159 Ga0068867_100005677 3300005459 Bacteria 8842
160 Ga0068867_100024391 3300005459 Bacteria 4333
161 Ga0068867_100027110 3300005459 Bacteria 4116
162 Ga0068867_100067298 3300005459 Bacteria 2670
163 Ga0068867_100190588 3300005459 Bacteria 1636
164 Ga0070706_100197584 3300005467 Bacteria 1879
165 Ga0070698_100011265 3300005471 Bacteria 9494
166 Ga0070699_100202435 3300005518 Bacteria 1766
167 Ga0070684_100001610 3300005535 Bacteria 16308
168 Ga0070684_100027140 3300005535 Bacteria 4831
169 Ga0070697_100094045 3300005536 Bacteria 2483
170 Ga0068853_100002463 3300005539 Bacteria 13860
171 Ga0068853_100039010 3300005539 Bacteria 4049
172 Ga0068853_100195647 3300005539 Bacteria 1839
173 Ga0068853_100323306 3300005539 Bacteria 1430
174 Ga0070672_100000011 3300005543 Bacteria 80761
175 Ga0070672_100118231 3300005543 Bacteria 2167
176 Ga0070672_100134004 3300005543 Bacteria 2039
177 Ga0070686_100000076 3300005544 Bacteria 71207
178 Ga0070686_100087073 3300005544 Bacteria 2081
179 Ga0070695_100053966 3300005545 Bacteria 2585
180 Ga0070696_100052443 3300005546 Bacteria 2837
181 Ga0070696_100056200 3300005546 Bacteria 2745
182 Ga0070693_100004777 3300005547 Bacteria 6450
183 Ga0070665_100002816 3300005548 Bacteria 18830
184 Ga0070665_100003012 3300005548 Bacteria 18172
185 Ga0070665_100016716 3300005548 Bacteria 7353
186 Ga0070665_100037641 3300005548 Bacteria 4864
187 Ga0070665_100289398 3300005548 Bacteria 1641
188 Ga0070665_100424974 3300005548 Bacteria 1337
189 Ga0068855_100049447 3300005563 Bacteria 4959
190 Ga0068855_100061125 3300005563 Bacteria 4402
191 Ga0068855_100110372 3300005563 Bacteria 3158
192 Ga0070664_100000112 3300005564 Bacteria 53506
193 Ga0068857_100000023 3300005577 Bacteria 86999
194 Ga0068857_100024933 3300005577 Bacteria 5267
195 Ga0068857_100031521 3300005577 Bacteria 4685
196 Ga0068854_100066891 3300005578 Bacteria 2616
197 Ga0068854_100178454 3300005578 Bacteria 1658
198 Ga0068856_100000099 3300005614 Bacteria 83061
199 Ga0068856_100006276 3300005614 Bacteria 11671
200 Ga0068856_100014002 3300005614 Bacteria 7755
201 Ga0068856_100095048 3300005614 Bacteria 2968
202 Ga0068856_100118811 3300005614 Bacteria 2644
203 Ga0070702_100000005 3300005615 Bacteria 70200
204 Ga0068852_100002886 3300005616 Bacteria 11926
205 Ga0068852_100014911 3300005616 Bacteria 6005
206 Ga0068859_100000503 3300005617 Bacteria 38475
207 Ga0068859_100128696 3300005617 Bacteria 2602
208 Ga0068859_100425277 3300005617 Bacteria 1425
209 Ga0068864_100000112 3300005618 Bacteria 79688
210 Ga0068864_100006199 3300005618 Bacteria 9804
211 Ga0068864_100029277 3300005618 Bacteria 4661
212 Ga0068866_10000977 3300005718 Bacteria 12586
213 Ga0068866_10201434 3300005718 Bacteria 1190
214 Ga0068861_100002096 3300005719 Bacteria 12937
215 Ga0068870_10000021 3300005840 Bacteria 56319
216 Ga0068863_100000227 3300005841 Bacteria 59675
217 Ga0068863_100100507 3300005841 Bacteria 2749
218 Ga0068858_100001279 3300005842 Bacteria 26017
219 Ga0068858_100004153 3300005842 Bacteria 14249
220 Ga0068858_100032557 3300005842 Bacteria 4840
221 Ga0068858_100367623 3300005842 Bacteria 1379
222 Ga0068860_100315040 3300005843 Bacteria 1535
223 Ga0068862_100001866 3300005844 Bacteria 19089
224 Ga0068862_100108483 3300005844 Bacteria 2435
225 Ga0081455_10004237 3300005937 Bacteria 16172
226 Ga0081455_10057110 3300005937 Bacteria 3310
227 Ga0081538_10019358 3300005981 Bacteria 5062
228 Ga0081540_1056049 3300005983 Bacteria 1915
229 Ga0081539_10001300 3300005985 Bacteria 43786
230 Ga0081539_10029652 3300005985 Bacteria 3412
231 Ga0081539_10046429 3300005985 Bacteria 2489
232 Ga0070717_10102440 3300006028 Bacteria 2432
233 Ga0070717_10130840 3300006028 Bacteria 2158
234 Ga0075365_10001809 3300006038 Bacteria 9990
235 Ga0075365_10002327 3300006038 Bacteria 9249
236 Ga0075365_10005519 3300006038 Bacteria 6829
237 Ga0075365_10008458 3300006038 Bacteria 5846
238 Ga0075365_10016973 3300006038 Bacteria 4445
239 Ga0075365_10018202 3300006038 Bacteria 4315
240 Ga0075365_10043121 3300006038 Bacteria 2952
241 Ga0075365_10054915 3300006038 Bacteria 2642
242 Ga0075365_10067884 3300006038 Bacteria 2395
243 Ga0075365_10086187 3300006038 Bacteria 2134
244 Ga0075365_10097891 3300006038 Bacteria 2006
245 Ga0075365_10137785 3300006038 Bacteria 1692
246 Ga0075365_10198465 3300006038 Bacteria 1405
247 Ga0075368_10000391 3300006042 Bacteria 12927
248 Ga0075368_10001480 3300006042 Bacteria 7524
249 Ga0075363_100004780 3300006048 Bacteria 5970
250 Ga0075363_100011783 3300006048 Bacteria 4195
251 Ga0075363_100026888 3300006048 Bacteria 2947
252 Ga0075364_10000060 3300006051 Bacteria 41109
253 Ga0075364_10016981 3300006051 Bacteria 4536
254 Ga0075364_10022672 3300006051 Bacteria 3968
255 Ga0070715_10014553 3300006163 Bacteria 2915
256 Ga0070712_100231222 3300006175 Bacteria 1468
257 Ga0075362_10003906 3300006177 Bacteria 5293
258 Ga0075362_10058503 3300006177 Bacteria 1738
259 Ga0075367_10014606 3300006178 Bacteria 4252
260 Ga0075367_10021848 3300006178 Bacteria 3582
261 Ga0075367_10031807 3300006178 Bacteria 3032
262 Ga0075367_10079464 3300006178 Bacteria 1982
263 Ga0075369_10000420 3300006186 Bacteria 12842
264 Ga0075369_10009712 3300006186 Bacteria 3745
265 Ga0075369_10024616 3300006186 Bacteria 2496
266 Ga0075369_10037369 3300006186 Bacteria 2068
267 Ga0075369_10109517 3300006186 Bacteria 1244
268 Ga0075366_10005612 3300006195 Bacteria 6803
269 Ga0075366_10030387 3300006195 Bacteria 3176
270 Ga0075366_10031004 3300006195 Bacteria 3145
271 Ga0075366_10044168 3300006195 Bacteria 2640
272 Ga0075366_10084443 3300006195 Bacteria 1898
273 Ga0075366_10142134 3300006195 Bacteria 1451
274 Ga0097621_100000115 3300006237 Bacteria 45694
275 Ga0097621_100031095 3300006237 Bacteria 4233
276 Ga0097621_100052758 3300006237 Bacteria 3313
277 Ga0075370_10019433 3300006353 Bacteria 3700
278 Ga0075370_10020715 3300006353 Bacteria 3597
279 Ga0075370_10049519 3300006353 Bacteria 2382
280 Ga0075370_10055381 3300006353 Bacteria 2253
281 Ga0075370_10058432 3300006353 Bacteria 2193
282 Ga0075370_10062341 3300006353 Bacteria 2124
283 Ga0075370_10072847 3300006353 Bacteria 1967
284 Ga0068871_100000064 3300006358 Bacteria 58283
285 Ga0068871_100031695 3300006358 Bacteria 4170
286 Ga0068871_100082934 3300006358 Bacteria 2659
287 Ga0068871_100183985 3300006358 Bacteria 1797
288 Ga0075428_100001096 3300006844 Bacteria 28836
289 Ga0075428_100019624 3300006844 Bacteria 7480
290 Ga0075428_100140962 3300006844 Bacteria 2621
291 Ga0075430_100016424 3300006846 Bacteria 6302
292 Ga0075430_100328763 3300006846 Bacteria 1263
293 Ga0075431_100002284 3300006847 Bacteria 18392
294 Ga0075431_100006045 3300006847 Bacteria 12001
295 Ga0075431_100057368 3300006847 Bacteria 4016
296 Ga0075433_10286206 3300006852 Bacteria 1460
297 Ga0075434_100011648 3300006871 Bacteria 8305
298 Ga0075429_100016045 3300006880 Bacteria 6488
299 Ga0075429_100040905 3300006880 Bacteria 4036
300 Ga0068865_100000088 3300006881 Bacteria 48315
301 Ga0068865_100107695 3300006881 Bacteria 2050
302 Ga0068865_100141135 3300006881 Bacteria 1817
303 Ga0097620_100000503 3300006931 Bacteria 38475
304 Ga0097620_100128696 3300006931 Bacteria 2602
305 Ga0097620_100168187 3300006931 Bacteria 2273
306 Ga0097620_100425243 3300006931 Bacteria 1425
307 Ga0099825_1026228 3300006941 Bacteria 3132
308 Ga0099824_1015882 3300006942 Bacteria 6981
309 Ga0099823_1016643 3300006944 Bacteria 7202
310 Ga0079104_1005313 3300006946 Bacteria 5180
311 Ga0079104_1029960 3300006946 Bacteria 1365
312 Ga0099826_10001162 3300006948 Bacteria 15168
313 Ga0099826_10055826 3300006948 Bacteria 2611
314 Ga0075435_100018640 3300007076 Bacteria 5285
315 Ga0105244_10027369 3300009036 Bacteria 3073
316 Ga0105244_10041442 3300009036 Bacteria 2386
317 Ga0105240_10000032 3300009093 Bacteria 283907
318 Ga0105240_10087091 3300009093 Bacteria 3825
319 Ga0111539_10000835 3300009094 Bacteria 40036
320 Ga0111539_10001836 3300009094 Bacteria 28237
321 Ga0111539_10002131 3300009094 Bacteria 26474
322 Ga0111539_10043003 3300009094 Bacteria 5420
323 Ga0111539_10240090 3300009094 Bacteria 2109
324 Ga0111539_10344038 3300009094 Bacteria 1736
325 Ga0105245_10000556 3300009098 Bacteria 33858
326 Ga0105245_10001381 3300009098 Bacteria 21973
327 Ga0105245_10042958 3300009098 Bacteria 4032
328 Ga0105247_10000474 3300009101 Bacteria 33690
329 Ga0105247_10008685 3300009101 Bacteria 6192
330 Ga0105247_10010587 3300009101 Bacteria 5571
331 Ga0105247_10036214 3300009101 Bacteria 3009
332 Ga0105247_10140550 3300009101 Bacteria 1582
333 Ga0114129_10005100 3300009147 Bacteria 18497
334 Ga0114129_10023557 3300009147 Bacteria 8726
335 Ga0114129_10041080 3300009147 Bacteria 6519
336 Ga0114129_10116705 3300009147 Bacteria 3678
337 Ga0114129_10135026 3300009147 Bacteria 3385
338 Ga0105243_10002817 3300009148 Bacteria 14441
339 Ga0105243_10003276 3300009148 Bacteria 13158
340 Ga0105243_10059291 3300009148 Bacteria 3054
341 Ga0105243_10111788 3300009148 Bacteria 2287
342 Ga0105243_10129972 3300009148 Bacteria 2135
343 Ga0105241_10013940 3300009174 Bacteria 5891
344 Ga0105242_10006548 3300009176 Bacteria 8967
345 Ga0105242_10010176 3300009176 Bacteria 7205
346 Ga0105242_10136056 3300009176 Bacteria 2127
347 Ga0105248_10000500 3300009177 Bacteria 44664
348 Ga0105248_10000873 3300009177 Bacteria 33799
349 Ga0105248_10005607 3300009177 Bacteria 13792
350 Ga0105248_10053120 3300009177 Bacteria 4547
351 Ga0105248_10064008 3300009177 Bacteria 4128
352 Ga0105248_10376789 3300009177 Bacteria 1598
353 Ga0105237_10000754 3300009545 Bacteria 44371
354 Ga0105237_10012593 3300009545 Bacteria 8908
355 Ga0105237_10053311 3300009545 Bacteria 4057
356 Ga0105238_10063446 3300009551 Bacteria 3695
357 Ga0105238_10076419 3300009551 Bacteria 3340
358 Ga0105238_10079722 3300009551 Bacteria 3264
359 Ga0105238_10095640 3300009551 Bacteria 2957
360 Ga0105249_10002423 3300009553 Bacteria 16185
361 Ga0123341_1003307 3300009765 Bacteria 13754
362 Ga0123342_1012832 3300009766 Bacteria 8595
363 Ga0123342_1023961 3300009766 Bacteria 3886
364 Ga0099796_10029332 3300010159 Bacteria 1774
365 Ga0105239_10003796 3300010375 Bacteria 18390
366 Ga0105239_10295074 3300010375 Bacteria 1825
367 Ga0105246_10000016 3300011119 Bacteria 65781
368 Ga0105246_10000220 3300011119 Bacteria 29009
369 Ga0105246_10058075 3300011119 Bacteria 2680
370 Ga0157373_10001237 3300013100 Bacteria 19540
371 Ga0157373_10042861 3300013100 Bacteria 3233
372 Ga0157373_10132801 3300013100 Bacteria 1750
373 Ga0157373_10168919 3300013100 Bacteria 1539
374 Ga0157371_10000004 3300013102 Bacteria 512593
375 Ga0157371_10015495 3300013102 Bacteria 5717
376 Ga0157370_10003636 3300013104 Bacteria 18019
377 Ga0157370_10234385 3300013104 Bacteria 1698
378 Ga0157369_10073358 3300013105 Bacteria 3672
379 Ga0157369_10102912 3300013105 Bacteria 3042
380 Ga0171463_1003 3300013249 Bacteria 695693
381 Ga0157374_10000092 3300013296 Bacteria 85738
382 Ga0157374_10000524 3300013296 Bacteria 34473
383 Ga0157374_10010385 3300013296 Bacteria 8009
384 Ga0157374_10030091 3300013296 Bacteria 4927
385 Ga0157374_10202455 3300013296 Bacteria 1944
386 Ga0157378_10000591 3300013297 Bacteria 34042
387 Ga0157378_10023177 3300013297 Bacteria 5464
388 Ga0157378_10271419 3300013297 Bacteria 1631
389 Ga0163162_10023568 3300013306 Bacteria 6076
390 Ga0163162_10075105 3300013306 Bacteria 3440
391 Ga0163162_10115386 3300013306 Bacteria 2785
392 Ga0163162_10375085 3300013306 Bacteria 1556
393 Ga0163162_10380472 3300013306 Bacteria 1545
394 Ga0157372_10006371 3300013307 Bacteria 12555
395 Ga0157372_10163959 3300013307 Bacteria 2569
396 Ga0157372_10314045 3300013307 Bacteria 1824
397 Ga0157372_10395714 3300013307 Bacteria 1610
398 Ga0157375_10000124 3300013308 Bacteria 76003
399 Ga0157375_10001668 3300013308 Bacteria 19088
400 Ga0157375_10006444 3300013308 Bacteria 10223
401 Ga0157375_10025162 3300013308 Bacteria 5523
402 Ga0163163_10003404 3300014325 Bacteria 13509
403 Ga0163163_10058876 3300014325 Bacteria 3798
404 Ga0157380_10001027 3300014326 Bacteria 17807
405 Ga0157380_10004466 3300014326 Bacteria 9691
406 Ga0157380_10102839 3300014326 Bacteria 2383
407 Ga0157380_10125337 3300014326 Bacteria 2182
408 Ga0157380_10131629 3300014326 Bacteria 2135
409 Ga0157380_10205409 3300014326 Bacteria 1751
410 Ga0157380_10363411 3300014326 Bacteria 1359
411 Ga0182008_10051736 3300014497 Bacteria 2037
412 Ga0157377_10000121 3300014745 Bacteria 51192
413 Ga0157379_10000422 3300014968 Bacteria 34158
414 Ga0157379_10040122 3300014968 Bacteria 4177
415 Ga0157379_10077910 3300014968 Bacteria 2968
416 Ga0157376_10000034 3300014969 Bacteria 161526
417 Ga0157376_10000285 3300014969 Bacteria 34194
418 Ga0157376_10409954 3300014969 Bacteria 1312
419 Ga0182006_1015445 3300015261 Bacteria 3273
420 Ga0182007_10062860 3300015262 Bacteria 1217
421 Ga0182005_1004008 3300015265 Bacteria 4843
422 Ga0183363_1047 3300015690 Bacteria 39413
423 Ga0163161_10000801 3300017792 Bacteria 24605
424 Ga0163161_10107639 3300017792 Bacteria 2081
425 Ga0214544_1001682 3300021320 Bacteria 46508
426 Ga0214542_1001614 3300021321 Bacteria 46380
427 Ga0214542_1028780 3300021321 Bacteria 2357
428 Ga0214543_1000078 3300021327 Bacteria 119775
429 Ga0214543_1001395 3300021327 Bacteria 46435
430 Ga0228711_1000016 3300022739 Bacteria 126351
431 Ga0228710_1000013 3300022740 Bacteria 145976
432 Ga0209436_100041 3300025208 Bacteria 74018
433 Ga0209436_101133 3300025208 Bacteria 9873
434 Ga0209437_100075 3300025233 Bacteria 297202
435 Ga0207425_1008603 3300025245 Bacteria 2597
436 Ga0209026_1000050 3300025250 Bacteria 254994
437 Ga0209148_1000032 3300025254 Bacteria 557660
438 Ga0209148_1000289 3300025254 Bacteria 75390
439 Ga0209759_1015261 3300025256 Bacteria 1988
440 Ga0209129_1001627 3300025258 Bacteria 12185
441 Ga0209129_1003249 3300025258 Bacteria 7219
442 Ga0209129_1006654 3300025258 Bacteria 3668
443 Ga0209233_1000034 3300025261 Bacteria 578898
444 Ga0209233_1000056 3300025261 Bacteria 438104
445 Ga0209233_1002652 3300025261 Bacteria 6482
446 Ga0207666_1000004 3300025271 Bacteria 56747
447 Ga0209455_1000190 3300025272 Bacteria 92473
448 Ga0209455_1001308 3300025272 Bacteria 11563
449 Ga0209673_1000060 3300025273 Bacteria 263602
450 Ga0209673_1004110 3300025273 Bacteria 7994
451 Ga0209673_1011460 3300025273 Bacteria 3654
452 Ga0209673_1017145 3300025273 Bacteria 2677
453 Ga0209130_1000018 3300025284 Bacteria 388301
454 Ga0209130_1000029 3300025284 Bacteria 323399
455 Ga0209130_1000030 3300025284 Bacteria 323323
456 Ga0207673_1000326 3300025290 Bacteria 4777
457 Ga0209676_1000100 3300025292 Bacteria 229621
458 Ga0209676_1002997 3300025292 Bacteria 10988
459 Ga0209676_1031133 3300025292 Bacteria 1622
460 Ga0209676_1038379 3300025292 Bacteria 1372
461 Ga0209025_1000060 3300025294 Bacteria 305017
462 Ga0209025_1000959 3300025294 Bacteria 43491
463 Ga0209025_1001184 3300025294 Bacteria 36925
464 Ga0209025_1023046 3300025294 Bacteria 3275
465 Ga0209564_1000278 3300025295 Bacteria 105405
466 Ga0209564_1000281 3300025295 Bacteria 104019
467 Ga0209564_1000937 3300025295 Bacteria 37831
468 Ga0209564_1001052 3300025295 Bacteria 33676
469 Ga0209564_1004532 3300025295 Bacteria 8443
470 Ga0209564_1017395 3300025295 Bacteria 2804
471 Ga0209564_1033434 3300025295 Bacteria 1528
472 Ga0209758_1000160 3300025297 Bacteria 154304
473 Ga0209758_1000219 3300025297 Bacteria 124186
474 Ga0209758_1000383 3300025297 Bacteria 76487
475 Ga0209758_1000637 3300025297 Bacteria 53635
476 Ga0209758_1000677 3300025297 Bacteria 50824
477 Ga0209758_1001377 3300025297 Bacteria 29000
478 Ga0209758_1009047 3300025297 Bacteria 6286
479 Ga0209758_1009123 3300025297 Bacteria 6251
480 Ga0209758_1012378 3300025297 Bacteria 4782
481 Ga0209050_1006153 3300025298 Bacteria 7222
482 Ga0209050_1009722 3300025298 Bacteria 4872
483 Ga0209050_1019463 3300025298 Bacteria 2576
484 Ga0209256_1000042 3300025299 Bacteria 341821
485 Ga0209256_1001295 3300025299 Bacteria 26989
486 Ga0209256_1002288 3300025299 Bacteria 16138
487 Ga0209256_1002941 3300025299 Bacteria 12786
488 Ga0209256_1003739 3300025299 Bacteria 10296
489 Ga0209256_1009106 3300025299 Bacteria 4424
490 Ga0209256_1024299 3300025299 Bacteria 1787
491 Ga0207426_1000044 3300025302 Bacteria 428043
492 Ga0207426_1000047 3300025302 Bacteria 417011
493 Ga0207426_1000074 3300025302 Bacteria 323399
494 Ga0207426_1000268 3300025302 Bacteria 109321
495 Ga0207426_1000379 3300025302 Bacteria 76587
496 Ga0207426_1000465 3300025302 Bacteria 62583
497 Ga0207426_1003500 3300025302 Bacteria 8458
498 Ga0207426_1016971 3300025302 Bacteria 2599
499 Ga0209051_1000236 3300025303 Bacteria 92738
500 Ga0209051_1003666 3300025303 Bacteria 9938
501 Ga0209051_1004392 3300025303 Bacteria 8719
502 Ga0209051_1008481 3300025303 Bacteria 5430
503 Ga0209051_1008829 3300025303 Bacteria 5276
504 Ga0209051_1012789 3300025303 Bacteria 4038
505 Ga0209257_1000650 3300025304 Bacteria 55188
506 Ga0209257_1002011 3300025304 Bacteria 21749
507 Ga0209257_1002210 3300025304 Bacteria 20082
508 Ga0209257_1005286 3300025304 Bacteria 9197
509 Ga0209257_1029619 3300025304 Bacteria 1780
510 Ga0207653_10001908 3300025885 Bacteria 6674
511 Ga0207682_10000016 3300025893 Bacteria 78971
512 Ga0207692_10013299 3300025898 Bacteria 3566
513 Ga0207642_10000976 3300025899 Bacteria 8924
514 Ga0207642_10078028 3300025899 Bacteria 1599
515 Ga0207710_10001396 3300025900 Bacteria 12097
516 Ga0207710_10001528 3300025900 Bacteria 11432
517 Ga0207710_10003942 3300025900 Bacteria 6545
518 Ga0207710_10009728 3300025900 Bacteria 4041
519 Ga0207710_10026449 3300025900 Bacteria 2508
520 Ga0207688_10002050 3300025901 Bacteria 10826
521 Ga0207688_10064625 3300025901 Bacteria 2067
522 Ga0207680_10002179 3300025903 Bacteria 9176
523 Ga0207680_10059119 3300025903 Bacteria 2327
524 Ga0207680_10135217 3300025903 Bacteria 1629
525 Ga0207680_10219750 3300025903 Bacteria 1302
526 Ga0207647_10003692 3300025904 Bacteria 11441
527 Ga0207647_10059232 3300025904 Bacteria 2344
528 Ga0207685_10083900 3300025905 Bacteria 1325
529 Ga0207645_10001535 3300025907 Bacteria 18877
530 Ga0207643_10000075 3300025908 Bacteria 64981
531 Ga0207643_10085289 3300025908 Bacteria 1834
532 Ga0207684_10099451 3300025910 Bacteria 2484
533 Ga0207654_10006201 3300025911 Bacteria 6008
534 Ga0207707_10003863 3300025912 Bacteria 13286
535 Ga0207707_10153787 3300025912 Bacteria 2011
536 Ga0207695_10000024 3300025913 Bacteria 632311
537 Ga0207695_10009034 3300025913 Bacteria 12390
538 Ga0207695_10146083 3300025913 Bacteria 2309
539 Ga0207695_10196807 3300025913 Bacteria 1931
540 Ga0207671_10000718 3300025914 Bacteria 42274
541 Ga0207671_10009593 3300025914 Bacteria 8069
542 Ga0207671_10116073 3300025914 Bacteria 2042
543 Ga0207693_10046639 3300025915 Bacteria 3404
544 Ga0207663_10112324 3300025916 Bacteria 1851
545 Ga0207660_10000023 3300025917 Bacteria 71712
546 Ga0207660_10103923 3300025917 Bacteria 2126
547 Ga0207662_10001681 3300025918 Bacteria 10824
548 Ga0207662_10029205 3300025918 Bacteria 3193
549 Ga0207657_10001755 3300025919 Bacteria 23396
550 Ga0207657_10073027 3300025919 Bacteria 2901
551 Ga0207657_10114168 3300025919 Bacteria 2228
552 Ga0207657_10217966 3300025919 Bacteria 1530
553 Ga0207649_10000122 3300025920 Bacteria 65841
554 Ga0207649_10015177 3300025920 Bacteria 4326
555 Ga0207652_10001146 3300025921 Bacteria 23846
556 Ga0207681_10000240 3300025923 Bacteria 42226
557 Ga0207681_10049729 3300025923 Bacteria 2835
558 Ga0207681_10076472 3300025923 Bacteria 2351
559 Ga0207681_10195542 3300025923 Bacteria 1550
560 Ga0207694_10020011 3300025924 Bacteria 5062
561 Ga0207650_10012941 3300025925 Bacteria 5768
562 Ga0207650_10088443 3300025925 Bacteria 2362
563 Ga0207659_10000017 3300025926 Bacteria 159908
564 Ga0207659_10085461 3300025926 Bacteria 2344
565 Ga0207659_10094800 3300025926 Bacteria 2237
566 Ga0207659_10096989 3300025926 Bacteria 2214
567 Ga0207687_10000077 3300025927 Bacteria 71218
568 Ga0207687_10001492 3300025927 Bacteria 16025
569 Ga0207687_10211238 3300025927 Bacteria 1523
570 Ga0207700_10046442 3300025928 Bacteria 3211
571 Ga0207700_10148027 3300025928 Bacteria 1938
572 Ga0207664_10045678 3300025929 Bacteria 3435
573 Ga0207644_10001298 3300025931 Bacteria 16078
574 Ga0207644_10003716 3300025931 Bacteria 9888
575 Ga0207644_10027349 3300025931 Bacteria 3940
576 Ga0207644_10106786 3300025931 Bacteria 2111
577 Ga0207644_10263806 3300025931 Bacteria 1378
578 Ga0207644_10371701 3300025931 Bacteria 1165
579 Ga0207690_10000151 3300025932 Bacteria 54897
580 Ga0207706_10005479 3300025933 Bacteria 11832
581 Ga0207706_10010327 3300025933 Bacteria 8534
582 Ga0207706_10354838 3300025933 Bacteria 1275
583 Ga0207706_10354839 3300025933 Bacteria 1275
584 Ga0207686_10000294 3300025934 Bacteria 36711
585 Ga0207686_10017811 3300025934 Bacteria 4009
586 Ga0207686_10031259 3300025934 Bacteria 3159
587 Ga0207709_10000126 3300025935 Bacteria 114049
588 Ga0207709_10045603 3300025935 Bacteria 2656
589 Ga0207709_10060946 3300025935 Bacteria 2355
590 Ga0207709_10090300 3300025935 Bacteria 2000
591 Ga0207709_10097350 3300025935 Bacteria 1937
592 Ga0207709_10114962 3300025935 Bacteria 1807
593 Ga0207670_10000086 3300025936 Bacteria 63570
594 Ga0207670_10080693 3300025936 Bacteria 2275
595 Ga0207669_10000188 3300025937 Bacteria 28047
596 Ga0207669_10014695 3300025937 Bacteria 3930
597 Ga0207669_10026710 3300025937 Bacteria 3146
598 Ga0207669_10156474 3300025937 Bacteria 1604
599 Ga0207669_10207167 3300025937 Bacteria 1428
600 Ga0207704_10001793 3300025938 Bacteria 9624
601 Ga0207665_10268951 3300025939 Bacteria 1265
602 Ga0207691_10007063 3300025940 Bacteria 10834
603 Ga0207691_10016974 3300025940 Bacteria 6909
604 Ga0207691_10183906 3300025940 Bacteria 1825
605 Ga0207711_10004478 3300025941 Bacteria 11909
606 Ga0207711_10005965 3300025941 Bacteria 10298
607 Ga0207711_10039484 3300025941 Bacteria 4016
608 Ga0207711_10316023 3300025941 Bacteria 1442
609 Ga0207689_10000140 3300025942 Bacteria 62258
610 Ga0207689_10047161 3300025942 Bacteria 3559
611 Ga0207689_10109566 3300025942 Bacteria 2269
612 Ga0207661_10000074 3300025944 Bacteria 68047
613 Ga0207661_10130409 3300025944 Bacteria 2152
614 Ga0207679_10000031 3300025945 Bacteria 165962
615 Ga0207679_10031984 3300025945 Bacteria 3688
616 Ga0207679_10221628 3300025945 Bacteria 1591
617 Ga0207667_10013359 3300025949 Bacteria 9400
618 Ga0207667_10045333 3300025949 Bacteria 4658
619 Ga0207667_10232803 3300025949 Bacteria 1886
620 Ga0207651_10000044 3300025960 Bacteria 58072
621 Ga0207651_10061639 3300025960 Bacteria 2610
622 Ga0207712_10000279 3300025961 Bacteria 48635
623 Ga0207712_10038823 3300025961 Bacteria 3258
624 Ga0207668_10000687 3300025972 Bacteria 20761
625 Ga0207668_10092184 3300025972 Bacteria 2229
626 Ga0207640_10000105 3300025981 Bacteria 64812
627 Ga0207640_10000216 3300025981 Bacteria 40557
628 Ga0207658_10001907 3300025986 Bacteria 15607
629 Ga0207658_10039014 3300025986 Bacteria 3425
630 Ga0207677_10000318 3300026023 Bacteria 35197
631 Ga0207703_10000418 3300026035 Bacteria 45072
632 Ga0207703_10006276 3300026035 Bacteria 9506
633 Ga0207703_10035176 3300026035 Bacteria 3980
634 Ga0207703_10374259 3300026035 Bacteria 1316
635 Ga0207639_10007495 3300026041 Bacteria 7445
636 Ga0207639_10246028 3300026041 Bacteria 1557
637 Ga0207639_10264405 3300026041 Bacteria 1506
638 Ga0207639_10278625 3300026041 Bacteria 1470
639 Ga0207678_10005986 3300026067 Bacteria 10821
640 Ga0207678_10007246 3300026067 Bacteria 9837
641 Ga0207678_10008184 3300026067 Bacteria 9222
642 Ga0207678_10014870 3300026067 Bacteria 6845
643 Ga0207678_10033040 3300026067 Bacteria 4508
644 Ga0207678_10087729 3300026067 Bacteria 2659
645 Ga0207708_10004013 3300026075 Bacteria 10826
646 Ga0207702_10000753 3300026078 Bacteria 34590
647 Ga0207702_10081034 3300026078 Bacteria 2818
648 Ga0207702_10159139 3300026078 Bacteria 2061
649 Ga0207641_10001634 3300026088 Bacteria 21851
650 Ga0207641_10068519 3300026088 Bacteria 3043
651 Ga0207641_10423619 3300026088 Bacteria 1282
652 Ga0207648_10007377 3300026089 Bacteria 10826
653 Ga0207648_10056668 3300026089 Bacteria 3419
654 Ga0207648_10161442 3300026089 Bacteria 1979
655 Ga0207676_10000133 3300026095 Bacteria 65766
656 Ga0207676_10015457 3300026095 Bacteria 5506
657 Ga0207676_10078003 3300026095 Bacteria 2681
658 Ga0207674_10001514 3300026116 Bacteria 29977
659 Ga0207674_10037910 3300026116 Bacteria 5008
660 Ga0207674_10066374 3300026116 Bacteria 3634
661 Ga0207674_10083784 3300026116 Bacteria 3187
662 Ga0207674_10428761 3300026116 Bacteria 1278
663 Ga0207675_100011837 3300026118 Bacteria 8155
664 Ga0207675_100152444 3300026118 Bacteria 2201
665 Ga0207675_100252407 3300026118 Bacteria 1707
666 Ga0207683_10000004 3300026121 Bacteria 188086
667 Ga0207683_10003094 3300026121 Bacteria 14533
668 Ga0207683_10035832 3300026121 Bacteria 4316
669 Ga0207698_10009206 3300026142 Bacteria 6283
670 Ga0209281_1000043 3300027111 Bacteria 341543
671 Ga0209281_1000221 3300027111 Bacteria 122380
672 Ga0209281_1000453 3300027111 Bacteria 58584
673 Ga0209389_1000008 3300027296 Bacteria 227385
674 Ga0209389_1000081 3300027296 Bacteria 89601
675 Ga0209371_1000009 3300027312 Bacteria 963030
676 Ga0209371_1000732 3300027312 Bacteria 27595
677 Ga0209371_1001249 3300027312 Bacteria 18174
678 Ga0209371_1002043 3300027312 Bacteria 12066
679 Ga0209589_1000091 3300027357 Bacteria 89601
680 Ga0209489_100096 3300027361 Bacteria 122075
681 Ga0209489_103917 3300027361 Bacteria 28294
682 Ga0209700_100036 3300027363 Bacteria 187888
683 Ga0209282_1000041 3300027666 Bacteria 122268
684 Ga0209282_1000179 3300027666 Bacteria 34839
685 Ga0209282_1070112 3300027666 Bacteria 1913
686 Ga0209998_10000939 3300027717 Bacteria 7414
687 Ga0209813_10001432 3300027866 Bacteria 5390
688 Ga0209813_10006967 3300027866 Bacteria 2806
689 Ga0209974_10005431 3300027876 Bacteria 4482
690 Ga0207428_10000218 3300027907 Bacteria 79728
691 Ga0207428_10002942 3300027907 Bacteria 16869
692 Ga0268266_10001063 3300028379 Bacteria 34421
693 Ga0268266_10005424 3300028379 Bacteria 11894
694 Ga0268266_10120870 3300028379 Bacteria 2331
695 Ga0268266_10122747 3300028379 Bacteria 2313
696 Ga0268265_10000194 3300028380 Bacteria 70928
697 Ga0268265_10168309 3300028380 Bacteria 1870
698 Ga0268264_10000393 3300028381 Bacteria 63015
699 Ga0268264_10089016 3300028381 Bacteria 2658
700 Ga0307515_10000023 3300028794 Bacteria 400846
701 Ga0268256_1000010 3300030500 Bacteria 963034
702 Ga0268256_1000660 3300030500 Bacteria 26255
703 Ga0268256_1012387 3300030500 Bacteria 2638
704 Ga0265320_10001570 3300031240 Bacteria 16415
705 Ga0265325_10020399 3300031241 Bacteria 3654
706 Ga0265340_10018115 3300031247 Bacteria 3636
707 Ga0265316_10226754 3300031344 Bacteria 1377
708 Ga0307513_10003030 3300031456 Bacteria 22903
709 Ga0307513_10117119 3300031456 Bacteria 2642
710 Ga0307508_10000235 3300031616 Bacteria 67350
711 Ga0265314_10015333 3300031711 Bacteria 6085
712 Ga0265342_10019097 3300031712 Bacteria 4423
713 Ga0316578_10012241 3300031728 Bacteria 4520
714 Ga0307516_10076539 3300031730 Bacteria 3198
715 Ga0307412_10004217 3300031911 Bacteria 8016
716 Ga0307412_10051473 3300031911 Bacteria 2722
717 Ga0307412_10096618 3300031911 Bacteria 2080
718 Ga0315914_1000030 3300031967 Bacteria 102599
719 Ga0307409_100079130 3300031995 Bacteria 2648
720 Ga0307414_10335036 3300032004 Bacteria 1293
721 Ga0307415_100162107 3300032126 Bacteria 1734
722 Ga0307510_10051197 3300033180 Bacteria 4370
723 Ga0307510_10166871 3300033180 Bacteria 1787
724 Ga0315913_1000017 3300033430 Bacteria 102835
725 Ga0315915_1000017 3300033464 Bacteria 148111
726 Ga0373926_0044621 3300035083 Bacteria 1588
727 Ga0373951_0006498 3300035091 Bacteria 2674
728 Ga0373952_0005697 3300035092 Bacteria 2282
729 Ga0373932_0006740 3300035112 Bacteria 2723
730 Ga0373939_0001147 3300035114 Bacteria 6475
731 Ga0373941_0004127 3300035115 Bacteria 3334
732 Ga0373945_0023874 3300035116 Bacteria 2115
733 Ga0373960_0002301 3300035121 Bacteria 4300
734 Ga0373942_0004747 3300035207 Bacteria 3155
735 Ga0373961_0006340 3300035241 Bacteria 2844
736 Ga0373962_0006222 3300035242 Bacteria 2887
737 Ga0316574_0000447 3300035398 Bacteria 16491
738 Ga0373931_0000034 3300035691 Bacteria 86665
739 Ga0373931_0106047 3300035691 Bacteria 1588
740 Ga0373935_0044469 3300035692 Bacteria 2798
741 Ga0373927_0198628 3300035695 Bacteria 1316
742 Ga0373947_0080704 3300035725 Bacteria 2013
743 Ga0373947_0094196 3300035725 Bacteria 1872
744 Ga0373925_0078900 3300037068 Bacteria 2500
745 Ga0395899_0005212 3300037312 Bacteria 10109
746 Ga0395899_0014217 3300037312 Bacteria 6074
747 Ga0395900_0006809 3300037418 Bacteria 11854
748 Ga0395900_0009382 3300037418 Bacteria 10032
749 Ga0395900_0028204 3300037418 Bacteria 5750
750 Ga0395900_0061357 3300037418 Bacteria 3865
751 Ga0395900_0064342 3300037418 Bacteria 3769
752 Ga0395900_0119882 3300037418 Bacteria 2700
753 Ga0395898_0031310 3300037466 Bacteria 5317
754 Ga0395898_0079159 3300037466 Bacteria 3170
755 Ga0395905_0012635 3300037471 Bacteria 8123
756 Ga0395905_0044671 3300037471 Bacteria 4157
757 Ga0395905_0185194 3300037471 Bacteria 1954
758 Ga0395905_0245905 3300037471 Bacteria 1671
759 Ga0395901_0014741 3300038443 Bacteria 7946
760 Ga0395901_0019762 3300038443 Bacteria 6888
761 Ga0395901_0034031 3300038443 Bacteria 5261
762 Ga0395901_0048672 3300038443 Bacteria 4402
763 Ga0395901_0107512 3300038443 Bacteria 2928
764 Ga0395901_0244469 3300038443 Bacteria 1871
765 Ga0436365_0226566 3300039437 Bacteria 1228
766 Ga0436360_0428998 3300039438 Bacteria 19607
767 Ga0439439_0029670 3300041406 Bacteria 1388
768 Ga0439465_0010381 3300041413 Bacteria 2926
769 Ga0451840_11510 3300041497 Bacteria 1202
770 Ga0451846_53461 3300041502 Bacteria 1961
771 Ga0451849_0343204 3300041505 Bacteria 2254
772 Ga0451854_38034 3300041510 Bacteria 1481
773 Ga0452268_28007 3300041907 Bacteria 1563
774 Ga0466972_0000142 3300044658 Bacteria 58711
775 Ga0466965_0041923 3300044683 Bacteria 2256
776 Ga0466966_0000743 3300044684 Bacteria 20686
777 Ga0466961_0000013 3300044693 Bacteria 129640
778 Ga0451576_0000108 3300045051 Bacteria 211233
779 Ga0466967_0223783 3300045976 Bacteria 1789
780 Ga0495617_038070 3300046452 Bacteria 1610
781 Ga0495592_0026735 3300046454 Bacteria 4374
782 Ga0495592_0035379 3300046454 Bacteria 3764
783 Ga0495629_0010621 3300046459 Bacteria 6698
784 Ga0495638_0000398 3300046460 Bacteria 53469
785 Ga0495638_0000984 3300046460 Bacteria 28644
786 Ga0495651_0001455 3300046462 Bacteria 18340
787 Ga0495651_0041355 3300046462 Bacteria 3581
788 Ga0495653_0054937 3300046463 Bacteria 3041
789 Ga0495580_0038736 3300046472 Bacteria 3413
790 Ga0495605_0027289 3300046474 Bacteria 2959
791 Ga0495605_0061921 3300046474 Bacteria 1789
792 Ga0495639_0090084 3300046475 Bacteria 1438
793 Ga0495662_0023492 3300046476 Bacteria 2977
794 Ga0495584_0038495 3300046491 Bacteria 2417
795 Ga0495584_0066931 3300046491 Bacteria 1807
796 Ga0495585_0008429 3300046492 Bacteria 6248
797 Ga0495594_0053341 3300046499 Bacteria 2227
798 Ga0495594_0189411 3300046499 Bacteria 1172
799 Ga0495596_0031129 3300046500 Bacteria 2133
800 Ga0495607_0031344 3300046501 Bacteria 3255
801 Ga0495607_0120054 3300046501 Bacteria 1381
802 Ga0495583_0033212 3300046506 Bacteria 2482
803 Ga0495583_0043839 3300046506 Bacteria 2081
804 Ga0495608_0060068 3300046511 Bacteria 2503
805 Ga0495608_0064835 3300046511 Bacteria 2394
806 Ga0495610_0005846 3300046512 Bacteria 8641
807 Ga0495610_0033707 3300046512 Bacteria 2644
808 Ga0495616_0019931 3300046513 Bacteria 3654
809 Ga0495618_0090406 3300046514 Bacteria 1958
810 Ga0495620_0005040 3300046515 Bacteria 7401
811 Ga0495620_0050099 3300046515 Bacteria 1783
812 Ga0495628_0012367 3300046516 Bacteria 7196
813 Ga0495628_0064312 3300046516 Bacteria 2872
814 Ga0495631_0002044 3300046518 Bacteria 11750
815 Ga0495632_0014778 3300046519 Bacteria 4404
816 Ga0495632_0025306 3300046519 Bacteria 3141
817 Ga0495643_0034038 3300046522 Bacteria 2813
818 Ga0495648_0023485 3300046524 Bacteria 4222
819 Ga0495654_0012329 3300046530 Bacteria 4594
820 Ga0495654_0042125 3300046530 Bacteria 2268
821 Ga0495665_0093167 3300046531 Bacteria 1583
822 Ga0495640_0081289 3300046533 Bacteria 2154
823 Ga0495587_0054702 3300046536 Bacteria 2352
824 Ga0495598_0010805 3300046537 Bacteria 2197
825 Ga0495609_0035152 3300046538 Bacteria 2269
826 Ga0495597_0034925 3300046542 Bacteria 2270
827 Ga0495645_0006446 3300046543 Bacteria 8142
828 Ga0495667_0178930 3300046559 Bacteria 1361
829 Ga0495668_0006092 3300046616 Bacteria 7985
830 Ga0495668_0093064 3300046616 Bacteria 1651
831 Ga0495668_0151443 3300046616 Bacteria 1270
832 Ga0495625_0005382 3300046660 Bacteria 11709
833 Ga0495625_0006283 3300046660 Bacteria 10626
834 Ga0495625_0132238 3300046660 Bacteria 1689
835 Ga0495635_0008179 3300046663 Bacteria 7304
836 Ga0495659_0009205 3300046664 Bacteria 3149
837 Ga0495661_0052588 3300046665 Bacteria 2453
838 Ga0495588_0001146 3300046674 Bacteria 11378
839 Ga0495588_0085757 3300046674 Bacteria 1647
840 Ga0495657_0010464 3300046675 Bacteria 6978
841 Ga0495599_0009888 3300046678 Bacteria 5837
842 Ga0495623_0006513 3300046679 Bacteria 7602
843 Ga0495646_0019580 3300046680 Bacteria 4282
844 Ga0495646_0055602 3300046680 Bacteria 2376
845 Ga0495647_0025057 3300046681 Bacteria 2176
846 Ga0495669_0003796 3300046684 Bacteria 6207
847 Ga0495624_0069333 3300046690 Bacteria 2196
848 Ga0495670_0016624 3300046691 Bacteria 3618
849 Ga0495649_0130167 3300046694 Bacteria 1328
850 Ga0495600_0005780 3300046809 Bacteria 7473
851 Ga0495660_0036980 3300046810 Bacteria 2721
852 Ga0495660_0049199 3300046810 Bacteria 2302
853 Ga0495660_0060603 3300046810 Bacteria 2032
854 Ga0495581_0060439 3300047315 Bacteria 2190
855 Ga0495604_0000939 3300047317 Bacteria 24255
856 Ga0495604_0004637 3300047317 Bacteria 10894
857 Ga0495604_0024899 3300047317 Bacteria 4773
858 Ga0495636_0040488 3300047318 Bacteria 1932
859 Ga0495636_0066614 3300047318 Bacteria 1531
860 Ga0495674_0008253 3300047319 Bacteria 9934
861 Ga0495674_0017976 3300047319 Bacteria 6581
862 Ga0495672_0118403 3300047320 Bacteria 1412
863 Ga0495676_0049415 3300047321 Bacteria 3382
864 Ga0495676_0080633 3300047321 Bacteria 2470
865 Ga0495680_0008716 3300047322 Bacteria 9190
866 Ga0495683_0044834 3300047323 Bacteria 2224
867 Ga0495683_0112830 3300047323 Bacteria 1296
868 Ga0495687_022010 3300047443 Bacteria 3069
869 Ga0495685_048100 3300047447 Bacteria 1450
870 Ga0495681_0004119 3300047470 Bacteria 9993
871 Ga0495681_0068694 3300047470 Bacteria 1612
872 Ga0495684_0054666 3300047471 Bacteria 3045
873 Ga0495684_0064339 3300047471 Bacteria 2787
874 Ga0495686_0014003 3300047472 Bacteria 5542
875 Ga0495686_0062679 3300047472 Bacteria 2305
876 Ga0495602_0022141 3300048088 Bacteria 6228
877 Ga0495602_0153059 3300048088 Bacteria 1810
878 Ga0495615_0005003 3300048090 Bacteria 2356
879 Ga0496100_0000050 3300048903 Bacteria 75449
880 Ga0496100_0000310 3300048903 Bacteria 24113
881 Ga0496100_0042930 3300048903 Bacteria 2890
882 Ga0496101_0000121 3300048904 Bacteria 76264
883 Ga0496101_0010077 3300048904 Bacteria 6230
884 Ga0496101_0051291 3300048904 Bacteria 2972
885 Ga0496101_0124102 3300048904 Bacteria 1955
886 Ga0496102_0000679 3300048905 Bacteria 34025
887 Ga0496102_0002728 3300048905 Bacteria 15045
888 Ga0496102_0010100 3300048905 Bacteria 8120
889 Ga0496102_0090375 3300048905 Bacteria 2834
890 Ga0496102_0224187 3300048905 Bacteria 1772
891 Ga0496102_0269753 3300048905 Bacteria 1604
892 Ga0496102_0471420 3300048905 Bacteria 1176
893 Ga0496103_0000175 3300048906 Bacteria 65716
894 Ga0496103_0000777 3300048906 Bacteria 23523
895 Ga0496103_0137749 3300048906 Bacteria 1560
896 Ga0496104_0000500 3300048907 Bacteria 33808
897 Ga0496104_0000588 3300048907 Bacteria 31033
898 Ga0496104_0011318 3300048907 Bacteria 7987
899 Ga0496104_0014050 3300048907 Bacteria 7227
900 Ga0496104_0020089 3300048907 Bacteria 6119
901 Ga0496104_0021190 3300048907 Bacteria 5965
902 Ga0496104_0182554 3300048907 Bacteria 2008
903 Ga0496105_0002408 3300048908 Bacteria 13543
904 Ga0496105_0002551 3300048908 Bacteria 13215
905 Ga0496105_0003077 3300048908 Bacteria 12259
906 Ga0496105_0006243 3300048908 Bacteria 9150
907 Ga0496105_0009375 3300048908 Bacteria 7654
908 Ga0496105_0009884 3300048908 Bacteria 7481
909 Ga0496105_0016466 3300048908 Bacteria 5903
910 Ga0496105_0045775 3300048908 Bacteria 3610
911 Ga0496106_0000133 3300048909 Bacteria 55926
912 Ga0496106_0000323 3300048909 Bacteria 33743
913 Ga0496106_0043242 3300048909 Bacteria 3380
914 Ga0496106_0055832 3300048909 Bacteria 2985
915 Ga0496106_0186856 3300048909 Bacteria 1646
916 Ga0496107_0000237 3300048910 Bacteria 29056
917 Ga0496107_0006942 3300048910 Bacteria 7802
918 Ga0496107_0008677 3300048910 Bacteria 7039
919 Ga0496107_0013131 3300048910 Bacteria 5787
920 Ga0496107_0148941 3300048910 Bacteria 1731
921 Ga0496107_0162931 3300048910 Bacteria 1653
922 Ga0496108_0001888 3300048911 Bacteria 16784
923 Ga0496108_0024837 3300048911 Bacteria 4934
924 Ga0496108_0038602 3300048911 Bacteria 3979
925 Ga0496108_0057474 3300048911 Bacteria 3269
926 Ga0496109_0000493 3300048912 Bacteria 33784
927 Ga0496109_0000952 3300048912 Bacteria 23938
928 Ga0496109_0001602 3300048912 Bacteria 18880
929 Ga0496109_0041234 3300048912 Bacteria 4182
930 Ga0496109_0049410 3300048912 Bacteria 3829
931 Ga0496109_0190810 3300048912 Bacteria 1925
932 Ga0496109_0192867 3300048912 Bacteria 1914
933 Ga0496110_0003720 3300048913 Bacteria 11747
934 Ga0496110_0003830 3300048913 Bacteria 11584
935 Ga0496110_0014142 3300048913 Bacteria 6619
936 Ga0496110_0064390 3300048913 Bacteria 3240
937 Ga0496110_0152174 3300048913 Bacteria 2095
938 Ga0496111_0001343 3300048914 Bacteria 13890
939 Ga0496111_0009718 3300048914 Bacteria 6430
940 Ga0496111_0066787 3300048914 Bacteria 2612
941 Ga0496111_0184353 3300048914 Bacteria 1552
942 Ga0496112_0011990 3300048915 Bacteria 7947
943 Ga0496112_0033461 3300048915 Bacteria 4997
944 Ga0496112_0042530 3300048915 Bacteria 4445
945 Ga0496112_0047993 3300048915 Bacteria 4188
946 Ga0496113_0000869 3300048916 Bacteria 15820
947 Ga0496113_0012388 3300048916 Bacteria 5730
948 Ga0496113_0032115 3300048916 Bacteria 3814
949 Ga0496113_0090154 3300048916 Bacteria 2361
950 Ga0496113_0124584 3300048916 Bacteria 2017
951 Ga0496114_0002721 3300048917 Bacteria 13500
952 Ga0496114_0026653 3300048917 Bacteria 4734
953 Ga0496114_0137983 3300048917 Bacteria 2109
954 Ga0496115_0001322 3300048918 Bacteria 17672
955 Ga0496115_0001562 3300048918 Bacteria 16472
956 Ga0496115_0009975 3300048918 Bacteria 7076
957 Ga0496115_0041219 3300048918 Bacteria 3673
958 Ga0496115_0064682 3300048918 Bacteria 2953
959 Ga0496115_0146054 3300048918 Bacteria 1952
960 Ga0496116_0000026 3300048919 Bacteria 450803
961 Ga0496116_0051378 3300048919 Bacteria 2739
962 Ga0496116_0060520 3300048919 Bacteria 2456
963 Ga0496116_0076919 3300048919 Bacteria 2088
964 Ga0496116_0082859 3300048919 Bacteria 1982
965 Ga0496117_0000002 3300048920 Bacteria 2483758
966 Ga0496117_0028675 3300048920 Bacteria 4307
967 Ga0496117_0083200 3300048920 Bacteria 2093
968 Ga0496117_0110951 3300048920 Bacteria 1708
969 Ga0496117_0162863 3300048920 Bacteria 1304
970 Ga0496118_0002844 3300048921 Bacteria 22597
971 Ga0496118_0014526 3300048921 Bacteria 7364
972 Ga0496118_0016840 3300048921 Bacteria 6680
973 Ga0496118_0022202 3300048921 Bacteria 5558
974 Ga0496118_0048224 3300048921 Bacteria 3293
975 Ga0496119_0010067 3300048922 Bacteria 7995
976 Ga0496119_0014918 3300048922 Bacteria 6038
977 Ga0496119_0021542 3300048922 Bacteria 4654
978 Ga0496120_0000034 3300048923 Bacteria 215228
979 Ga0496120_0000455 3300048923 Bacteria 64606
980 Ga0496120_0025451 3300048923 Bacteria 3672
981 Ga0496120_0077220 3300048923 Bacteria 1813
982 Ga0496120_0152319 3300048923 Bacteria 1161
983 Ga0496121_0000220 3300048924 Bacteria 123930
984 Ga0496121_0071800 3300048924 Bacteria 2782
985 Ga0496121_0080858 3300048924 Bacteria 2574
986 Ga0496122_0000001 3300048925 Bacteria 1827766
987 Ga0496122_0035793 3300048925 Bacteria 4030
988 Ga0496122_0059858 3300048925 Bacteria 2809
989 Ga0496123_0000001 3300048926 Bacteria 1831497
990 Ga0496123_0014463 3300048926 Bacteria 6539
991 Ga0496123_0045453 3300048926 Bacteria 2991
992 Ga0496123_0142329 3300048926 Bacteria 1309
993 Ga0496124_0000083 3300048927 Bacteria 207798
994 Ga0496124_0002875 3300048927 Bacteria 21765
995 Ga0496124_0013228 3300048927 Bacteria 8070
996 Ga0496124_0102824 3300048927 Bacteria 2311
997 Ga0496125_0000001 3300048928 Bacteria 1766138
998 Ga0496125_0009589 3300048928 Bacteria 9907
999 Ga0496125_0029586 3300048928 Bacteria 4919
1000 Ga0496125_0064016 3300048928 Bacteria 2927
1001 Ga0496126_0000069 3300048929 Bacteria 246935
1002 Ga0496126_0007323 3300048929 Bacteria 12119
1003 Ga0496126_0057065 3300048929 Bacteria 3527
1004 Ga0496126_0188432 3300048929 Bacteria 1748
1005 Ga0496126_0262819 3300048929 Bacteria 1434
1006 Ga0496126_0378317 3300048929 Bacteria 1153
1007 Ga0495678_042185 3300049459 Bacteria 1820
1008 Ga0495682_0045915 3300049460 Bacteria 1596
1009 Ga0501031_0000006 3300049568 Bacteria 176019
1010 Ga0501032_0000016 3300049569 Bacteria 174688
1011 Ga0501032_0059787 3300049569 Bacteria 2557
1012 Ga0501033_0000101 3300049570 Bacteria 81870
1013 Ga0501033_0061814 3300049570 Bacteria 2759
1014 Ga0501034_0000168 3300049571 Bacteria 122667
1015 Ga0501034_0010519 3300049571 Bacteria 9635
1016 Ga0501034_0030869 3300049571 Bacteria 5446
1017 Ga0501034_0137323 3300049571 Bacteria 2425
1018 Ga0501036_0000019 3300049572 Bacteria 118632
1019 Ga0501036_0099560 3300049572 Bacteria 2458
1020 Ga0501037_0000013 3300049573 Bacteria 174688
1021 Ga0501037_0000895 3300049573 Bacteria 22218
1022 Ga0501037_0143061 3300049573 Bacteria 1711
1023 Ga0501038_0000012 3300049574 Bacteria 174688
1024 Ga0501038_0011999 3300049574 Bacteria 7912
1025 Ga0501038_0165827 3300049574 Bacteria 1792
1026 Ga0501039_0000019 3300049575 Bacteria 174688
1027 Ga0501039_0079324 3300049575 Bacteria 2554
1028 Ga0501040_0148787 3300049576 Bacteria 1651
1029 Ga0501042_0019008 3300049578 Bacteria 4768
1030 Ga0501043_0000045 3300049579 Bacteria 114003
1031 Ga0501043_0000209 3300049579 Bacteria 53858
1032 Ga0501043_0048636 3300049579 Bacteria 3334
1033 Ga0501043_0132686 3300049579 Bacteria 1952
1034 Ga0501047_0003738 3300049581 Bacteria 14331
1035 Ga0501047_0023848 3300049581 Bacteria 5875
1036 Ga0501047_0234199 3300049581 Bacteria 1688
1037 Ga0501069_0000007 3300049585 Bacteria 182820
1038 Ga0501070_0000758 3300049586 Bacteria 29461
1039 Ga0501070_0003344 3300049586 Bacteria 13925
1040 Ga0501070_0021164 3300049586 Bacteria 5458
1041 Ga0501070_0059883 3300049586 Bacteria 3156
1042 Ga0501070_0084105 3300049586 Bacteria 2634
1043 Ga0501070_0131515 3300049586 Bacteria 2067
1044 Ga0501071_0013377 3300049587 Bacteria 5590
1045 Ga0501071_0091102 3300049587 Bacteria 2240
1046 Ga0501072_0036236 3300049588 Bacteria 3867
1047 Ga0501074_0000047 3300049590 Bacteria 57039
1048 Ga0501074_0010115 3300049590 Bacteria 6849
1049 Ga0501074_0047884 3300049590 Bacteria 3089
1050 Ga0501076_0006762 3300049592 Bacteria 8322
1051 Ga0501080_0005487 3300049742 Bacteria 11319
1052 Ga0501080_0009780 3300049742 Bacteria 8760
1053 Ga0501080_0203467 3300049742 Bacteria 1817
1054 Ga0501083_0000029 3300049744 Bacteria 107507
1055 Ga0501280_002770 3300049776 Bacteria 2831
1056 Ga0501035_0000060 3300049822 Bacteria 132293
1057 Ga0501035_0000081 3300049822 Bacteria 117453
1058 Ga0501035_0004420 3300049822 Bacteria 13345
1059 Ga0501035_0029235 3300049822 Bacteria 5025
1060 Ga0501035_0044246 3300049822 Bacteria 4010
1061 Ga0501035_0092164 3300049822 Bacteria 2666
1062 Ga0501044_0000009 3300049823 Bacteria 270072
1063 Ga0501044_0000029 3300049823 Bacteria 176024
1064 Ga0501044_0052912 3300049823 Bacteria 4179
1065 Ga0501044_0252875 3300049823 Bacteria 1702
1066 Ga0501045_0006727 3300049824 Bacteria 7965
1067 nmdc:mga03683_1100_c1 3300050489 Bacteria 3363
1068 nmdc:mga03683_409_c1 3300050489 Bacteria 12382
1069 nmdc:mga03683_83526_c1 3300050489 Bacteria 1383
1070 nmdc:mga03n38_12016_c1 3300050490 Bacteria 3245
1071 nmdc:mga00v17_106281_c1 3300050491 Bacteria 1777
1072 nmdc:mga00v17_108403_c1 3300050491 Bacteria 1760
1073 nmdc:mga00v17_130499_c1 3300050491 Bacteria 1606
1074 nmdc:mga00v17_180316_c1 3300050491 Bacteria 1363
1075 nmdc:mga00v17_26_c1 3300050491 Bacteria 37082
1076 nmdc:mga00v17_30112_c1 3300050491 Bacteria 3191
1077 nmdc:mga00v17_47_c1 3300050491 Bacteria 77934
1078 nmdc:mga0yw44_11106_c1 3300050492 Bacteria 4630
1079 nmdc:mga0yw44_165685_c1 3300050492 Bacteria 1449
1080 nmdc:mga0yw44_18361_c1 3300050492 Bacteria 3828
1081 nmdc:mga0yw44_185747_c1 3300050492 Bacteria 1370
1082 nmdc:mga0yw44_31900_c1 3300050492 Bacteria 3067
1083 nmdc:mga0yw44_3820_c1 3300050492 Bacteria 6764
1084 nmdc:mga0yw44_3977_c1 3300050492 Bacteria 6679
1085 nmdc:mga0yw44_81306_c1 3300050492 Bacteria 2031
1086 nmdc:mga0yw44_831_c1 3300050492 Bacteria 11561
1087 nmdc:mga0yw44_8596_c1 3300050492 Bacteria 5098
1088 nmdc:mga0k408_143738_c1 3300050493 Bacteria 1420
1089 nmdc:mga0k408_40451_c1 3300050493 Bacteria 2682
1090 nmdc:mga0k408_7428_c1 3300050493 Bacteria 5851
1091 nmdc:mga0k408_9138_c1 3300050493 Bacteria 5339
1092 nmdc:mga06z11_114704_c1 3300050494 Bacteria 1496
1093 nmdc:mga06z11_16404_c1 3300050494 Bacteria 3336
1094 nmdc:mga06z11_176767_c1 3300050494 Bacteria 1229
1095 nmdc:mga06z11_18791_c1 3300050494 Bacteria 3165
1096 nmdc:mga06z11_3255_c1 3300050494 Bacteria 6275
1097 nmdc:mga06z11_91170_c1 3300050494 Bacteria 1655
1098 nmdc:mga06z11_92439_c1 3300050494 Bacteria 1645
1099 nmdc:mga04h51_23837_c1 3300050495 Bacteria 1868
1100 nmdc:mga04h51_32896_c1 3300050495 Bacteria 1648
1101 nmdc:mga04h51_4064_c1 3300050495 Bacteria 3606
1102 nmdc:mga07m45_108881_c1 3300050496 Bacteria 1595
1103 nmdc:mga07m45_23668_c2 3300050496 Bacteria 2490
1104 nmdc:mga07m45_30403_c1 3300050496 Bacteria 2992
1105 nmdc:mga07m45_3358_c1 3300050496 Bacteria 7713
1106 nmdc:mga07m45_36073_c1 3300050496 Bacteria 2753
1107 nmdc:mga07m45_50498_c1 3300050496 Bacteria 2344
1108 nmdc:mga07m45_61401_c1 3300050496 Bacteria 2129
1109 nmdc:mga07m45_64686_c1 3300050496 Bacteria 2076
1110 nmdc:mga07m45_91680_c1 3300050496 Bacteria 1741
1111 nmdc:mga05p37_41138_c1 3300050507 Bacteria 5675
1112 nmdc:mga05p37_83860_c1 3300050507 Bacteria 3926
1113 nmdc:mga05p37_94463_c1 3300050507 Bacteria 3684
1114 nmdc:mga09592_17221_c1 3300050508 Bacteria 5918
1115 nmdc:mga09592_76716_c1 3300050508 Bacteria 2842
1116 nmdc:mga0qj67_34351_c1 3300050509 Bacteria 3961
1117 nmdc:mga06r32_14671_c1 3300050510 Bacteria 7112
1118 nmdc:mga06r32_272496_c1 3300050510 Bacteria 1680
1119 nmdc:mga06r32_8869_c1 3300050510 Bacteria 9064
1120 nmdc:mga08y16_202134_c1 3300050511 Bacteria 2059
1121 nmdc:mga08y16_3032_c1 3300050511 Bacteria 17340
1122 nmdc:mga08y16_409700_c1 3300050511 Bacteria 1386
1123 nmdc:mga08y16_706_c1 3300050511 Bacteria 31784
1124 nmdc:mga0n895_151399_c1 3300050512 Bacteria 2350
1125 nmdc:mga0n895_2736_c1 3300050512 Bacteria 13917
1126 nmdc:mga0rr50_54810_c1 3300050513 Bacteria 2972
1127 nmdc:mga0a205_197_c1 3300050515 Bacteria 22634
1128 nmdc:mga0sz30_148_c1 3300050516 Bacteria 26288
1129 nmdc:mga0sz30_18723_c1 3300050516 Bacteria 2774
1130 nmdc:mga0sz30_57771_c1 3300050516 Bacteria 1654
1131 nmdc:mga0sz30_6454_c1 3300050516 Bacteria 4352
1132 Ga0495601_0013325 3300053077 Bacteria 4942
1133 Ga0495612_0003890 3300053078 Bacteria 6191
1134 Ga0500610_0025694 3300053079 Bacteria 2940
1135 Ga0500610_0072570 3300053079 Bacteria 1795
1136 Ga0495619_0001328 3300053085 Bacteria 16220
1137 Ga0495619_0013741 3300053085 Bacteria 5106
1138 Ga0500578_0060890 3300053086 Bacteria 2410
1139 Ga0500643_000015 3300053087 Bacteria 310312
1140 Ga0500643_012824 3300053087 Bacteria 2988
1141 Ga0500644_0040454 3300053088 Bacteria 1543
1142 Ga0500581_120407 3300053089 Bacteria 1268
1143 Ga0500566_0000082 3300053094 Bacteria 47150
1144 Ga0500641_0000376 3300053096 Bacteria 16585
1145 Ga0500641_0004622 3300053096 Bacteria 4866
1146 Ga0500641_0017367 3300053096 Bacteria 2690
1147 Ga0500641_0026306 3300053096 Bacteria 2258
1148 Ga0500650_0013072 3300053098 Bacteria 3471
1149 Ga0500556_0000002 3300053104 Bacteria 773626
1150 Ga0500557_000022 3300053105 Bacteria 88506
1151 Ga0500557_018021 3300053105 Bacteria 1962
1152 Ga0500562_032766 3300053108 Bacteria 1372
1153 Ga0500569_005635 3300053109 Bacteria 2700
1154 Ga0500569_029724 3300053109 Bacteria 1524
1155 Ga0500592_001501 3300053116 Bacteria 3780
1156 Ga0500594_0015572 3300053118 Bacteria 1835
1157 Ga0500642_0000016 3300053130 Bacteria 176560
1158 Ga0500642_0000166 3300053130 Bacteria 27296
1159 Ga0500658_0000625 3300053134 Bacteria 14656
1160 Ga0500659_0043180 3300053135 Bacteria 2446
1161 Ga0500559_0020582 3300053136 Bacteria 2790
1162 Ga0500568_0000035 3300053139 Bacteria 137912
1163 Ga0500568_0002154 3300053139 Bacteria 11868
1164 Ga0500568_0013231 3300053139 Bacteria 3764
1165 Ga0500568_0018845 3300053139 Bacteria 3010
1166 Ga0500577_0000373 3300053142 Bacteria 11382
1167 Ga0500577_0043761 3300053142 Bacteria 1647
1168 Ga0500588_0072814 3300053146 Bacteria 1131
1169 Ga0500604_0000742 3300053151 Bacteria 8922
1170 Ga0500604_0020569 3300053151 Bacteria 1859
1171 Ga0500616_0001686 3300053153 Bacteria 20346
1172 Ga0500616_0014259 3300053153 Bacteria 4573
1173 Ga0500622_0000668 3300053156 Bacteria 30285
1174 Ga0500622_0010502 3300053156 Bacteria 5080
1175 Ga0500624_001406 3300053157 Bacteria 3975
1176 Ga0500627_0035377 3300053158 Bacteria 2121
1177 Ga0500627_0039600 3300053158 Bacteria 2019
1178 Ga0500627_0052474 3300053158 Bacteria 1780
1179 Ga0500634_0004710 3300053161 Bacteria 6365
1180 Ga0500636_0000036 3300053177 Bacteria 71714
1181 Ga0500636_0003407 3300053177 Bacteria 8946
1182 Ga0500611_006845 3300053727 Bacteria 1683
1183 Ga0500625_006836 3300053729 Bacteria 4900
1184 Ga0500645_012516 3300053730 Bacteria 2739
1185 Ga0500645_028625 3300053730 Bacteria 1685
1186 Ga0500645_039163 3300053730 Bacteria 1405
1187 Ga0500609_003310 3300053731 Bacteria 2272
1188 Ga0500601_000258 3300053737 Bacteria 10116
1189 Ga0501084_0001734 3300054114 Bacteria 17311
1190 Ga0587090_004716 3300059510 Bacteria 1671
1191 Ga0501082_0000053 3300060353 Bacteria 82895
1192 Ga0501082_0007228 3300060353 Bacteria 9573
1193 Ga0501082_0360620 3300060353 Bacteria 1268
1194 Ga0530510_0041559 3300061734 Bacteria 3320

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0034031 Ga0395901_0034031_932_1984 310
2 3300037312 Ga0395899_0005212 Ga0395899_0005212_7964_9172 323
3 3300037418 Ga0395900_0009382 Ga0395900_0009382_8421_9629 323
4 3300037418 Ga0395900_0064342 Ga0395900_0064342_748_1839 323
5 3300037466 Ga0395898_0031310 Ga0395898_0031310_1821_3029 323
6 3300037466 Ga0395898_0079159 Ga0395898_0079159_1573_2664 323
7 3300005543 Ga0070672_100134004 Ga0070672_1001340042 336
8 3300006358 Ga0068871_100183985 Ga0068871_1001839853 336
9 3300009176 Ga0105242_10136056 Ga0105242_101360562 336
10 3300014326 Ga0157380_10131629 Ga0157380_101316292 336
11 3300005356 Ga0070674_100184190 Ga0070674_1001841902 338
12 3300025937 Ga0207669_10207167 Ga0207669_102071671 338
13 3300026121 Ga0207683_10035832 Ga0207683_100358322 338
14 3300027312 Ga0209371_1000009 Ga0209371_1000009815 340
15 3300027312 Ga0209371_1000732 Ga0209371_10007327 340
16 3300030500 Ga0268256_1000010 Ga0268256_1000010814 340
17 3300049571 Ga0501034_0010519 Ga0501034_0010519_8374_9480 340
18 3300031241 Ga0265325_10020399 Ga0265325_100203992 341
19 3300031247 Ga0265340_10018115 Ga0265340_100181151 341
20 3300031712 Ga0265342_10019097 Ga0265342_100190974 341
21 3300005458 Ga0070681_10182879 Ga0070681_101828791 342
22 3300013306 Ga0163162_10375085 Ga0163162_103750852 342
23 3300013307 Ga0157372_10395714 Ga0157372_103957142 342
24 3300026116 Ga0207674_10083784 Ga0207674_100837843 342
25 3300005937 Ga0081455_10057110 Ga0081455_100571102 343
26 3300006844 Ga0075428_100001096 Ga0075428_10000109619 343
27 3300006847 Ga0075431_100002284 Ga0075431_1000022844 343
28 3300009094 Ga0111539_10000835 Ga0111539_1000083514 343
29 3300009147 Ga0114129_10005100 Ga0114129_1000510014 343
30 3300035725 Ga0373947_0080704 Ga0373947_0080704_21_1082 343
31 3300039437 Ga0436365_0226566 Ga0436365_0226566_118_1203 343
32 3300045976 Ga0466967_0223783 Ga0466967_0223783_374_1465 343
33 3300046454 Ga0495592_0035379 Ga0495592_0035379_1067_2155 343
34 3300046462 Ga0495651_0001455 Ga0495651_0001455_16581_17669 343
35 3300046499 Ga0495594_0189411 Ga0495594_0189411_26_1114 343
36 3300046511 Ga0495608_0060068 Ga0495608_0060068_1067_2155 343
37 3300046516 Ga0495628_0064312 Ga0495628_0064312_329_1417 343
38 3300046543 Ga0495645_0006446 Ga0495645_0006446_2865_3953 343
39 3300046663 Ga0495635_0008179 Ga0495635_0008179_3117_4205 343
40 3300046675 Ga0495657_0010464 Ga0495657_0010464_1160_2248 343
41 3300046679 Ga0495623_0006513 Ga0495623_0006513_3581_4669 343
42 3300046680 Ga0495646_0019580 Ga0495646_0019580_1999_3087 343
43 3300046809 Ga0495600_0005780 Ga0495600_0005780_5601_6689 343
44 3300047317 Ga0495604_0000939 Ga0495604_0000939_18577_19665 343
45 3300047319 Ga0495674_0017976 Ga0495674_0017976_5070_6158 343
46 3300047322 Ga0495680_0008716 Ga0495680_0008716_3612_4700 343
47 3300047471 Ga0495684_0054666 Ga0495684_0054666_615_1703 343
48 3300048088 Ga0495602_0022141 Ga0495602_0022141_1393_2481 343
49 3300053094 Ga0500566_0000082 Ga0500566_0000082_8011_9099 343
50 3300005290 Ga0065712_10111484 Ga0065712_101114842 344
51 3300005340 Ga0070689_100076641 Ga0070689_1000766412 344
52 3300005343 Ga0070687_100039459 Ga0070687_1000394592 344
53 3300005355 Ga0070671_100129759 Ga0070671_1001297591 344
54 3300005356 Ga0070674_100026259 Ga0070674_1000262592 344
55 3300005457 Ga0070662_100303483 Ga0070662_1003034831 344
56 3300005543 Ga0070672_100118231 Ga0070672_1001182311 344
57 3300005544 Ga0070686_100087073 Ga0070686_1000870731 344
58 3300005577 Ga0068857_100031521 Ga0068857_1000315212 344
59 3300005618 Ga0068864_100006199 Ga0068864_1000061993 344
60 3300005843 Ga0068860_100315040 Ga0068860_1003150401 344
61 3300005985 Ga0081539_10029652 Ga0081539_100296522 344
62 3300006048 Ga0075363_100004780 Ga0075363_1000047803 344
63 3300006051 Ga0075364_10016981 Ga0075364_100169814 344
64 3300006178 Ga0075367_10021848 Ga0075367_100218484 344
65 3300009094 Ga0111539_10043003 Ga0111539_100430032 344
66 3300009101 Ga0105247_10010587 Ga0105247_100105873 344
67 3300009148 Ga0105243_10111788 Ga0105243_101117882 344
68 3300014325 Ga0163163_10058876 Ga0163163_100588762 344
69 3300014969 Ga0157376_10409954 Ga0157376_104099541 344
70 3300025254 Ga0209148_1000289 Ga0209148_10002898 344
71 3300025272 Ga0209455_1001308 Ga0209455_10013084 344
72 3300025295 Ga0209564_1004532 Ga0209564_10045328 344
73 3300025297 Ga0209758_1000677 Ga0209758_100067717 344
74 3300025304 Ga0209257_1029619 Ga0209257_10296192 344
75 3300025900 Ga0207710_10003942 Ga0207710_100039426 344
76 3300025918 Ga0207662_10029205 Ga0207662_100292052 344
77 3300025926 Ga0207659_10094800 Ga0207659_100948002 344
78 3300025935 Ga0207709_10060946 Ga0207709_100609462 344
79 3300025937 Ga0207669_10026710 Ga0207669_100267102 344
80 3300025940 Ga0207691_10016974 Ga0207691_100169748 344
81 3300025942 Ga0207689_10047161 Ga0207689_100471613 344
82 3300026095 Ga0207676_10015457 Ga0207676_100154571 344
83 3300026116 Ga0207674_10037910 Ga0207674_100379102 344
84 3300026116 Ga0207674_10066374 Ga0207674_100663742 344
85 3300028381 Ga0268264_10089016 Ga0268264_100890161 344
86 3300033180 Ga0307510_10166871 Ga0307510_101668712 344
87 3300046462 Ga0495651_0041355 Ga0495651_0041355_162_1253 344
88 3300046511 Ga0495608_0064835 Ga0495608_0064835_250_1341 344
89 3300046533 Ga0495640_0081289 Ga0495640_0081289_865_1956 344
90 3300046674 Ga0495588_0085757 Ga0495588_0085757_234_1325 344
91 3300046690 Ga0495624_0069333 Ga0495624_0069333_839_1930 344
92 3300047315 Ga0495581_0060439 Ga0495581_0060439_131_1222 344
93 3300047317 Ga0495604_0004637 Ga0495604_0004637_2778_3869 344
94 3300047318 Ga0495636_0040488 Ga0495636_0040488_796_1884 344
95 3300047321 Ga0495676_0080633 Ga0495676_0080633_584_1675 344
96 3300048088 Ga0495602_0153059 Ga0495602_0153059_394_1485 344
97 3300048908 Ga0496105_0002408 Ga0496105_0002408_8915_10006 344
98 3300048919 Ga0496116_0076919 Ga0496116_0076919_41_1132 344
99 3300048922 Ga0496119_0014918 Ga0496119_0014918_3795_4886 344
100 3300048929 Ga0496126_0057065 Ga0496126_0057065_2018_3109 344
101 3300049571 Ga0501034_0137323 Ga0501034_0137323_697_1803 344
102 3300049574 Ga0501038_0165827 Ga0501038_0165827_536_1642 344
103 3300049579 Ga0501043_0048636 Ga0501043_0048636_1052_2158 344
104 3300049581 Ga0501047_0023848 Ga0501047_0023848_3393_4499 344
105 3300049581 Ga0501047_0234199 Ga0501047_0234199_185_1291 344
106 3300049586 Ga0501070_0059883 Ga0501070_0059883_707_1885 344
107 3300049822 Ga0501035_0029235 Ga0501035_0029235_839_2017 344
108 3300050490 nmdc:mga03n38_12016_c1 nmdc:mga03n38_12016_c1_1355_2443 344
109 3300050494 nmdc:mga06z11_114704_c1 nmdc:mga06z11_114704_c1_112_1200 344
110 3300050496 nmdc:mga07m45_91680_c1 nmdc:mga07m45_91680_c1_188_1276 344
111 3300053096 Ga0500641_0004622 Ga0500641_0004622_1008_2096 344
112 3300053136 Ga0500559_0020582 Ga0500559_0020582_46_1137 344
113 3300053142 Ga0500577_0043761 Ga0500577_0043761_298_1386 344
114 3300053151 Ga0500604_0020569 Ga0500604_0020569_648_1736 344
115 3300053158 Ga0500627_0039600 Ga0500627_0039600_226_1317 344
116 3300060353 Ga0501082_0000053 Ga0501082_0000053_56821_57909 344
117 3300003215 JGI25153J46596_10026971 JGI25153J46596_100269712 345
118 3300005262 Ga0065165_1000780 Ga0065165_10007806 345
119 3300005445 Ga0070708_100257647 Ga0070708_1002576472 345
120 3300005471 Ga0070698_100011265 Ga0070698_10001126512 345
121 3300009147 Ga0114129_10135026 Ga0114129_101350261 345
122 3300013306 Ga0163162_10380472 Ga0163162_103804722 345
123 3300014326 Ga0157380_10102839 Ga0157380_101028391 345
124 3300025297 Ga0209758_1012378 Ga0209758_10123783 345
125 3300025299 Ga0209256_1024299 Ga0209256_10242992 345
126 3300025302 Ga0207426_1003500 Ga0207426_10035005 345
127 3300033180 Ga0307510_10051197 Ga0307510_100511974 345
128 3300044684 Ga0466966_0000743 Ga0466966_0000743_18097_19188 345
129 3300044693 Ga0466961_0000013 Ga0466961_0000013_65555_66646 345
130 3300046460 Ga0495638_0000398 Ga0495638_0000398_13677_14768 345
131 3300048904 Ga0496101_0124102 Ga0496101_0124102_128_1231 345
132 3300048905 Ga0496102_0224187 Ga0496102_0224187_490_1593 345
133 3300048907 Ga0496104_0182554 Ga0496104_0182554_101_1204 345
134 3300048908 Ga0496105_0009375 Ga0496105_0009375_2259_3362 345
135 3300048911 Ga0496108_0038602 Ga0496108_0038602_2631_3734 345
136 3300048912 Ga0496109_0041234 Ga0496109_0041234_1521_2624 345
137 3300048913 Ga0496110_0003720 Ga0496110_0003720_9514_10617 345
138 3300048915 Ga0496112_0042530 Ga0496112_0042530_1862_2965 345
139 3300048915 Ga0496112_0047993 Ga0496112_0047993_198_1289 345
140 3300048918 Ga0496115_0041219 Ga0496115_0041219_1856_2959 345
141 3300048924 Ga0496121_0071800 Ga0496121_0071800_710_1801 345
142 3300048926 Ga0496123_0142329 Ga0496123_0142329_20_1111 345
143 3300050492 nmdc:mga0yw44_8596_c1 nmdc:mga0yw44_8596_c1_812_1903 345
144 3300050512 nmdc:mga0n895_151399_c1 nmdc:mga0n895_151399_c1_654_1757 345
145 3300053087 Ga0500643_000015 Ga0500643_000015_20103_21194 345
146 3300053088 Ga0500644_0040454 Ga0500644_0040454_381_1472 345
147 3300053156 Ga0500622_0010502 Ga0500622_0010502_2125_3216 345
148 3300053158 Ga0500627_0052474 Ga0500627_0052474_205_1296 345
149 3300053730 Ga0500645_028625 Ga0500645_028625_530_1621 345
150 iso_pu_bacteria 2841957949 2841958666 345
151 iso_pu_bacteria 2847930680 2847936209 345
152 iso_pu_bacteria 2879083081 2879083705 345
153 iso_pu_bacteria 2906643746 2906651447 345
154 3300001989 JGI24739J22299_10043423 JGI24739J22299_100434232 346
155 3300002739 JGI25158J39367_1000393 JGI25158J39367_10003933 346
156 3300002773 JGI25152J39213_1003706 JGI25152J39213_10037063 346
157 3300002987 JGI25159J45721_1000508 JGI25159J45721_10005083 346
158 3300003187 JGI25151J46595_10000585 JGI25151J46595_1000058525 346
159 3300003187 JGI25151J46595_10001084 JGI25151J46595_1000108417 346
160 3300003215 JGI25153J46596_10001318 JGI25153J46596_100013183 346
161 3300003215 JGI25153J46596_10004290 JGI25153J46596_100042907 346
162 3300003215 JGI25153J46596_10017933 JGI25153J46596_100179333 346
163 3300003354 JGI25160J50197_1000015 JGI25160J50197_100001527 346
164 3300003354 JGI25160J50197_1001146 JGI25160J50197_10011468 346
165 3300003354 JGI25160J50197_1001518 JGI25160J50197_10015182 346
166 3300003354 JGI25160J50197_1005355 JGI25160J50197_10053556 346
167 3300003374 JGI25161J50226_1000005 JGI25161J50226_1000005214 346
168 3300003374 JGI25161J50226_1000120 JGI25161J50226_100012020 346
169 3300003374 JGI25161J50226_1005409 JGI25161J50226_10054091 346
170 3300003771 Ga0055526_1001753 Ga0055526_100175313 346
171 3300003771 Ga0055526_1002151 Ga0055526_10021519 346
172 3300003775 Ga0055524_1011640 Ga0055524_10116403 346
173 3300003775 Ga0055524_1019832 Ga0055524_10198321 346
174 3300003775 Ga0055524_1021731 Ga0055524_10217312 346
175 3300003781 Ga0055536_1002870 Ga0055536_10028706 346
176 3300003790 Ga0055528_1000693 Ga0055528_100069315 346
177 3300003790 Ga0055528_1001185 Ga0055528_10011853 346
178 3300003790 Ga0055528_1005562 Ga0055528_10055626 346
179 3300003792 Ga0055540_1001134 Ga0055540_10011343 346
180 3300003792 Ga0055540_1002353 Ga0055540_10023538 346
181 3300003792 Ga0055540_1014218 Ga0055540_10142182 346
182 3300004625 Ga0055543_1000012 Ga0055543_100001228 346
183 3300004625 Ga0055543_1000155 Ga0055543_100015530 346
184 3300004625 Ga0055543_1000631 Ga0055543_10006314 346
185 3300005262 Ga0065165_1000125 Ga0065165_1000125113 346
186 3300005262 Ga0065165_1003182 Ga0065165_10031827 346
187 3300005262 Ga0065165_1013609 Ga0065165_10136092 346
188 3300005439 Ga0070711_100032827 Ga0070711_1000328272 346
189 3300005539 Ga0068853_100039010 Ga0068853_1000390104 346
190 3300005548 Ga0070665_100016716 Ga0070665_1000167164 346
191 3300005548 Ga0070665_100424974 Ga0070665_1004249741 346
192 3300005563 Ga0068855_100110372 Ga0068855_1001103721 346
193 3300005937 Ga0081455_10057110 Ga0081455_100571101 346
194 3300005983 Ga0081540_1056049 Ga0081540_10560492 346
195 3300006038 Ga0075365_10001809 Ga0075365_100018095 346
196 3300006038 Ga0075365_10016973 Ga0075365_100169733 346
197 3300006038 Ga0075365_10086187 Ga0075365_100861871 346
198 3300006038 Ga0075365_10137785 Ga0075365_101377853 346
199 3300006051 Ga0075364_10000060 Ga0075364_1000006019 346
200 3300006177 Ga0075362_10058503 Ga0075362_100585032 346
201 3300006178 Ga0075367_10014606 Ga0075367_100146063 346
202 3300006186 Ga0075369_10009712 Ga0075369_100097122 346
203 3300006195 Ga0075366_10030387 Ga0075366_100303873 346
204 3300006195 Ga0075366_10031004 Ga0075366_100310042 346
205 3300006195 Ga0075366_10084443 Ga0075366_100844432 346
206 3300006353 Ga0075370_10055381 Ga0075370_100553812 346
207 3300009093 Ga0105240_10000032 Ga0105240_10000032192 346
208 3300009093 Ga0105240_10087091 Ga0105240_100870913 346
209 3300009148 Ga0105243_10059291 Ga0105243_100592912 346
210 3300009545 Ga0105237_10000754 Ga0105237_100007543 346
211 3300009545 Ga0105237_10053311 Ga0105237_100533112 346
212 3300009551 Ga0105238_10095640 Ga0105238_100956403 346
213 3300009765 Ga0123341_1003307 Ga0123341_100330713 346
214 3300009766 Ga0123342_1012832 Ga0123342_10128327 346
215 3300010375 Ga0105239_10003796 Ga0105239_100037963 346
216 3300013104 Ga0157370_10003636 Ga0157370_100036362 346
217 3300013105 Ga0157369_10102912 Ga0157369_101029122 346
218 3300015265 Ga0182005_1004008 Ga0182005_10040084 346
219 3300017792 Ga0163161_10107639 Ga0163161_101076392 346
220 3300025208 Ga0209436_100041 Ga0209436_10004115 346
221 3300025245 Ga0207425_1008603 Ga0207425_10086032 346
222 3300025258 Ga0209129_1001627 Ga0209129_10016275 346
223 3300025258 Ga0209129_1003249 Ga0209129_10032491 346
224 3300025258 Ga0209129_1006654 Ga0209129_10066543 346
225 3300025273 Ga0209673_1000060 Ga0209673_1000060236 346
226 3300025273 Ga0209673_1004110 Ga0209673_10041104 346
227 3300025273 Ga0209673_1011460 Ga0209673_10114602 346
228 3300025273 Ga0209673_1017145 Ga0209673_10171452 346
229 3300025284 Ga0209130_1000018 Ga0209130_1000018243 346
230 3300025284 Ga0209130_1000030 Ga0209130_1000030144 346
231 3300025292 Ga0209676_1000100 Ga0209676_1000100153 346
232 3300025292 Ga0209676_1038379 Ga0209676_10383792 346
233 3300025294 Ga0209025_1001184 Ga0209025_100118419 346
234 3300025295 Ga0209564_1000281 Ga0209564_100028179 346
235 3300025295 Ga0209564_1000937 Ga0209564_100093728 346
236 3300025295 Ga0209564_1001052 Ga0209564_100105217 346
237 3300025297 Ga0209758_1000637 Ga0209758_100063716 346
238 3300025297 Ga0209758_1001377 Ga0209758_100137719 346
239 3300025297 Ga0209758_1009047 Ga0209758_10090473 346
240 3300025297 Ga0209758_1009123 Ga0209758_10091233 346
241 3300025298 Ga0209050_1009722 Ga0209050_10097226 346
242 3300025299 Ga0209256_1001295 Ga0209256_100129512 346
243 3300025299 Ga0209256_1002288 Ga0209256_10022883 346
244 3300025299 Ga0209256_1009106 Ga0209256_10091062 346
245 3300025302 Ga0207426_1000044 Ga0207426_1000044146 346
246 3300025302 Ga0207426_1000047 Ga0207426_1000047256 346
247 3300025302 Ga0207426_1000268 Ga0207426_100026814 346
248 3300025303 Ga0209051_1000236 Ga0209051_100023671 346
249 3300025303 Ga0209051_1008829 Ga0209051_10088293 346
250 3300025303 Ga0209051_1012789 Ga0209051_10127893 346
251 3300025304 Ga0209257_1002011 Ga0209257_10020119 346
252 3300025904 Ga0207647_10059232 Ga0207647_100592323 346
253 3300025913 Ga0207695_10000024 Ga0207695_10000024193 346
254 3300025913 Ga0207695_10146083 Ga0207695_101460832 346
255 3300025914 Ga0207671_10000718 Ga0207671_1000071828 346
256 3300025914 Ga0207671_10116073 Ga0207671_101160732 346
257 3300025915 Ga0207693_10046639 Ga0207693_100466392 346
258 3300025923 Ga0207681_10076472 Ga0207681_100764722 346
259 3300025924 Ga0207694_10020011 Ga0207694_100200111 346
260 3300025926 Ga0207659_10085461 Ga0207659_100854611 346
261 3300025949 Ga0207667_10232803 Ga0207667_102328032 346
262 3300026041 Ga0207639_10264405 Ga0207639_102644051 346
263 3300026067 Ga0207678_10087729 Ga0207678_100877292 346
264 3300028380 Ga0268265_10168309 Ga0268265_101683091 346
265 3300031730 Ga0307516_10076539 Ga0307516_100765392 346
266 3300031911 Ga0307412_10051473 Ga0307412_100514731 346
267 3300037418 Ga0395900_0028204 Ga0395900_0028204_4560_5669 346
268 3300037471 Ga0395905_0185194 Ga0395905_0185194_555_1661 346
269 3300038443 Ga0395901_0014741 Ga0395901_0014741_5266_6417 346
270 3300038443 Ga0395901_0244469 Ga0395901_0244469_680_1789 346
271 3300039438 Ga0436360_0428998 Ga0436360_0428998_16199_17308 346
272 3300041497 Ga0451840_11510 Ga0451840_11510_55_1161 346
273 3300041502 Ga0451846_53461 Ga0451846_53461_534_1640 346
274 3300041505 Ga0451849_0343204 Ga0451849_0343204_419_1525 346
275 3300041510 Ga0451854_38034 Ga0451854_38034_42_1148 346
276 3300041907 Ga0452268_28007 Ga0452268_28007_23_1129 346
277 3300046452 Ga0495617_038070 Ga0495617_038070_252_1358 346
278 3300046460 Ga0495638_0000984 Ga0495638_0000984_17304_18410 346
279 3300046474 Ga0495605_0027289 Ga0495605_0027289_1240_2346 346
280 3300046492 Ga0495585_0008429 Ga0495585_0008429_1037_2143 346
281 3300046500 Ga0495596_0031129 Ga0495596_0031129_513_1619 346
282 3300046501 Ga0495607_0120054 Ga0495607_0120054_85_1191 346
283 3300046506 Ga0495583_0033212 Ga0495583_0033212_340_1446 346
284 3300046512 Ga0495610_0033707 Ga0495610_0033707_505_1611 346
285 3300046513 Ga0495616_0019931 Ga0495616_0019931_2016_3122 346
286 3300046515 Ga0495620_0050099 Ga0495620_0050099_467_1573 346
287 3300046518 Ga0495631_0002044 Ga0495631_0002044_1916_3022 346
288 3300046519 Ga0495632_0014778 Ga0495632_0014778_263_1369 346
289 3300046519 Ga0495632_0025306 Ga0495632_0025306_1601_2707 346
290 3300046530 Ga0495654_0042125 Ga0495654_0042125_654_1760 346
291 3300046538 Ga0495609_0035152 Ga0495609_0035152_454_1560 346
292 3300046542 Ga0495597_0034925 Ga0495597_0034925_536_1642 346
293 3300046616 Ga0495668_0006092 Ga0495668_0006092_6542_7648 346
294 3300046660 Ga0495625_0005382 Ga0495625_0005382_10036_11142 346
295 3300046660 Ga0495625_0132238 Ga0495625_0132238_395_1501 346
296 3300046810 Ga0495660_0036980 Ga0495660_0036980_391_1497 346
297 3300046810 Ga0495660_0049199 Ga0495660_0049199_542_1648 346
298 3300047318 Ga0495636_0066614 Ga0495636_0066614_248_1354 346
299 3300047323 Ga0495683_0044834 Ga0495683_0044834_413_1519 346
300 3300047443 Ga0495687_022010 Ga0495687_022010_436_1542 346
301 3300047470 Ga0495681_0068694 Ga0495681_0068694_74_1180 346
302 3300047472 Ga0495686_0062679 Ga0495686_0062679_989_2095 346
303 3300048903 Ga0496100_0042930 Ga0496100_0042930_1277_2365 346
304 3300048905 Ga0496102_0090375 Ga0496102_0090375_62_1150 346
305 3300048910 Ga0496107_0148941 Ga0496107_0148941_233_1321 346
306 3300048914 Ga0496111_0009718 Ga0496111_0009718_1861_2964 346
307 3300048916 Ga0496113_0090154 Ga0496113_0090154_22_1125 346
308 3300048918 Ga0496115_0146054 Ga0496115_0146054_344_1432 346
309 3300048919 Ga0496116_0082859 Ga0496116_0082859_639_1745 346
310 3300048921 Ga0496118_0022202 Ga0496118_0022202_418_1524 346
311 3300048922 Ga0496119_0021542 Ga0496119_0021542_2587_3696 346
312 3300048923 Ga0496120_0000455 Ga0496120_0000455_14684_15793 346
313 3300048927 Ga0496124_0102824 Ga0496124_0102824_576_1682 346
314 3300048929 Ga0496126_0188432 Ga0496126_0188432_279_1385 346
315 3300049459 Ga0495678_042185 Ga0495678_042185_476_1582 346
316 3300049460 Ga0495682_0045915 Ga0495682_0045915_376_1482 346
317 3300049570 Ga0501033_0061814 Ga0501033_0061814_1255_2361 346
318 3300049573 Ga0501037_0000895 Ga0501037_0000895_376_1482 346
319 3300049579 Ga0501043_0000045 Ga0501043_0000045_4518_5624 346
320 3300049585 Ga0501069_0000007 Ga0501069_0000007_158379_159485 346
321 3300049586 Ga0501070_0000758 Ga0501070_0000758_25740_26846 346
322 3300049586 Ga0501070_0003344 Ga0501070_0003344_5962_7068 346
323 3300049586 Ga0501070_0059883 Ga0501070_0059883_2014_3120 346
324 3300049586 Ga0501070_0084105 Ga0501070_0084105_113_1219 346
325 3300049587 Ga0501071_0013377 Ga0501071_0013377_2911_4017 346
326 3300049590 Ga0501074_0000047 Ga0501074_0000047_16190_17296 346
327 3300049590 Ga0501074_0010115 Ga0501074_0010115_2711_3817 346
328 3300049742 Ga0501080_0005487 Ga0501080_0005487_1703_2809 346
329 3300049742 Ga0501080_0009780 Ga0501080_0009780_697_1803 346
330 3300049744 Ga0501083_0000029 Ga0501083_0000029_105801_106907 346
331 3300049822 Ga0501035_0000060 Ga0501035_0000060_33996_35102 346
332 3300049822 Ga0501035_0092164 Ga0501035_0092164_839_1945 346
333 3300049823 Ga0501044_0000009 Ga0501044_0000009_158363_159469 346
334 3300050491 nmdc:mga00v17_26_c1 nmdc:mga00v17_26_c1_17904_19037 346
335 3300050492 nmdc:mga0yw44_185747_c1 nmdc:mga0yw44_185747_c1_89_1198 346
336 3300050492 nmdc:mga0yw44_3820_c1 nmdc:mga0yw44_3820_c1_4773_5879 346
337 3300050492 nmdc:mga0yw44_81306_c1 nmdc:mga0yw44_81306_c1_46_1134 346
338 3300050494 nmdc:mga06z11_176767_c1 nmdc:mga06z11_176767_c1_111_1217 346
339 3300050496 nmdc:mga07m45_64686_c1 nmdc:mga07m45_64686_c1_474_1580 346
340 3300053079 Ga0500610_0072570 Ga0500610_0072570_530_1636 346
341 3300053086 Ga0500578_0060890 Ga0500578_0060890_989_2095 346
342 3300053105 Ga0500557_018021 Ga0500557_018021_449_1555 346
343 3300053109 Ga0500569_005635 Ga0500569_005635_1245_2351 346
344 3300053134 Ga0500658_0000625 Ga0500658_0000625_12449_13555 346
345 3300053135 Ga0500659_0043180 Ga0500659_0043180_862_1968 346
346 3300053139 Ga0500568_0002154 Ga0500568_0002154_463_1569 346
347 3300053153 Ga0500616_0014259 Ga0500616_0014259_3274_4380 346
348 3300053158 Ga0500627_0035377 Ga0500627_0035377_398_1504 346
349 3300060353 Ga0501082_0360620 Ga0501082_0360620_34_1140 346
350 iso_pu_bacteria 2507262055 2507508584 346
351 iso_pu_bacteria 2508501009 2508542656 346
352 iso_pu_bacteria 2508501042 2508691568 346
353 iso_pu_bacteria 2511231028 2511401273 346
354 iso_pu_bacteria 2513237092 2513623046 346
355 iso_pu_bacteria 2513237095 2513645841 346
356 iso_pu_bacteria 2513237139 2513872767 346
357 iso_pu_bacteria 2513237161 2514011853 346
358 iso_pu_bacteria 2515154112 2515628365 346
359 iso_pu_bacteria 2517093001 2517106751 346
360 iso_pu_bacteria 2524023205 2524443297 346
361 iso_pu_bacteria 2528768022 2528854928 346
362 iso_pu_bacteria 2617270735 2617349020 346
363 iso_pu_bacteria 2744054633 2745076657 346
364 iso_pu_bacteria 2791355196 2793062393 346
365 iso_pu_bacteria 2802429603 2805915335 346
366 iso_pu_bacteria 2816332527 2818238887 346
367 iso_pu_bacteria 2824600985 2824605745 346
368 iso_pu_bacteria 2824609381 2824614458 346
369 iso_pu_bacteria 2824617872 2824623239 346
370 iso_pu_bacteria 2824626560 2824633177 346
371 iso_pu_bacteria 2824635225 2824640014 346
372 iso_pu_bacteria 2824644064 2824649699 346
373 iso_pu_bacteria 2824653114 2824657749 346
374 iso_pu_bacteria 2824661429 2824667126 346
375 iso_pu_bacteria 2824671348 2824677394 346
376 iso_pu_bacteria 2824679649 2824685260 346
377 iso_pu_bacteria 2824687955 2824693056 346
378 iso_pu_bacteria 2824696289 2824700757 346
379 iso_pu_bacteria 2824704595 2824711336 346
380 iso_pu_bacteria 2824714736 2824722402 346
381 iso_pu_bacteria 2824723954 2824732061 346
382 iso_pu_bacteria 2824753945 2824758195 346
383 iso_pu_bacteria 2824763712 2824768176 346
384 iso_pu_bacteria 2824773399 2824779545 346
385 iso_pu_bacteria 2838122688 2838123749 346
386 iso_pu_bacteria 2841941048 2841948642 346
387 iso_pu_bacteria 2841949485 2841949850 346
388 iso_pu_bacteria 2841966195 2841966268 346
389 iso_pu_bacteria 2841974524 2841975005 346
390 iso_pu_bacteria 2841983080 2841983427 346
391 iso_pu_bacteria 2847939898 2847946565 346
392 iso_pu_bacteria 2849076700 2849079310 346
393 iso_pu_bacteria 2854681122 2854682063 346
394 iso_pu_bacteria 2874590934 2874598047 346
395 iso_pu_bacteria 2874612657 2874615408 346
396 iso_pu_bacteria 2874620515 2874627828 346
397 iso_pu_bacteria 2874628541 2874631855 346
398 iso_pu_bacteria 2874645413 2874647507 346
399 iso_pu_bacteria 2876771140 2876778475 346
400 iso_pu_bacteria 2876818435 2876820421 346
401 iso_pu_bacteria 2879074833 2879082269 346
402 iso_pu_bacteria 2879099564 2879101241 346
403 iso_pu_bacteria 2879127579 2879135416 346
404 iso_pu_bacteria 2879142872 2879150624 346
405 iso_pu_bacteria 2881665667 2881671171 346
406 iso_pu_bacteria 2888378607 2888384063 346
407 iso_pu_bacteria 2888388044 2888393794 346
408 iso_pu_bacteria 2888419890 2888424475 346
409 iso_pu_bacteria 2904666416 2904672852 346
410 iso_pu_bacteria 2904711408 2904714618 346
411 iso_pu_bacteria 2906626472 2906633266 346
412 iso_pu_bacteria 2922368715 2922374395 346
413 iso_pu_bacteria 2922393267 2922396239 346
414 iso_pu_bacteria 2929615660 2929618065 346
415 iso_pu_bacteria 2929624759 2929627746 346
416 iso_pu_bacteria 2932784394 2932790355 346
417 iso_pu_bacteria 2932809354 2932810775 346
418 iso_pu_bacteria 2932818245 2932823894 346
419 iso_pu_bacteria 2933577622 2933579993 346
420 iso_pu_bacteria 2935608549 2935608885 346
421 iso_pu_bacteria 2935616580 2935623052 346
422 iso_pu_bacteria 2935638405 2935642416 346
423 iso_pu_bacteria 2935648319 2935650051 346
424 iso_pu_bacteria 2935656913 2935661797 346
425 iso_pu_bacteria 2935665750 2935668281 346
426 iso_pu_bacteria 2935675223 2935676312 346
427 iso_pu_bacteria 2935684952 2935692919 346
428 iso_pu_bacteria 2935694250 2935701078 346
429 iso_pu_bacteria 2935703347 2935706141 346
430 iso_pu_bacteria 2935713505 2935721356 346
431 iso_pu_bacteria 2935722832 2935730274 346
432 iso_pu_bacteria 2935732158 2935740287 346
433 iso_pu_bacteria 2935741537 2935749551 346
434 iso_pu_bacteria 2935750917 2935759136 346
435 iso_pu_bacteria 2935760218 2935762536 346
436 iso_pu_bacteria 2935769743 2935773297 346
437 iso_pu_bacteria 2935777560 2935778538 346
438 iso_pu_bacteria 2935785616 2935792749 346
439 iso_pu_bacteria 2935793552 2935800776 346
440 iso_pu_bacteria 2935801545 2935803140 346
441 iso_pu_bacteria 2935810662 2935814456 346
442 iso_pu_bacteria 2935819856 2935822045 346
443 iso_pu_bacteria 2935827899 2935831594 346
444 iso_pu_bacteria 2935837841 2935838454 346
445 iso_pu_bacteria 2935847175 2935847627 346
446 iso_pu_bacteria 2935855204 2935861300 346
447 iso_pu_bacteria 2935864058 2935865838 346
448 iso_pu_bacteria 2935873716 2935878339 346
449 iso_pu_bacteria 2935908558 2935909102 346
450 iso_pu_bacteria 2935916978 2935919823 346
451 iso_pu_bacteria 2935926038 2935926324 346
452 iso_pu_bacteria 2935934488 2935934774 346
453 iso_pu_bacteria 2935942939 2935943224 346
454 iso_pu_bacteria 2935951376 2935951662 346
455 iso_pu_bacteria 2935967501 2935967787 346
456 iso_pu_bacteria 2935975950 2935982671 346
457 iso_pu_bacteria 2935984226 2935988165 346
458 iso_pu_bacteria 2935992306 2935994652 346
459 iso_pu_bacteria 2936002035 2936007549 346
460 iso_pu_bacteria 2936011229 2936012465 346
461 iso_pu_bacteria 2936019824 2936021030 346
462 iso_pu_bacteria 2936028420 2936029758 346
463 iso_pu_bacteria 2936037263 2936040013 346
464 iso_pu_bacteria 2936046547 2936047223 346
465 iso_pu_bacteria 2936055302 2936057618 346
466 iso_pu_bacteria 2940556831 2940564859 346
467 iso_pu_bacteria 2941538514 2941538878 346
468 iso_pu_bacteria 8016511872 8016522331 346
469 iso_pu_bacteria 8016522445 8016529612 346
470 iso_pu_bacteria 8016530956 8016534829 346
471 iso_pu_bacteria 8016539877 8016548040 346
472 iso_pu_bacteria 8016548790 8016554087 346
473 iso_pu_bacteria 8016557553 8016562462 346
474 iso_pu_bacteria 8016566248 8016573177 346
475 iso_pu_bacteria 8016575299 8016577319 346
476 iso_pu_bacteria 8016595262 8016600257 346
477 iso_pu_bacteria 8016613128 8016614442 346
478 iso_pu_bacteria 8016622563 8016626554 346
479 iso_pu_bacteria 8016630954 8016640339 346
480 iso_pu_bacteria 8017057580 8017063228 346
481 iso_pu_bacteria 8019530166 8019534593 346
482 iso_pu_bacteria 8019538911 8019544879 346
483 iso_pu_bacteria 8019547302 8019553655 346
484 iso_pu_bacteria 8019576017 8019582654 346
485 iso_pu_bacteria 8019597564 8019600907 346
486 iso_pu_bacteria 8019608314 8019617643 346
487 iso_pu_bacteria 8019629233 8019634457 346
488 iso_pu_bacteria 8019638758 8019645272 346
489 iso_pu_bacteria 8019659431 8019662348 346
490 iso_pu_bacteria 8019668869 8019671849 346
491 iso_pu_bacteria 8019687851 8019690079 346
492 iso_pu_bacteria 8055742211 8055746346 346
493 iso_pu_bacteria 8056967851 8056968040 346
494 3300002705 JGI25156J39149_1004063 JGI25156J39149_10040632 347
495 3300002741 JGI25157J39369_1000738 JGI25157J39369_10007389 347
496 3300003214 JGI25165J46597_1000147 JGI25165J46597_100014784 347
497 3300006042 Ga0075368_10001480 Ga0075368_100014803 347
498 3300006177 Ga0075362_10003906 Ga0075362_100039063 347
499 3300006186 Ga0075369_10000420 Ga0075369_100004206 347
500 3300006353 Ga0075370_10072847 Ga0075370_100728472 347
501 3300009148 Ga0105243_10129972 Ga0105243_101299722 347
502 3300025250 Ga0209026_1000050 Ga0209026_1000050129 347
503 3300025256 Ga0209759_1015261 Ga0209759_10152612 347
504 3300025261 Ga0209233_1000034 Ga0209233_100003483 347
505 3300025294 Ga0209025_1023046 Ga0209025_10230462 347
506 3300025303 Ga0209051_1008481 Ga0209051_10084813 347
507 3300025935 Ga0207709_10097350 Ga0207709_100973502 347
508 3300027111 Ga0209281_1000043 Ga0209281_1000043139 347
509 3300048917 Ga0496114_0137983 Ga0496114_0137983_770_1921 347
510 3300048919 Ga0496116_0000026 Ga0496116_0000026_267598_268701 347
511 3300048929 Ga0496126_0000069 Ga0496126_0000069_24840_25943 347
512 3300048929 Ga0496126_0007323 Ga0496126_0007323_5814_6920 347
513 3300049822 Ga0501035_0044246 Ga0501035_0044246_2834_3940 347
514 3300049823 Ga0501044_0052912 Ga0501044_0052912_1694_2800 347
515 3300050492 nmdc:mga0yw44_831_c1 nmdc:mga0yw44_831_c1_3855_4961 347
516 3300050493 nmdc:mga0k408_40451_c1 nmdc:mga0k408_40451_c1_404_1510 347
517 3300050494 nmdc:mga06z11_18791_c1 nmdc:mga06z11_18791_c1_50_1156 347
518 3300050496 nmdc:mga07m45_3358_c1 nmdc:mga07m45_3358_c1_1294_2400 347
519 3300050516 nmdc:mga0sz30_148_c1 nmdc:mga0sz30_148_c1_24525_25631 347
520 3300053139 Ga0500568_0000035 Ga0500568_0000035_118904_120013 347
521 iso_pu_bacteria 2551306093 2551745077 347
522 iso_pu_bacteria 2599185301 2599935464 347
523 iso_pu_bacteria 2643221653 2644298042 347
524 iso_pu_bacteria 2643221719 2644656294 347
525 iso_pu_bacteria 2818991272 2819244365 347
526 iso_pu_bacteria 2842038055 2842039066 347
527 iso_pu_bacteria 2842045827 2842047987 347
528 iso_pu_bacteria 2989776772 2989777012 347
529 iso_pu_bacteria 8005246636 8005247960 347
530 iso_pu_bacteria 8018150411 8018154626 347
531 3300006028 Ga0070717_10102440 Ga0070717_101024402 348
532 3300006844 Ga0075428_100019624 Ga0075428_1000196244 348
533 3300006846 Ga0075430_100328763 Ga0075430_1003287631 348
534 3300006847 Ga0075431_100057368 Ga0075431_1000573686 348
535 3300009147 Ga0114129_10023557 Ga0114129_100235576 348
536 3300009147 Ga0114129_10116705 Ga0114129_101167053 348
537 3300025939 Ga0207665_10268951 Ga0207665_102689511 348
538 3300031616 Ga0307508_10000235 Ga0307508_1000023552 348
539 3300048925 Ga0496122_0035793 Ga0496122_0035793_2404_3507 348
540 3300048927 Ga0496124_0002875 Ga0496124_0002875_796_1902 348
541 3300050507 nmdc:mga05p37_41138_c1 nmdc:mga05p37_41138_c1_3238_4335 348
542 3300050507 nmdc:mga05p37_94463_c1 nmdc:mga05p37_94463_c1_1720_2808 348
543 3300050510 nmdc:mga06r32_14671_c1 nmdc:mga06r32_14671_c1_5102_6199 348
544 3300050510 nmdc:mga06r32_272496_c1 nmdc:mga06r32_272496_c1_200_1288 348
545 iso_pu_bacteria 2551306089 2551713208 348
546 iso_pu_bacteria 2643221688 2644491797 348
547 iso_pu_bacteria 2765235802 2765469412 348
548 iso_pu_bacteria 2767802442 2770200143 348
549 iso_pu_bacteria 2775506901 2776264471 348
550 iso_pu_bacteria 2775506902 2776270195 348
551 iso_pu_bacteria 2775506904 2776285078 348
552 iso_pu_bacteria 2839993093 2839998355 348
553 iso_pu_bacteria 2881161766 2881164678 348
554 iso_pu_bacteria 2894652903 2894655527 348
555 iso_pu_bacteria 2904578770 2904584140 348
556 iso_pu_bacteria 2919119836 2919125020 348
557 iso_pu_bacteria 2996310559 2996311828 348
558 iso_pu_bacteria 3002141150 3002145180 348
559 3300001979 JGI24740J21852_10006190 JGI24740J21852_100061903 349
560 3300001979 JGI24740J21852_10007518 JGI24740J21852_100075182 349
561 3300002737 JGI25162J39368_1001169 JGI25162J39368_10011697 349
562 3300003214 JGI25165J46597_1000630 JGI25165J46597_100063010 349
563 3300003762 Ga0055542_1000252 Ga0055542_100025221 349
564 3300003791 Ga0055530_10012693 Ga0055530_100126932 349
565 3300003792 Ga0055540_1002011 Ga0055540_10020114 349
566 3300003794 Ga0055531_10002835 Ga0055531_1000283510 349
567 3300004625 Ga0055543_1002832 Ga0055543_10028324 349
568 3300005262 Ga0065165_1000826 Ga0065165_10008268 349
569 3300005327 Ga0070658_10205856 Ga0070658_102058562 349
570 3300005338 Ga0068868_100009208 Ga0068868_1000092086 349
571 3300005338 Ga0068868_100186489 Ga0068868_1001864892 349
572 3300005344 Ga0070661_100111987 Ga0070661_1001119872 349
573 3300005364 Ga0070673_100112291 Ga0070673_1001122912 349
574 3300005459 Ga0068867_100024391 Ga0068867_1000243913 349
575 3300005467 Ga0070706_100197584 Ga0070706_1001975842 349
576 3300005518 Ga0070699_100202435 Ga0070699_1002024352 349
577 3300005535 Ga0070684_100027140 Ga0070684_1000271403 349
578 3300005539 Ga0068853_100195647 Ga0068853_1001956472 349
579 3300005539 Ga0068853_100323306 Ga0068853_1003233062 349
580 3300005578 Ga0068854_100178454 Ga0068854_1001784542 349
581 3300005614 Ga0068856_100014002 Ga0068856_1000140027 349
582 3300006038 Ga0075365_10005519 Ga0075365_100055197 349
583 3300006038 Ga0075365_10067884 Ga0075365_100678843 349
584 3300006038 Ga0075365_10198465 Ga0075365_101984652 349
585 3300006048 Ga0075363_100011783 Ga0075363_1000117835 349
586 3300006353 Ga0075370_10019433 Ga0075370_100194332 349
587 3300006358 Ga0068871_100082934 Ga0068871_1000829342 349
588 3300006881 Ga0068865_100141135 Ga0068865_1001411351 349
589 3300006941 Ga0099825_1026228 Ga0099825_10262282 349
590 3300006944 Ga0099823_1016643 Ga0099823_10166435 349
591 3300009177 Ga0105248_10376789 Ga0105248_103767892 349
592 3300009551 Ga0105238_10076419 Ga0105238_100764193 349
593 3300010159 Ga0099796_10029332 Ga0099796_100293322 349
594 3300013104 Ga0157370_10234385 Ga0157370_102343851 349
595 3300013296 Ga0157374_10010385 Ga0157374_100103852 349
596 3300013296 Ga0157374_10202455 Ga0157374_102024553 349
597 3300013306 Ga0163162_10075105 Ga0163162_100751051 349
598 3300013308 Ga0157375_10006444 Ga0157375_100064445 349
599 3300014326 Ga0157380_10205409 Ga0157380_102054092 349
600 3300014497 Ga0182008_10051736 Ga0182008_100517363 349
601 3300015261 Ga0182006_1015445 Ga0182006_10154453 349
602 3300015262 Ga0182007_10062860 Ga0182007_100628601 349
603 3300021320 Ga0214544_1001682 Ga0214544_100168218 349
604 3300021321 Ga0214542_1001614 Ga0214542_100161417 349
605 3300021327 Ga0214543_1001395 Ga0214543_100139517 349
606 3300025233 Ga0209437_100075 Ga0209437_100075206 349
607 3300025254 Ga0209148_1000032 Ga0209148_1000032345 349
608 3300025261 Ga0209233_1000056 Ga0209233_100005632 349
609 3300025272 Ga0209455_1000190 Ga0209455_100019066 349
610 3300025292 Ga0209676_1002997 Ga0209676_100299712 349
611 3300025297 Ga0209758_1000383 Ga0209758_100038317 349
612 3300025298 Ga0209050_1006153 Ga0209050_10061536 349
613 3300025303 Ga0209051_1004392 Ga0209051_10043929 349
614 3300025304 Ga0209257_1002210 Ga0209257_100221012 349
615 3300025910 Ga0207684_10099451 Ga0207684_100994512 349
616 3300025913 Ga0207695_10196807 Ga0207695_101968072 349
617 3300025919 Ga0207657_10114168 Ga0207657_101141682 349
618 3300025931 Ga0207644_10371701 Ga0207644_103717011 349
619 3300025933 Ga0207706_10010327 Ga0207706_100103271 349
620 3300025940 Ga0207691_10183906 Ga0207691_101839061 349
621 3300025961 Ga0207712_10038823 Ga0207712_100388232 349
622 3300026041 Ga0207639_10246028 Ga0207639_102460281 349
623 3300026067 Ga0207678_10008184 Ga0207678_100081844 349
624 3300026067 Ga0207678_10033040 Ga0207678_100330402 349
625 3300026078 Ga0207702_10081034 Ga0207702_100810342 349
626 3300026116 Ga0207674_10428761 Ga0207674_104287611 349
627 3300026118 Ga0207675_100152444 Ga0207675_1001524441 349
628 3300027296 Ga0209389_1000008 Ga0209389_1000008135 349
629 3300027312 Ga0209371_1001249 Ga0209371_10012492 349
630 3300027361 Ga0209489_103917 Ga0209489_10391721 349
631 3300027363 Ga0209700_100036 Ga0209700_10003621 349
632 3300030500 Ga0268256_1000660 Ga0268256_100066019 349
633 3300031911 Ga0307412_10096618 Ga0307412_100966181 349
634 3300046684 Ga0495669_0003796 Ga0495669_0003796_3608_4867 349
635 3300048904 Ga0496101_0051291 Ga0496101_0051291_57_1145 349
636 3300048905 Ga0496102_0010100 Ga0496102_0010100_3430_4518 349
637 3300048908 Ga0496105_0016466 Ga0496105_0016466_746_1834 349
638 3300048909 Ga0496106_0186856 Ga0496106_0186856_535_1623 349
639 3300048910 Ga0496107_0162931 Ga0496107_0162931_196_1284 349
640 3300048911 Ga0496108_0024837 Ga0496108_0024837_523_1611 349
641 3300048912 Ga0496109_0192867 Ga0496109_0192867_667_1755 349
642 3300048913 Ga0496110_0014142 Ga0496110_0014142_912_2000 349
643 3300048913 Ga0496110_0152174 Ga0496110_0152174_200_1288 349
644 3300048914 Ga0496111_0066787 Ga0496111_0066787_666_1754 349
645 3300048916 Ga0496113_0012388 Ga0496113_0012388_3191_4279 349
646 3300048917 Ga0496114_0026653 Ga0496114_0026653_2631_3719 349
647 3300048918 Ga0496115_0001562 Ga0496115_0001562_14959_16047 349
648 3300048923 Ga0496120_0077220 Ga0496120_0077220_363_1472 349
649 3300048923 Ga0496120_0152319 Ga0496120_0152319_37_1143 349
650 3300048928 Ga0496125_0064016 Ga0496125_0064016_763_1872 349
651 3300048929 Ga0496126_0378317 Ga0496126_0378317_17_1126 349
652 3300050507 nmdc:mga05p37_83860_c1 nmdc:mga05p37_83860_c1_2376_3473 349
653 3300053153 Ga0500616_0001686 Ga0500616_0001686_12182_13288 349
654 3300053727 Ga0500611_006845 Ga0500611_006845_505_1614 349
655 iso_pu_bacteria 2503198000 2503198329 349
656 iso_pu_bacteria 2508501114 2509079577 349
657 iso_pu_bacteria 2508501122 2509111394 349
658 iso_pu_bacteria 2508501123 2509114447 349
659 iso_pu_bacteria 2509276018 2509368395 349
660 iso_pu_bacteria 2509276019 2509375667 349
661 iso_pu_bacteria 2509276033 2509447931 349
662 iso_pu_bacteria 2510065019 2510134869 349
663 iso_pu_bacteria 2510065057 2510303293 349
664 iso_pu_bacteria 2510065059 2510314677 349
665 iso_pu_bacteria 2510461076 2510896275 349
666 iso_pu_bacteria 2510917022 2511137054 349
667 iso_pu_bacteria 2510917026 2511174201 349
668 iso_pu_bacteria 2511231027 2511390399 349
669 iso_pu_bacteria 2511231052 2511501969 349
670 iso_pu_bacteria 2512047086 2512533337 349
671 iso_pu_bacteria 2512875016 2512934195 349
672 iso_pu_bacteria 2512875024 2512962495 349
673 iso_pu_bacteria 2512875026 2512971094 349
674 iso_pu_bacteria 2513237084 2513572632 349
675 iso_pu_bacteria 2513237085 2513580137 349
676 iso_pu_bacteria 2513237086 2513582634 349
677 iso_pu_bacteria 2513237089 2513604549 349
678 iso_pu_bacteria 2513237090 2513609801 349
679 iso_pu_bacteria 2513237091 2513615464 349
680 iso_pu_bacteria 2513237093 2513631293 349
681 iso_pu_bacteria 2513237094 2513640447 349
682 iso_pu_bacteria 2513237103 2513710812 349
683 iso_pu_bacteria 2513237140 2513881253 349
684 iso_pu_bacteria 2513237143 2513902384 349
685 iso_pu_bacteria 2513237156 2513984597 349
686 iso_pu_bacteria 2513237159 2513997068 349
687 iso_pu_bacteria 2513237160 2514007602 349
688 iso_pu_bacteria 2513237162 2514022310 349
689 iso_pu_bacteria 2513237164 2514037866 349
690 iso_pu_bacteria 2513237351 2514587362 349
691 iso_pu_bacteria 2515075009 2515113952 349
692 iso_pu_bacteria 2515154107 2515608762 349
693 iso_pu_bacteria 2515154113 2515636974 349
694 iso_pu_bacteria 2515154114 2515643003 349
695 iso_pu_bacteria 2515154116 2515656752 349
696 iso_pu_bacteria 2515154134 2515743691 349
697 iso_pu_bacteria 2516143018 2516209689 349
698 iso_pu_bacteria 2516653046 2516893265 349
699 iso_pu_bacteria 2516653077 2517037583 349
700 iso_pu_bacteria 2516653085 2517077870 349
701 iso_pu_bacteria 2517093000 2517096667 349
702 iso_pu_bacteria 2517093001 2517102527 349
703 iso_pu_bacteria 2517287029 2517410381 349
704 iso_pu_bacteria 2517487022 2517570022 349
705 iso_pu_bacteria 2519899620 2520377947 349
706 iso_pu_bacteria 2524023207 2524448835 349
707 iso_pu_bacteria 2524023209 2524460624 349
708 iso_pu_bacteria 2529292951 2530646980 349
709 iso_pu_bacteria 2534681796 2535519405 349
710 iso_pu_bacteria 2537561587 2537877385 349
711 iso_pu_bacteria 2551306084 2551675157 349
712 iso_pu_bacteria 2551306084 2551680517 349
713 iso_pu_bacteria 2551306085 2551688050 349
714 iso_pu_bacteria 2551306086 2551691142 349
715 iso_pu_bacteria 2551306086 2551693968 349
716 iso_pu_bacteria 2554235003 2554246281 349
717 iso_pu_bacteria 2558860100 2558867983 349
718 iso_pu_bacteria 2558860242 2559293503 349
719 iso_pu_bacteria 2582581283 2585166129 349
720 iso_pu_bacteria 2582581294 2585202444 349
721 iso_pu_bacteria 2582581307 2585273236 349
722 iso_pu_bacteria 2582581308 2585278930 349
723 iso_pu_bacteria 2582581315 2585325455 349
724 iso_pu_bacteria 2582581866 2585393047 349
725 iso_pu_bacteria 2582581867 2585402245 349
726 iso_pu_bacteria 2585427526 2585529053 349
727 iso_pu_bacteria 2585427527 2585530727 349
728 iso_pu_bacteria 2585427528 2585540993 349
729 iso_pu_bacteria 2585427530 2585554907 349
730 iso_pu_bacteria 2585427531 2585559464 349
731 iso_pu_bacteria 2585427590 2585822455 349
732 iso_pu_bacteria 2585427593 2585839755 349
733 iso_pu_bacteria 2585427608 2585902135 349
734 iso_pu_bacteria 2585427609 2585905160 349
735 iso_pu_bacteria 2585427633 2585998486 349
736 iso_pu_bacteria 2585427634 2586003050 349
737 iso_pu_bacteria 2585428125 2587979725 349
738 iso_pu_bacteria 2588253730 2588520344 349
739 iso_pu_bacteria 2597489875 2597810534 349
740 iso_pu_bacteria 2599185156 2599331579 349
741 iso_pu_bacteria 2599185210 2599604385 349
742 iso_pu_bacteria 2599185352 2600193092 349
743 iso_pu_bacteria 2600255279 2601609478 349
744 iso_pu_bacteria 2600255308 2601746253 349
745 iso_pu_bacteria 2615840624 2616295586 349
746 iso_pu_bacteria 2615840626 2616305797 349
747 iso_pu_bacteria 2643221550 2643772430 349
748 iso_pu_bacteria 2643221557 2643803592 349
749 iso_pu_bacteria 2643221564 2643838345 349
750 iso_pu_bacteria 2643221568 2643857896 349
751 iso_pu_bacteria 2643221582 2643920662 349
752 iso_pu_bacteria 2643221595 2643983922 349
753 iso_pu_bacteria 2643221607 2644050739 349
754 iso_pu_bacteria 2643221610 2644067559 349
755 iso_pu_bacteria 2643221618 2644107705 349
756 iso_pu_bacteria 2643221623 2644133353 349
757 iso_pu_bacteria 2643221626 2644148624 349
758 iso_pu_bacteria 2643221627 2644156052 349
759 iso_pu_bacteria 2643221636 2644205213 349
760 iso_pu_bacteria 2643221637 2644210227 349
761 iso_pu_bacteria 2643221655 2644309099 349
762 iso_pu_bacteria 2643221659 2644332927 349
763 iso_pu_bacteria 2643221668 2644375239 349
764 iso_pu_bacteria 2643221675 2644418612 349
765 iso_pu_bacteria 2643221680 2644451979 349
766 iso_pu_bacteria 2643221686 2644483657 349
767 iso_pu_bacteria 2643221689 2644501345 349
768 iso_pu_bacteria 2643221693 2644519530 349
769 iso_pu_bacteria 2643221698 2644545901 349
770 iso_pu_bacteria 2643221712 2644615041 349
771 iso_pu_bacteria 2643221718 2644653779 349
772 iso_pu_bacteria 2643221723 2644676578 349
773 iso_pu_bacteria 2643221726 2644690741 349
774 iso_pu_bacteria 2657244999 2657681192 349
775 iso_pu_bacteria 2667528174 2671115284 349
776 iso_pu_bacteria 2687453392 2688595651 349
777 iso_pu_bacteria 2693429783 2694628186 349
778 iso_pu_bacteria 2693429784 2694640957 349
779 iso_pu_bacteria 2718217927 2719387293 349
780 iso_pu_bacteria 2718218199 2720493355 349
781 iso_pu_bacteria 2718218232 2720614829 349
782 iso_pu_bacteria 2718218233 2720621602 349
783 iso_pu_bacteria 2718218235 2720632930 349
784 iso_pu_bacteria 2718218269 2720776654 349
785 iso_pu_bacteria 2718218423 2721400928 349
786 iso_pu_bacteria 2721755556 2723028242 349
787 iso_pu_bacteria 2721755684 2723561870 349
788 iso_pu_bacteria 2721755685 2723568502 349
789 iso_pu_bacteria 2721755686 2723572937 349
790 iso_pu_bacteria 2721755755 2723848000 349
791 iso_pu_bacteria 2721755809 2724039741 349
792 iso_pu_bacteria 2721755819 2724091261 349
793 iso_pu_bacteria 2721755822 2724105767 349
794 iso_pu_bacteria 2721755823 2724111593 349
795 iso_pu_bacteria 2724679232 2725945441 349
796 iso_pu_bacteria 2728369352 2730109178 349
797 iso_pu_bacteria 2738541293 2738800404 349
798 iso_pu_bacteria 2738541317 2738948748 349
799 iso_pu_bacteria 2738541333 2739035550 349
800 iso_pu_bacteria 2738543024 2739309537 349
801 iso_pu_bacteria 2756170246 2756674264 349
802 iso_pu_bacteria 2765235942 2766065296 349
803 iso_pu_bacteria 2773857925 2774868707 349
804 iso_pu_bacteria 2773857925 2774871196 349
805 iso_pu_bacteria 2775506901 2776261404 349
806 iso_pu_bacteria 2791355082 2792581765 349
807 iso_pu_bacteria 2791355091 2792620165 349
808 iso_pu_bacteria 2791355092 2792626415 349
809 iso_pu_bacteria 2791355094 2792639364 349
810 iso_pu_bacteria 2791355123 2792746838 349
811 iso_pu_bacteria 2791355256 2793293610 349
812 iso_pu_bacteria 2791355259 2793313050 349
813 iso_pu_bacteria 2791355261 2793327796 349
814 iso_pu_bacteria 2791355262 2793333405 349
815 iso_pu_bacteria 2791355265 2793353726 349
816 iso_pu_bacteria 2791355266 2793359676 349
817 iso_pu_bacteria 2791355267 2793369429 349
818 iso_pu_bacteria 2802428858 2802719517 349
819 iso_pu_bacteria 2802428859 2802726890 349
820 iso_pu_bacteria 2802428860 2802732251 349
821 iso_pu_bacteria 2802428861 2802739854 349
822 iso_pu_bacteria 2802428862 2802745360 349
823 iso_pu_bacteria 2802428863 2802752752 349
824 iso_pu_bacteria 2802429268 2804752392 349
825 iso_pu_bacteria 2802429605 2805929431 349
826 iso_pu_bacteria 2802429606 2805935387 349
827 iso_pu_bacteria 2802429633 2806044536 349
828 iso_pu_bacteria 2802429634 2806052737 349
829 iso_pu_bacteria 2802429635 2806059037 349
830 iso_pu_bacteria 2802429636 2806068300 349
831 iso_pu_bacteria 2802429637 2806074420 349
832 iso_pu_bacteria 2808606387 2808986726 349
833 iso_pu_bacteria 2818991439 2819556800 349
834 iso_pu_bacteria 2818991448 2819612185 349
835 iso_pu_bacteria 2818991453 2819639226 349
836 iso_pu_bacteria 2821123053 2821123279 349
837 iso_pu_bacteria 2835312727 2835314675 349
838 iso_pu_bacteria 2835312727 2835315267 349
839 iso_pu_bacteria 2837678835 2837683087 349
840 iso_pu_bacteria 2838016132 2838019132 349
841 iso_pu_bacteria 2838029111 2838031451 349
842 iso_pu_bacteria 2838048938 2838051150 349
843 iso_pu_bacteria 2838061910 2838063873 349
844 iso_pu_bacteria 2838068647 2838073357 349
845 iso_pu_bacteria 2838074704 2838079594 349
846 iso_pu_bacteria 2838675328 2838677535 349
847 iso_pu_bacteria 2838680041 2838684936 349
848 iso_pu_bacteria 2838686498 2838691295 349
849 iso_pu_bacteria 2838694306 2838699227 349
850 iso_pu_bacteria 2838701080 2838703709 349
851 iso_pu_bacteria 2838707686 2838712708 349
852 iso_pu_bacteria 2838714209 2838716424 349
853 iso_pu_bacteria 2838719591 2838719776 349
854 iso_pu_bacteria 2838724970 2838727175 349
855 iso_pu_bacteria 2838729681 2838735778 349
856 iso_pu_bacteria 2838736955 2838739698 349
857 iso_pu_bacteria 2838742623 2838748680 349
858 iso_pu_bacteria 2841734538 2841736075 349
859 iso_pu_bacteria 2841840854 2841844178 349
860 iso_pu_bacteria 2841846520 2841846707 349
861 iso_pu_bacteria 2841851746 2841853885 349
862 iso_pu_bacteria 2841859092 2841860764 349
863 iso_pu_bacteria 2841864319 2841868146 349
864 iso_pu_bacteria 2842077413 2842082185 349
865 iso_pu_bacteria 2842110456 2842113410 349
866 iso_pu_bacteria 2842118031 2842123108 349
867 iso_pu_bacteria 2842124991 2842127264 349
868 iso_pu_bacteria 2842130223 2842132428 349
869 iso_pu_bacteria 2842140634 2842143899 349
870 iso_pu_bacteria 2842146304 2842151218 349
871 iso_pu_bacteria 2842152218 2842152403 349
872 iso_pu_bacteria 2842156927 2842162597 349
873 iso_pu_bacteria 2842163707 2842169975 349
874 iso_pu_bacteria 2842170452 2842172669 349
875 iso_pu_bacteria 2842175837 2842176022 349
876 iso_pu_bacteria 2842180545 2842185034 349
877 iso_pu_bacteria 2842187318 2842189531 349
878 iso_pu_bacteria 2842192696 2842198237 349
879 iso_pu_bacteria 2842205361 2842208330 349
880 iso_pu_bacteria 2842211629 2842213845 349
881 iso_pu_bacteria 2842224351 2842224537 349
882 iso_pu_bacteria 2842229732 2842235593 349
883 iso_pu_bacteria 2842237096 2842241990 349
884 iso_pu_bacteria 2842243621 2842249373 349
885 iso_pu_bacteria 2842250916 2842256274 349
886 iso_pu_bacteria 2842257432 2842263490 349
887 iso_pu_bacteria 2842264693 2842266633 349
888 iso_pu_bacteria 2842271015 2842275770 349
889 iso_pu_bacteria 2842278818 2842281661 349
890 iso_pu_bacteria 2842291075 2842296185 349
891 iso_pu_bacteria 2842298080 2842302428 349
892 iso_pu_bacteria 2842304105 2842308246 349
893 iso_pu_bacteria 2842311132 2842316473 349
894 iso_pu_bacteria 2842317721 2842321362 349
895 iso_pu_bacteria 2842341865 2842345029 349
896 iso_pu_bacteria 2842357229 2842360839 349
897 iso_pu_bacteria 2842363717 2842369148 349
898 iso_pu_bacteria 2842370503 2842375613 349
899 iso_pu_bacteria 2842377471 2842382585 349
900 iso_pu_bacteria 2842384541 2842389986 349
901 iso_pu_bacteria 2842395702 2842398485 349
902 iso_pu_bacteria 2842422224 2842426992 349
903 iso_pu_bacteria 2842428310 2842429952 349
904 iso_pu_bacteria 2842434925 2842436388 349
905 iso_pu_bacteria 2842441272 2842444091 349
906 iso_pu_bacteria 2842447887 2842451055 349
907 iso_pu_bacteria 2842462802 2842464373 349
908 iso_pu_bacteria 2842469257 2842470717 349
909 iso_pu_bacteria 2842475841 2842477954 349
910 iso_pu_bacteria 2842489311 2842493302 349
911 iso_pu_bacteria 2842495871 2842499128 349
912 iso_pu_bacteria 2842502639 2842504763 349
913 iso_pu_bacteria 2842515876 2842517549 349
914 iso_pu_bacteria 2842521101 2842522690 349
915 iso_pu_bacteria 2842871566 2842872368 349
916 iso_pu_bacteria 2842922631 2842923976 349
917 iso_pu_bacteria 2844002411 2844003818 349
918 iso_pu_bacteria 2844009547 2844010450 349
919 iso_pu_bacteria 2844163670 2844167582 349
920 iso_pu_bacteria 2844315083 2844319500 349
921 iso_pu_bacteria 2844454524 2844457469 349
922 iso_pu_bacteria 2847670302 2847673181 349
923 iso_pu_bacteria 2847686936 2847689695 349
924 iso_pu_bacteria 2850079185 2850081157 349
925 iso_pu_bacteria 2852387548 2852389098 349
926 iso_pu_bacteria 2854896431 2854900802 349
927 iso_pu_bacteria 2854916844 2854918831 349
928 iso_pu_bacteria 2855825444 2855825988 349
929 iso_pu_bacteria 2855839649 2855841333 349
930 iso_pu_bacteria 2856314179 2856319786 349
931 iso_pu_bacteria 2856320880 2856320892 349
932 iso_pu_bacteria 2856328259 2856332866 349
933 iso_pu_bacteria 2856334872 2856340247 349
934 iso_pu_bacteria 2856342000 2856342172 349
935 iso_pu_bacteria 2856349417 2856353700 349
936 iso_pu_bacteria 2856356410 2856363311 349
937 iso_pu_bacteria 2856364286 2856366157 349
938 iso_pu_bacteria 2857349434 2857352623 349
939 iso_pu_bacteria 2857367948 2857371115 349
940 iso_pu_bacteria 2857516855 2857518877 349
941 iso_pu_bacteria 2857531043 2857533769 349
942 iso_pu_bacteria 2858800743 2858802320 349
943 iso_pu_bacteria 2869162929 2869165868 349
944 iso_pu_bacteria 2869169390 2869171985 349
945 iso_pu_bacteria 2869234852 2869239355 349
946 iso_pu_bacteria 2869242130 2869249017 349
947 iso_pu_bacteria 2869249662 2869254940 349
948 iso_pu_bacteria 2869256925 2869260691 349
949 iso_pu_bacteria 2869264136 2869267204 349
950 iso_pu_bacteria 2869271264 2869275465 349
951 iso_pu_bacteria 2869278585 2869280138 349
952 iso_pu_bacteria 2869285874 2869290988 349
953 iso_pu_bacteria 2871429161 2871433270 349
954 iso_pu_bacteria 2871435913 2871441977 349
955 iso_pu_bacteria 2871459585 2871463507 349
956 iso_pu_bacteria 2871466892 2871468359 349
957 iso_pu_bacteria 2871474448 2871475039 349
958 iso_pu_bacteria 2871481445 2871488368 349
959 iso_pu_bacteria 2871488783 2871491170 349
960 iso_pu_bacteria 2871495908 2871498916 349
961 iso_pu_bacteria 2874102143 2874105934 349
962 iso_pu_bacteria 2874116593 2874120873 349
963 iso_pu_bacteria 2874123672 2874131425 349
964 iso_pu_bacteria 2874131515 2874132980 349
965 iso_pu_bacteria 2874139085 2874143309 349
966 iso_pu_bacteria 2874146452 2874148788 349
967 iso_pu_bacteria 2874155637 2874160834 349
968 iso_pu_bacteria 2874162495 2874164783 349
969 iso_pu_bacteria 2874168670 2874172064 349
970 iso_pu_bacteria 2876363079 2876363543 349
971 iso_pu_bacteria 2876369609 2876373026 349
972 iso_pu_bacteria 2876377896 2876382929 349
973 iso_pu_bacteria 2876386047 2876391354 349
974 iso_pu_bacteria 2876392853 2876397340 349
975 iso_pu_bacteria 2876399893 2876403926 349
976 iso_pu_bacteria 2876406927 2876410068 349
977 iso_pu_bacteria 2876413966 2876418874 349
978 iso_pu_bacteria 2876420981 2876426048 349
979 iso_pu_bacteria 2876761206 2876766943 349
980 iso_pu_bacteria 2878035449 2878039739 349
981 iso_pu_bacteria 2878730984 2878733682 349
982 iso_pu_bacteria 2878738818 2878740624 349
983 iso_pu_bacteria 2878745973 2878750883 349
984 iso_pu_bacteria 2878753008 2878755579 349
985 iso_pu_bacteria 2878760144 2878763129 349
986 iso_pu_bacteria 2878767105 2878770104 349
987 iso_pu_bacteria 2878774303 2878780050 349
988 iso_pu_bacteria 2878781027 2878781873 349
989 iso_pu_bacteria 2878788777 2878795242 349
990 iso_pu_bacteria 2881147464 2881147898 349
991 iso_pu_bacteria 2881155292 2881159071 349
992 iso_pu_bacteria 2881845957 2881847929 349
993 iso_pu_bacteria 2881853255 2881859601 349
994 iso_pu_bacteria 2881861095 2881867237 349
995 iso_pu_bacteria 2882456835 2882457510 349
996 iso_pu_bacteria 2882456835 2882457540 349
997 iso_pu_bacteria 2882456835 2882457711 349
998 iso_pu_bacteria 2882632389 2882634694 349
999 iso_pu_bacteria 2882912400 2882918198 349
1000 iso_pu_bacteria 2884298095 2884300795 349
1001 iso_pu_bacteria 2885305155 2885306520 349
1002 iso_pu_bacteria 2885312484 2885314468 349
1003 iso_pu_bacteria 2885318864 2885324216 349
1004 iso_pu_bacteria 2885326080 2885333295 349
1005 iso_pu_bacteria 2885334103 2885337006 349
1006 iso_pu_bacteria 2885350715 2885352224 349
1007 iso_pu_bacteria 2885409591 2885413692 349
1008 iso_pu_bacteria 2888337043 2888342995 349
1009 iso_pu_bacteria 2888343758 2888344044 349
1010 iso_pu_bacteria 2888350351 2888352805 349
1011 iso_pu_bacteria 2889010040 2889014580 349
1012 iso_pu_bacteria 2889016732 2889020438 349
1013 iso_pu_bacteria 2889914905 2889919154 349
1014 iso_pu_bacteria 2894232714 2894239106 349
1015 iso_pu_bacteria 2896384573 2896389937 349
1016 iso_pu_bacteria 2898795034 2898798926 349
1017 iso_pu_bacteria 2899792073 2899794409 349
1018 iso_pu_bacteria 2899803654 2899808658 349
1019 iso_pu_bacteria 2899845264 2899845792 349
1020 iso_pu_bacteria 2903448605 2903454374 349
1021 iso_pu_bacteria 2903492973 2903498946 349
1022 iso_pu_bacteria 2903492973 2903501539 349
1023 iso_pu_bacteria 2903521522 2903525493 349
1024 iso_pu_bacteria 2903528002 2903531762 349
1025 iso_pu_bacteria 2903540706 2903543715 349
1026 iso_pu_bacteria 2903727486 2903734436 349
1027 iso_pu_bacteria 2904659560 2904664094 349
1028 iso_pu_bacteria 2906308376 2906313808 349
1029 iso_pu_bacteria 2906321335 2906326517 349
1030 iso_pu_bacteria 2906328253 2906334889 349
1031 iso_pu_bacteria 2906354277 2906354969 349
1032 iso_pu_bacteria 2906363423 2906367875 349
1033 iso_pu_bacteria 2906370794 2906375568 349
1034 iso_pu_bacteria 2906378014 2906380841 349
1035 iso_pu_bacteria 2906393657 2906398191 349
1036 iso_pu_bacteria 2906401398 2906401483 349
1037 iso_pu_bacteria 2906408224 2906411273 349
1038 iso_pu_bacteria 2906414383 2906420562 349
1039 iso_pu_bacteria 2906427513 2906432778 349
1040 iso_pu_bacteria 2906602504 2906609232 349
1041 iso_pu_bacteria 2913295892 2913300841 349
1042 iso_pu_bacteria 2913308742 2913313844 349
1043 iso_pu_bacteria 2915980308 2915981890 349
1044 iso_pu_bacteria 2915986958 2915991341 349
1045 iso_pu_bacteria 2915993759 2915994365 349
1046 iso_pu_bacteria 2916000859 2916004386 349
1047 iso_pu_bacteria 2916007675 2916008150 349
1048 iso_pu_bacteria 2916014648 2916015089 349
1049 iso_pu_bacteria 2916021584 2916024236 349
1050 iso_pu_bacteria 2916028427 2916031768 349
1051 iso_pu_bacteria 2916035215 2916041270 349
1052 iso_pu_bacteria 2916041962 2916042536 349
1053 iso_pu_bacteria 2916048683 2916052276 349
1054 iso_pu_bacteria 2916055098 2916056437 349
1055 iso_pu_bacteria 2916061851 2916067576 349
1056 iso_pu_bacteria 2916068649 2916075702 349
1057 iso_pu_bacteria 2916076590 2916080863 349
1058 iso_pu_bacteria 2919114240 2919116641 349
1059 iso_pu_bacteria 2919166419 2919168460 349
1060 iso_pu_bacteria 2919171160 2919172424 349
1061 iso_pu_bacteria 2919408235 2919409333 349
1062 iso_pu_bacteria 2920760137 2920766095 349
1063 iso_pu_bacteria 2920822456 2920824721 349
1064 iso_pu_bacteria 2921201388 2921201938 349
1065 iso_pu_bacteria 2921208531 2921211204 349
1066 iso_pu_bacteria 2921237296 2921240723 349
1067 iso_pu_bacteria 2921244191 2921244634 349
1068 iso_pu_bacteria 2921250672 2921251173 349
1069 iso_pu_bacteria 2921257292 2921262468 349
1070 iso_pu_bacteria 2921263974 2921265116 349
1071 iso_pu_bacteria 2921282425 2921283767 349
1072 iso_pu_bacteria 2921289301 2921296325 349
1073 iso_pu_bacteria 2921296804 2921303773 349
1074 iso_pu_bacteria 2922130491 2922135182 349
1075 iso_pu_bacteria 2922151315 2922155086 349
1076 iso_pu_bacteria 2922158528 2922165083 349
1077 iso_pu_bacteria 2922172374 2922177911 349
1078 iso_pu_bacteria 2922178524 2922184595 349
1079 iso_pu_bacteria 2922185730 2922186354 349
1080 iso_pu_bacteria 2923556063 2923558760 349
1081 iso_pu_bacteria 2924144063 2924147098 349
1082 iso_pu_bacteria 2924150972 2924155258 349
1083 iso_pu_bacteria 2924158325 2924160763 349
1084 iso_pu_bacteria 2924165586 2924167341 349
1085 iso_pu_bacteria 2924172951 2924178982 349
1086 iso_pu_bacteria 2924179722 2924184070 349
1087 iso_pu_bacteria 2924186466 2924189069 349
1088 iso_pu_bacteria 2924193448 2924194796 349
1089 iso_pu_bacteria 2924200457 2924203356 349
1090 iso_pu_bacteria 2924207177 2924208830 349
1091 iso_pu_bacteria 2924214083 2924217920 349
1092 iso_pu_bacteria 2924221636 2924226508 349
1093 iso_pu_bacteria 2924228884 2924229950 349
1094 iso_pu_bacteria 2924718760 2924723133 349
1095 iso_pu_bacteria 2924726620 2924728230 349
1096 iso_pu_bacteria 2924733363 2924736665 349
1097 iso_pu_bacteria 2924741084 2924741501 349
1098 iso_pu_bacteria 2924748358 2924754607 349
1099 iso_pu_bacteria 2924762789 2924764011 349
1100 iso_pu_bacteria 2924776078 2924778225 349
1101 iso_pu_bacteria 2924784321 2924785569 349
1102 iso_pu_bacteria 2926754445 2926754650 349
1103 iso_pu_bacteria 2926760298 2926761818 349
1104 iso_pu_bacteria 2928521798 2928524268 349
1105 iso_pu_bacteria 2929138655 2929142117 349
1106 iso_pu_bacteria 2933006813 2933007050 349
1107 iso_pu_bacteria 2933011516 2933015360 349
1108 iso_pu_bacteria 2933570622 2933574695 349
1109 iso_pu_bacteria 2933586486 2933589300 349
1110 iso_pu_bacteria 2933594066 2933594252 349
1111 iso_pu_bacteria 2933599457 2933603512 349
1112 iso_pu_bacteria 2935894831 2935899711 349
1113 iso_pu_bacteria 2935901341 2935907530 349
1114 iso_pu_bacteria 2936367885 2936374846 349
1115 iso_pu_bacteria 2936375103 2936380538 349
1116 iso_pu_bacteria 2936996657 2936998124 349
1117 iso_pu_bacteria 2937002841 2937005064 349
1118 iso_pu_bacteria 2937009748 2937012208 349
1119 iso_pu_bacteria 2937016420 2937018633 349
1120 iso_pu_bacteria 2937023124 2937028972 349
1121 iso_pu_bacteria 2937029754 2937031276 349
1122 iso_pu_bacteria 2937036028 2937038583 349
1123 iso_pu_bacteria 2937042894 2937045881 349
1124 iso_pu_bacteria 2937049772 2937050950 349
1125 iso_pu_bacteria 2937056579 2937061544 349
1126 iso_pu_bacteria 2937063883 2937065229 349
1127 iso_pu_bacteria 2937071275 2937073048 349
1128 iso_pu_bacteria 2937078374 2937079798 349
1129 iso_pu_bacteria 2937084907 2937085166 349
1130 iso_pu_bacteria 2937091812 2937097588 349
1131 iso_pu_bacteria 2937098957 2937099535 349
1132 iso_pu_bacteria 2937106411 2937110009 349
1133 iso_pu_bacteria 2937113482 2937116269 349
1134 iso_pu_bacteria 2937119839 2937123079 349
1135 iso_pu_bacteria 2937126314 2937128708 349
1136 iso_pu_bacteria 2937813078 2937819887 349
1137 iso_pu_bacteria 2937822353 2937826378 349
1138 iso_pu_bacteria 2937836603 2937836691 349
1139 iso_pu_bacteria 2937843397 2937847812 349
1140 iso_pu_bacteria 2937843397 2937847813 349
1141 iso_pu_bacteria 2937848649 2937854682 349
1142 iso_pu_bacteria 2937861824 2937861906 349
1143 iso_pu_bacteria 2937877337 2937878346 349
1144 iso_pu_bacteria 2937891427 2937892192 349
1145 iso_pu_bacteria 2937972304 2937980258 349
1146 iso_pu_bacteria 2937980651 2937982872 349
1147 iso_pu_bacteria 2937994558 2937997564 349
1148 iso_pu_bacteria 2938014810 2938018158 349
1149 iso_pu_bacteria 2941499720 2941504977 349
1150 iso_pu_bacteria 2941531003 2941533285 349
1151 iso_pu_bacteria 2954011201 2954013218 349
1152 iso_pu_bacteria 2957382221 2957384802 349
1153 iso_pu_bacteria 2957388812 2957394844 349
1154 iso_pu_bacteria 2957395598 2957398270 349
1155 iso_pu_bacteria 2957402308 2957403206 349
1156 iso_pu_bacteria 2957408893 2957411599 349
1157 iso_pu_bacteria 2957415311 2957418323 349
1158 iso_pu_bacteria 2957422303 2957423296 349
1159 iso_pu_bacteria 2957430029 2957432799 349
1160 iso_pu_bacteria 2957437181 2957441264 349
1161 iso_pu_bacteria 2957443900 2957444988 349
1162 iso_pu_bacteria 2957450854 2957455969 349
1163 iso_pu_bacteria 2957457609 2957459920 349
1164 iso_pu_bacteria 2957464669 2957465992 349
1165 iso_pu_bacteria 2957471148 2957477087 349
1166 iso_pu_bacteria 2957478035 2957479219 349
1167 iso_pu_bacteria 2957484790 2957486256 349
1168 iso_pu_bacteria 2957491536 2957492868 349
1169 iso_pu_bacteria 2957498199 2957498692 349
1170 iso_pu_bacteria 2957505466 2957507657 349
1171 iso_pu_bacteria 2958034702 2958036004 349
1172 iso_pu_bacteria 2958041894 2958045310 349
1173 iso_pu_bacteria 2958064165 2958068017 349
1174 iso_pu_bacteria 2958071322 2958076059 349
1175 iso_pu_bacteria 2958084443 2958085462 349
1176 iso_pu_bacteria 2958092219 2958098827 349
1177 iso_pu_bacteria 2958100919 2958101736 349
1178 iso_pu_bacteria 2958108152 2958108961 349
1179 iso_pu_bacteria 2958115193 2958119418 349
1180 iso_pu_bacteria 2958122699 2958127179 349
1181 iso_pu_bacteria 2958130278 2958135388 349
1182 iso_pu_bacteria 2958137437 2958139459 349
1183 iso_pu_bacteria 2958144490 2958145512 349
1184 iso_pu_bacteria 2958158011 2958161411 349
1185 iso_pu_bacteria 2958165035 2958168037 349
1186 iso_pu_bacteria 2958172287 2958178982 349
1187 iso_pu_bacteria 2958179912 2958184417 349
1188 iso_pu_bacteria 2960584000 2960584303 349
1189 iso_pu_bacteria 2960591022 2960592717 349
1190 iso_pu_bacteria 2960597568 2960602687 349
1191 iso_pu_bacteria 2960603979 2960605934 349
1192 iso_pu_bacteria 2960610863 2960612420 349
1193 iso_pu_bacteria 2960617483 2960620014 349
1194 iso_pu_bacteria 2960624210 2960629228 349
1195 iso_pu_bacteria 2960631154 2960632834 349
1196 iso_pu_bacteria 2960637947 2960639852 349
1197 iso_pu_bacteria 2960645483 2960650504 349
1198 iso_pu_bacteria 2960652885 2960660039 349
1199 iso_pu_bacteria 2960660292 2960660850 349
1200 iso_pu_bacteria 2960667422 2960670966 349
1201 iso_pu_bacteria 2960674078 2960675913 349
1202 iso_pu_bacteria 2960680706 2960681859 349
1203 iso_pu_bacteria 2960687367 2960688014 349
1204 iso_pu_bacteria 2960693952 2960694661 349
1205 iso_pu_bacteria 2961077736 2961082472 349
1206 iso_pu_bacteria 2961114664 2961118766 349
1207 iso_pu_bacteria 2961127735 2961129736 349
1208 iso_pu_bacteria 2961163497 2961166503 349
1209 iso_pu_bacteria 2961170736 2961176477 349
1210 iso_pu_bacteria 2961183825 2961190417 349
1211 iso_pu_bacteria 2963644680 2963645003 349
1212 iso_pu_bacteria 2964607997 2964611615 349
1213 iso_pu_bacteria 2964615318 2964616576 349
1214 iso_pu_bacteria 2964621998 2964622582 349
1215 iso_pu_bacteria 2964628898 2964635803 349
1216 iso_pu_bacteria 2964636051 2964640947 349
1217 iso_pu_bacteria 2964643177 2964649473 349
1218 iso_pu_bacteria 2964649959 2964651787 349
1219 iso_pu_bacteria 2964656573 2964661011 349
1220 iso_pu_bacteria 2964663802 2964667043 349
1221 iso_pu_bacteria 2964670856 2964677501 349
1222 iso_pu_bacteria 2964678106 2964684091 349
1223 iso_pu_bacteria 2964685014 2964687675 349
1224 iso_pu_bacteria 2964691889 2964692863 349
1225 iso_pu_bacteria 2964698721 2964702322 349
1226 iso_pu_bacteria 2964705432 2964711844 349
1227 iso_pu_bacteria 2964712639 2964716771 349
1228 iso_pu_bacteria 2964719344 2964723890 349
1229 iso_pu_bacteria 2965018300 2965021323 349
1230 iso_pu_bacteria 2965025482 2965030313 349
1231 iso_pu_bacteria 2965032056 2965038417 349
1232 iso_pu_bacteria 2965040258 2965046986 349
1233 iso_pu_bacteria 2965047637 2965054068 349
1234 iso_pu_bacteria 2965062239 2965066309 349
1235 iso_pu_bacteria 2965089291 2965094312 349
1236 iso_pu_bacteria 2965102966 2965107799 349
1237 iso_pu_bacteria 2965119406 2965126747 349
1238 iso_pu_bacteria 2967664464 2967665501 349
1239 iso_pu_bacteria 2967671571 2967672560 349
1240 iso_pu_bacteria 2967678726 2967681857 349
1241 iso_pu_bacteria 2967686174 2967691700 349
1242 iso_pu_bacteria 2967693043 2967695255 349
1243 iso_pu_bacteria 2967699805 2967703245 349
1244 iso_pu_bacteria 2967706974 2967707788 349
1245 iso_pu_bacteria 2967714385 2967716661 349
1246 iso_pu_bacteria 2967721400 2967721662 349
1247 iso_pu_bacteria 2967728569 2967734983 349
1248 iso_pu_bacteria 2967735183 2967736860 349
1249 iso_pu_bacteria 2967742019 2967744128 349
1250 iso_pu_bacteria 2967748971 2967755481 349
1251 iso_pu_bacteria 2967755722 2967758749 349
1252 iso_pu_bacteria 2967762386 2967765379 349
1253 iso_pu_bacteria 2967769361 2967775657 349
1254 iso_pu_bacteria 2967775926 2967782292 349
1255 iso_pu_bacteria 2967996073 2968001506 349
1256 iso_pu_bacteria 2968003550 2968007559 349
1257 iso_pu_bacteria 2968016561 2968017258 349
1258 iso_pu_bacteria 2968083720 2968088715 349
1259 iso_pu_bacteria 2968091066 2968093852 349
1260 iso_pu_bacteria 2968097103 2968097725 349
1261 iso_pu_bacteria 2968110612 2968115233 349
1262 iso_pu_bacteria 2968117919 2968121968 349
1263 iso_pu_bacteria 2968128360 2968134129 349
1264 iso_pu_bacteria 2968138860 2968142241 349
1265 iso_pu_bacteria 2968171901 2968174907 349
1266 iso_pu_bacteria 2970019648 2970026519 349
1267 iso_pu_bacteria 2970026789 2970031011 349
1268 iso_pu_bacteria 2970033650 2970039721 349
1269 iso_pu_bacteria 2970040964 2970041328 349
1270 iso_pu_bacteria 2970047711 2970054421 349
1271 iso_pu_bacteria 2970054988 2970057812 349
1272 iso_pu_bacteria 2970061556 2970066697 349
1273 iso_pu_bacteria 2970068827 2970073000 349
1274 iso_pu_bacteria 2970076120 2970077458 349
1275 iso_pu_bacteria 2970082768 2970083746 349
1276 iso_pu_bacteria 2970088815 2970091173 349
1277 iso_pu_bacteria 2970095765 2970097288 349
1278 iso_pu_bacteria 2970102677 2970107499 349
1279 iso_pu_bacteria 2970109326 2970110866 349
1280 iso_pu_bacteria 2970116247 2970122166 349
1281 iso_pu_bacteria 2970122695 2970122980 349
1282 iso_pu_bacteria 2970129317 2970131683 349
1283 iso_pu_bacteria 2970136068 2970138581 349
1284 iso_pu_bacteria 2970143518 2970144100 349
1285 iso_pu_bacteria 2970149975 2970154256 349
1286 iso_pu_bacteria 2970156795 2970160120 349
1287 iso_pu_bacteria 2970164137 2970167122 349
1288 iso_pu_bacteria 2970170962 2970173284 349
1289 iso_pu_bacteria 2970177841 2970178377 349
1290 iso_pu_bacteria 2970184632 2970187579 349
1291 iso_pu_bacteria 2970191845 2970193336 349
1292 iso_pu_bacteria 2970469710 2970470615 349
1293 iso_pu_bacteria 2970489779 2970490168 349
1294 iso_pu_bacteria 2970503327 2970509148 349
1295 iso_pu_bacteria 2970510686 2970514787 349
1296 iso_pu_bacteria 2970524798 2970525748 349
1297 iso_pu_bacteria 2970532167 2970536594 349
1298 iso_pu_bacteria 2970540015 2970544000 349
1299 iso_pu_bacteria 2970547951 2970550468 349
1300 iso_pu_bacteria 2970554993 2970557977 349
1301 iso_pu_bacteria 2970593180 2970594735 349
1302 iso_pu_bacteria 2970619444 2970623981 349
1303 iso_pu_bacteria 2977516862 2977522403 349
1304 iso_pu_bacteria 2977523885 2977529043 349
1305 iso_pu_bacteria 2977530762 2977531669 349
1306 iso_pu_bacteria 2977537788 2977540564 349
1307 iso_pu_bacteria 2977544691 2977549084 349
1308 iso_pu_bacteria 2977551784 2977554418 349
1309 iso_pu_bacteria 2977558990 2977560182 349
1310 iso_pu_bacteria 2977565890 2977572260 349
1311 iso_pu_bacteria 2977572785 2977575289 349
1312 iso_pu_bacteria 2977579622 2977580173 349
1313 iso_pu_bacteria 2977821940 2977824719 349
1314 iso_pu_bacteria 2977828996 2977835715 349
1315 iso_pu_bacteria 2977843712 2977845485 349
1316 iso_pu_bacteria 2977851361 2977857594 349
1317 iso_pu_bacteria 2977858184 2977864368 349
1318 iso_pu_bacteria 2977864932 2977866508 349
1319 iso_pu_bacteria 2977872689 2977873694 349
1320 iso_pu_bacteria 2977898635 2977905298 349
1321 iso_pu_bacteria 2977907340 2977908976 349
1322 iso_pu_bacteria 2977915119 2977918008 349
1323 iso_pu_bacteria 2977922695 2977925870 349
1324 iso_pu_bacteria 2977935797 2977939515 349
1325 iso_pu_bacteria 2977942078 2977944147 349
1326 iso_pu_bacteria 2977950692 2977951496 349
1327 iso_pu_bacteria 2977957713 2977963420 349
1328 iso_pu_bacteria 2977971508 2977978799 349
1329 iso_pu_bacteria 2977986579 2977991602 349
1330 iso_pu_bacteria 2978969890 2978971135 349
1331 iso_pu_bacteria 2979089926 2979092916 349
1332 iso_pu_bacteria 2979095461 2979099695 349
1333 iso_pu_bacteria 2979100975 2979104885 349
1334 iso_pu_bacteria 2979710463 2979712958 349
1335 iso_pu_bacteria 2979742915 2979751194 349
1336 iso_pu_bacteria 2979764755 2979771573 349
1337 iso_pu_bacteria 2979772303 2979776490 349
1338 iso_pu_bacteria 2979779861 2979782582 349
1339 iso_pu_bacteria 2979793036 2979794707 349
1340 iso_pu_bacteria 2979808191 2979813827 349
1341 iso_pu_bacteria 2984509177 2984513314 349
1342 iso_pu_bacteria 2984518228 2984520317 349
1343 iso_pu_bacteria 2984537506 2984539615 349
1344 iso_pu_bacteria 2984587000 2984588296 349
1345 iso_pu_bacteria 2984601300 2984601841 349
1346 iso_pu_bacteria 2987636660 2987641216 349
1347 iso_pu_bacteria 2987645492 2987646125 349
1348 iso_pu_bacteria 2987652177 2987656608 349
1349 iso_pu_bacteria 2987659509 2987662513 349
1350 iso_pu_bacteria 2987666974 2987667547 349
1351 iso_pu_bacteria 2987673487 2987677285 349
1352 iso_pu_bacteria 2989349275 2989354132 349
1353 iso_pu_bacteria 2996336353 2996338547 349
1354 iso_pu_bacteria 2996341866 2996346800 349
1355 iso_pu_bacteria 2996348954 2996349945 349
1356 iso_pu_bacteria 2996386984 2996391656 349
1357 iso_pu_bacteria 2996887358 2996889227 349
1358 iso_pu_bacteria 2996893221 2996894710 349
1359 iso_pu_bacteria 3000135777 3000142582 349
1360 iso_pu_bacteria 3003930520 3003932697 349
1361 iso_pu_bacteria 3004167301 3004172866 349
1362 iso_pu_bacteria 3004188549 3004191563 349
1363 iso_pu_bacteria 3004195979 3004198194 349
1364 iso_pu_bacteria 3004203850 3004210023 349
1365 iso_pu_bacteria 3004211236 3004216424 349
1366 iso_pu_bacteria 3004218560 3004218635 349
1367 iso_pu_bacteria 3004232784 3004239420 349
1368 iso_pu_bacteria 3004248173 3004255195 349
1369 iso_pu_bacteria 3004268573 3004272554 349
1370 iso_pu_bacteria 3004275668 3004276647 349
1371 iso_pu_bacteria 3004289098 3004293723 349
1372 iso_pu_bacteria 3004334049 3004337751 349
1373 iso_pu_bacteria 3005416602 3005417164 349
1374 iso_pu_bacteria 3005718088 3005722735 349
1375 iso_pu_bacteria 637000159 637077346 349
1376 iso_pu_bacteria 639633055 639650021 349
1377 iso_pu_bacteria 643692032 643825975 349
1378 iso_pu_bacteria 648276728 648739557 349
1379 iso_pu_bacteria 649633066 649870218 349
1380 iso_pu_bacteria 650716007 650738741 349
1381 iso_pu_bacteria 8002285264 8002287118 349
1382 iso_pu_bacteria 8003570095 8003572287 349
1383 iso_pu_bacteria 8003992118 8003993848 349
1384 iso_pu_bacteria 8003999396 8004001393 349
1385 iso_pu_bacteria 8004300914 8004301013 349
1386 iso_pu_bacteria 8004312739 8004315020 349
1387 iso_pu_bacteria 8004361976 8004363417 349
1388 iso_pu_bacteria 8004374579 8004377158 349
1389 iso_pu_bacteria 8004387939 8004393277 349
1390 iso_pu_bacteria 8004445564 8004451485 349
1391 iso_pu_bacteria 8004633249 8004637718 349
1392 iso_pu_bacteria 8004640170 8004644241 349
1393 iso_pu_bacteria 8004695233 8004697698 349
1394 iso_pu_bacteria 8004703790 8004707002 349
1395 iso_pu_bacteria 8004714634 8004720064 349
1396 iso_pu_bacteria 8004727605 8004729718 349
1397 iso_pu_bacteria 8005258706 8005264195 349
1398 iso_pu_bacteria 8005275841 8005282039 349
1399 iso_pu_bacteria 8005282627 8005288486 349
1400 iso_pu_bacteria 8005289223 8005294242 349
1401 iso_pu_bacteria 8005301065 8005306653 349
1402 iso_pu_bacteria 8005307578 8005309411 349
1403 iso_pu_bacteria 8005314921 8005315225 349
1404 iso_pu_bacteria 8005321885 8005323754 349
1405 iso_pu_bacteria 8005376324 8005382762 349
1406 iso_pu_bacteria 8005382845 8005383819 349
1407 iso_pu_bacteria 8005395548 8005401145 349
1408 iso_pu_bacteria 8005430974 8005434098 349
1409 iso_pu_bacteria 8005460587 8005464639 349
1410 iso_pu_bacteria 8005484373 8005485605 349
1411 iso_pu_bacteria 8005497431 8005501689 349
1412 iso_pu_bacteria 8005542996 8005547094 349
1413 iso_pu_bacteria 8005556819 8005559142 349
1414 iso_pu_bacteria 8005563573 8005566799 349
1415 iso_pu_bacteria 8005570704 8005574923 349
1416 iso_pu_bacteria 8005619151 8005623043 349
1417 iso_pu_bacteria 8005626139 8005631653 349
1418 iso_pu_bacteria 8005645114 8005648378 349
1419 iso_pu_bacteria 8005668836 8005673111 349
1420 iso_pu_bacteria 8005682033 8005684545 349
1421 iso_pu_bacteria 8005688590 8005693651 349
1422 iso_pu_bacteria 8005695170 8005700889 349
1423 iso_pu_bacteria 8018127388 8018133594 349
1424 iso_pu_bacteria 8018163183 8018170242 349
1425 iso_pu_bacteria 8018176218 8018178441 349
1426 iso_pu_bacteria 8023680758 8023687524 349
1427 iso_pu_bacteria 8024479707 8024481973 349
1428 iso_pu_bacteria 8024501048 8024505914 349
1429 iso_pu_bacteria 8049293176 8049294959 349
1430 iso_pu_bacteria 8054460903 8054461050 349
1431 iso_pu_bacteria 8054558443 8054562059 349
1432 iso_pu_bacteria 8055617313 8055617561 349
1433 iso_pu_bacteria 8056375014 8056381606 349
1434 iso_pu_bacteria 8056382006 8056387047 349
1435 iso_pu_bacteria 8056875544 8056878716 349
1436 iso_pu_bacteria 8056875544 8056878717 349
1437 iso_pu_bacteria 8056967851 8056968483 349
1438 iso_pu_bacteria 8057874678 8057877014 349
1439 3300003215 JGI25153J46596_10000428 JGI25153J46596_1000042828 350
1440 3300003354 JGI25160J50197_1000438 JGI25160J50197_10004386 350
1441 3300003354 JGI25160J50197_1002737 JGI25160J50197_10027374 350
1442 3300003794 Ga0055531_10007059 Ga0055531_100070593 350
1443 3300005262 Ga0065165_1001465 Ga0065165_10014654 350
1444 3300005347 Ga0070668_100021775 Ga0070668_1000217752 350
1445 3300005355 Ga0070671_100098198 Ga0070671_1000981982 350
1446 3300005367 Ga0070667_100019257 Ga0070667_1000192571 350
1447 3300005455 Ga0070663_100113712 Ga0070663_1001137122 350
1448 3300005459 Ga0068867_100067298 Ga0068867_1000672983 350
1449 3300005617 Ga0068859_100425277 Ga0068859_1004252771 350
1450 3300005842 Ga0068858_100367623 Ga0068858_1003676231 350
1451 3300005937 Ga0081455_10004237 Ga0081455_100042377 350
1452 3300005985 Ga0081539_10001300 Ga0081539_1000130014 350
1453 3300005985 Ga0081539_10046429 Ga0081539_100464291 350
1454 3300006038 Ga0075365_10043121 Ga0075365_100431213 350
1455 3300006048 Ga0075363_100026888 Ga0075363_1000268883 350
1456 3300006051 Ga0075364_10022672 Ga0075364_100226722 350
1457 3300006178 Ga0075367_10031807 Ga0075367_100318072 350
1458 3300006186 Ga0075369_10000420 Ga0075369_100004202 350
1459 3300006186 Ga0075369_10109517 Ga0075369_101095171 350
1460 3300006195 Ga0075366_10044168 Ga0075366_100441682 350
1461 3300006353 Ga0075370_10049519 Ga0075370_100495192 350
1462 3300006353 Ga0075370_10058432 Ga0075370_100584323 350
1463 3300006353 Ga0075370_10062341 Ga0075370_100623412 350
1464 3300006881 Ga0068865_100107695 Ga0068865_1001076952 350
1465 3300006931 Ga0097620_100425243 Ga0097620_1004252431 350
1466 3300006942 Ga0099824_1015882 Ga0099824_10158824 350
1467 3300009094 Ga0111539_10240090 Ga0111539_102400902 350
1468 3300009101 Ga0105247_10140550 Ga0105247_101405502 350
1469 3300009177 Ga0105248_10005607 Ga0105248_1000560717 350
1470 3300013100 Ga0157373_10132801 Ga0157373_101328011 350
1471 3300025261 Ga0209233_1002652 Ga0209233_10026525 350
1472 3300025295 Ga0209564_1033434 Ga0209564_10334341 350
1473 3300025297 Ga0209758_1000160 Ga0209758_100016046 350
1474 3300025297 Ga0209758_1000219 Ga0209758_100021937 350
1475 3300025299 Ga0209256_1003739 Ga0209256_10037394 350
1476 3300025302 Ga0207426_1000465 Ga0207426_100046523 350
1477 3300025304 Ga0209257_1000650 Ga0209257_100065016 350
1478 3300025903 Ga0207680_10219750 Ga0207680_102197501 350
1479 3300025919 Ga0207657_10217966 Ga0207657_102179661 350
1480 3300025925 Ga0207650_10088443 Ga0207650_100884431 350
1481 3300025935 Ga0207709_10090300 Ga0207709_100903002 350
1482 3300025936 Ga0207670_10080693 Ga0207670_100806932 350
1483 3300025941 Ga0207711_10316023 Ga0207711_103160231 350
1484 3300026035 Ga0207703_10374259 Ga0207703_103742592 350
1485 3300026067 Ga0207678_10007246 Ga0207678_100072461 350
1486 3300026089 Ga0207648_10056668 Ga0207648_100566682 350
1487 3300027296 Ga0209389_1000081 Ga0209389_100008177 350
1488 3300027357 Ga0209589_1000091 Ga0209589_100009177 350
1489 3300027361 Ga0209489_100096 Ga0209489_100096109 350
1490 3300028379 Ga0268266_10120870 Ga0268266_101208702 350
1491 3300037418 Ga0395900_0006809 Ga0395900_0006809_3255_4343 350
1492 3300037418 Ga0395900_0119882 Ga0395900_0119882_721_1812 350
1493 3300037471 Ga0395905_0044671 Ga0395905_0044671_2931_4022 350
1494 3300038443 Ga0395901_0019762 Ga0395901_0019762_511_1599 350
1495 3300044658 Ga0466972_0000142 Ga0466972_0000142_10033_11127 350
1496 3300044683 Ga0466965_0041923 Ga0466965_0041923_1138_2229 350
1497 3300046474 Ga0495605_0061921 Ga0495605_0061921_304_1455 350
1498 3300046501 Ga0495607_0031344 Ga0495607_0031344_1907_3058 350
1499 3300046506 Ga0495583_0043839 Ga0495583_0043839_55_1146 350
1500 3300046512 Ga0495610_0005846 Ga0495610_0005846_7239_8390 350
1501 3300046514 Ga0495618_0090406 Ga0495618_0090406_806_1897 350
1502 3300046515 Ga0495620_0005040 Ga0495620_0005040_4752_5903 350
1503 3300046522 Ga0495643_0034038 Ga0495643_0034038_1578_2669 350
1504 3300046524 Ga0495648_0023485 Ga0495648_0023485_541_1692 350
1505 3300046530 Ga0495654_0012329 Ga0495654_0012329_238_1389 350
1506 3300046616 Ga0495668_0093064 Ga0495668_0093064_382_1533 350
1507 3300046616 Ga0495668_0151443 Ga0495668_0151443_101_1192 350
1508 3300046660 Ga0495625_0006283 Ga0495625_0006283_8643_9794 350
1509 3300046665 Ga0495661_0052588 Ga0495661_0052588_590_1741 350
1510 3300046691 Ga0495670_0016624 Ga0495670_0016624_1473_2624 350
1511 3300046694 Ga0495649_0130167 Ga0495649_0130167_89_1180 350
1512 3300046810 Ga0495660_0060603 Ga0495660_0060603_860_2011 350
1513 3300047323 Ga0495683_0112830 Ga0495683_0112830_176_1267 350
1514 3300047472 Ga0495686_0014003 Ga0495686_0014003_2593_3744 350
1515 3300048905 Ga0496102_0269753 Ga0496102_0269753_209_1300 350
1516 3300048912 Ga0496109_0049410 Ga0496109_0049410_2327_3418 350
1517 3300048913 Ga0496110_0064390 Ga0496110_0064390_441_1532 350
1518 3300048916 Ga0496113_0124584 Ga0496113_0124584_899_1990 350
1519 3300048920 Ga0496117_0083200 Ga0496117_0083200_648_1799 350
1520 3300048920 Ga0496117_0162863 Ga0496117_0162863_169_1260 350
1521 3300048921 Ga0496118_0048224 Ga0496118_0048224_2076_3167 350
1522 3300048924 Ga0496121_0080858 Ga0496121_0080858_208_1359 350
1523 3300048925 Ga0496122_0059858 Ga0496122_0059858_1335_2486 350
1524 3300048926 Ga0496123_0045453 Ga0496123_0045453_208_1359 350
1525 3300048928 Ga0496125_0029586 Ga0496125_0029586_1053_2144 350
1526 3300048929 Ga0496126_0262819 Ga0496126_0262819_129_1280 350
1527 3300050489 nmdc:mga03683_1100_c1 nmdc:mga03683_1100_c1_550_1647 350
1528 3300050489 nmdc:mga03683_409_c1 nmdc:mga03683_409_c1_6631_7728 350
1529 3300050491 nmdc:mga00v17_108403_c1 nmdc:mga00v17_108403_c1_348_1439 350
1530 3300050491 nmdc:mga00v17_180316_c1 nmdc:mga00v17_180316_c1_150_1241 350
1531 3300050492 nmdc:mga0yw44_31900_c1 nmdc:mga0yw44_31900_c1_1039_2130 350
1532 3300050492 nmdc:mga0yw44_3977_c1 nmdc:mga0yw44_3977_c1_3836_4987 350
1533 3300050493 nmdc:mga0k408_143738_c1 nmdc:mga0k408_143738_c1_312_1403 350
1534 3300050493 nmdc:mga0k408_9138_c1 nmdc:mga0k408_9138_c1_1628_2725 350
1535 3300050494 nmdc:mga06z11_3255_c1 nmdc:mga06z11_3255_c1_1343_2440 350
1536 3300050495 nmdc:mga04h51_23837_c1 nmdc:mga04h51_23837_c1_563_1654 350
1537 3300050496 nmdc:mga07m45_108881_c1 nmdc:mga07m45_108881_c1_338_1429 350
1538 3300050496 nmdc:mga07m45_23668_c2 nmdc:mga07m45_23668_c2_521_1618 350
1539 3300050496 nmdc:mga07m45_3358_c1 nmdc:mga07m45_3358_c1_6078_7175 350
1540 3300050496 nmdc:mga07m45_61401_c1 nmdc:mga07m45_61401_c1_519_1610 350
1541 3300050511 nmdc:mga08y16_202134_c1 nmdc:mga08y16_202134_c1_699_1796 350
1542 3300050516 nmdc:mga0sz30_57771_c1 nmdc:mga0sz30_57771_c1_98_1189 350
1543 3300050516 nmdc:mga0sz30_6454_c1 nmdc:mga0sz30_6454_c1_3148_4245 350
1544 3300053079 Ga0500610_0025694 Ga0500610_0025694_694_1785 350
1545 3300053087 Ga0500643_012824 Ga0500643_012824_1589_2740 350
1546 3300053089 Ga0500581_120407 Ga0500581_120407_143_1231 350
1547 3300053096 Ga0500641_0000376 Ga0500641_0000376_10287_11384 350
1548 3300053096 Ga0500641_0026306 Ga0500641_0026306_648_1799 350
1549 3300053098 Ga0500650_0013072 Ga0500650_0013072_1506_2657 350
1550 3300053104 Ga0500556_0000002 Ga0500556_0000002_330437_331588 350
1551 3300053105 Ga0500557_000022 Ga0500557_000022_81948_83039 350
1552 3300053109 Ga0500569_029724 Ga0500569_029724_286_1377 350
1553 3300053116 Ga0500592_001501 Ga0500592_001501_591_1742 350
1554 3300053118 Ga0500594_0015572 Ga0500594_0015572_214_1365 350
1555 3300053130 Ga0500642_0000016 Ga0500642_0000016_22580_23731 350
1556 3300053130 Ga0500642_0000166 Ga0500642_0000166_20021_21112 350
1557 3300053139 Ga0500568_0013231 Ga0500568_0013231_2177_3328 350
1558 3300053146 Ga0500588_0072814 Ga0500588_0072814_18_1106 350
1559 3300053151 Ga0500604_0000742 Ga0500604_0000742_2741_3892 350
1560 3300053156 Ga0500622_0000668 Ga0500622_0000668_8719_9807 350
1561 3300053177 Ga0500636_0003407 Ga0500636_0003407_5978_7069 350
1562 3300053729 Ga0500625_006836 Ga0500625_006836_1106_2197 350
1563 3300053730 Ga0500645_012516 Ga0500645_012516_72_1175 350
1564 3300053730 Ga0500645_039163 Ga0500645_039163_46_1197 350
1565 3300053731 Ga0500609_003310 Ga0500609_003310_636_1727 350
1566 3300053737 Ga0500601_000258 Ga0500601_000258_2532_3623 350
1567 iso_pu_bacteria 2919450847 2919454316 350
1568 3300006038 Ga0075365_10002327 Ga0075365_100023272 351
1569 3300006186 Ga0075369_10024616 Ga0075369_100246164 351
1570 3300006195 Ga0075366_10005612 Ga0075366_100056126 351
1571 3300009766 Ga0123342_1023961 Ga0123342_10239613 351
1572 3300025295 Ga0209564_1017395 Ga0209564_10173952 351
1573 3300031911 Ga0307412_10004217 Ga0307412_100042173 351
1574 3300045051 Ga0451576_0000108 Ga0451576_0000108_13376_14467 351
1575 3300049586 Ga0501070_0021164 Ga0501070_0021164_3449_4540 351
1576 3300049776 Ga0501280_002770 Ga0501280_002770_380_1477 351
1577 3300049822 Ga0501035_0004420 Ga0501035_0004420_6596_7687 351
1578 3300050493 nmdc:mga0k408_7428_c1 nmdc:mga0k408_7428_c1_1289_2416 351
1579 3300053139 Ga0500568_0018845 Ga0500568_0018845_1879_2985 351
1580 iso_pu_bacteria 2775507049 2776916135 351
1581 3300005329 Ga0070683_100057598 Ga0070683_1000575983 352
1582 3300005339 Ga0070660_100084487 Ga0070660_1000844871 352
1583 3300005344 Ga0070661_100046186 Ga0070661_1000461861 352
1584 3300005563 Ga0068855_100049447 Ga0068855_1000494472 352
1585 3300005614 Ga0068856_100006276 Ga0068856_1000062764 352
1586 3300005616 Ga0068852_100014911 Ga0068852_1000149113 352
1587 3300006038 Ga0075365_10054915 Ga0075365_100549153 352
1588 3300006195 Ga0075366_10142134 Ga0075366_101421341 352
1589 3300009551 Ga0105238_10063446 Ga0105238_100634463 352
1590 3300013105 Ga0157369_10073358 Ga0157369_100733582 352
1591 3300013307 Ga0157372_10163959 Ga0157372_101639592 352
1592 3300025919 Ga0207657_10073027 Ga0207657_100730272 352
1593 3300025920 Ga0207649_10015177 Ga0207649_100151774 352
1594 3300025944 Ga0207661_10130409 Ga0207661_101304092 352
1595 3300025945 Ga0207679_10031984 Ga0207679_100319841 352
1596 3300025949 Ga0207667_10045333 Ga0207667_100453333 352
1597 3300031240 Ga0265320_10001570 Ga0265320_1000157014 352
1598 3300031711 Ga0265314_10015333 Ga0265314_100153333 352
1599 3300031728 Ga0316578_10012241 Ga0316578_100122415 352
1600 3300035398 Ga0316574_0000447 Ga0316574_0000447_9403_10512 352
1601 3300037312 Ga0395899_0014217 Ga0395899_0014217_1376_2479 352
1602 3300037418 Ga0395900_0061357 Ga0395900_0061357_1913_3016 352
1603 3300038443 Ga0395901_0048672 Ga0395901_0048672_704_1807 352
1604 3300038443 Ga0395901_0107512 Ga0395901_0107512_317_1420 352
1605 3300047320 Ga0495672_0118403 Ga0495672_0118403_29_1135 352
1606 3300048918 Ga0496115_0064682 Ga0496115_0064682_1674_2759 352
1607 3300053096 Ga0500641_0017367 Ga0500641_0017367_1089_2204 352
1608 3300053142 Ga0500577_0000373 Ga0500577_0000373_1967_3055 352
1609 3300001915 JGI24741J21665_1007941 JGI24741J21665_10079412 353
1610 3300001977 JGI24746J21847_1000755 JGI24746J21847_10007553 353
1611 3300001989 JGI24739J22299_10000344 JGI24739J22299_1000034416 353
1612 3300001990 JGI24737J22298_10001079 JGI24737J22298_1000107910 353
1613 3300002070 JGI24750J21931_1000255 JGI24750J21931_10002552 353
1614 3300002073 JGI24745J21846_1000003 JGI24745J21846_100000312 353
1615 3300002126 JGI24035J26624_1000595 JGI24035J26624_10005952 353
1616 3300002155 JGI24033J26618_1000489 JGI24033J26618_10004894 353
1617 3300002239 JGI24034J26672_10000322 JGI24034J26672_100003223 353
1618 3300002244 JGI24742J22300_10002875 JGI24742J22300_100028752 353
1619 3300002459 JGI24751J29686_10004924 JGI24751J29686_100049242 353
1620 3300002459 JGI24751J29686_10010970 JGI24751J29686_100109701 353
1621 3300003187 JGI25151J46595_10036025 JGI25151J46595_100360251 353
1622 3300003354 JGI25160J50197_1000216 JGI25160J50197_100021615 353
1623 3300003354 JGI25160J50197_1000463 JGI25160J50197_100046318 353
1624 3300003374 JGI25161J50226_1000412 JGI25161J50226_100041219 353
1625 3300003771 Ga0055526_1000594 Ga0055526_100059413 353
1626 3300003781 Ga0055536_1013021 Ga0055536_10130211 353
1627 3300003791 Ga0055530_10011385 Ga0055530_100113854 353
1628 3300003794 Ga0055531_10007361 Ga0055531_100073612 353
1629 3300003856 Ga0058692_1000689 Ga0058692_100068911 353
1630 3300004625 Ga0055543_1000301 Ga0055543_100030136 353
1631 3300005262 Ga0065165_1000717 Ga0065165_100071715 353
1632 3300005290 Ga0065712_10003725 Ga0065712_100037251 353
1633 3300005290 Ga0065712_10070614 Ga0065712_100706142 353
1634 3300005293 Ga0065715_10093037 Ga0065715_100930374 353
1635 3300005328 Ga0070676_10000784 Ga0070676_100007842 353
1636 3300005329 Ga0070683_100000114 Ga0070683_1000001146 353
1637 3300005330 Ga0070690_100000064 Ga0070690_10000006439 353
1638 3300005330 Ga0070690_100022010 Ga0070690_1000220104 353
1639 3300005331 Ga0070670_100002373 Ga0070670_1000023732 353
1640 3300005333 Ga0070677_10000193 Ga0070677_1000019312 353
1641 3300005333 Ga0070677_10022088 Ga0070677_100220882 353
1642 3300005334 Ga0068869_100000020 Ga0068869_10000002014 353
1643 3300005334 Ga0068869_100006431 Ga0068869_1000064312 353
1644 3300005335 Ga0070666_10030214 Ga0070666_100302142 353
1645 3300005336 Ga0070680_100000242 Ga0070680_10000024233 353
1646 3300005337 Ga0070682_100000224 Ga0070682_10000022435 353
1647 3300005338 Ga0068868_100001773 Ga0068868_1000017736 353
1648 3300005339 Ga0070660_100000123 Ga0070660_1000001232 353
1649 3300005340 Ga0070689_100000685 Ga0070689_1000006855 353
1650 3300005340 Ga0070689_100153949 Ga0070689_1001539492 353
1651 3300005341 Ga0070691_10013336 Ga0070691_100133362 353
1652 3300005343 Ga0070687_100000351 Ga0070687_10000035116 353
1653 3300005344 Ga0070661_100026596 Ga0070661_1000265962 353
1654 3300005345 Ga0070692_10000108 Ga0070692_100001087 353
1655 3300005347 Ga0070668_100003586 Ga0070668_1000035863 353
1656 3300005347 Ga0070668_100180266 Ga0070668_1001802662 353
1657 3300005353 Ga0070669_100000176 Ga0070669_1000001769 353
1658 3300005353 Ga0070669_100062083 Ga0070669_1000620832 353
1659 3300005354 Ga0070675_100000259 Ga0070675_10000025923 353
1660 3300005354 Ga0070675_100099529 Ga0070675_1000995291 353
1661 3300005354 Ga0070675_100193875 Ga0070675_1001938752 353
1662 3300005355 Ga0070671_100004849 Ga0070671_1000048498 353
1663 3300005355 Ga0070671_100006467 Ga0070671_1000064673 353
1664 3300005355 Ga0070671_100153294 Ga0070671_1001532942 353
1665 3300005356 Ga0070674_100000099 Ga0070674_1000000992 353
1666 3300005356 Ga0070674_100026259 Ga0070674_1000262591 353
1667 3300005364 Ga0070673_100000042 Ga0070673_10000004249 353
1668 3300005364 Ga0070673_100084549 Ga0070673_1000845492 353
1669 3300005365 Ga0070688_100000329 Ga0070688_10000032911 353
1670 3300005365 Ga0070688_100074173 Ga0070688_1000741732 353
1671 3300005366 Ga0070659_100000348 Ga0070659_10000034830 353
1672 3300005367 Ga0070667_100001075 Ga0070667_10000107511 353
1673 3300005367 Ga0070667_100042027 Ga0070667_1000420273 353
1674 3300005406 Ga0070703_10000878 Ga0070703_100008786 353
1675 3300005434 Ga0070709_10032295 Ga0070709_100322953 353
1676 3300005434 Ga0070709_10129479 Ga0070709_101294792 353
1677 3300005435 Ga0070714_100152101 Ga0070714_1001521011 353
1678 3300005436 Ga0070713_100030475 Ga0070713_1000304752 353
1679 3300005436 Ga0070713_100183785 Ga0070713_1001837852 353
1680 3300005437 Ga0070710_10024016 Ga0070710_100240162 353
1681 3300005437 Ga0070710_10083034 Ga0070710_100830342 353
1682 3300005438 Ga0070701_10000025 Ga0070701_100000254 353
1683 3300005440 Ga0070705_100003281 Ga0070705_1000032816 353
1684 3300005440 Ga0070705_100170695 Ga0070705_1001706951 353
1685 3300005444 Ga0070694_100003777 Ga0070694_1000037778 353
1686 3300005444 Ga0070694_100100151 Ga0070694_1001001512 353
1687 3300005455 Ga0070663_100000064 Ga0070663_10000006437 353
1688 3300005456 Ga0070678_100002536 Ga0070678_1000025362 353
1689 3300005457 Ga0070662_100073373 Ga0070662_1000733731 353
1690 3300005458 Ga0070681_10000435 Ga0070681_1000043522 353
1691 3300005458 Ga0070681_10236072 Ga0070681_102360721 353
1692 3300005459 Ga0068867_100005677 Ga0068867_1000056772 353
1693 3300005459 Ga0068867_100027110 Ga0068867_1000271102 353
1694 3300005459 Ga0068867_100190588 Ga0068867_1001905882 353
1695 3300005535 Ga0070684_100001610 Ga0070684_1000016103 353
1696 3300005536 Ga0070697_100094045 Ga0070697_1000940452 353
1697 3300005539 Ga0068853_100002463 Ga0068853_10000246310 353
1698 3300005543 Ga0070672_100000011 Ga0070672_10000001133 353
1699 3300005544 Ga0070686_100000076 Ga0070686_10000007626 353
1700 3300005545 Ga0070695_100053966 Ga0070695_1000539662 353
1701 3300005546 Ga0070696_100052443 Ga0070696_1000524432 353
1702 3300005546 Ga0070696_100056200 Ga0070696_1000562002 353
1703 3300005547 Ga0070693_100004777 Ga0070693_1000047773 353
1704 3300005548 Ga0070665_100002816 Ga0070665_10000281617 353
1705 3300005548 Ga0070665_100003012 Ga0070665_10000301216 353
1706 3300005548 Ga0070665_100037641 Ga0070665_1000376414 353
1707 3300005548 Ga0070665_100289398 Ga0070665_1002893982 353
1708 3300005563 Ga0068855_100061125 Ga0068855_1000611253 353
1709 3300005564 Ga0070664_100000112 Ga0070664_10000011212 353
1710 3300005577 Ga0068857_100000023 Ga0068857_10000002360 353
1711 3300005577 Ga0068857_100024933 Ga0068857_1000249335 353
1712 3300005578 Ga0068854_100066891 Ga0068854_1000668912 353
1713 3300005614 Ga0068856_100000099 Ga0068856_10000009910 353
1714 3300005614 Ga0068856_100095048 Ga0068856_1000950482 353
1715 3300005614 Ga0068856_100118811 Ga0068856_1001188112 353
1716 3300005615 Ga0070702_100000005 Ga0070702_10000000566 353
1717 3300005616 Ga0068852_100002886 Ga0068852_1000028864 353
1718 3300005617 Ga0068859_100000503 Ga0068859_10000050310 353
1719 3300005617 Ga0068859_100128696 Ga0068859_1001286962 353
1720 3300005618 Ga0068864_100000112 Ga0068864_10000011244 353
1721 3300005618 Ga0068864_100006199 Ga0068864_1000061994 353
1722 3300005618 Ga0068864_100029277 Ga0068864_1000292772 353
1723 3300005718 Ga0068866_10000977 Ga0068866_1000097711 353
1724 3300005718 Ga0068866_10201434 Ga0068866_102014342 353
1725 3300005719 Ga0068861_100002096 Ga0068861_10000209612 353
1726 3300005840 Ga0068870_10000021 Ga0068870_1000002121 353
1727 3300005841 Ga0068863_100000227 Ga0068863_10000022744 353
1728 3300005841 Ga0068863_100100507 Ga0068863_1001005072 353
1729 3300005842 Ga0068858_100001279 Ga0068858_1000012796 353
1730 3300005842 Ga0068858_100004153 Ga0068858_1000041539 353
1731 3300005842 Ga0068858_100032557 Ga0068858_1000325571 353
1732 3300005844 Ga0068862_100001866 Ga0068862_10000186613 353
1733 3300005844 Ga0068862_100108483 Ga0068862_1001084832 353
1734 3300005981 Ga0081538_10019358 Ga0081538_100193582 353
1735 3300006028 Ga0070717_10130840 Ga0070717_101308401 353
1736 3300006038 Ga0075365_10008458 Ga0075365_100084586 353
1737 3300006038 Ga0075365_10018202 Ga0075365_100182023 353
1738 3300006038 Ga0075365_10097891 Ga0075365_100978913 353
1739 3300006042 Ga0075368_10000391 Ga0075368_100003919 353
1740 3300006163 Ga0070715_10014553 Ga0070715_100145532 353
1741 3300006175 Ga0070712_100231222 Ga0070712_1002312222 353
1742 3300006178 Ga0075367_10079464 Ga0075367_100794642 353
1743 3300006186 Ga0075369_10037369 Ga0075369_100373692 353
1744 3300006237 Ga0097621_100000115 Ga0097621_1000001156 353
1745 3300006237 Ga0097621_100031095 Ga0097621_1000310953 353
1746 3300006237 Ga0097621_100052758 Ga0097621_1000527582 353
1747 3300006353 Ga0075370_10020715 Ga0075370_100207152 353
1748 3300006358 Ga0068871_100000064 Ga0068871_10000006443 353
1749 3300006358 Ga0068871_100031695 Ga0068871_1000316952 353
1750 3300006844 Ga0075428_100140962 Ga0075428_1001409622 353
1751 3300006846 Ga0075430_100016424 Ga0075430_1000164242 353
1752 3300006847 Ga0075431_100006045 Ga0075431_1000060455 353
1753 3300006852 Ga0075433_10286206 Ga0075433_102862061 353
1754 3300006871 Ga0075434_100011648 Ga0075434_1000116489 353
1755 3300006880 Ga0075429_100016045 Ga0075429_1000160456 353
1756 3300006880 Ga0075429_100040905 Ga0075429_1000409053 353
1757 3300006881 Ga0068865_100000088 Ga0068865_10000008817 353
1758 3300006931 Ga0097620_100000503 Ga0097620_10000050310 353
1759 3300006931 Ga0097620_100128696 Ga0097620_1001286962 353
1760 3300006931 Ga0097620_100168187 Ga0097620_1001681872 353
1761 3300006946 Ga0079104_1005313 Ga0079104_10053133 353
1762 3300006946 Ga0079104_1029960 Ga0079104_10299601 353
1763 3300006948 Ga0099826_10001162 Ga0099826_100011626 353
1764 3300006948 Ga0099826_10055826 Ga0099826_100558263 353
1765 3300007076 Ga0075435_100018640 Ga0075435_1000186403 353
1766 3300009036 Ga0105244_10027369 Ga0105244_100273692 353
1767 3300009036 Ga0105244_10041442 Ga0105244_100414422 353
1768 3300009094 Ga0111539_10001836 Ga0111539_1000183613 353
1769 3300009094 Ga0111539_10002131 Ga0111539_1000213111 353
1770 3300009094 Ga0111539_10344038 Ga0111539_103440381 353
1771 3300009098 Ga0105245_10000556 Ga0105245_1000055631 353
1772 3300009098 Ga0105245_10001381 Ga0105245_1000138110 353
1773 3300009098 Ga0105245_10042958 Ga0105245_100429582 353
1774 3300009101 Ga0105247_10000474 Ga0105247_100004743 353
1775 3300009101 Ga0105247_10008685 Ga0105247_100086852 353
1776 3300009101 Ga0105247_10010587 Ga0105247_100105874 353
1777 3300009101 Ga0105247_10036214 Ga0105247_100362142 353
1778 3300009147 Ga0114129_10041080 Ga0114129_100410802 353
1779 3300009148 Ga0105243_10002817 Ga0105243_1000281714 353
1780 3300009148 Ga0105243_10003276 Ga0105243_1000327613 353
1781 3300009174 Ga0105241_10013940 Ga0105241_100139404 353
1782 3300009176 Ga0105242_10006548 Ga0105242_100065485 353
1783 3300009176 Ga0105242_10010176 Ga0105242_100101761 353
1784 3300009177 Ga0105248_10000500 Ga0105248_100005006 353
1785 3300009177 Ga0105248_10000873 Ga0105248_1000087331 353
1786 3300009177 Ga0105248_10053120 Ga0105248_100531203 353
1787 3300009177 Ga0105248_10064008 Ga0105248_100640082 353
1788 3300009545 Ga0105237_10012593 Ga0105237_100125933 353
1789 3300009551 Ga0105238_10079722 Ga0105238_100797222 353
1790 3300009553 Ga0105249_10002423 Ga0105249_1000242314 353
1791 3300010375 Ga0105239_10295074 Ga0105239_102950742 353
1792 3300011119 Ga0105246_10000016 Ga0105246_1000001636 353
1793 3300011119 Ga0105246_10000220 Ga0105246_100002205 353
1794 3300011119 Ga0105246_10058075 Ga0105246_100580753 353
1795 3300013100 Ga0157373_10001237 Ga0157373_1000123718 353
1796 3300013100 Ga0157373_10042861 Ga0157373_100428612 353
1797 3300013100 Ga0157373_10168919 Ga0157373_101689191 353
1798 3300013102 Ga0157371_10000004 Ga0157371_10000004183 353
1799 3300013102 Ga0157371_10015495 Ga0157371_100154954 353
1800 3300013249 Ga0171463_1003 Ga0171463_1003640 353
1801 3300013296 Ga0157374_10000092 Ga0157374_1000009240 353
1802 3300013296 Ga0157374_10000524 Ga0157374_1000052432 353
1803 3300013296 Ga0157374_10030091 Ga0157374_100300913 353
1804 3300013297 Ga0157378_10000591 Ga0157378_100005914 353
1805 3300013297 Ga0157378_10023177 Ga0157378_100231775 353
1806 3300013297 Ga0157378_10271419 Ga0157378_102714192 353
1807 3300013306 Ga0163162_10023568 Ga0163162_100235685 353
1808 3300013306 Ga0163162_10115386 Ga0163162_101153861 353
1809 3300013307 Ga0157372_10006371 Ga0157372_100063719 353
1810 3300013307 Ga0157372_10314045 Ga0157372_103140452 353
1811 3300013308 Ga0157375_10000124 Ga0157375_1000012414 353
1812 3300013308 Ga0157375_10001668 Ga0157375_100016684 353
1813 3300013308 Ga0157375_10025162 Ga0157375_100251624 353
1814 3300014325 Ga0163163_10003404 Ga0163163_1000340411 353
1815 3300014325 Ga0163163_10058876 Ga0163163_100588763 353
1816 3300014326 Ga0157380_10001027 Ga0157380_1000102713 353
1817 3300014326 Ga0157380_10004466 Ga0157380_100044662 353
1818 3300014326 Ga0157380_10125337 Ga0157380_101253372 353
1819 3300014326 Ga0157380_10363411 Ga0157380_103634111 353
1820 3300014745 Ga0157377_10000121 Ga0157377_1000012136 353
1821 3300014968 Ga0157379_10000422 Ga0157379_100004225 353
1822 3300014968 Ga0157379_10040122 Ga0157379_100401222 353
1823 3300014968 Ga0157379_10077910 Ga0157379_100779101 353
1824 3300014969 Ga0157376_10000034 Ga0157376_1000003463 353
1825 3300014969 Ga0157376_10000285 Ga0157376_100002855 353
1826 3300015690 Ga0183363_1047 Ga0183363_104722 353
1827 3300017792 Ga0163161_10000801 Ga0163161_1000080122 353
1828 3300021321 Ga0214542_1028780 Ga0214542_10287802 353
1829 3300021327 Ga0214543_1000078 Ga0214543_100007821 353
1830 3300022739 Ga0228711_1000016 Ga0228711_100001634 353
1831 3300022740 Ga0228710_1000013 Ga0228710_1000013100 353
1832 3300025208 Ga0209436_101133 Ga0209436_1011337 353
1833 3300025271 Ga0207666_1000004 Ga0207666_10000049 353
1834 3300025284 Ga0209130_1000029 Ga0209130_1000029283 353
1835 3300025290 Ga0207673_1000326 Ga0207673_10003264 353
1836 3300025292 Ga0209676_1031133 Ga0209676_10311331 353
1837 3300025294 Ga0209025_1000060 Ga0209025_100006070 353
1838 3300025294 Ga0209025_1000959 Ga0209025_10009599 353
1839 3300025295 Ga0209564_1000278 Ga0209564_100027885 353
1840 3300025298 Ga0209050_1019463 Ga0209050_10194631 353
1841 3300025299 Ga0209256_1000042 Ga0209256_100004223 353
1842 3300025299 Ga0209256_1002941 Ga0209256_10029416 353
1843 3300025302 Ga0207426_1000074 Ga0207426_100007415 353
1844 3300025302 Ga0207426_1000379 Ga0207426_100037915 353
1845 3300025302 Ga0207426_1016971 Ga0207426_10169712 353
1846 3300025303 Ga0209051_1003666 Ga0209051_10036668 353
1847 3300025304 Ga0209257_1005286 Ga0209257_10052868 353
1848 3300025885 Ga0207653_10001908 Ga0207653_100019085 353
1849 3300025893 Ga0207682_10000016 Ga0207682_1000001625 353
1850 3300025898 Ga0207692_10013299 Ga0207692_100132992 353
1851 3300025899 Ga0207642_10000976 Ga0207642_100009762 353
1852 3300025899 Ga0207642_10078028 Ga0207642_100780281 353
1853 3300025900 Ga0207710_10001396 Ga0207710_100013965 353
1854 3300025900 Ga0207710_10001528 Ga0207710_100015287 353
1855 3300025900 Ga0207710_10003942 Ga0207710_100039425 353
1856 3300025900 Ga0207710_10009728 Ga0207710_100097282 353
1857 3300025900 Ga0207710_10026449 Ga0207710_100264492 353
1858 3300025901 Ga0207688_10002050 Ga0207688_100020503 353
1859 3300025901 Ga0207688_10064625 Ga0207688_100646252 353
1860 3300025903 Ga0207680_10002179 Ga0207680_100021798 353
1861 3300025903 Ga0207680_10059119 Ga0207680_100591191 353
1862 3300025903 Ga0207680_10135217 Ga0207680_101352171 353
1863 3300025904 Ga0207647_10003692 Ga0207647_100036929 353
1864 3300025905 Ga0207685_10083900 Ga0207685_100839001 353
1865 3300025907 Ga0207645_10001535 Ga0207645_1000153518 353
1866 3300025908 Ga0207643_10000075 Ga0207643_1000007548 353
1867 3300025908 Ga0207643_10085289 Ga0207643_100852892 353
1868 3300025911 Ga0207654_10006201 Ga0207654_100062014 353
1869 3300025912 Ga0207707_10003863 Ga0207707_100038637 353
1870 3300025912 Ga0207707_10153787 Ga0207707_101537872 353
1871 3300025913 Ga0207695_10009034 Ga0207695_100090346 353
1872 3300025914 Ga0207671_10009593 Ga0207671_100095933 353
1873 3300025916 Ga0207663_10112324 Ga0207663_101123242 353
1874 3300025917 Ga0207660_10000023 Ga0207660_1000002337 353
1875 3300025917 Ga0207660_10103923 Ga0207660_101039231 353
1876 3300025918 Ga0207662_10001681 Ga0207662_100016819 353
1877 3300025919 Ga0207657_10001755 Ga0207657_100017553 353
1878 3300025920 Ga0207649_10000122 Ga0207649_1000012211 353
1879 3300025921 Ga0207652_10001146 Ga0207652_1000114610 353
1880 3300025923 Ga0207681_10000240 Ga0207681_1000024031 353
1881 3300025923 Ga0207681_10049729 Ga0207681_100497292 353
1882 3300025923 Ga0207681_10195542 Ga0207681_101955422 353
1883 3300025925 Ga0207650_10012941 Ga0207650_100129412 353
1884 3300025926 Ga0207659_10000017 Ga0207659_1000001761 353
1885 3300025926 Ga0207659_10096989 Ga0207659_100969891 353
1886 3300025927 Ga0207687_10000077 Ga0207687_1000007719 353
1887 3300025927 Ga0207687_10001492 Ga0207687_100014922 353
1888 3300025927 Ga0207687_10211238 Ga0207687_102112381 353
1889 3300025928 Ga0207700_10046442 Ga0207700_100464422 353
1890 3300025928 Ga0207700_10148027 Ga0207700_101480272 353
1891 3300025929 Ga0207664_10045678 Ga0207664_100456782 353
1892 3300025931 Ga0207644_10001298 Ga0207644_100012982 353
1893 3300025931 Ga0207644_10003716 Ga0207644_100037164 353
1894 3300025931 Ga0207644_10027349 Ga0207644_100273494 353
1895 3300025931 Ga0207644_10106786 Ga0207644_101067862 353
1896 3300025931 Ga0207644_10263806 Ga0207644_102638062 353
1897 3300025932 Ga0207690_10000151 Ga0207690_100001515 353
1898 3300025933 Ga0207706_10005479 Ga0207706_100054795 353
1899 3300025933 Ga0207706_10354838 Ga0207706_103548382 353
1900 3300025933 Ga0207706_10354839 Ga0207706_103548392 353
1901 3300025934 Ga0207686_10000294 Ga0207686_1000029423 353
1902 3300025934 Ga0207686_10017811 Ga0207686_100178111 353
1903 3300025934 Ga0207686_10031259 Ga0207686_100312592 353
1904 3300025935 Ga0207709_10000126 Ga0207709_100001266 353
1905 3300025935 Ga0207709_10045603 Ga0207709_100456032 353
1906 3300025935 Ga0207709_10114962 Ga0207709_101149622 353
1907 3300025936 Ga0207670_10000086 Ga0207670_1000008614 353
1908 3300025937 Ga0207669_10000188 Ga0207669_1000018823 353
1909 3300025937 Ga0207669_10014695 Ga0207669_100146952 353
1910 3300025937 Ga0207669_10156474 Ga0207669_101564741 353
1911 3300025938 Ga0207704_10001793 Ga0207704_100017933 353
1912 3300025940 Ga0207691_10007063 Ga0207691_100070633 353
1913 3300025940 Ga0207691_10016974 Ga0207691_100169749 353
1914 3300025941 Ga0207711_10004478 Ga0207711_100044786 353
1915 3300025941 Ga0207711_10005965 Ga0207711_100059658 353
1916 3300025941 Ga0207711_10039484 Ga0207711_100394842 353
1917 3300025942 Ga0207689_10000140 Ga0207689_1000014041 353
1918 3300025942 Ga0207689_10109566 Ga0207689_101095661 353
1919 3300025944 Ga0207661_10000074 Ga0207661_1000007421 353
1920 3300025945 Ga0207679_10000031 Ga0207679_10000031118 353
1921 3300025945 Ga0207679_10221628 Ga0207679_102216282 353
1922 3300025949 Ga0207667_10013359 Ga0207667_100133592 353
1923 3300025960 Ga0207651_10000044 Ga0207651_100000449 353
1924 3300025960 Ga0207651_10061639 Ga0207651_100616392 353
1925 3300025961 Ga0207712_10000279 Ga0207712_1000027914 353
1926 3300025972 Ga0207668_10000687 Ga0207668_1000068712 353
1927 3300025972 Ga0207668_10092184 Ga0207668_100921842 353
1928 3300025981 Ga0207640_10000105 Ga0207640_100001057 353
1929 3300025981 Ga0207640_10000216 Ga0207640_1000021623 353
1930 3300025986 Ga0207658_10001907 Ga0207658_100019072 353
1931 3300025986 Ga0207658_10039014 Ga0207658_100390143 353
1932 3300026023 Ga0207677_10000318 Ga0207677_100003186 353
1933 3300026035 Ga0207703_10000418 Ga0207703_1000041833 353
1934 3300026035 Ga0207703_10006276 Ga0207703_100062767 353
1935 3300026035 Ga0207703_10035176 Ga0207703_100351763 353
1936 3300026041 Ga0207639_10007495 Ga0207639_100074957 353
1937 3300026041 Ga0207639_10278625 Ga0207639_102786251 353
1938 3300026067 Ga0207678_10005986 Ga0207678_100059863 353
1939 3300026067 Ga0207678_10014870 Ga0207678_100148704 353
1940 3300026075 Ga0207708_10004013 Ga0207708_100040133 353
1941 3300026078 Ga0207702_10000753 Ga0207702_1000075327 353
1942 3300026078 Ga0207702_10159139 Ga0207702_101591391 353
1943 3300026088 Ga0207641_10001634 Ga0207641_1000163417 353
1944 3300026088 Ga0207641_10068519 Ga0207641_100685192 353
1945 3300026088 Ga0207641_10423619 Ga0207641_104236191 353
1946 3300026089 Ga0207648_10007377 Ga0207648_100073773 353
1947 3300026089 Ga0207648_10161442 Ga0207648_101614422 353
1948 3300026095 Ga0207676_10000133 Ga0207676_1000013335 353
1949 3300026095 Ga0207676_10015457 Ga0207676_100154572 353
1950 3300026095 Ga0207676_10078003 Ga0207676_100780032 353
1951 3300026116 Ga0207674_10001514 Ga0207674_1000151414 353
1952 3300026118 Ga0207675_100011837 Ga0207675_1000118377 353
1953 3300026118 Ga0207675_100252407 Ga0207675_1002524072 353
1954 3300026121 Ga0207683_10000004 Ga0207683_1000000488 353
1955 3300026121 Ga0207683_10003094 Ga0207683_1000309411 353
1956 3300026142 Ga0207698_10009206 Ga0207698_100092063 353
1957 3300027111 Ga0209281_1000221 Ga0209281_100022130 353
1958 3300027111 Ga0209281_1000453 Ga0209281_10004532 353
1959 3300027312 Ga0209371_1002043 Ga0209371_10020433 353
1960 3300027666 Ga0209282_1000041 Ga0209282_100004130 353
1961 3300027666 Ga0209282_1000179 Ga0209282_100017916 353
1962 3300027666 Ga0209282_1070112 Ga0209282_10701122 353
1963 3300027717 Ga0209998_10000939 Ga0209998_100009393 353
1964 3300027866 Ga0209813_10001432 Ga0209813_100014325 353
1965 3300027866 Ga0209813_10006967 Ga0209813_100069673 353
1966 3300027876 Ga0209974_10005431 Ga0209974_100054314 353
1967 3300027907 Ga0207428_10000218 Ga0207428_1000021835 353
1968 3300027907 Ga0207428_10002942 Ga0207428_1000294212 353
1969 3300028379 Ga0268266_10001063 Ga0268266_1000106331 353
1970 3300028379 Ga0268266_10005424 Ga0268266_100054244 353
1971 3300028379 Ga0268266_10122747 Ga0268266_101227471 353
1972 3300028380 Ga0268265_10000194 Ga0268265_1000019443 353
1973 3300028381 Ga0268264_10000393 Ga0268264_1000039336 353
1974 3300028381 Ga0268264_10089016 Ga0268264_100890162 353
1975 3300028794 Ga0307515_10000023 Ga0307515_10000023292 353
1976 3300030500 Ga0268256_1012387 Ga0268256_10123873 353
1977 3300031344 Ga0265316_10226754 Ga0265316_102267541 353
1978 3300031456 Ga0307513_10003030 Ga0307513_100030304 353
1979 3300031456 Ga0307513_10117119 Ga0307513_101171192 353
1980 3300031967 Ga0315914_1000030 Ga0315914_1000030101 353
1981 3300031995 Ga0307409_100079130 Ga0307409_1000791303 353
1982 3300032004 Ga0307414_10335036 Ga0307414_103350361 353
1983 3300032126 Ga0307415_100162107 Ga0307415_1001621072 353
1984 3300033430 Ga0315913_1000017 Ga0315913_100001799 353
1985 3300033464 Ga0315915_1000017 Ga0315915_100001766 353
1986 3300035083 Ga0373926_0044621 Ga0373926_0044621_318_1406 353
1987 3300035091 Ga0373951_0006498 Ga0373951_0006498_530_1615 353
1988 3300035092 Ga0373952_0005697 Ga0373952_0005697_657_1742 353
1989 3300035112 Ga0373932_0006740 Ga0373932_0006740_697_1782 353
1990 3300035114 Ga0373939_0001147 Ga0373939_0001147_471_1556 353
1991 3300035115 Ga0373941_0004127 Ga0373941_0004127_1581_2666 353
1992 3300035116 Ga0373945_0023874 Ga0373945_0023874_966_2054 353
1993 3300035121 Ga0373960_0002301 Ga0373960_0002301_103_1188 353
1994 3300035207 Ga0373942_0004747 Ga0373942_0004747_1248_2333 353
1995 3300035241 Ga0373961_0006340 Ga0373961_0006340_52_1137 353
1996 3300035242 Ga0373962_0006222 Ga0373962_0006222_971_2056 353
1997 3300035691 Ga0373931_0000034 Ga0373931_0000034_52656_53741 353
1998 3300035691 Ga0373931_0106047 Ga0373931_0106047_387_1475 353
1999 3300035692 Ga0373935_0044469 Ga0373935_0044469_754_1842 353
2000 3300035695 Ga0373927_0198628 Ga0373927_0198628_132_1220 353
2001 3300035725 Ga0373947_0094196 Ga0373947_0094196_774_1862 353
2002 3300037068 Ga0373925_0078900 Ga0373925_0078900_428_1516 353
2003 3300037471 Ga0395905_0012635 Ga0395905_0012635_1813_2901 353
2004 3300037471 Ga0395905_0245905 Ga0395905_0245905_255_1343 353
2005 3300041406 Ga0439439_0029670 Ga0439439_0029670_201_1307 353
2006 3300041413 Ga0439465_0010381 Ga0439465_0010381_208_1407 353
2007 3300046454 Ga0495592_0026735 Ga0495592_0026735_2891_3979 353
2008 3300046459 Ga0495629_0010621 Ga0495629_0010621_2295_3383 353
2009 3300046463 Ga0495653_0054937 Ga0495653_0054937_1237_2325 353
2010 3300046472 Ga0495580_0038736 Ga0495580_0038736_1495_2583 353
2011 3300046475 Ga0495639_0090084 Ga0495639_0090084_66_1154 353
2012 3300046476 Ga0495662_0023492 Ga0495662_0023492_812_1900 353
2013 3300046491 Ga0495584_0038495 Ga0495584_0038495_848_1936 353
2014 3300046491 Ga0495584_0066931 Ga0495584_0066931_41_1129 353
2015 3300046499 Ga0495594_0053341 Ga0495594_0053341_97_1185 353
2016 3300046516 Ga0495628_0012367 Ga0495628_0012367_1929_3017 353
2017 3300046531 Ga0495665_0093167 Ga0495665_0093167_418_1506 353
2018 3300046536 Ga0495587_0054702 Ga0495587_0054702_122_1210 353
2019 3300046537 Ga0495598_0010805 Ga0495598_0010805_161_1249 353
2020 3300046559 Ga0495667_0178930 Ga0495667_0178930_191_1279 353
2021 3300046664 Ga0495659_0009205 Ga0495659_0009205_883_1971 353
2022 3300046674 Ga0495588_0001146 Ga0495588_0001146_7828_8931 353
2023 3300046678 Ga0495599_0009888 Ga0495599_0009888_1859_2947 353
2024 3300046680 Ga0495646_0055602 Ga0495646_0055602_800_1888 353
2025 3300046681 Ga0495647_0025057 Ga0495647_0025057_841_1929 353
2026 3300047317 Ga0495604_0024899 Ga0495604_0024899_1672_2760 353
2027 3300047319 Ga0495674_0008253 Ga0495674_0008253_7026_8114 353
2028 3300047321 Ga0495676_0049415 Ga0495676_0049415_1755_2843 353
2029 3300047447 Ga0495685_048100 Ga0495685_048100_187_1275 353
2030 3300047470 Ga0495681_0004119 Ga0495681_0004119_4266_5441 353
2031 3300047471 Ga0495684_0064339 Ga0495684_0064339_479_1567 353
2032 3300048090 Ga0495615_0005003 Ga0495615_0005003_153_1241 353
2033 3300048903 Ga0496100_0000050 Ga0496100_0000050_27854_28939 353
2034 3300048903 Ga0496100_0000310 Ga0496100_0000310_21864_22952 353
2035 3300048904 Ga0496101_0000121 Ga0496101_0000121_31318_32403 353
2036 3300048904 Ga0496101_0010077 Ga0496101_0010077_3414_4502 353
2037 3300048905 Ga0496102_0000679 Ga0496102_0000679_31558_32646 353
2038 3300048905 Ga0496102_0002728 Ga0496102_0002728_2961_4046 353
2039 3300048905 Ga0496102_0471420 Ga0496102_0471420_63_1151 353
2040 3300048906 Ga0496103_0000175 Ga0496103_0000175_19537_20622 353
2041 3300048906 Ga0496103_0000777 Ga0496103_0000777_21295_22383 353
2042 3300048906 Ga0496103_0137749 Ga0496103_0137749_46_1134 353
2043 3300048907 Ga0496104_0000500 Ga0496104_0000500_1163_2251 353
2044 3300048907 Ga0496104_0000588 Ga0496104_0000588_190_1278 353
2045 3300048907 Ga0496104_0011318 Ga0496104_0011318_309_1394 353
2046 3300048907 Ga0496104_0014050 Ga0496104_0014050_399_1487 353
2047 3300048907 Ga0496104_0020089 Ga0496104_0020089_1589_2677 353
2048 3300048907 Ga0496104_0021190 Ga0496104_0021190_77_1180 353
2049 3300048908 Ga0496105_0002551 Ga0496105_0002551_7297_8385 353
2050 3300048908 Ga0496105_0003077 Ga0496105_0003077_9921_11009 353
2051 3300048908 Ga0496105_0006243 Ga0496105_0006243_1160_2248 353
2052 3300048908 Ga0496105_0009884 Ga0496105_0009884_1406_2494 353
2053 3300048908 Ga0496105_0045775 Ga0496105_0045775_969_2072 353
2054 3300048909 Ga0496106_0000133 Ga0496106_0000133_40661_41746 353
2055 3300048909 Ga0496106_0000323 Ga0496106_0000323_1126_2214 353
2056 3300048909 Ga0496106_0043242 Ga0496106_0043242_911_2014 353
2057 3300048909 Ga0496106_0055832 Ga0496106_0055832_203_1291 353
2058 3300048910 Ga0496107_0000237 Ga0496107_0000237_8436_9521 353
2059 3300048910 Ga0496107_0006942 Ga0496107_0006942_5555_6643 353
2060 3300048910 Ga0496107_0008677 Ga0496107_0008677_475_1563 353
2061 3300048910 Ga0496107_0013131 Ga0496107_0013131_1609_2697 353
2062 3300048911 Ga0496108_0001888 Ga0496108_0001888_14551_15639 353
2063 3300048911 Ga0496108_0057474 Ga0496108_0057474_721_1806 353
2064 3300048912 Ga0496109_0000493 Ga0496109_0000493_1163_2251 353
2065 3300048912 Ga0496109_0000952 Ga0496109_0000952_5883_6968 353
2066 3300048912 Ga0496109_0001602 Ga0496109_0001602_14874_15959 353
2067 3300048912 Ga0496109_0190810 Ga0496109_0190810_60_1148 353
2068 3300048913 Ga0496110_0003830 Ga0496110_0003830_9389_10477 353
2069 3300048914 Ga0496111_0001343 Ga0496111_0001343_1163_2251 353
2070 3300048914 Ga0496111_0184353 Ga0496111_0184353_444_1529 353
2071 3300048915 Ga0496112_0011990 Ga0496112_0011990_1144_2232 353
2072 3300048915 Ga0496112_0033461 Ga0496112_0033461_2470_3555 353
2073 3300048916 Ga0496113_0000869 Ga0496113_0000869_1151_2239 353
2074 3300048916 Ga0496113_0032115 Ga0496113_0032115_2147_3250 353
2075 3300048917 Ga0496114_0002721 Ga0496114_0002721_8245_9333 353
2076 3300048918 Ga0496115_0001322 Ga0496115_0001322_1517_2605 353
2077 3300048918 Ga0496115_0009975 Ga0496115_0009975_3054_4157 353
2078 3300048919 Ga0496116_0051378 Ga0496116_0051378_867_1970 353
2079 3300048919 Ga0496116_0060520 Ga0496116_0060520_831_1934 353
2080 3300048920 Ga0496117_0000002 Ga0496117_0000002_2301171_2302274 353
2081 3300048920 Ga0496117_0028675 Ga0496117_0028675_1008_2111 353
2082 3300048920 Ga0496117_0110951 Ga0496117_0110951_77_1180 353
2083 3300048921 Ga0496118_0002844 Ga0496118_0002844_6408_7511 353
2084 3300048921 Ga0496118_0014526 Ga0496118_0014526_5857_6960 353
2085 3300048921 Ga0496118_0016840 Ga0496118_0016840_2745_3848 353
2086 3300048922 Ga0496119_0010067 Ga0496119_0010067_2840_3943 353
2087 3300048923 Ga0496120_0000034 Ga0496120_0000034_207689_208792 353
2088 3300048923 Ga0496120_0025451 Ga0496120_0025451_1051_2154 353
2089 3300048924 Ga0496121_0000220 Ga0496121_0000220_37804_38907 353
2090 3300048925 Ga0496122_0000001 Ga0496122_0000001_1645178_1646281 353
2091 3300048926 Ga0496123_0000001 Ga0496123_0000001_1648909_1650012 353
2092 3300048926 Ga0496123_0014463 Ga0496123_0014463_3326_4429 353
2093 3300048927 Ga0496124_0000083 Ga0496124_0000083_13320_14423 353
2094 3300048927 Ga0496124_0013228 Ga0496124_0013228_301_1404 353
2095 3300048928 Ga0496125_0000001 Ga0496125_0000001_37954_39057 353
2096 3300048928 Ga0496125_0009589 Ga0496125_0009589_5381_6484 353
2097 3300049568 Ga0501031_0000006 Ga0501031_0000006_71635_72741 353
2098 3300049569 Ga0501032_0000016 Ga0501032_0000016_71640_72746 353
2099 3300049569 Ga0501032_0059787 Ga0501032_0059787_31_1116 353
2100 3300049570 Ga0501033_0000101 Ga0501033_0000101_19619_20725 353
2101 3300049571 Ga0501034_0000168 Ga0501034_0000168_101943_103049 353
2102 3300049571 Ga0501034_0010519 Ga0501034_0010519_7050_8156 353
2103 3300049571 Ga0501034_0030869 Ga0501034_0030869_4108_5193 353
2104 3300049572 Ga0501036_0000019 Ga0501036_0000019_15595_16701 353
2105 3300049572 Ga0501036_0099560 Ga0501036_0099560_635_1720 353
2106 3300049573 Ga0501037_0000013 Ga0501037_0000013_101943_103049 353
2107 3300049573 Ga0501037_0143061 Ga0501037_0143061_396_1481 353
2108 3300049574 Ga0501038_0000012 Ga0501038_0000012_101943_103049 353
2109 3300049574 Ga0501038_0011999 Ga0501038_0011999_4510_5604 353
2110 3300049575 Ga0501039_0000019 Ga0501039_0000019_101943_103049 353
2111 3300049575 Ga0501039_0079324 Ga0501039_0079324_906_2000 353
2112 3300049576 Ga0501040_0148787 Ga0501040_0148787_167_1261 353
2113 3300049578 Ga0501042_0019008 Ga0501042_0019008_3290_4384 353
2114 3300049579 Ga0501043_0000209 Ga0501043_0000209_52130_53236 353
2115 3300049579 Ga0501043_0132686 Ga0501043_0132686_357_1442 353
2116 3300049581 Ga0501047_0003738 Ga0501047_0003738_12597_13703 353
2117 3300049586 Ga0501070_0131515 Ga0501070_0131515_729_1835 353
2118 3300049587 Ga0501071_0091102 Ga0501071_0091102_236_1324 353
2119 3300049588 Ga0501072_0036236 Ga0501072_0036236_861_1955 353
2120 3300049590 Ga0501074_0047884 Ga0501074_0047884_83_1177 353
2121 3300049592 Ga0501076_0006762 Ga0501076_0006762_3860_4954 353
2122 3300049742 Ga0501080_0203467 Ga0501080_0203467_378_1472 353
2123 3300049822 Ga0501035_0000081 Ga0501035_0000081_14405_15511 353
2124 3300049823 Ga0501044_0000029 Ga0501044_0000029_71640_72746 353
2125 3300049823 Ga0501044_0252875 Ga0501044_0252875_598_1683 353
2126 3300049824 Ga0501045_0006727 Ga0501045_0006727_2060_3154 353
2127 3300050489 nmdc:mga03683_83526_c1 nmdc:mga03683_83526_c1_221_1312 353
2128 3300050491 nmdc:mga00v17_106281_c1 nmdc:mga00v17_106281_c1_487_1578 353
2129 3300050491 nmdc:mga00v17_130499_c1 nmdc:mga00v17_130499_c1_435_1538 353
2130 3300050491 nmdc:mga00v17_30112_c1 nmdc:mga00v17_30112_c1_637_1740 353
2131 3300050491 nmdc:mga00v17_47_c1 nmdc:mga00v17_47_c1_21258_22361 353
2132 3300050492 nmdc:mga0yw44_11106_c1 nmdc:mga0yw44_11106_c1_879_1982 353
2133 3300050492 nmdc:mga0yw44_165685_c1 nmdc:mga0yw44_165685_c1_299_1390 353
2134 3300050492 nmdc:mga0yw44_18361_c1 nmdc:mga0yw44_18361_c1_1688_2794 353
2135 3300050494 nmdc:mga06z11_16404_c1 nmdc:mga06z11_16404_c1_426_1514 353
2136 3300050494 nmdc:mga06z11_91170_c1 nmdc:mga06z11_91170_c1_27_1118 353
2137 3300050494 nmdc:mga06z11_92439_c1 nmdc:mga06z11_92439_c1_469_1554 353
2138 3300050495 nmdc:mga04h51_32896_c1 nmdc:mga04h51_32896_c1_62_1150 353
2139 3300050495 nmdc:mga04h51_4064_c1 nmdc:mga04h51_4064_c1_1569_2672 353
2140 3300050496 nmdc:mga07m45_30403_c1 nmdc:mga07m45_30403_c1_955_2058 353
2141 3300050496 nmdc:mga07m45_36073_c1 nmdc:mga07m45_36073_c1_200_1291 353
2142 3300050496 nmdc:mga07m45_50498_c1 nmdc:mga07m45_50498_c1_314_1402 353
2143 3300050508 nmdc:mga09592_17221_c1 nmdc:mga09592_17221_c1_1168_2256 353
2144 3300050508 nmdc:mga09592_76716_c1 nmdc:mga09592_76716_c1_537_1655 353
2145 3300050509 nmdc:mga0qj67_34351_c1 nmdc:mga0qj67_34351_c1_623_1711 353
2146 3300050510 nmdc:mga06r32_8869_c1 nmdc:mga06r32_8869_c1_4125_5213 353
2147 3300050511 nmdc:mga08y16_3032_c1 nmdc:mga08y16_3032_c1_12279_13397 353
2148 3300050511 nmdc:mga08y16_409700_c1 nmdc:mga08y16_409700_c1_62_1162 353
2149 3300050511 nmdc:mga08y16_706_c1 nmdc:mga08y16_706_c1_15801_16886 353
2150 3300050512 nmdc:mga0n895_2736_c1 nmdc:mga0n895_2736_c1_695_1780 353
2151 3300050513 nmdc:mga0rr50_54810_c1 nmdc:mga0rr50_54810_c1_573_1658 353
2152 3300050515 nmdc:mga0a205_197_c1 nmdc:mga0a205_197_c1_391_1476 353
2153 3300050516 nmdc:mga0sz30_18723_c1 nmdc:mga0sz30_18723_c1_721_1824 353
2154 3300053077 Ga0495601_0013325 Ga0495601_0013325_3792_4880 353
2155 3300053078 Ga0495612_0003890 Ga0495612_0003890_1530_2618 353
2156 3300053085 Ga0495619_0001328 Ga0495619_0001328_9329_10417 353
2157 3300053085 Ga0495619_0013741 Ga0495619_0013741_891_1979 353
2158 3300053096 Ga0500641_0004622 Ga0500641_0004622_2284_3375 353
2159 3300053108 Ga0500562_032766 Ga0500562_032766_182_1273 353
2160 3300053157 Ga0500624_001406 Ga0500624_001406_574_1677 353
2161 3300053161 Ga0500634_0004710 Ga0500634_0004710_991_2094 353
2162 3300053177 Ga0500636_0000036 Ga0500636_0000036_65634_66737 353
2163 3300054114 Ga0501084_0001734 Ga0501084_0001734_10821_11915 353
2164 3300059510 Ga0587090_004716 Ga0587090_004716_408_1511 353
2165 3300060353 Ga0501082_0000053 Ga0501082_0000053_58088_59179 353
2166 3300060353 Ga0501082_0007228 Ga0501082_0007228_167_1261 353
2167 3300061734 Ga0530510_0041559 Ga0530510_0041559_2060_3154 353
2168 iso_pu_bacteria 2840764183 2840769232 353
2169 iso_pu_bacteria 2919073203 2919075731 353
2170 iso_pu_bacteria 2939669807 2939672400 353

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03480

DctP

Bacterial extracellular solute-binding protein, family 7

111

398

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hzl-assembly1.cif.gz_A crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms 0.9906 23 352
4yzz-assembly1.cif.gz_A crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi-500035) mixed occupancy dimer, copurified calcium and picolinate bound active site versus apo site 0.9814 21 352
7ug8-assembly1.cif.gz_A crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium 0.9773 20 345
2hzl-assembly1.cif.gz_A crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms 0.9759 23 352
5cm6-assembly1.cif.gz_B crystal structure of a trap periplasmic solute binding protein from pseudoalteromonas atlantica t6c(patl_2292, target efi-510180) with bound sodium and pyruvate 0.9708 22 343
ID Description Score Start End Superfamily
2hzkC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9786 23 349 3.40.190.170
4yzzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9682 21 351 3.40.190.170
2hzkC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.965 23 349 3.40.190.170
4yicB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.956 145 313 3.40.190.10
4yzzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9551 21 351 3.40.190.170
ID Description Score Start End GO Terms
AF-A0A0D7EEV2-F1-model_v4 ABC transporter substrate-binding protein 0.9886 23 353 GO:0015849
GO:0031317
GO:0043177
GO:0046872
GO:0055085
AF-A0A3N5FTX4-F1-model_v4 ABC transporter substrate-binding protein 0.9886 41 347 GO:0055085
AF-A0A537VVV0-F1-model_v4 ABC transporter substrate-binding protein 0.9855 65 353 GO:0055085
AF-A0A0D7EEV2-F1-model_v4 ABC transporter substrate-binding protein 0.9827 23 353 GO:0015849
GO:0031317
GO:0043177
GO:0046872
GO:0055085
AF-A0A527HEM5-F1-model_v4 ABC transporter substrate-binding protein 0.9823 167 352 GO:0055085

Feature Viewer

pLDDT pTM Quality
93.34 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map