F496324

General Info

Members Datasets Scaffolds Average Seq Length
2054 1293 1153 161

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0426201|Ga0495638_0426201_45_611
Length 188
Sequence VPKRVRRTSFLTWIASGNCASNTGAGTKKGEKQVIERLNEALFLELGAVNQYWVHFRLLEDWGYTKLAKKERAESIEEMHHADRIVARIIFLEGHPNLQTLAPLRIGQNVKEVLESDLAGEYDARTSYRKSREICQELGDYVTMQLFEDLLKDEEGHIDFLETQLDLLADIGDGKYGQLNADSADEAE

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
3 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
4 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
5 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
6 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
7 2509276019 Ensifer aridi TW10 Isolate Nodule
8 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
9 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
10 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
11 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
12 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
13 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
14 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
15 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
16 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
17 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
18 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
19 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
20 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
21 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
22 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
23 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
24 2512875024 Mesorhizobium loti R88b Isolate Nodule
25 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
26 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
27 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
28 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
29 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
30 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
31 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
32 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
33 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
34 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
35 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
36 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
37 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
38 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
39 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
40 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
41 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
42 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
43 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
44 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
45 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
46 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
47 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
48 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
49 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
50 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
51 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
52 2516143018 Ensifer sp. BR816 Isolate Nodule
53 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
54 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
55 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
56 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
57 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
58 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
59 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
60 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
61 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
62 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
63 2534681786 Brucella suis 92/29 Isolate Unclassified
64 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
65 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
66 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
67 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
68 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
69 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
70 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
71 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
72 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
73 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
74 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
75 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
76 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
77 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
78 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
79 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
80 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
81 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
82 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
83 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
84 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
85 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
86 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
87 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
88 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
89 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
90 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
91 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
92 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
93 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
94 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
95 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
96 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
97 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
98 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
99 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
100 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
101 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
102 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
103 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
104 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
105 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
106 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
107 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
108 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
109 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
110 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
111 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
112 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
113 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
114 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
115 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
116 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
117 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
118 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
119 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
120 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
121 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
122 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
123 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
124 2643221557 Ensifer sp. Root558 Isolate Unclassified
125 2643221558 Rhizobium sp. Root149 Isolate Unclassified
126 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
127 2643221568 Rhizobium sp. Root564 Isolate Unclassified
128 2643221580 Devosia sp. Root635 Isolate Unclassified
129 2643221582 Rhizobium sp. Root651 Isolate Unclassified
130 2643221591 Devosia sp. Root685 Isolate Unclassified
131 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
132 2643221599 Rhizobium sp. Root708 Isolate Unclassified
133 2643221607 Rhizobium sp. Root73 Isolate Unclassified
134 2643221610 Ensifer sp. Root74 Isolate Unclassified
135 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
136 2643221626 Ensifer sp. Root31 Isolate Unclassified
137 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
138 2643221629 Devosia sp. Root105 Isolate Unclassified
139 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
140 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
141 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
142 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
143 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
144 2643221655 Ensifer sp. Root1252 Isolate Unclassified
145 2643221659 Ensifer sp. Root127 Isolate Unclassified
146 2643221662 Devosia sp. Root413D1 Isolate Unclassified
147 2643221668 Ensifer sp. Root423 Isolate Unclassified
148 2643221674 Devosia sp. Root436 Isolate Unclassified
149 2643221675 Ensifer sp. Root1298 Isolate Unclassified
150 2643221680 Ensifer sp. Root1312 Isolate Unclassified
151 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
152 2643221688 Rhizobium sp. Root482 Isolate Unclassified
153 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
154 2643221693 Rhizobium sp. Root491 Isolate Unclassified
155 2643221698 Ensifer sp. Root142 Isolate Unclassified
156 2643221712 Ensifer sp. Root258 Isolate Unclassified
157 2643221718 Rhizobium sp. Root268 Isolate Unclassified
158 2643221719 Rhizobium sp. Root274 Isolate Unclassified
159 2643221723 Ensifer sp. Root278 Isolate Unclassified
160 2643221726 Ensifer sp. Root954 Isolate Unclassified
161 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
162 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
163 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
164 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
165 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
166 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
167 2718217882 Rhizobium sp. N741 Isolate Nodule
168 2718217927 Rhizobium sp. N324 Isolate Nodule
169 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
170 2718218009 Rhizobium sp. N561 Isolate Nodule
171 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
172 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
173 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
174 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
175 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
176 2718218363 Rhizobium sp. N113 Isolate Nodule
177 2718218365 Rhizobium sp. N731 Isolate Nodule
178 2718218366 Rhizobium sp. N621 Isolate Nodule
179 2718218423 Rhizobium sp. N941 Isolate Nodule
180 2721755514 Rhizobium sp. N6212 Isolate Nodule
181 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
182 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
183 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
184 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
185 2721755809 Rhizobium sp. N541 Isolate Nodule
186 2721755810 Rhizobium sp. N871 Isolate Nodule
187 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
188 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
189 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
190 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
191 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
192 2728369365 Rhizobium sp. N1341 Isolate Nodule
193 2728369397 Rhizobium sp. N1314 Isolate Nodule
194 2738541293 Rhizobium sp. GV031 Isolate Unclassified
195 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
196 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
197 2738543024 Aminobacter sp. AP02 Isolate Unclassified
198 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
199 2751185800 Brucella pituitosa AA2 Isolate Unclassified
200 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
201 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
202 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
203 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
204 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
205 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
206 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
207 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
208 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
209 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
210 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
211 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
212 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
213 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
214 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
215 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
216 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
217 2791355256 Rhizobium sp. M10 Isolate Nodule
218 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
219 2791355260 Rhizobium sp. L9 Isolate Nodule
220 2791355261 Rhizobium sp. J15 Isolate Nodule
221 2791355262 Rhizobium sp. M1 Isolate Nodule
222 2791355263 Rhizobium chutanense C5 Isolate Nodule
223 2791355264 Rhizobium sp. S9 Isolate Nodule
224 2791355265 Rhizobium sp. H4 Isolate Nodule
225 2791355266 Rhizobium sp. L43 Isolate Nodule
226 2791355267 Rhizobium sp. L18 Isolate Nodule
227 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
228 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
229 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
230 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
231 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
232 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
233 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
234 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
235 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
236 2802429633 Rhizobium anhuiense J3 Isolate Nodule
237 2802429634 Rhizobium anhuiense S10 Isolate Nodule
238 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
239 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
240 2802429637 Rhizobium anhuiense C15 Isolate Nodule
241 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
242 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
243 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
244 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
245 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
246 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
247 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
248 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
249 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
250 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
251 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
252 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
253 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
254 2838048938 Rhizobium pisi 27/80 Isolate Nodule
255 2838061910 Rhizobium phaseoli L15 Isolate Nodule
256 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
257 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
258 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
259 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
260 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
261 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
262 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
263 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
264 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
265 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
266 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
267 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
268 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
269 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
270 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
271 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
272 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
273 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
274 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
275 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
276 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
277 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
278 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
279 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
280 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
281 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
282 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
283 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
284 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
285 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
286 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
287 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
288 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
289 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
290 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
291 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
292 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
293 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
294 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
295 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
296 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
297 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
298 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
299 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
300 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
301 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
302 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
303 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
304 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
305 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
306 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
307 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
308 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
309 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
310 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
311 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
312 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
313 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
314 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
315 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
316 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
317 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
318 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
319 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
320 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
321 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
322 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
323 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
324 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
325 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
326 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
327 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
328 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
329 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
330 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
331 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
332 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
333 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
334 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
335 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
336 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
337 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
338 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
339 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
340 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
341 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
342 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
343 2844163670 Ensifer sp. 1H6 Isolate Unclassified
344 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
345 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
346 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
347 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
348 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
349 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
350 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
351 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
352 2854911287 Brucella lupini LUP21 Isolate Unclassified
353 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
354 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
355 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
356 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
357 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
358 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
359 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
360 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
361 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
362 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
363 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
364 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
365 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
366 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
367 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
368 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
369 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
370 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
371 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
372 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
373 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
374 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
375 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
376 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
377 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
378 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
379 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
380 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
381 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
382 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
383 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
384 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
385 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
386 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
387 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
388 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
389 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
390 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
391 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
392 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
393 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
394 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
395 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
396 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
397 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
398 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
399 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
400 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
401 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
402 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
403 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
404 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
405 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
406 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
407 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
408 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
409 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
410 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
411 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
412 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
413 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
414 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
415 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
416 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
417 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
418 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
419 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
420 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
421 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
422 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
423 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
424 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
425 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
426 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
427 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
428 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
429 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
430 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
431 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
432 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
433 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
434 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
435 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
436 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
437 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
438 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
439 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
440 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
441 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
442 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
443 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
444 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
445 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
446 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
447 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
448 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
449 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
450 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
451 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
452 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
453 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
454 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
455 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
456 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
457 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
458 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
459 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
460 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
461 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
462 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
463 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
464 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
465 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
466 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
467 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
468 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
469 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
470 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
471 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
472 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
473 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
474 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
475 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
476 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
477 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
478 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
479 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
480 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
481 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
482 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
483 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
484 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
485 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
486 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
487 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
488 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
489 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
490 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
491 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
492 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
493 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
494 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
495 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
496 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
497 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
498 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
499 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
500 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
501 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
502 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
503 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
504 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
505 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
506 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
507 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
508 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
509 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
510 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
511 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
512 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
513 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
514 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
515 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
516 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
517 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
518 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
519 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
520 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
521 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
522 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
523 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
524 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
525 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
526 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
527 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
528 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
529 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
530 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
531 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
532 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
533 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
534 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
535 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
536 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
537 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
538 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
539 2932401849 Devosia sp. 2618 Isolate Rhizosphere
540 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
541 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
542 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
543 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
544 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
545 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
546 2933599457 Rhizobium phaseoli M3 Isolate Nodule
547 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
548 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
549 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
550 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
551 2936381700 Rhizobium chutanense C16 Isolate Unclassified
552 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
553 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
554 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
555 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
556 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
557 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
558 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
559 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
560 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
561 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
562 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
563 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
564 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
565 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
566 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
567 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
568 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
569 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
570 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
571 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
572 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
573 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
574 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
575 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
576 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
577 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
578 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
579 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
580 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
581 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
582 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
583 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
584 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
585 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
586 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
587 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
588 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
589 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
590 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
591 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
592 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
593 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
594 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
595 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
596 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
597 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
598 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
599 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
600 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
601 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
602 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
603 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
604 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
605 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
606 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
607 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
608 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
609 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
610 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
611 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
612 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
613 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
614 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
615 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
616 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
617 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
618 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
619 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
620 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
621 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
622 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
623 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
624 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
625 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
626 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
627 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
628 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
629 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
630 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
631 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
632 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
633 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
634 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
635 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
636 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
637 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
638 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
639 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
640 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
641 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
642 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
643 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
644 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
645 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
646 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
647 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
648 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
649 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
650 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
651 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
652 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
653 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
654 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
655 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
656 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
657 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
658 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
659 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
660 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
661 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
662 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
663 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
664 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
665 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
666 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
667 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
668 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
669 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
670 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
671 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
672 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
673 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
674 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
675 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
676 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
677 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
678 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
679 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
680 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
681 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
682 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
683 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
684 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
685 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
686 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
687 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
688 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
689 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
690 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
691 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
692 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
693 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
694 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
695 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
696 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
697 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
698 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
699 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
700 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
701 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
702 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
703 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
704 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
705 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
706 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
707 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
708 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
709 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
710 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
711 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
712 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
713 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
714 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
715 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
716 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
717 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
718 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
719 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
720 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
721 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
722 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
723 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
724 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
725 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
726 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
727 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
728 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
729 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
730 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
731 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
732 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
733 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
734 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
735 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
736 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
737 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
738 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
739 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
740 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
741 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
742 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
743 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
744 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
745 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
746 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
747 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
748 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
749 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
750 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
751 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
752 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
753 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
754 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
755 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
756 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
757 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
758 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
759 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
760 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
761 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
762 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
763 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
764 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
765 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
766 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
767 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
768 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
769 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
770 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
771 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
772 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
773 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
774 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
775 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
776 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
777 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
778 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
779 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
780 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
781 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
782 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
783 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
784 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
785 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
786 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
787 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
788 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
789 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
790 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
791 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
792 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
793 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
794 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
795 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
796 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
797 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
798 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
799 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
800 2996887358 Rhizobium sp. R711 Isolate Nodule
801 2996893221 Rhizobium sp. R635 Isolate Nodule
802 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
803 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
804 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
805 3004167301 Mesorhizobium loti 582 Isolate Unclassified
806 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
807 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
808 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
809 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
810 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
811 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
812 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
813 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
814 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
815 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
816 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
817 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
818 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
819 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
820 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
821 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
822 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
823 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
824 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
825 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
826 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
827 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
828 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
829 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
830 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
831 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
832 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
833 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
834 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
835 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
836 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
837 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
838 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
839 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
840 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
841 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
842 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
843 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
844 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
845 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
846 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
847 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
848 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
849 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
850 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
851 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
852 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
853 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
854 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
855 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
856 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
857 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
858 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
859 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
860 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
861 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
862 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
863 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
864 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
865 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
866 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
867 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
868 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
869 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
870 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
871 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
872 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
873 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
874 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
875 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
876 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
877 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
878 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
879 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
880 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
881 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
882 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
883 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
884 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
885 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
886 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
887 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
888 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
889 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
890 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
891 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
892 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
893 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
894 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
895 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
896 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
897 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
898 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
899 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
900 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
901 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
902 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
903 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
904 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
905 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
906 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
907 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
908 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
909 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
910 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
911 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
912 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
913 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
914 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
915 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
916 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
917 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
918 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
919 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
920 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
921 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
922 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
923 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
924 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
925 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
926 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
927 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
928 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
929 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
930 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
931 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
932 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
933 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
934 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
935 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
936 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
937 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
938 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
939 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
940 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
941 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
942 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
943 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
944 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
945 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
946 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
947 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
948 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
949 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
950 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
951 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
952 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
953 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
954 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
955 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
956 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
957 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
958 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
959 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
960 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
961 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
962 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
963 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
964 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
965 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
966 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
967 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
968 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
969 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
970 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
971 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
972 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
973 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
974 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
975 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
976 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
977 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
978 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
979 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
980 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
981 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
982 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
983 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
984 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
985 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
986 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
987 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
988 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
989 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
990 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
991 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
992 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
993 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
994 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
995 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
996 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
997 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
998 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
999 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
1000 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
1001 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
1002 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
1003 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
1004 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
1005 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
1006 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
1007 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
1008 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
1009 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
1010 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
1011 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
1012 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
1013 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
1014 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
1015 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
1016 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
1017 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
1018 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
1019 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
1020 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
1021 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
1022 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
1023 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
1024 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
1025 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
1026 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
1027 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
1028 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
1029 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
1030 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
1031 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
1032 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
1033 3300041493 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaT Metatranscriptome Unclassified
1034 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
1035 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
1036 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
1037 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
1038 3300041500 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaT Metatranscriptome Unclassified
1039 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
1040 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
1041 3300041504 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaT Metatranscriptome Unclassified
1042 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
1043 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
1044 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
1045 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
1046 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
1047 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
1048 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
1049 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
1050 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
1051 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
1052 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
1053 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
1054 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
1055 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
1056 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
1057 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
1058 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
1059 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
1060 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
1061 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
1062 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
1063 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
1064 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
1065 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
1066 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
1067 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
1068 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
1069 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
1070 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
1071 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
1072 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
1073 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
1074 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
1075 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
1076 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
1077 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
1078 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
1079 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
1080 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
1081 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
1082 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
1083 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
1084 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
1085 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
1086 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
1087 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
1088 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
1089 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
1090 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
1091 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
1092 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
1093 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
1094 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
1095 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
1096 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
1097 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
1098 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
1099 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
1100 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
1101 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
1102 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
1103 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
1104 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
1105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1106 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
1107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1108 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
1110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1111 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
1112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1114 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1115 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1116 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1117 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1118 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1119 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1120 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1121 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1122 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1123 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1124 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1125 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
1126 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1134 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1135 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
1136 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
1137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1138 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1140 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
1141 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1143 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
1147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1149 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
1150 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
1151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1152 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1153 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
1154 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
1155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1158 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1159 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
1160 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1161 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1162 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1163 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1164 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
1165 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1166 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
1168 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
1169 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
1170 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
1171 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
1172 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
1173 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
1174 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
1175 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
1176 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
1177 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1178 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1179 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
1180 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
1181 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1182 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
1183 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
1184 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1185 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1186 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1187 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
1188 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
1189 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1190 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1191 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
1192 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1193 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1194 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1195 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1196 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1197 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1198 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1199 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1200 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1201 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1202 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1203 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1204 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1205 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1206 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1207 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1208 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1209 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1210 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1211 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1212 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1213 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1214 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1215 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1216 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1217 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1218 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1219 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1220 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1221 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1222 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1223 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1225 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1226 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1227 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1228 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1229 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1230 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1231 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1232 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1233 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1234 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1235 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1236 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1237 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1238 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1239 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1240 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1241 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1242 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1243 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1244 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1245 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1246 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1247 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1248 8005258706 Rhizobium sp. R693 Isolate Nodule
1249 8005275841 Rhizobium sp. N4311 Isolate Nodule
1250 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1251 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1252 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1253 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1254 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1255 8005321885 Rhizobium sp. R72 Isolate Nodule
1256 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1257 8005382845 Rhizobium sp. R634 Isolate Nodule
1258 8005395548 Rhizobium sp. R339 Isolate Nodule
1259 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1260 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1261 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1262 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1263 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1264 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1265 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1266 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1267 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1268 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1269 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1270 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1271 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1272 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1273 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1274 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1275 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1276 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1277 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1278 8018176218 Rhizobium sp. N122 Isolate Nodule
1279 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1280 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1281 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1282 8024501048 Rhizobium sp. H4 Isolate Nodule
1283 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1284 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1285 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1286 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1287 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1288 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1289 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1290 8056382006 Rhizobium croatiense 13T Isolate Nodule
1291 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1292 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1293 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 53.07
Metatranscriptomes 3.07
Isolates 43.87

Biome Distribution

Category Percentage (%)
Aerial Root 0.24
Bulb 0
Endosphere 16.46
Nodule 33.89
Rhizoplane 1.51
Rhizosphere 33.3
Stem 0
Stem Tuber 0
Unclassified 14.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_FSXC2569_b1 2010549000 Bacteria 851
2 JGI24741J21665_1062818 3300001915 Bacteria 549
3 JGI24740J21852_10036962 3300001979 Bacteria 1511
4 JGI24740J21852_10049384 3300001979 Bacteria 1216
5 JGI24740J21852_10079623 3300001979 Bacteria 861
6 JGI24740J21852_10108231 3300001979 Bacteria 703
7 JGI24739J22299_10048442 3300001989 Bacteria 1382
8 JGI24735J21928_10041271 3300002067 Bacteria 1345
9 JGI25155J39150_1000018 3300002704 Bacteria 157606
10 JGI25156J39149_1000140 3300002705 Bacteria 53384
11 JGI25162J39368_1000253 3300002737 Bacteria 51894
12 JGI25162J39368_1000485 3300002737 Bacteria 30412
13 JGI25154J39366_1000069 3300002738 Bacteria 96438
14 JGI25154J39366_1000161 3300002738 Bacteria 51880
15 JGI25158J39367_1000014 3300002739 Bacteria 47475
16 JGI25158J39367_1010618 3300002739 Bacteria 1241
17 JGI25157J39369_1000108 3300002741 Bacteria 69980
18 JGI25157J39369_1001286 3300002741 Bacteria 10081
19 JGI25152J39213_1000229 3300002773 Bacteria 37906
20 JGI25152J39213_1002877 3300002773 Bacteria 6157
21 JGI25152J39213_1007990 3300002773 Bacteria 2674
22 JGI25152J39213_1036572 3300002773 Bacteria 718
23 JGI25150J39212_1000018 3300002774 Bacteria 146535
24 JGI25159J45721_1000176 3300002987 Bacteria 29633
25 JGI25159J45721_1000326 3300002987 Bacteria 22165
26 JGI25159J45721_1001680 3300002987 Bacteria 8968
27 JGI25151J46595_10000034 3300003187 Bacteria 192271
28 JGI25151J46595_10001853 3300003187 Bacteria 13603
29 JGI25151J46595_10002548 3300003187 Bacteria 10807
30 JGI25151J46595_10004959 3300003187 Bacteria 6947
31 JGI25151J46595_10006983 3300003187 Bacteria 5590
32 JGI25151J46595_10016793 3300003187 Bacteria 3193
33 JGI25151J46595_10024001 3300003187 Bacteria 2501
34 JGI25406J46586_10022009 3300003203 Bacteria 2550
35 JGI25165J46597_1000019 3300003214 Bacteria 371528
36 JGI25165J46597_1000536 3300003214 Bacteria 35271
37 JGI25165J46597_1001677 3300003214 Bacteria 10057
38 JGI25165J46597_1003663 3300003214 Bacteria 3673
39 JGI25153J46596_10009433 3300003215 Bacteria 4535
40 JGI25153J46596_10013005 3300003215 Bacteria 3548
41 JGI25153J46596_10016521 3300003215 Bacteria 2950
42 JGI25153J46596_10093972 3300003215 Bacteria 718
43 rootH2_10030154 3300003320 Bacteria 2246
44 JGI25160J50197_1000027 3300003354 Bacteria 182809
45 JGI25160J50197_1000051 3300003354 Bacteria 132923
46 JGI25160J50197_1001076 3300003354 Bacteria 14001
47 JGI25160J50197_1002609 3300003354 Bacteria 8313
48 JGI25160J50197_1039569 3300003354 Bacteria 1102
49 JGI25161J50226_1000011 3300003374 Bacteria 210140
50 JGI25161J50226_1000038 3300003374 Bacteria 131804
51 JGI25161J50226_1000757 3300003374 Bacteria 12368
52 Ga0006562J51391_1012861 3300003578 Bacteria 1981
53 Ga0006562J51391_1012870 3300003578 Bacteria 1930
54 Ga0032354_1025696 3300003693 Bacteria 1194
55 Ga0006780_1021509 3300003735 Bacteria 1174
56 Ga0055542_1002133 3300003762 Bacteria 7218
57 Ga0055529_1001568 3300003763 Bacteria 6426
58 Ga0055526_1001048 3300003771 Bacteria 20191
59 Ga0055526_1008864 3300003771 Bacteria 4940
60 Ga0055526_1014842 3300003771 Bacteria 3170
61 Ga0055526_1025515 3300003771 Bacteria 1895
62 Ga0055526_1034323 3300003771 Bacteria 1388
63 Ga0055526_1053599 3300003771 Bacteria 902
64 Ga0055524_1004059 3300003775 Bacteria 6878
65 Ga0055524_1006311 3300003775 Bacteria 5155
66 Ga0055524_1012498 3300003775 Bacteria 3256
67 Ga0055524_1025292 3300003775 Bacteria 1862
68 Ga0055524_1038558 3300003775 Bacteria 1248
69 Ga0055524_1048165 3300003775 Bacteria 996
70 Ga0055536_1000540 3300003781 Bacteria 25879
71 Ga0055536_1007552 3300003781 Bacteria 4841
72 Ga0055528_1000884 3300003790 Bacteria 20244
73 Ga0055528_1000979 3300003790 Bacteria 18966
74 Ga0055528_1004196 3300003790 Bacteria 7000
75 Ga0055528_1009005 3300003790 Bacteria 4213
76 Ga0055528_1009863 3300003790 Bacteria 3947
77 Ga0055530_10006351 3300003791 Bacteria 5303
78 Ga0055540_1002302 3300003792 Bacteria 10267
79 Ga0055540_1003597 3300003792 Bacteria 7401
80 Ga0055540_1008610 3300003792 Bacteria 3652
81 Ga0055540_1023085 3300003792 Bacteria 1575
82 Ga0055540_1024202 3300003792 Bacteria 1511
83 Ga0055540_1025163 3300003792 Bacteria 1463
84 Ga0055531_10004904 3300003794 Bacteria 7961
85 Ga0055531_10007527 3300003794 Bacteria 5916
86 Ga0058692_1003317 3300003856 Bacteria 5004
87 Ga0058692_1007328 3300003856 Bacteria 2938
88 Ga0055543_1000030 3300004625 Bacteria 130849
89 Ga0055543_1000041 3300004625 Bacteria 118501
90 Ga0055543_1000317 3300004625 Bacteria 33524
91 Ga0055543_1000416 3300004625 Bacteria 26883
92 Ga0065165_1000133 3300005262 Bacteria 128540
93 Ga0065165_1000135 3300005262 Bacteria 127785
94 Ga0065165_1010834 3300005262 Bacteria 3885
95 Ga0065165_1010844 3300005262 Bacteria 3881
96 Ga0065704_10204987 3300005289 Bacteria 1131
97 Ga0065712_10581084 3300005290 Bacteria 601
98 Ga0070658_10276980 3300005327 Bacteria 1427
99 Ga0070658_10391938 3300005327 Bacteria 1192
100 Ga0070670_100000061 3300005331 Bacteria 113254
101 Ga0070682_100639962 3300005337 Bacteria 845
102 Ga0070660_100066880 3300005339 Bacteria 2799
103 Ga0070660_100571327 3300005339 Bacteria 944
104 Ga0070660_100584776 3300005339 Bacteria 933
105 Ga0070660_101202324 3300005339 Bacteria 643
106 Ga0070689_100578240 3300005340 Bacteria 971
107 Ga0070668_100101702 3300005347 Bacteria 2278
108 Ga0070668_100120935 3300005347 Bacteria 2093
109 Ga0070668_100139712 3300005347 Bacteria 1951
110 Ga0070669_100315714 3300005353 Bacteria 1261
111 Ga0070671_100324784 3300005355 Bacteria 1311
112 Ga0070673_101271477 3300005364 Bacteria 691
113 Ga0070667_100295986 3300005367 Bacteria 1456
114 Ga0070663_100052882 3300005455 Bacteria 2898
115 Ga0070663_100171861 3300005455 Bacteria 1676
116 Ga0070663_100243900 3300005455 Bacteria 1419
117 Ga0070663_100847189 3300005455 Bacteria 787
118 Ga0070678_100490727 3300005456 Bacteria 1082
119 Ga0070662_100100915 3300005457 Bacteria 2184
120 Ga0070662_100328016 3300005457 Bacteria 1250
121 Ga0068867_100352987 3300005459 Bacteria 1228
122 Ga0070698_101396742 3300005471 Bacteria 651
123 Ga0070672_100405630 3300005543 Bacteria 1169
124 Ga0070665_100013727 3300005548 Bacteria 8153
125 Ga0070665_100060359 3300005548 Bacteria 3801
126 Ga0070665_100093261 3300005548 Bacteria 3015
127 Ga0070665_100103373 3300005548 Bacteria 2852
128 Ga0070665_100204393 3300005548 Bacteria 1976
129 Ga0070665_100361308 3300005548 Bacteria 1458
130 Ga0070665_101440430 3300005548 Bacteria 698
131 Ga0068855_100166759 3300005563 Bacteria 2496
132 Ga0068855_101297718 3300005563 Bacteria 754
133 Ga0068855_101448286 3300005563 Bacteria 707
134 Ga0070664_100431911 3300005564 Bacteria 1207
135 Ga0068854_100671069 3300005578 Bacteria 892
136 Ga0068854_100728815 3300005578 Bacteria 858
137 Ga0068854_100943801 3300005578 Bacteria 760
138 Ga0068856_100357583 3300005614 Bacteria 1479
139 Ga0068856_100726070 3300005614 Bacteria 1014
140 Ga0068852_100257629 3300005616 Bacteria 1674
141 Ga0068852_100501561 3300005616 Bacteria 1208
142 Ga0068861_101180966 3300005719 Bacteria 739
143 Ga0068851_10050731 3300005834 Bacteria 2107
144 Ga0068870_10286210 3300005840 Bacteria 1035
145 Ga0068860_101205441 3300005843 Bacteria 777
146 Ga0081539_10000429 3300005985 Bacteria 89452
147 Ga0075365_10000592 3300006038 Bacteria 14151
148 Ga0075365_10004401 3300006038 Bacteria 7460
149 Ga0075365_10009173 3300006038 Bacteria 5669
150 Ga0075365_10023469 3300006038 Bacteria 3881
151 Ga0075365_10067109 3300006038 Bacteria 2408
152 Ga0075365_10094630 3300006038 Bacteria 2039
153 Ga0075365_10104481 3300006038 Bacteria 1942
154 Ga0075365_10182820 3300006038 Bacteria 1466
155 Ga0075365_10234287 3300006038 Bacteria 1289
156 Ga0075365_10258815 3300006038 Bacteria 1223
157 Ga0075365_10305262 3300006038 Bacteria 1120
158 Ga0075368_10001899 3300006042 Bacteria 6713
159 Ga0075368_10046504 3300006042 Bacteria 1716
160 Ga0075368_10056159 3300006042 Bacteria 1571
161 Ga0075368_10072478 3300006042 Bacteria 1393
162 Ga0075368_10099038 3300006042 Bacteria 1196
163 Ga0075368_10177137 3300006042 Bacteria 898
164 Ga0075363_100002706 3300006048 Bacteria 7334
165 Ga0075363_100003123 3300006048 Bacteria 6956
166 Ga0075363_100066180 3300006048 Bacteria 1955
167 Ga0075363_100210933 3300006048 Bacteria 1111
168 Ga0075363_100292789 3300006048 Bacteria 944
169 Ga0075364_10000006 3300006051 Bacteria 86571
170 Ga0075364_10011027 3300006051 Bacteria 5483
171 Ga0075364_10054564 3300006051 Bacteria 2614
172 Ga0075364_10130820 3300006051 Bacteria 1684
173 Ga0075364_10242848 3300006051 Bacteria 1223
174 Ga0075364_10253286 3300006051 Bacteria 1196
175 Ga0075364_10497301 3300006051 Bacteria 833
176 Ga0075364_10556888 3300006051 Bacteria 784
177 Ga0075364_10670092 3300006051 Bacteria 708
178 Ga0075362_10000510 3300006177 Bacteria 11371
179 Ga0075362_10002423 3300006177 Bacteria 6259
180 Ga0075362_10060693 3300006177 Bacteria 1709
181 Ga0075362_10101501 3300006177 Bacteria 1346
182 Ga0075362_10332784 3300006177 Bacteria 758
183 Ga0075362_10423637 3300006177 Bacteria 673
184 Ga0075367_10000418 3300006178 Bacteria 15724
185 Ga0075367_10003403 3300006178 Bacteria 7583
186 Ga0075367_10020967 3300006178 Bacteria 3647
187 Ga0075367_10030824 3300006178 Bacteria 3077
188 Ga0075367_10097782 3300006178 Bacteria 1791
189 Ga0075367_10139884 3300006178 Bacteria 1499
190 Ga0075367_10147096 3300006178 Bacteria 1461
191 Ga0075367_10312120 3300006178 Bacteria 990
192 Ga0075367_10322702 3300006178 Bacteria 973
193 Ga0075367_10330042 3300006178 Bacteria 962
194 Ga0075367_10360621 3300006178 Bacteria 918
195 Ga0075367_10400875 3300006178 Bacteria 868
196 Ga0075367_10658915 3300006178 Bacteria 665
197 Ga0075367_10674073 3300006178 Bacteria 657
198 Ga0075369_10006597 3300006186 Bacteria 4394
199 Ga0075369_10016932 3300006186 Bacteria 2949
200 Ga0075369_10036926 3300006186 Bacteria 2080
201 Ga0075369_10084045 3300006186 Bacteria 1414
202 Ga0075369_10409351 3300006186 Bacteria 640
203 Ga0075366_10001216 3300006195 Bacteria 12781
204 Ga0075366_10123373 3300006195 Bacteria 1562
205 Ga0075366_10192516 3300006195 Bacteria 1239
206 Ga0075366_10233157 3300006195 Bacteria 1122
207 Ga0075366_10506088 3300006195 Bacteria 747
208 Ga0075366_11022923 3300006195 Bacteria 516
209 Ga0075370_10001979 3300006353 Bacteria 9280
210 Ga0075370_10007019 3300006353 Bacteria 5712
211 Ga0075370_10043874 3300006353 Bacteria 2528
212 Ga0075370_10051128 3300006353 Bacteria 2344
213 Ga0075370_10057045 3300006353 Bacteria 2219
214 Ga0075370_10092246 3300006353 Bacteria 1748
215 Ga0075370_10106112 3300006353 Bacteria 1629
216 Ga0075370_10153797 3300006353 Bacteria 1348
217 Ga0075370_10157872 3300006353 Bacteria 1330
218 Ga0075370_10175669 3300006353 Bacteria 1260
219 Ga0075370_10279551 3300006353 Bacteria 991
220 Ga0079104_1000207 3300006946 Bacteria 82261
221 Ga0079104_1004038 3300006946 Bacteria 6485
222 Ga0079104_1008945 3300006946 Bacteria 3437
223 Ga0099826_10000468 3300006948 Bacteria 19486
224 Ga0105251_10025303 3300009011 Bacteria 3037
225 Ga0105244_10053649 3300009036 Bacteria 2048
226 Ga0105244_10070912 3300009036 Bacteria 1738
227 Ga0105244_10299656 3300009036 Bacteria 744
228 Ga0105250_10043784 3300009092 Bacteria 1794
229 Ga0105250_10100239 3300009092 Bacteria 1181
230 Ga0105240_10000142 3300009093 Bacteria 146932
231 Ga0105240_10256742 3300009093 Bacteria 2018
232 Ga0105240_10381420 3300009093 Bacteria 1592
233 Ga0105240_10707692 3300009093 Bacteria 1099
234 Ga0105240_11893129 3300009093 Bacteria 621
235 Ga0105245_10775113 3300009098 Bacteria 996
236 Ga0105247_10252899 3300009101 Bacteria 1205
237 Ga0105243_10031735 3300009148 Bacteria 4075
238 Ga0105243_10060917 3300009148 Bacteria 3016
239 Ga0105243_10685295 3300009148 Bacteria 997
240 Ga0105243_10890296 3300009148 Bacteria 885
241 Ga0105243_11537287 3300009148 Bacteria 690
242 Ga0105243_11624785 3300009148 Bacteria 673
243 Ga0105241_10379515 3300009174 Bacteria 1235
244 Ga0105248_10085321 3300009177 Bacteria 3553
245 Ga0105248_10345475 3300009177 Bacteria 1675
246 Ga0105237_10013922 3300009545 Bacteria 8416
247 Ga0105237_10211542 3300009545 Bacteria 1939
248 Ga0105237_11085200 3300009545 Bacteria 807
249 Ga0105237_11517174 3300009545 Bacteria 677
250 Ga0105238_10002270 3300009551 Bacteria 19365
251 Ga0105238_10545309 3300009551 Bacteria 1164
252 Ga0105238_10662712 3300009551 Bacteria 1054
253 Ga0105238_11765302 3300009551 Bacteria 650
254 Ga0105249_10195740 3300009553 Bacteria 1975
255 Ga0105249_10215405 3300009553 Bacteria 1887
256 Ga0105249_10562989 3300009553 Bacteria 1191
257 Ga0123341_1000260 3300009765 Bacteria 28683
258 Ga0123342_1011038 3300009766 Bacteria 10076
259 Ga0123342_1023166 3300009766 Bacteria 4080
260 Ga0105239_10001079 3300010375 Bacteria 37830
261 Ga0105239_10136688 3300010375 Bacteria 2729
262 Ga0105239_10209803 3300010375 Bacteria 2183
263 Ga0105239_10341653 3300010375 Bacteria 1689
264 Ga0105239_10543586 3300010375 Bacteria 1323
265 Ga0105239_10580700 3300010375 Bacteria 1278
266 Ga0105239_11522269 3300010375 Bacteria 773
267 Ga0105246_10010820 3300011119 Bacteria 5653
268 Ga0105246_10564924 3300011119 Bacteria 977
269 Ga0157373_10031709 3300013100 Bacteria 3804
270 Ga0157373_10143527 3300013100 Bacteria 1679
271 Ga0157371_10000071 3300013102 Bacteria 164088
272 Ga0157371_10283406 3300013102 Bacteria 1197
273 Ga0157370_10000469 3300013104 Bacteria 50288
274 Ga0157370_10007351 3300013104 Bacteria 12018
275 Ga0157370_10073494 3300013104 Bacteria 3226
276 Ga0157370_10194986 3300013104 Bacteria 1880
277 Ga0157370_11330431 3300013104 Bacteria 647
278 Ga0157369_10043197 3300013105 Bacteria 4914
279 Ga0157369_10141547 3300013105 Bacteria 2545
280 Ga0157369_10199524 3300013105 Bacteria 2100
281 Ga0157369_10446502 3300013105 Bacteria 1339
282 Ga0157369_10456722 3300013105 Bacteria 1323
283 Ga0171463_1004 3300013249 Bacteria 437207
284 Ga0157378_10224811 3300013297 Bacteria 1786
285 Ga0163162_10136131 3300013306 Bacteria 2567
286 Ga0163162_10281441 3300013306 Bacteria 1795
287 Ga0163162_10589112 3300013306 Bacteria 1239
288 Ga0157372_10257782 3300013307 Bacteria 2025
289 Ga0157372_10416562 3300013307 Bacteria 1565
290 Ga0157372_10858728 3300013307 Bacteria 1053
291 Ga0157372_11409050 3300013307 Bacteria 803
292 Ga0157372_11930094 3300013307 Bacteria 679
293 Ga0157375_10398831 3300013308 Bacteria 1542
294 Ga0163163_10285014 3300014325 Bacteria 1704
295 Ga0182008_10038526 3300014497 Bacteria 2391
296 Ga0182008_10045308 3300014497 Bacteria 2187
297 Ga0182006_1044474 3300015261 Bacteria 1731
298 Ga0182007_10002964 3300015262 Bacteria 8228
299 Ga0182005_1023373 3300015265 Bacteria 1690
300 Ga0183363_1306 3300015690 Bacteria 6749
301 Ga0163161_10170499 3300017792 Bacteria 1664
302 Ga0163161_10269258 3300017792 Bacteria 1333
303 Ga0163161_10523387 3300017792 Bacteria 969
304 Ga0214544_1000018 3300021320 Bacteria 187095
305 Ga0214542_1001855 3300021321 Bacteria 43676
306 Ga0214542_1016122 3300021321 Bacteria 7406
307 Ga0214542_1017131 3300021321 Bacteria 6685
308 Ga0214545_1057813 3300021324 Bacteria 656
309 Ga0214543_1000005 3300021327 Bacteria 454523
310 Ga0214543_1000015 3300021327 Bacteria 305679
311 Ga0214543_1000016 3300021327 Bacteria 295257
312 Ga0214543_1000195 3300021327 Bacteria 89886
313 Ga0228711_1000004 3300022739 Bacteria 250146
314 Ga0228710_1000264 3300022740 Bacteria 57413
315 Ga0209435_100031 3300025206 Bacteria 164115
316 Ga0209436_100013 3300025208 Bacteria 131492
317 Ga0209436_104935 3300025208 Bacteria 3194
318 Ga0209436_109069 3300025208 Bacteria 1925
319 Ga0209672_103130 3300025228 Bacteria 3565
320 Ga0209437_100179 3300025233 Bacteria 134210
321 Ga0209437_100181 3300025233 Bacteria 132953
322 Ga0209437_101277 3300025233 Bacteria 6820
323 Ga0207425_1000035 3300025245 Bacteria 225942
324 Ga0207425_1009611 3300025245 Bacteria 2396
325 Ga0207425_1010263 3300025245 Bacteria 2287
326 Ga0207425_1027973 3300025245 Bacteria 1146
327 Ga0209646_1000102 3300025246 Bacteria 164115
328 Ga0209646_1006752 3300025246 Bacteria 1910
329 Ga0209646_1011821 3300025246 Bacteria 1347
330 Ga0209026_1000013 3300025250 Bacteria 415633
331 Ga0209026_1000096 3300025250 Bacteria 164115
332 Ga0209677_100455 3300025253 Bacteria 23764
333 Ga0209148_1000032 3300025254 Bacteria 557660
334 Ga0209759_1000058 3300025256 Bacteria 203580
335 Ga0209759_1000090 3300025256 Bacteria 164115
336 Ga0209129_1000029 3300025258 Bacteria 401149
337 Ga0209129_1000050 3300025258 Bacteria 267408
338 Ga0209129_1000377 3300025258 Bacteria 36213
339 Ga0209129_1002478 3300025258 Bacteria 9017
340 Ga0209129_1003900 3300025258 Bacteria 6202
341 Ga0209129_1005885 3300025258 Bacteria 4162
342 Ga0209233_1000034 3300025261 Bacteria 578898
343 Ga0209233_1000185 3300025261 Bacteria 133788
344 Ga0209233_1000212 3300025261 Bacteria 110364
345 Ga0209233_1000445 3300025261 Bacteria 28225
346 Ga0209233_1005424 3300025261 Bacteria 4233
347 Ga0209455_1000098 3300025272 Bacteria 213890
348 Ga0209455_1007268 3300025272 Bacteria 3148
349 Ga0209673_1000033 3300025273 Bacteria 335369
350 Ga0209673_1000050 3300025273 Bacteria 285287
351 Ga0209673_1000476 3300025273 Bacteria 66898
352 Ga0209673_1001553 3300025273 Bacteria 20717
353 Ga0209673_1001715 3300025273 Bacteria 18534
354 Ga0209673_1003312 3300025273 Bacteria 9646
355 Ga0209673_1009152 3300025273 Bacteria 4323
356 Ga0209673_1010740 3300025273 Bacteria 3835
357 Ga0209673_1029461 3300025273 Bacteria 1748
358 Ga0209130_1000009 3300025284 Bacteria 498952
359 Ga0209130_1000027 3300025284 Bacteria 327700
360 Ga0209130_1000058 3300025284 Bacteria 210250
361 Ga0209130_1007773 3300025284 Bacteria 3256
362 Ga0209130_1008855 3300025284 Bacteria 2927
363 Ga0209130_1033594 3300025284 Bacteria 1038
364 Ga0209675_1014761 3300025291 Bacteria 2360
365 Ga0209676_1000406 3300025292 Bacteria 77603
366 Ga0209676_1003843 3300025292 Bacteria 8812
367 Ga0209676_1010085 3300025292 Bacteria 3984
368 Ga0209676_1045954 3300025292 Bacteria 1184
369 Ga0209025_1000042 3300025294 Bacteria 370577
370 Ga0209025_1000132 3300025294 Bacteria 197432
371 Ga0209025_1000241 3300025294 Bacteria 128329
372 Ga0209025_1000453 3300025294 Bacteria 80110
373 Ga0209025_1001274 3300025294 Bacteria 34655
374 Ga0209025_1002759 3300025294 Bacteria 17753
375 Ga0209025_1008059 3300025294 Bacteria 7671
376 Ga0209025_1022149 3300025294 Bacteria 3385
377 Ga0209025_1048453 3300025294 Bacteria 1722
378 Ga0209025_1076352 3300025294 Bacteria 1161
379 Ga0209025_1148251 3300025294 Bacteria 652
380 Ga0209564_1000111 3300025295 Bacteria 212210
381 Ga0209564_1000227 3300025295 Bacteria 125497
382 Ga0209564_1000284 3300025295 Bacteria 102684
383 Ga0209564_1002155 3300025295 Bacteria 16608
384 Ga0209564_1009667 3300025295 Bacteria 4554
385 Ga0209564_1017086 3300025295 Bacteria 2850
386 Ga0209758_1000255 3300025297 Bacteria 106892
387 Ga0209758_1000406 3300025297 Bacteria 73962
388 Ga0209758_1000563 3300025297 Bacteria 58374
389 Ga0209758_1001039 3300025297 Bacteria 36357
390 Ga0209758_1001297 3300025297 Bacteria 30633
391 Ga0209758_1003074 3300025297 Bacteria 15852
392 Ga0209758_1017669 3300025297 Bacteria 3535
393 Ga0209758_1021428 3300025297 Bacteria 3013
394 Ga0209758_1021657 3300025297 Bacteria 2988
395 Ga0209758_1021673 3300025297 Bacteria 2986
396 Ga0209758_1035760 3300025297 Bacteria 1952
397 Ga0209758_1058408 3300025297 Bacteria 1290
398 Ga0209050_1004183 3300025298 Bacteria 9993
399 Ga0209050_1009264 3300025298 Bacteria 5070
400 Ga0209256_1000361 3300025299 Bacteria 73723
401 Ga0209256_1001149 3300025299 Bacteria 30019
402 Ga0209256_1001517 3300025299 Bacteria 23446
403 Ga0209256_1002615 3300025299 Bacteria 14241
404 Ga0209256_1003137 3300025299 Bacteria 12038
405 Ga0209256_1003810 3300025299 Bacteria 10107
406 Ga0209256_1010847 3300025299 Bacteria 3746
407 Ga0209256_1055479 3300025299 Bacteria 941
408 Ga0209256_1081405 3300025299 Bacteria 707
409 Ga0207426_1000041 3300025302 Bacteria 433536
410 Ga0207426_1000072 3300025302 Bacteria 327700
411 Ga0207426_1000131 3300025302 Bacteria 210250
412 Ga0207426_1000214 3300025302 Bacteria 137296
413 Ga0207426_1002342 3300025302 Bacteria 12374
414 Ga0209051_1000118 3300025303 Bacteria 149426
415 Ga0209051_1001684 3300025303 Bacteria 17792
416 Ga0209051_1002434 3300025303 Bacteria 13370
417 Ga0209051_1006052 3300025303 Bacteria 6906
418 Ga0209051_1075092 3300025303 Bacteria 999
419 Ga0209257_1001639 3300025304 Bacteria 25617
420 Ga0209257_1001825 3300025304 Bacteria 23289
421 Ga0209257_1003745 3300025304 Bacteria 12591
422 Ga0209257_1032140 3300025304 Bacteria 1668
423 Ga0209257_1039424 3300025304 Bacteria 1420
424 Ga0209257_1094812 3300025304 Bacteria 738
425 Ga0207656_10194928 3300025321 Bacteria 977
426 Ga0207680_10795888 3300025903 Bacteria 678
427 Ga0207647_10007088 3300025904 Bacteria 8131
428 Ga0207645_10089984 3300025907 Bacteria 1974
429 Ga0207643_10358138 3300025908 Bacteria 917
430 Ga0207654_10029870 3300025911 Bacteria 2988
431 Ga0207654_10080358 3300025911 Bacteria 1960
432 Ga0207695_10000234 3300025913 Bacteria 146987
433 Ga0207695_10071983 3300025913 Bacteria 3529
434 Ga0207695_10331756 3300025913 Bacteria 1410
435 Ga0207695_10847244 3300025913 Bacteria 794
436 Ga0207695_11503466 3300025913 Bacteria 554
437 Ga0207671_10000043 3300025914 Bacteria 206915
438 Ga0207671_10023356 3300025914 Bacteria 4663
439 Ga0207671_10671813 3300025914 Bacteria 824
440 Ga0207657_10057261 3300025919 Bacteria 3359
441 Ga0207657_10452758 3300025919 Bacteria 1007
442 Ga0207681_10175757 3300025923 Bacteria 1627
443 Ga0207681_10256917 3300025923 Bacteria 1366
444 Ga0207694_10353883 3300025924 Bacteria 1216
445 Ga0207650_10000207 3300025925 Bacteria 67267
446 Ga0207687_10623780 3300025927 Bacteria 910
447 Ga0207687_10745828 3300025927 Bacteria 833
448 Ga0207706_10176921 3300025933 Bacteria 1874
449 Ga0207686_10695319 3300025934 Bacteria 808
450 Ga0207709_10145508 3300025935 Bacteria 1635
451 Ga0207709_10224098 3300025935 Bacteria 1358
452 Ga0207704_10513584 3300025938 Bacteria 968
453 Ga0207691_10972252 3300025940 Bacteria 709
454 Ga0207711_10479700 3300025941 Bacteria 1158
455 Ga0207689_10418819 3300025942 Bacteria 1117
456 Ga0207679_10591490 3300025945 Bacteria 999
457 Ga0207667_10159711 3300025949 Bacteria 2319
458 Ga0207667_10499075 3300025949 Bacteria 1235
459 Ga0207667_10545953 3300025949 Bacteria 1172
460 Ga0207712_10427121 3300025961 Bacteria 1119
461 Ga0207668_10013360 3300025972 Bacteria 5053
462 Ga0207668_10091320 3300025972 Bacteria 2238
463 Ga0207668_10147887 3300025972 Bacteria 1815
464 Ga0207668_10250865 3300025972 Bacteria 1437
465 Ga0207668_10681340 3300025972 Bacteria 902
466 Ga0207640_10283277 3300025981 Bacteria 1303
467 Ga0207640_10444323 3300025981 Bacteria 1067
468 Ga0207640_11023872 3300025981 Bacteria 727
469 Ga0207639_10004025 3300026041 Bacteria 9917
470 Ga0207639_10362850 3300026041 Bacteria 1297
471 Ga0207639_10557684 3300026041 Bacteria 1052
472 Ga0207678_10023129 3300026067 Bacteria 5438
473 Ga0207678_10187876 3300026067 Bacteria 1765
474 Ga0207678_10193094 3300026067 Bacteria 1740
475 Ga0207678_10265126 3300026067 Bacteria 1472
476 Ga0207678_10434387 3300026067 Bacteria 1140
477 Ga0207702_10045234 3300026078 Bacteria 3703
478 Ga0207702_10102227 3300026078 Bacteria 2532
479 Ga0207702_10245482 3300026078 Bacteria 1679
480 Ga0207648_10399153 3300026089 Bacteria 1246
481 Ga0207674_10477297 3300026116 Bacteria 1205
482 Ga0207674_11517631 3300026116 Bacteria 639
483 Ga0207675_101350440 3300026118 Bacteria 733
484 Ga0207683_10255124 3300026121 Bacteria 1601
485 Ga0209281_1000028 3300027111 Bacteria 440027
486 Ga0209281_1000030 3300027111 Bacteria 425931
487 Ga0209281_1000857 3300027111 Bacteria 26596
488 Ga0209371_1000037 3300027312 Bacteria 367074
489 Ga0209371_1001614 3300027312 Bacteria 14629
490 Ga0209371_1021804 3300027312 Bacteria 1545
491 Ga0209983_1023367 3300027665 Bacteria 1298
492 Ga0209282_1000004 3300027666 Bacteria 425931
493 Ga0209282_1010364 3300027666 Bacteria 5896
494 Ga0209813_10014181 3300027866 Bacteria 2143
495 Ga0209813_10025670 3300027866 Bacteria 1697
496 Ga0209813_10037922 3300027866 Bacteria 1454
497 Ga0209813_10286423 3300027866 Bacteria 636
498 Ga0268266_10009893 3300028379 Bacteria 8381
499 Ga0268266_10027268 3300028379 Bacteria 4858
500 Ga0268266_10036851 3300028379 Bacteria 4166
501 Ga0268266_10056837 3300028379 Bacteria 3366
502 Ga0268266_10112977 3300028379 Bacteria 2408
503 Ga0268266_10289288 3300028379 Bacteria 1526
504 Ga0268266_10827908 3300028379 Bacteria 894
505 Ga0307515_10000136 3300028794 Bacteria 174265
506 Ga0307515_10001840 3300028794 Bacteria 47276
507 Ga0307515_10003402 3300028794 Bacteria 33496
508 Ga0307515_10050525 3300028794 Bacteria 6224
509 Ga0307515_10186903 3300028794 Bacteria 1998
510 Ga0307515_10342304 3300028794 Bacteria 1147
511 Ga0307515_10496673 3300028794 Bacteria 831
512 Ga0268256_1000039 3300030500 Bacteria 354969
513 Ga0268256_1032238 3300030500 Bacteria 1250
514 Ga0268256_1042016 3300030500 Bacteria 1017
515 Ga0316181_1054311 3300030744 Bacteria 709
516 Ga0307513_10010967 3300031456 Bacteria 11309
517 Ga0307513_10377852 3300031456 Bacteria 1157
518 Ga0307408_100012911 3300031548 Bacteria 5538
519 Ga0307408_100230484 3300031548 Bacteria 1517
520 Ga0307408_100469156 3300031548 Bacteria 1096
521 Ga0316579_10374278 3300031691 Bacteria 689
522 Ga0307516_10060302 3300031730 Bacteria 3687
523 Ga0307405_10000203 3300031731 Bacteria 21655
524 Ga0307405_10053789 3300031731 Bacteria 2510
525 Ga0307405_10492615 3300031731 Bacteria 981
526 Ga0307405_10612896 3300031731 Bacteria 890
527 Ga0307405_10723009 3300031731 Bacteria 827
528 Ga0307413_10307820 3300031824 Bacteria 1204
529 Ga0307413_10552463 3300031824 Bacteria 934
530 Ga0307410_10211898 3300031852 Bacteria 1485
531 Ga0307410_10634021 3300031852 Bacteria 895
532 Ga0307406_10019753 3300031901 Bacteria 3958
533 Ga0307406_10691522 3300031901 Bacteria 851
534 Ga0307406_10967503 3300031901 Bacteria 728
535 Ga0307407_10299958 3300031903 Bacteria 1120
536 Ga0307407_11088364 3300031903 Bacteria 621
537 Ga0307412_10000671 3300031911 Bacteria 19855
538 Ga0307412_10050105 3300031911 Bacteria 2755
539 Ga0307412_10224860 3300031911 Bacteria 1441
540 Ga0307412_10496624 3300031911 Bacteria 1015
541 Ga0307412_10866104 3300031911 Bacteria 789
542 Ga0315914_1000001 3300031967 Bacteria 416633
543 Ga0307409_100122337 3300031995 Bacteria 2207
544 Ga0307409_100234209 3300031995 Bacteria 1667
545 Ga0307409_100811955 3300031995 Bacteria 944
546 Ga0307409_101057072 3300031995 Bacteria 832
547 Ga0307409_102230496 3300031995 Bacteria 577
548 Ga0307416_100210294 3300032002 Bacteria 1855
549 Ga0307416_100314458 3300032002 Bacteria 1565
550 Ga0307416_100702315 3300032002 Bacteria 1101
551 Ga0307416_101145900 3300032002 Bacteria 883
552 Ga0307416_101435017 3300032002 Bacteria 796
553 Ga0307414_10054702 3300032004 Bacteria 2791
554 Ga0307414_10294614 3300032004 Bacteria 1369
555 Ga0307414_10364487 3300032004 Bacteria 1244
556 Ga0307414_10452460 3300032004 Bacteria 1126
557 Ga0307414_10822952 3300032004 Bacteria 848
558 Ga0307411_10574965 3300032005 Bacteria 965
559 Ga0315913_1000364 3300033430 Bacteria 38616
560 Ga0315915_1000002 3300033464 Bacteria 425854
561 Ga0373935_0164347 3300035692 Bacteria 1515
562 Ga0373935_0284707 3300035692 Bacteria 1164
563 Ga0373935_1466639 3300035692 Bacteria 510
564 Ga0373927_0000074 3300035695 Bacteria 72943
565 Ga0373925_0008542 3300037068 Bacteria 7463
566 Ga0395899_0000014 3300037312 Bacteria 488813
567 Ga0395899_0578189 3300037312 Bacteria 718
568 Ga0395900_0000007 3300037418 Bacteria 488860
569 Ga0395900_0256182 3300037418 Bacteria 1749
570 Ga0395900_0287462 3300037418 Bacteria 1634
571 Ga0395900_0487374 3300037418 Bacteria 1185
572 Ga0395900_0534583 3300037418 Bacteria 1119
573 Ga0395900_0656906 3300037418 Bacteria 985
574 Ga0395898_0000011 3300037466 Bacteria 488860
575 Ga0395898_0066132 3300037466 Bacteria 3504
576 Ga0395898_0170613 3300037466 Bacteria 2080
577 Ga0395898_0845855 3300037466 Bacteria 854
578 Ga0395905_0000008 3300037471 Bacteria 488860
579 Ga0395905_0003609 3300037471 Bacteria 16455
580 Ga0395905_0062829 3300037471 Bacteria 3473
581 Ga0395905_0081757 3300037471 Bacteria 3027
582 Ga0395905_0087746 3300037471 Bacteria 2916
583 Ga0395905_0184733 3300037471 Bacteria 1957
584 Ga0395905_0198464 3300037471 Bacteria 1881
585 Ga0395901_0000020 3300038443 Bacteria 314918
586 Ga0395901_0203247 3300038443 Bacteria 2076
587 Ga0395901_0418062 3300038443 Bacteria 1375
588 Ga0395901_0735369 3300038443 Bacteria 981
589 Ga0395901_1494359 3300038443 Bacteria 632
590 Ga0439465_0002198 3300041413 Bacteria 6395
591 Ga0439465_0028181 3300041413 Bacteria 1780
592 Ga0439465_0196135 3300041413 Bacteria 734
593 Ga0439465_0216688 3300041413 Bacteria 701
594 Ga0439465_0249916 3300041413 Bacteria 656
595 Ga0451787_031617 3300041441 Bacteria 2785
596 Ga0451789_0616123 3300041443 Bacteria 636
597 Ga0451790_41710 3300041444 Bacteria 835
598 Ga0451791_0907373 3300041451 Bacteria 1697
599 Ga0451791_1393878 3300041451 Bacteria 975
600 Ga0451797_1310432 3300041453 Bacteria 819
601 Ga0451833_1319809 3300041491 Bacteria 1021
602 Ga0451835_0218371 3300041492 Bacteria 723
603 Ga0451836_13108 3300041493 Bacteria 932
604 Ga0451837_0471602 3300041494 Bacteria 1174
605 Ga0451837_0562295 3300041494 Bacteria 2544
606 Ga0451839_0562329 3300041496 Bacteria 581
607 Ga0451840_28572 3300041497 Bacteria 1023
608 Ga0451841_0541929 3300041498 Bacteria 1181
609 Ga0451841_0881634 3300041498 Bacteria 1298
610 Ga0451844_02159 3300041500 Bacteria 1056
611 Ga0451845_0753293 3300041501 Bacteria 802
612 Ga0451847_0228755 3300041503 Bacteria 2112
613 Ga0451847_0469452 3300041503 Bacteria 846
614 Ga0451848_06670 3300041504 Bacteria 799
615 Ga0451851_0283834 3300041507 Bacteria 922
616 Ga0451851_0517594 3300041507 Bacteria 2003
617 Ga0451843_1214210 3300041509 Bacteria 1028
618 Ga0451854_30503 3300041510 Bacteria 1210
619 Ga0451855_0216161 3300041511 Bacteria 3739
620 Ga0451855_0278802 3300041511 Bacteria 1015
621 Ga0451853_2686657 3300041512 Bacteria 2451
622 Ga0452268_02506 3300041907 Bacteria 944
623 Ga0452268_31546 3300041907 Bacteria 746
624 Ga0439441_059889 3300042001 Bacteria 800
625 Ga0439442_105887 3300042002 Bacteria 611
626 Ga0439445_0044398 3300042004 Bacteria 1187
627 Ga0439432_049090 3300042006 Bacteria 1320
628 Ga0439449_0020537 3300042007 Bacteria 2474
629 Ga0450900_023943 3300042136 Bacteria 864
630 Ga0439458_0050942 3300042157 Bacteria 1022
631 Ga0439434_0006200 3300042435 Bacteria 3489
632 Ga0450918_000624 3300042531 Bacteria 7595
633 Ga0466972_0039301 3300044658 Bacteria 2309
634 Ga0466965_0155215 3300044683 Bacteria 1198
635 Ga0466965_0174919 3300044683 Bacteria 1131
636 Ga0466968_0156700 3300044735 Bacteria 1049
637 Ga0466968_0514774 3300044735 Bacteria 597
638 Ga0466970_0640706 3300044765 Bacteria 618
639 Ga0466960_0112323 3300044901 Bacteria 1417
640 Ga0466959_0395808 3300045049 Bacteria 939
641 Ga0451576_1303413 3300045051 Bacteria 757
642 Ga0495629_0037852 3300046459 Bacteria 3399
643 Ga0495638_0000110 3300046460 Bacteria 131410
644 Ga0495638_0012945 3300046460 Bacteria 5695
645 Ga0495638_0028199 3300046460 Bacteria 3627
646 Ga0495638_0426201 3300046460 Bacteria 683
647 Ga0495638_0465294 3300046460 Bacteria 643
648 Ga0495650_0095593 3300046471 Bacteria 1123
649 Ga0495605_0008847 3300046474 Bacteria 5677
650 Ga0495662_0004122 3300046476 Bacteria 7322
651 Ga0495585_0008442 3300046492 Bacteria 6242
652 Ga0495585_0245939 3300046492 Bacteria 894
653 Ga0495596_0025403 3300046500 Bacteria 2394
654 Ga0495607_0023917 3300046501 Bacteria 3817
655 Ga0495583_0025141 3300046506 Bacteria 2980
656 Ga0495583_0141152 3300046506 Bacteria 1003
657 Ga0495583_0383331 3300046506 Bacteria 553
658 Ga0495606_0001739 3300046507 Bacteria 27980
659 Ga0495606_0015600 3300046507 Bacteria 5843
660 Ga0495606_0234470 3300046507 Bacteria 1027
661 Ga0495610_0001935 3300046512 Bacteria 17840
662 Ga0495610_0066907 3300046512 Bacteria 1690
663 Ga0495620_0178898 3300046515 Bacteria 820
664 Ga0495631_0173697 3300046518 Bacteria 924
665 Ga0495631_0205993 3300046518 Bacteria 841
666 Ga0495632_0000347 3300046519 Bacteria 44084
667 Ga0495632_0019297 3300046519 Bacteria 3718
668 Ga0495632_0062337 3300046519 Bacteria 1808
669 Ga0495637_0063642 3300046520 Bacteria 1507
670 Ga0495637_0117180 3300046520 Bacteria 1028
671 Ga0495643_0015286 3300046522 Bacteria 4539
672 Ga0495643_0027853 3300046522 Bacteria 3171
673 Ga0495652_0429760 3300046529 Bacteria 929
674 Ga0495654_0000143 3300046530 Bacteria 74495
675 Ga0495654_0034316 3300046530 Bacteria 2561
676 Ga0495587_0140782 3300046536 Bacteria 1377
677 Ga0495609_0030102 3300046538 Bacteria 2471
678 Ga0495609_0047745 3300046538 Bacteria 1915
679 Ga0495622_0025118 3300046557 Bacteria 2783
680 Ga0495622_0115690 3300046557 Bacteria 1226
681 Ga0495633_0067416 3300046558 Bacteria 1671
682 Ga0495656_0122164 3300046615 Bacteria 1231
683 Ga0495656_0486606 3300046615 Bacteria 653
684 Ga0495656_0618489 3300046615 Bacteria 580
685 Ga0495668_0035633 3300046616 Bacteria 2789
686 Ga0495668_0094268 3300046616 Bacteria 1639
687 Ga0495668_0138825 3300046616 Bacteria 1330
688 Ga0495625_0032377 3300046660 Bacteria 3877
689 Ga0495625_0171839 3300046660 Bacteria 1447
690 Ga0495625_0267893 3300046660 Bacteria 1103
691 Ga0495635_0124869 3300046663 Bacteria 1755
692 Ga0495661_0032290 3300046665 Bacteria 3311
693 Ga0495658_0115609 3300046683 Bacteria 1617
694 Ga0495670_0013105 3300046691 Bacteria 4077
695 Ga0495671_0033323 3300046692 Bacteria 2625
696 Ga0495660_0080875 3300046810 Bacteria 1704
697 Ga0495604_0019395 3300047317 Bacteria 5442
698 Ga0495636_0091956 3300047318 Bacteria 1318
699 Ga0495672_0110440 3300047320 Bacteria 1477
700 Ga0495676_0819074 3300047321 Bacteria 599
701 Ga0495687_070586 3300047443 Bacteria 1402
702 Ga0495677_0195012 3300047445 Bacteria 787
703 Ga0495681_0091967 3300047470 Bacteria 1338
704 Ga0495681_0117388 3300047470 Bacteria 1146
705 Ga0495686_0000922 3300047472 Bacteria 36620
706 Ga0495686_0002075 3300047472 Bacteria 19695
707 Ga0495686_0006491 3300047472 Bacteria 8938
708 Ga0495686_0033990 3300047472 Bacteria 3287
709 Ga0495686_0093608 3300047472 Bacteria 1822
710 Ga0495602_0304557 3300048088 Bacteria 1165
711 Ga0495626_0147980 3300048091 Bacteria 992
712 Ga0496102_0352497 3300048905 Bacteria 1386
713 Ga0496102_1758046 3300048905 Bacteria 537
714 Ga0496103_0178336 3300048906 Bacteria 1365
715 Ga0496104_0261376 3300048907 Bacteria 1644
716 Ga0496106_1270917 3300048909 Bacteria 572
717 Ga0496109_0513229 3300048912 Bacteria 1131
718 Ga0496110_0533748 3300048913 Bacteria 1067
719 Ga0496111_0000447 3300048914 Bacteria 20952
720 Ga0496111_0853401 3300048914 Bacteria 657
721 Ga0496112_0042936 3300048915 Bacteria 4425
722 Ga0496112_0218361 3300048915 Bacteria 1863
723 Ga0496115_0051128 3300048918 Bacteria 3313
724 Ga0496115_0333921 3300048918 Bacteria 1238
725 Ga0496116_0000057 3300048919 Bacteria 281652
726 Ga0496116_0004102 3300048919 Bacteria 14061
727 Ga0496116_0005154 3300048919 Bacteria 12270
728 Ga0496116_0155737 3300048919 Bacteria 1261
729 Ga0496117_0000031 3300048920 Bacteria 381048
730 Ga0496117_0001716 3300048920 Bacteria 30323
731 Ga0496117_0003198 3300048920 Bacteria 19389
732 Ga0496117_0055346 3300048920 Bacteria 2772
733 Ga0496117_0146975 3300048920 Bacteria 1402
734 Ga0496117_0189855 3300048920 Bacteria 1171
735 Ga0496118_0000208 3300048921 Bacteria 102645
736 Ga0496118_0014561 3300048921 Bacteria 7353
737 Ga0496118_0026276 3300048921 Bacteria 4966
738 Ga0496118_0039076 3300048921 Bacteria 3792
739 Ga0496118_0043584 3300048921 Bacteria 3524
740 Ga0496118_0053043 3300048921 Bacteria 3087
741 Ga0496118_0101758 3300048921 Bacteria 1939
742 Ga0496118_0246096 3300048921 Bacteria 1020
743 Ga0496118_0483954 3300048921 Bacteria 620
744 Ga0496118_0487981 3300048921 Bacteria 616
745 Ga0496119_0014917 3300048922 Bacteria 6039
746 Ga0496119_0035101 3300048922 Bacteria 3291
747 Ga0496119_0049554 3300048922 Bacteria 2595
748 Ga0496119_0083457 3300048922 Bacteria 1835
749 Ga0496119_0088348 3300048922 Bacteria 1767
750 Ga0496119_0118815 3300048922 Bacteria 1456
751 Ga0496119_0232717 3300048922 Bacteria 937
752 Ga0496119_0468903 3300048922 Bacteria 590
753 Ga0496120_0001350 3300048923 Bacteria 30183
754 Ga0496120_0001677 3300048923 Bacteria 25420
755 Ga0496120_0114344 3300048923 Bacteria 1405
756 Ga0496120_0130251 3300048923 Bacteria 1289
757 Ga0496120_0139297 3300048923 Bacteria 1233
758 Ga0496120_0204615 3300048923 Bacteria 953
759 Ga0496120_0244623 3300048923 Bacteria 845
760 Ga0496121_0000034 3300048924 Bacteria 377095
761 Ga0496121_0000888 3300048924 Bacteria 53958
762 Ga0496121_0002668 3300048924 Bacteria 26718
763 Ga0496121_0018567 3300048924 Bacteria 7005
764 Ga0496121_0039767 3300048924 Bacteria 4136
765 Ga0496121_0066030 3300048924 Bacteria 2940
766 Ga0496121_0110599 3300048924 Bacteria 2096
767 Ga0496121_0221325 3300048924 Bacteria 1333
768 Ga0496121_0266623 3300048924 Bacteria 1179
769 Ga0496121_0419085 3300048924 Bacteria 872
770 Ga0496121_0537548 3300048924 Bacteria 734
771 Ga0496121_0675887 3300048924 Bacteria 625
772 Ga0496122_0000023 3300048925 Bacteria 381035
773 Ga0496122_0000082 3300048925 Bacteria 209159
774 Ga0496122_0000286 3300048925 Bacteria 112940
775 Ga0496122_0004894 3300048925 Bacteria 16255
776 Ga0496122_0018350 3300048925 Bacteria 6473
777 Ga0496122_0026286 3300048925 Bacteria 5022
778 Ga0496122_0087471 3300048925 Bacteria 2140
779 Ga0496122_0095309 3300048925 Bacteria 2011
780 Ga0496122_0170011 3300048925 Bacteria 1315
781 Ga0496123_0000027 3300048926 Bacteria 306773
782 Ga0496123_0000066 3300048926 Bacteria 210327
783 Ga0496123_0000067 3300048926 Bacteria 209159
784 Ga0496123_0013117 3300048926 Bacteria 6990
785 Ga0496123_0041094 3300048926 Bacteria 3210
786 Ga0496123_0046501 3300048926 Bacteria 2943
787 Ga0496123_0061041 3300048926 Bacteria 2426
788 Ga0496123_0063420 3300048926 Bacteria 2361
789 Ga0496123_0076632 3300048926 Bacteria 2057
790 Ga0496123_0091216 3300048926 Bacteria 1808
791 Ga0496123_0098893 3300048926 Bacteria 1704
792 Ga0496124_0000174 3300048927 Bacteria 129228
793 Ga0496124_0003251 3300048927 Bacteria 20064
794 Ga0496124_0006284 3300048927 Bacteria 12983
795 Ga0496124_0009223 3300048927 Bacteria 10176
796 Ga0496124_0015603 3300048927 Bacteria 7270
797 Ga0496124_0022211 3300048927 Bacteria 5824
798 Ga0496124_0028978 3300048927 Bacteria 4942
799 Ga0496124_0037583 3300048927 Bacteria 4209
800 Ga0496124_0038925 3300048927 Bacteria 4125
801 Ga0496124_0121559 3300048927 Bacteria 2086
802 Ga0496124_0153605 3300048927 Bacteria 1803
803 Ga0496124_0190362 3300048927 Bacteria 1571
804 Ga0496124_0218741 3300048927 Bacteria 1434
805 Ga0496124_0307385 3300048927 Bacteria 1142
806 Ga0496125_0000030 3300048928 Bacteria 375023
807 Ga0496125_0000279 3300048928 Bacteria 102551
808 Ga0496125_0000288 3300048928 Bacteria 99681
809 Ga0496125_0006344 3300048928 Bacteria 12831
810 Ga0496125_0061583 3300048928 Bacteria 3008
811 Ga0496125_0077477 3300048928 Bacteria 2562
812 Ga0496125_0142884 3300048928 Bacteria 1660
813 Ga0496125_0176690 3300048928 Bacteria 1427
814 Ga0496125_0415216 3300048928 Bacteria 782
815 Ga0496126_0000115 3300048929 Bacteria 188546
816 Ga0496126_0000258 3300048929 Bacteria 113843
817 Ga0496126_0032272 3300048929 Bacteria 4935
818 Ga0496126_0059518 3300048929 Bacteria 3440
819 Ga0496126_0073711 3300048929 Bacteria 3034
820 Ga0496126_0106372 3300048929 Bacteria 2448
821 Ga0496126_0175746 3300048929 Bacteria 1821
822 Ga0496126_0238009 3300048929 Bacteria 1522
823 Ga0496126_0248570 3300048929 Bacteria 1483
824 Ga0496126_0297042 3300048929 Bacteria 1334
825 Ga0496126_0465308 3300048929 Bacteria 1015
826 Ga0496126_1090073 3300048929 Bacteria 594
827 Ga0501300_019550 3300049523 Bacteria 989
828 Ga0501031_0000831 3300049568 Bacteria 18554
829 Ga0501031_0024325 3300049568 Bacteria 3947
830 Ga0501031_0032259 3300049568 Bacteria 3415
831 Ga0501031_0052719 3300049568 Bacteria 2651
832 Ga0501031_0143196 3300049568 Bacteria 1562
833 Ga0501032_0000019 3300049569 Bacteria 155168
834 Ga0501032_0000102 3300049569 Bacteria 72452
835 Ga0501032_0002196 3300049569 Bacteria 15348
836 Ga0501032_0011699 3300049569 Bacteria 6290
837 Ga0501032_0013398 3300049569 Bacteria 5833
838 Ga0501032_0020932 3300049569 Bacteria 4551
839 Ga0501032_0032000 3300049569 Bacteria 3606
840 Ga0501032_0050455 3300049569 Bacteria 2806
841 Ga0501032_0580689 3300049569 Bacteria 714
842 Ga0501032_0754517 3300049569 Bacteria 615
843 Ga0501033_0000133 3300049570 Bacteria 72459
844 Ga0501033_0000185 3300049570 Bacteria 59836
845 Ga0501033_0003165 3300049570 Bacteria 13674
846 Ga0501033_0008082 3300049570 Bacteria 8151
847 Ga0501033_0015786 3300049570 Bacteria 5724
848 Ga0501033_0024075 3300049570 Bacteria 4594
849 Ga0501033_0089980 3300049570 Bacteria 2245
850 Ga0501033_0216610 3300049570 Bacteria 1364
851 Ga0501033_0310137 3300049570 Bacteria 1109
852 Ga0501033_0399009 3300049570 Bacteria 959
853 Ga0501033_0968875 3300049570 Bacteria 570
854 Ga0501034_0000130 3300049571 Bacteria 139568
855 Ga0501034_0000296 3300049571 Bacteria 88355
856 Ga0501034_0000611 3300049571 Bacteria 56186
857 Ga0501034_0011862 3300049571 Bacteria 9018
858 Ga0501034_0013933 3300049571 Bacteria 8278
859 Ga0501034_0033876 3300049571 Bacteria 5178
860 Ga0501034_0056088 3300049571 Bacteria 3965
861 Ga0501034_0089007 3300049571 Bacteria 3085
862 Ga0501034_0111233 3300049571 Bacteria 2729
863 Ga0501034_0125911 3300049571 Bacteria 2547
864 Ga0501034_0168146 3300049571 Bacteria 2161
865 Ga0501034_0207269 3300049571 Bacteria 1916
866 Ga0501034_0392880 3300049571 Bacteria 1311
867 Ga0501034_0395688 3300049571 Bacteria 1305
868 Ga0501034_0406609 3300049571 Bacteria 1283
869 Ga0501034_0618241 3300049571 Bacteria 987
870 Ga0501034_0738934 3300049571 Bacteria 880
871 Ga0501034_1208711 3300049571 Bacteria 634
872 Ga0501034_1458588 3300049571 Bacteria 559
873 Ga0501036_0000034 3300049572 Bacteria 88355
874 Ga0501036_0020290 3300049572 Bacteria 5582
875 Ga0501036_0024429 3300049572 Bacteria 5094
876 Ga0501036_0030905 3300049572 Bacteria 4526
877 Ga0501036_0061705 3300049572 Bacteria 3175
878 Ga0501036_0115820 3300049572 Bacteria 2264
879 Ga0501036_0199776 3300049572 Bacteria 1682
880 Ga0501036_0210707 3300049572 Bacteria 1633
881 Ga0501036_0945732 3300049572 Bacteria 706
882 Ga0501037_0000079 3300049573 Bacteria 88355
883 Ga0501037_0000089 3300049573 Bacteria 85102
884 Ga0501037_0023331 3300049573 Bacteria 4575
885 Ga0501037_0039467 3300049573 Bacteria 3475
886 Ga0501037_0082089 3300049573 Bacteria 2336
887 Ga0501037_0216648 3300049573 Bacteria 1348
888 Ga0501037_0444244 3300049573 Bacteria 885
889 Ga0501037_0602240 3300049573 Bacteria 738
890 Ga0501038_0000063 3300049574 Bacteria 88355
891 Ga0501038_0000478 3300049574 Bacteria 35183
892 Ga0501038_0008634 3300049574 Bacteria 9354
893 Ga0501038_0028340 3300049574 Bacteria 4975
894 Ga0501038_0093901 3300049574 Bacteria 2508
895 Ga0501038_0104265 3300049574 Bacteria 2357
896 Ga0501038_0145772 3300049574 Bacteria 1933
897 Ga0501038_0356263 3300049574 Bacteria 1139
898 Ga0501038_0356932 3300049574 Bacteria 1137
899 Ga0501039_0000028 3300049575 Bacteria 139568
900 Ga0501039_0000058 3300049575 Bacteria 88355
901 Ga0501039_0143657 3300049575 Bacteria 1875
902 Ga0501039_0151499 3300049575 Bacteria 1822
903 Ga0501039_0477382 3300049575 Bacteria 979
904 Ga0501039_0520285 3300049575 Bacteria 934
905 Ga0501040_0336600 3300049576 Bacteria 1080
906 Ga0501041_0529004 3300049577 Bacteria 751
907 Ga0501042_0675925 3300049578 Bacteria 751
908 Ga0501043_0000007 3300049579 Bacteria 224595
909 Ga0501043_0000113 3300049579 Bacteria 76112
910 Ga0501043_0000355 3300049579 Bacteria 41664
911 Ga0501043_0023562 3300049579 Bacteria 4827
912 Ga0501043_0107791 3300049579 Bacteria 2188
913 Ga0501043_0150489 3300049579 Bacteria 1821
914 Ga0501043_0377465 3300049579 Bacteria 1074
915 Ga0501043_0422719 3300049579 Bacteria 1004
916 Ga0501046_0074876 3300049580 Bacteria 2625
917 Ga0501047_0000969 3300049581 Bacteria 28952
918 Ga0501047_0005048 3300049581 Bacteria 12387
919 Ga0501047_0009690 3300049581 Bacteria 9107
920 Ga0501047_0014312 3300049581 Bacteria 7545
921 Ga0501047_0022132 3300049581 Bacteria 6107
922 Ga0501047_0175568 3300049581 Bacteria 2010
923 Ga0501047_0180407 3300049581 Bacteria 1978
924 Ga0501047_0199065 3300049581 Bacteria 1864
925 Ga0501047_0285388 3300049581 Bacteria 1495
926 Ga0501047_0558421 3300049581 Bacteria 969
927 Ga0501047_0633710 3300049581 Bacteria 889
928 Ga0501048_0057912 3300049582 Bacteria 2747
929 Ga0501048_0747413 3300049582 Bacteria 703
930 Ga0501067_0072755 3300049583 Bacteria 1904
931 Ga0501068_0005603 3300049584 Bacteria 6878
932 Ga0501068_0119051 3300049584 Bacteria 1646
933 Ga0501069_0000001 3300049585 Bacteria 289100
934 Ga0501069_0009230 3300049585 Bacteria 5205
935 Ga0501069_0025263 3300049585 Bacteria 3245
936 Ga0501069_0028526 3300049585 Bacteria 3061
937 Ga0501069_0140327 3300049585 Bacteria 1386
938 Ga0501069_0376150 3300049585 Bacteria 839
939 Ga0501070_0000789 3300049586 Bacteria 28809
940 Ga0501070_0001012 3300049586 Bacteria 25214
941 Ga0501070_0003595 3300049586 Bacteria 13407
942 Ga0501070_0033843 3300049586 Bacteria 4276
943 Ga0501070_0046330 3300049586 Bacteria 3616
944 Ga0501070_0061369 3300049586 Bacteria 3114
945 Ga0501070_0076869 3300049586 Bacteria 2763
946 Ga0501070_0102806 3300049586 Bacteria 2363
947 Ga0501070_0133106 3300049586 Bacteria 2053
948 Ga0501070_0252646 3300049586 Bacteria 1442
949 Ga0501070_0833925 3300049586 Bacteria 722
950 Ga0501070_0847477 3300049586 Bacteria 715
951 Ga0501071_0047076 3300049587 Bacteria 3098
952 Ga0501071_0803087 3300049587 Bacteria 725
953 Ga0501072_0544756 3300049588 Bacteria 917
954 Ga0501072_0851653 3300049588 Bacteria 713
955 Ga0501073_0011583 3300049589 Bacteria 6446
956 Ga0501073_0034527 3300049589 Bacteria 3599
957 Ga0501073_0164719 3300049589 Bacteria 1535
958 Ga0501073_0264810 3300049589 Bacteria 1186
959 Ga0501074_0000003 3300049590 Bacteria 116101
960 Ga0501074_0012185 3300049590 Bacteria 6250
961 Ga0501074_0032625 3300049590 Bacteria 3772
962 Ga0501074_0068543 3300049590 Bacteria 2550
963 Ga0501074_0494006 3300049590 Bacteria 867
964 Ga0501238_046359 3300049671 Bacteria 646
965 Ga0501079_1076655 3300049741 Bacteria 633
966 Ga0501080_0000090 3300049742 Bacteria 61585
967 Ga0501080_0002221 3300049742 Bacteria 16875
968 Ga0501080_0017506 3300049742 Bacteria 6627
969 Ga0501080_0021242 3300049742 Bacteria 6008
970 Ga0501080_0028515 3300049742 Bacteria 5195
971 Ga0501080_0081908 3300049742 Bacteria 2998
972 Ga0501080_0258070 3300049742 Bacteria 1588
973 Ga0501083_0000012 3300049744 Bacteria 178668
974 Ga0501083_0092675 3300049744 Bacteria 1994
975 Ga0501266_014742 3300049763 Bacteria 1027
976 Ga0501280_001648 3300049776 Bacteria 3994
977 Ga0501280_001986 3300049776 Bacteria 3556
978 Ga0501035_0000037 3300049822 Bacteria 160921
979 Ga0501035_0000143 3300049822 Bacteria 86821
980 Ga0501035_0000203 3300049822 Bacteria 72435
981 Ga0501035_0000529 3300049822 Bacteria 42811
982 Ga0501035_0001061 3300049822 Bacteria 28803
983 Ga0501035_0001616 3300049822 Bacteria 22785
984 Ga0501035_0006787 3300049822 Bacteria 10696
985 Ga0501035_0022057 3300049822 Bacteria 5850
986 Ga0501035_0022420 3300049822 Bacteria 5798
987 Ga0501035_0073893 3300049822 Bacteria 3016
988 Ga0501035_0094304 3300049822 Bacteria 2632
989 Ga0501035_0493833 3300049822 Bacteria 1008
990 Ga0501035_0589024 3300049822 Bacteria 907
991 Ga0501035_0830144 3300049822 Bacteria 736
992 Ga0501044_0000018 3300049823 Bacteria 225885
993 Ga0501044_0000142 3300049823 Bacteria 88355
994 Ga0501044_0008899 3300049823 Bacteria 10973
995 Ga0501044_0034593 3300049823 Bacteria 5297
996 Ga0501044_0038672 3300049823 Bacteria 4981
997 Ga0501044_0050480 3300049823 Bacteria 4292
998 Ga0501044_0094578 3300049823 Bacteria 3012
999 Ga0501044_0188088 3300049823 Bacteria 2029
1000 Ga0501044_0307646 3300049823 Bacteria 1512
1001 Ga0501044_0314997 3300049823 Bacteria 1490
1002 Ga0501044_0316730 3300049823 Bacteria 1485
1003 Ga0501044_0316810 3300049823 Bacteria 1485
1004 Ga0501044_0330106 3300049823 Bacteria 1448
1005 Ga0501044_0405368 3300049823 Bacteria 1275
1006 Ga0501044_0465105 3300049823 Bacteria 1170
1007 Ga0501044_0660312 3300049823 Bacteria 934
1008 Ga0501044_1002814 3300049823 Bacteria 707
1009 Ga0501045_0001774 3300049824 Bacteria 14567
1010 Ga0501045_0317041 3300049824 Bacteria 1160
1011 Ga0501045_0745925 3300049824 Bacteria 722
1012 nmdc:mga03683_201857_c1 3300050489 Bacteria 913
1013 nmdc:mga03683_208704_c1 3300050489 Bacteria 898
1014 nmdc:mga03683_3182_c1 3300050489 Bacteria 5242
1015 nmdc:mga03683_328154_c1 3300050489 Bacteria 721
1016 nmdc:mga03683_6840_c1 3300050489 Bacteria 3926
1017 nmdc:mga03683_811_c1 3300050489 Bacteria 8951
1018 nmdc:mga03n38_188260_c1 3300050490 Bacteria 1062
1019 nmdc:mga03n38_378752_c1 3300050490 Bacteria 775
1020 nmdc:mga03n38_71982_c1 3300050490 Bacteria 1602
1021 nmdc:mga03n38_83643_c1 3300050490 Bacteria 1505
1022 nmdc:mga00v17_102223_c1 3300050491 Bacteria 1810
1023 nmdc:mga00v17_15_c1 3300050491 Bacteria 126234
1024 nmdc:mga00v17_26228_c1 3300050491 Bacteria 3394
1025 nmdc:mga00v17_584912_c1 3300050491 Bacteria 720
1026 nmdc:mga00v17_8647_c1 3300050491 Bacteria 5483
1027 nmdc:mga00v17_89_c1 3300050491 Bacteria 55686
1028 nmdc:mga0yw44_140008_c1 3300050492 Bacteria 1572
1029 nmdc:mga0yw44_183296_c1 3300050492 Bacteria 1379
1030 nmdc:mga0yw44_23657_c1 3300050492 Bacteria 3465
1031 nmdc:mga0yw44_401659_c1 3300050492 Bacteria 927
1032 nmdc:mga0yw44_5630_c1 3300050492 Bacteria 5957
1033 nmdc:mga0k408_308704_c1 3300050493 Bacteria 944
1034 nmdc:mga0k408_375785_c1 3300050493 Bacteria 847
1035 nmdc:mga0k408_588902_c1 3300050493 Bacteria 656
1036 nmdc:mga0k408_6366_c1 3300050493 Bacteria 6301
1037 nmdc:mga0k408_77366_c1 3300050493 Bacteria 1946
1038 nmdc:mga06z11_126586_c1 3300050494 Bacteria 1430
1039 nmdc:mga06z11_176227_c1 3300050494 Bacteria 1230
1040 nmdc:mga06z11_22195_c1 3300050494 Bacteria 2961
1041 nmdc:mga06z11_38443_c1 3300050494 Bacteria 2377
1042 nmdc:mga06z11_48863_c1 3300050494 Bacteria 2155
1043 nmdc:mga06z11_48902_c1 3300050494 Bacteria 2154
1044 nmdc:mga06z11_95147_c1 3300050494 Bacteria 1625
1045 nmdc:mga04h51_113833_c1 3300050495 Bacteria 1000
1046 nmdc:mga04h51_126921_c1 3300050495 Bacteria 956
1047 nmdc:mga04h51_73206_c1 3300050495 Bacteria 1201
1048 nmdc:mga04h51_74946_c1 3300050495 Bacteria 1190
1049 nmdc:mga07m45_292368_c1 3300050496 Bacteria 948
1050 nmdc:mga07m45_338145_c1 3300050496 Bacteria 875
1051 nmdc:mga07m45_4831_c1 3300050496 Bacteria 6627
1052 nmdc:mga07m45_6173_c1 3300050496 Bacteria 6042
1053 nmdc:mga0sz30_2214_c2 3300050516 Bacteria 3232
1054 nmdc:mga0sz30_2494_c1 3300050516 Bacteria 6559
1055 nmdc:mga0sz30_4223_c1 3300050516 Bacteria 5178
1056 nmdc:mga0sz30_65238_c1 3300050516 Bacteria 1561
1057 nmdc:mga0sz30_74182_c1 3300050516 Bacteria 1467
1058 Ga0495601_0143683 3300053077 Bacteria 1557
1059 Ga0500610_0044800 3300053079 Bacteria 2296
1060 Ga0500610_0110793 3300053079 Bacteria 1412
1061 Ga0495655_0112419 3300053083 Bacteria 820
1062 Ga0500578_0099734 3300053086 Bacteria 1838
1063 Ga0500643_025102 3300053087 Bacteria 1883
1064 Ga0500562_046931 3300053108 Bacteria 1152
1065 Ga0500569_045348 3300053109 Bacteria 1305
1066 Ga0500592_054822 3300053116 Bacteria 650
1067 Ga0500595_020626 3300053119 Bacteria 2368
1068 Ga0500608_018114 3300053122 Bacteria 3210
1069 Ga0500618_000528 3300053125 Bacteria 23979
1070 Ga0500618_000573 3300053125 Bacteria 22735
1071 Ga0500618_006786 3300053125 Bacteria 3327
1072 Ga0500618_038091 3300053125 Bacteria 1110
1073 Ga0500658_0002828 3300053134 Bacteria 6661
1074 Ga0500658_0100561 3300053134 Bacteria 1261
1075 Ga0500559_0012657 3300053136 Bacteria 3582
1076 Ga0500561_0000030 3300053137 Bacteria 29291
1077 Ga0500568_0000421 3300053139 Bacteria 31992
1078 Ga0500568_0000607 3300053139 Bacteria 25984
1079 Ga0500568_0000640 3300053139 Bacteria 25250
1080 Ga0500573_0013675 3300053140 Bacteria 4578
1081 Ga0500573_0024212 3300053140 Bacteria 3490
1082 Ga0500590_000839 3300053148 Bacteria 11548
1083 Ga0500604_0000684 3300053151 Bacteria 9290
1084 Ga0500604_0015547 3300053151 Bacteria 2086
1085 Ga0500604_0050226 3300053151 Bacteria 1285
1086 Ga0500616_0000583 3300053153 Bacteria 44437
1087 Ga0500616_0001279 3300053153 Bacteria 25126
1088 Ga0500616_0027523 3300053153 Bacteria 3139
1089 Ga0500616_0048098 3300053153 Bacteria 2262
1090 Ga0500616_0104269 3300053153 Bacteria 1380
1091 Ga0500616_0189142 3300053153 Bacteria 920
1092 Ga0500622_0000541 3300053156 Bacteria 34818
1093 Ga0500622_0000962 3300053156 Bacteria 24454
1094 Ga0500624_001087 3300053157 Bacteria 5176
1095 Ga0500627_0031040 3300053158 Bacteria 2241
1096 Ga0500634_0062389 3300053161 Bacteria 1974
1097 Ga0500636_0000025 3300053177 Bacteria 86697
1098 Ga0500611_011078 3300053727 Bacteria 1480
1099 Ga0587084_012437 3300059477 Bacteria 1153
1100 Ga0587066_012837 3300059490 Bacteria 1258
1101 Ga0587066_041647 3300059490 Bacteria 868
1102 Ga0587070_045005 3300059491 Bacteria 860
1103 Ga0587073_0020523 3300059492 Bacteria 1261
1104 Ga0587073_0210759 3300059492 Bacteria 588
1105 Ga0587077_023247 3300059493 Bacteria 1118
1106 Ga0587077_048248 3300059493 Bacteria 881
1107 Ga0587077_068672 3300059493 Bacteria 786
1108 Ga0587077_076300 3300059493 Bacteria 760
1109 Ga0587080_036364 3300059503 Bacteria 880
1110 Ga0587080_125430 3300059503 Bacteria 573
1111 Ga0587082_019304 3300059504 Bacteria 1093
1112 Ga0587082_025181 3300059504 Bacteria 999
1113 Ga0587083_0031082 3300059505 Bacteria 1063
1114 Ga0587086_026272 3300059507 Bacteria 829
1115 Ga0587088_026264 3300059508 Bacteria 1010
1116 Ga0587088_031222 3300059508 Bacteria 953
1117 Ga0587090_008592 3300059510 Bacteria 1374
1118 Ga0587090_020816 3300059510 Bacteria 1024
1119 Ga0587091_047505 3300059511 Bacteria 870
1120 Ga0587091_127142 3300059511 Bacteria 625
1121 Ga0587094_027488 3300059513 Bacteria 864
1122 Ga0587098_019801 3300059604 Bacteria 845
1123 Ga0587106_029697 3300059605 Bacteria 870
1124 Ga0587101_017071 3300059623 Bacteria 1001
1125 Ga0587109_050145 3300059624 Bacteria 853
1126 Ga0587109_142633 3300059624 Bacteria 586
1127 Ga0587115_015762 3300059626 Bacteria 1004
1128 Ga0587122_009880 3300059628 Bacteria 890
1129 Ga0587128_013341 3300059630 Bacteria 1158
1130 Ga0587128_032618 3300059630 Bacteria 871
1131 Ga0587062_007581 3300059639 Bacteria 1271
1132 Ga0587062_031311 3300059639 Bacteria 816
1133 Ga0587067_033485 3300059640 Bacteria 961
1134 Ga0587067_038145 3300059640 Bacteria 921
1135 Ga0587068_012550 3300059641 Bacteria 1294
1136 Ga0587072_016120 3300059643 Bacteria 1276
1137 Ga0587072_044876 3300059643 Bacteria 869
1138 Ga0587072_048542 3300059643 Bacteria 844
1139 Ga0587072_052449 3300059643 Bacteria 821
1140 Ga0587075_027659 3300059644 Bacteria 884
1141 Ga0587075_049075 3300059644 Bacteria 731
1142 Ga0587076_012829 3300059645 Bacteria 1259
1143 Ga0587079_087446 3300059647 Bacteria 723
1144 Ga0587102_016744 3300059649 Bacteria 791
1145 Ga0587107_017107 3300059652 Bacteria 967
1146 Ga0587107_034344 3300059652 Bacteria 789
1147 Ga0587108_011115 3300059653 Bacteria 763
1148 Ga0587114_025361 3300059655 Bacteria 869
1149 Ga0587111_0052522 3300060346 Bacteria 904
1150 Ga0501082_0034353 3300060353 Bacteria 4373
1151 Ga0501082_0088000 3300060353 Bacteria 2680
1152 Ga0501082_0786025 3300060353 Bacteria 833
1153 Ga0501082_0896214 3300060353 Bacteria 776

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046474 Ga0495605_0008847 Ga0495605_0008847_4495_4956 153
2 3300046520 Ga0495637_0063642 Ga0495637_0063642_811_1299 154
3 iso_pu_bacteria 2802429606 2805934065 156
4 iso_pu_bacteria 2503198000 2503198039 157
5 iso_pu_bacteria 2508501122 2509109527 157
6 iso_pu_bacteria 2508501122 2509110718 157
7 iso_pu_bacteria 2508501123 2509113629 157
8 iso_pu_bacteria 2508501127 2509140291 157
9 iso_pu_bacteria 2508501127 2509143867 157
10 iso_pu_bacteria 2509276018 2509370596 157
11 iso_pu_bacteria 2509276019 2509377383 157
12 iso_pu_bacteria 2509276019 2509378149 157
13 iso_pu_bacteria 2509276021 2509389276 157
14 iso_pu_bacteria 2509276022 2509392966 157
15 iso_pu_bacteria 2509276033 2509446332 157
16 iso_pu_bacteria 2510065019 2510135384 157
17 iso_pu_bacteria 2510065057 2510305395 157
18 iso_pu_bacteria 2510065059 2510314385 157
19 iso_pu_bacteria 2510461069 2510842809 157
20 iso_pu_bacteria 2510461076 2510896837 157
21 iso_pu_bacteria 2510917022 2511135880 157
22 iso_pu_bacteria 2510917026 2511172729 157
23 iso_pu_bacteria 2510917028 2511182955 157
24 iso_pu_bacteria 2510917030 2511199394 157
25 iso_pu_bacteria 2511231027 2511389492 157
26 iso_pu_bacteria 2511231052 2511498414 157
27 iso_pu_bacteria 2512875016 2512934477 157
28 iso_pu_bacteria 2512875024 2512962826 157
29 iso_pu_bacteria 2512875026 2512973635 157
30 iso_pu_bacteria 2513237084 2513572921 157
31 iso_pu_bacteria 2513237085 2513580454 157
32 iso_pu_bacteria 2513237086 2513586060 157
33 iso_pu_bacteria 2513237088 2513596934 157
34 iso_pu_bacteria 2513237089 2513601846 157
35 iso_pu_bacteria 2513237090 2513609505 157
36 iso_pu_bacteria 2513237091 2513615654 157
37 iso_pu_bacteria 2513237093 2513634957 157
38 iso_pu_bacteria 2513237103 2513711483 157
39 iso_pu_bacteria 2513237138 2513865211 157
40 iso_pu_bacteria 2513237140 2513884231 157
41 iso_pu_bacteria 2513237143 2513903574 157
42 iso_pu_bacteria 2513237144 2513912854 157
43 iso_pu_bacteria 2513237146 2513928649 157
44 iso_pu_bacteria 2513237156 2513984120 157
45 iso_pu_bacteria 2513237159 2513998329 157
46 iso_pu_bacteria 2513237160 2514003570 157
47 iso_pu_bacteria 2513237162 2514019547 157
48 iso_pu_bacteria 2513237164 2514037502 157
49 iso_pu_bacteria 2513237351 2514586367 157
50 iso_pu_bacteria 2515075009 2515114554 157
51 iso_pu_bacteria 2515154107 2515611001 157
52 iso_pu_bacteria 2515154113 2515635029 157
53 iso_pu_bacteria 2515154114 2515644408 157
54 iso_pu_bacteria 2515154116 2515657512 157
55 iso_pu_bacteria 2515154134 2515741735 157
56 iso_pu_bacteria 2516143018 2516205531 157
57 iso_pu_bacteria 2516653046 2516894695 157
58 iso_pu_bacteria 2516653077 2517038195 157
59 iso_pu_bacteria 2516653085 2517078473 157
60 iso_pu_bacteria 2517093000 2517097212 157
61 iso_pu_bacteria 2517287029 2517408398 157
62 iso_pu_bacteria 2517487022 2517571361 157
63 iso_pu_bacteria 2523231067 2523466550 157
64 iso_pu_bacteria 2524023207 2524450495 157
65 iso_pu_bacteria 2524023209 2524461147 157
66 iso_pu_bacteria 2529292951 2530647221 157
67 iso_pu_bacteria 2534681786 2535486529 157
68 iso_pu_bacteria 2534681796 2535519139 157
69 iso_pu_bacteria 2537561587 2537873608 157
70 iso_pu_bacteria 2551306084 2551675848 157
71 iso_pu_bacteria 2551306085 2551689652 157
72 iso_pu_bacteria 2551306086 2551691566 157
73 iso_pu_bacteria 2551306087 2551698009 157
74 iso_pu_bacteria 2551306089 2551711777 157
75 iso_pu_bacteria 2551306090 2551716144 157
76 iso_pu_bacteria 2551306090 2551721422 157
77 iso_pu_bacteria 2551306091 2551731009 157
78 iso_pu_bacteria 2551306092 2551737147 157
79 iso_pu_bacteria 2551306093 2551742054 157
80 iso_pu_bacteria 2554235003 2554248933 157
81 iso_pu_bacteria 2558860100 2558862091 157
82 iso_pu_bacteria 2558860100 2558867351 157
83 iso_pu_bacteria 2558860242 2559296021 157
84 iso_pu_bacteria 2558860983 2561467190 157
85 iso_pu_bacteria 2582581283 2585166549 157
86 iso_pu_bacteria 2582581294 2585201622 157
87 iso_pu_bacteria 2582581298 2585224069 157
88 iso_pu_bacteria 2582581299 2585233479 157
89 iso_pu_bacteria 2582581304 2585257241 157
90 iso_pu_bacteria 2582581306 2585267123 157
91 iso_pu_bacteria 2582581307 2585272031 157
92 iso_pu_bacteria 2582581308 2585279666 157
93 iso_pu_bacteria 2582581315 2585327503 157
94 iso_pu_bacteria 2582581316 2585333960 157
95 iso_pu_bacteria 2582581865 2585388175 157
96 iso_pu_bacteria 2582581866 2585396222 157
97 iso_pu_bacteria 2582581867 2585399866 157
98 iso_pu_bacteria 2585427526 2585529229 157
99 iso_pu_bacteria 2585427527 2585535746 157
100 iso_pu_bacteria 2585427528 2585543045 157
101 iso_pu_bacteria 2585427529 2585549769 157
102 iso_pu_bacteria 2585427530 2585551122 157
103 iso_pu_bacteria 2585427531 2585563424 157
104 iso_pu_bacteria 2585427590 2585820954 157
105 iso_pu_bacteria 2585427593 2585839186 157
106 iso_pu_bacteria 2585427594 2585845002 157
107 iso_pu_bacteria 2585427608 2585897154 157
108 iso_pu_bacteria 2585427609 2585909069 157
109 iso_pu_bacteria 2585427633 2585998041 157
110 iso_pu_bacteria 2585427634 2586002621 157
111 iso_pu_bacteria 2585428125 2587984483 157
112 iso_pu_bacteria 2588253730 2588520647 157
113 iso_pu_bacteria 2597489875 2597810128 157
114 iso_pu_bacteria 2597489875 2597813014 157
115 iso_pu_bacteria 2599185156 2599335805 157
116 iso_pu_bacteria 2599185170 2599419998 157
117 iso_pu_bacteria 2599185210 2599603186 157
118 iso_pu_bacteria 2599185236 2599722606 157
119 iso_pu_bacteria 2599185301 2599935759 157
120 iso_pu_bacteria 2599185352 2600193412 157
121 iso_pu_bacteria 2600254933 2600377406 157
122 iso_pu_bacteria 2600255279 2601610909 157
123 iso_pu_bacteria 2600255308 2601747683 157
124 iso_pu_bacteria 2615840624 2616297454 157
125 iso_pu_bacteria 2615840626 2616306455 157
126 iso_pu_bacteria 2615840698 2616551059 157
127 iso_pu_bacteria 2617270742 2617382292 157
128 iso_pu_bacteria 2643221550 2643770635 157
129 iso_pu_bacteria 2643221551 2643777559 157
130 iso_pu_bacteria 2643221555 2643796007 157
131 iso_pu_bacteria 2643221557 2643808110 157
132 iso_pu_bacteria 2643221558 2643814859 157
133 iso_pu_bacteria 2643221564 2643838225 157
134 iso_pu_bacteria 2643221568 2643854886 157
135 iso_pu_bacteria 2643221580 2643909812 157
136 iso_pu_bacteria 2643221582 2643921545 157
137 iso_pu_bacteria 2643221591 2643965812 157
138 iso_pu_bacteria 2643221595 2643984997 157
139 iso_pu_bacteria 2643221599 2644002575 157
140 iso_pu_bacteria 2643221607 2644052399 157
141 iso_pu_bacteria 2643221610 2644068701 157
142 iso_pu_bacteria 2643221623 2644130433 157
143 iso_pu_bacteria 2643221626 2644150380 157
144 iso_pu_bacteria 2643221627 2644154073 157
145 iso_pu_bacteria 2643221629 2644165825 157
146 iso_pu_bacteria 2643221634 2644194716 157
147 iso_pu_bacteria 2643221636 2644201218 157
148 iso_pu_bacteria 2643221637 2644209630 157
149 iso_pu_bacteria 2643221643 2644240397 157
150 iso_pu_bacteria 2643221653 2644299697 157
151 iso_pu_bacteria 2643221655 2644312984 157
152 iso_pu_bacteria 2643221659 2644336532 157
153 iso_pu_bacteria 2643221662 2644348572 157
154 iso_pu_bacteria 2643221668 2644379544 157
155 iso_pu_bacteria 2643221674 2644413027 157
156 iso_pu_bacteria 2643221675 2644419771 157
157 iso_pu_bacteria 2643221680 2644453128 157
158 iso_pu_bacteria 2643221686 2644484677 157
159 iso_pu_bacteria 2643221688 2644494835 157
160 iso_pu_bacteria 2643221689 2644499457 157
161 iso_pu_bacteria 2643221693 2644521599 157
162 iso_pu_bacteria 2643221698 2644546178 157
163 iso_pu_bacteria 2643221712 2644618714 157
164 iso_pu_bacteria 2643221718 2644653158 157
165 iso_pu_bacteria 2643221719 2644657925 157
166 iso_pu_bacteria 2643221723 2644677138 157
167 iso_pu_bacteria 2643221726 2644688844 157
168 iso_pu_bacteria 2657244999 2657682462 157
169 iso_pu_bacteria 2657244999 2657685729 157
170 iso_pu_bacteria 2667528174 2671116062 157
171 iso_pu_bacteria 2687453392 2688595352 157
172 iso_pu_bacteria 2690316117 2692320003 157
173 iso_pu_bacteria 2693429783 2694630351 157
174 iso_pu_bacteria 2693429784 2694637863 157
175 iso_pu_bacteria 2718217882 2719183090 157
176 iso_pu_bacteria 2718217927 2719387810 157
177 iso_pu_bacteria 2718217997 2719667432 157
178 iso_pu_bacteria 2718218009 2719733807 157
179 iso_pu_bacteria 2718218199 2720493852 157
180 iso_pu_bacteria 2718218232 2720615313 157
181 iso_pu_bacteria 2718218233 2720622101 157
182 iso_pu_bacteria 2718218235 2720633455 157
183 iso_pu_bacteria 2718218269 2720777153 157
184 iso_pu_bacteria 2718218363 2721149202 157
185 iso_pu_bacteria 2718218365 2721160606 157
186 iso_pu_bacteria 2718218366 2721166015 157
187 iso_pu_bacteria 2718218423 2721401443 157
188 iso_pu_bacteria 2721755514 2722842185 157
189 iso_pu_bacteria 2721755556 2723028751 157
190 iso_pu_bacteria 2721755684 2723562364 157
191 iso_pu_bacteria 2721755685 2723569060 157
192 iso_pu_bacteria 2721755686 2723572571 157
193 iso_pu_bacteria 2721755809 2724040257 157
194 iso_pu_bacteria 2721755810 2724046563 157
195 iso_pu_bacteria 2721755819 2724091760 157
196 iso_pu_bacteria 2721755822 2724106325 157
197 iso_pu_bacteria 2721755823 2724112132 157
198 iso_pu_bacteria 2724679232 2725945741 157
199 iso_pu_bacteria 2728369352 2730109687 157
200 iso_pu_bacteria 2728369365 2730166325 157
201 iso_pu_bacteria 2728369397 2730300238 157
202 iso_pu_bacteria 2738541293 2738801084 157
203 iso_pu_bacteria 2738541317 2738946983 157
204 iso_pu_bacteria 2738541333 2739037741 157
205 iso_pu_bacteria 2738543024 2739307613 157
206 iso_pu_bacteria 2738543031 2739348394 157
207 iso_pu_bacteria 2751185800 2753356903 157
208 iso_pu_bacteria 2751185821 2753462509 157
209 iso_pu_bacteria 2756170246 2756674574 157
210 iso_pu_bacteria 2757320392 2757571925 157
211 iso_pu_bacteria 2758568016 2758639225 157
212 iso_pu_bacteria 2765235802 2765466278 157
213 iso_pu_bacteria 2765235942 2766064124 157
214 iso_pu_bacteria 2767802442 2770195654 157
215 iso_pu_bacteria 2775506902 2776271452 157
216 iso_pu_bacteria 2775506904 2776280038 157
217 iso_pu_bacteria 2775507049 2776915497 157
218 iso_pu_bacteria 2775507266 2778179184 157
219 iso_pu_bacteria 2791355082 2792582191 157
220 iso_pu_bacteria 2791355082 2792583738 157
221 iso_pu_bacteria 2791355091 2792621965 157
222 iso_pu_bacteria 2791355092 2792628778 157
223 iso_pu_bacteria 2791355094 2792639911 157
224 iso_pu_bacteria 2791355123 2792746549 157
225 iso_pu_bacteria 2791355253 2793281802 157
226 iso_pu_bacteria 2791355256 2793295503 157
227 iso_pu_bacteria 2791355259 2793317608 157
228 iso_pu_bacteria 2791355260 2793320849 157
229 iso_pu_bacteria 2791355261 2793327418 157
230 iso_pu_bacteria 2791355262 2793332363 157
231 iso_pu_bacteria 2791355263 2793338957 157
232 iso_pu_bacteria 2791355264 2793346727 157
233 iso_pu_bacteria 2791355265 2793356101 157
234 iso_pu_bacteria 2791355266 2793359246 157
235 iso_pu_bacteria 2791355267 2793366031 157
236 iso_pu_bacteria 2802428858 2802717271 157
237 iso_pu_bacteria 2802428859 2802724739 157
238 iso_pu_bacteria 2802428860 2802729491 157
239 iso_pu_bacteria 2802428861 2802736837 157
240 iso_pu_bacteria 2802428862 2802743242 157
241 iso_pu_bacteria 2802428863 2802749632 157
242 iso_pu_bacteria 2802429268 2804753647 157
243 iso_pu_bacteria 2802429268 2804755007 157
244 iso_pu_bacteria 2802429605 2805926338 157
245 iso_pu_bacteria 2802429633 2806047715 157
246 iso_pu_bacteria 2802429634 2806055291 157
247 iso_pu_bacteria 2802429635 2806062172 157
248 iso_pu_bacteria 2802429636 2806070069 157
249 iso_pu_bacteria 2802429637 2806076631 157
250 iso_pu_bacteria 2808606387 2808988153 157
251 iso_pu_bacteria 2818991272 2819244473 157
252 iso_pu_bacteria 2818991439 2819561031 157
253 iso_pu_bacteria 2818991448 2819611939 157
254 iso_pu_bacteria 2818991453 2819638522 157
255 iso_pu_bacteria 2818991461 2819688326 157
256 iso_pu_bacteria 2821123053 2821129254 157
257 iso_pu_bacteria 2837651117 2837651560 157
258 iso_pu_bacteria 2838016132 2838018197 157
259 iso_pu_bacteria 2838022645 2838023877 157
260 iso_pu_bacteria 2838029111 2838034201 157
261 iso_pu_bacteria 2838035591 2838040205 157
262 iso_pu_bacteria 2838042994 2838046711 157
263 iso_pu_bacteria 2838048938 2838050944 157
264 iso_pu_bacteria 2838061910 2838062711 157
265 iso_pu_bacteria 2838068647 2838072256 157
266 iso_pu_bacteria 2838074704 2838078227 157
267 iso_pu_bacteria 2838661181 2838667021 157
268 iso_pu_bacteria 2838668709 2838672292 157
269 iso_pu_bacteria 2838680041 2838683749 157
270 iso_pu_bacteria 2838686498 2838693305 157
271 iso_pu_bacteria 2838694306 2838698277 157
272 iso_pu_bacteria 2838701080 2838704839 157
273 iso_pu_bacteria 2838707686 2838711392 157
274 iso_pu_bacteria 2838714209 2838718313 157
275 iso_pu_bacteria 2838719591 2838722895 157
276 iso_pu_bacteria 2838729681 2838735299 157
277 iso_pu_bacteria 2838736955 2838742121 157
278 iso_pu_bacteria 2838742623 2838748152 157
279 iso_pu_bacteria 2839993093 2839995491 157
280 iso_pu_bacteria 2840764183 2840768100 157
281 iso_pu_bacteria 2841734538 2841735820 157
282 iso_pu_bacteria 2841840854 2841845977 157
283 iso_pu_bacteria 2841846520 2841850451 157
284 iso_pu_bacteria 2841851746 2841857371 157
285 iso_pu_bacteria 2841859092 2841863296 157
286 iso_pu_bacteria 2841864319 2841867624 157
287 iso_pu_bacteria 2842077413 2842081193 157
288 iso_pu_bacteria 2842110456 2842116555 157
289 iso_pu_bacteria 2842118031 2842122030 157
290 iso_pu_bacteria 2842124991 2842129039 157
291 iso_pu_bacteria 2842130223 2842133492 157
292 iso_pu_bacteria 2842140634 2842145658 157
293 iso_pu_bacteria 2842146304 2842148925 157
294 iso_pu_bacteria 2842152218 2842155597 157
295 iso_pu_bacteria 2842156927 2842162454 157
296 iso_pu_bacteria 2842163707 2842166845 157
297 iso_pu_bacteria 2842170452 2842174445 157
298 iso_pu_bacteria 2842175837 2842179106 157
299 iso_pu_bacteria 2842180545 2842186094 157
300 iso_pu_bacteria 2842187318 2842190737 157
301 iso_pu_bacteria 2842192696 2842194755 157
302 iso_pu_bacteria 2842198810 2842201231 157
303 iso_pu_bacteria 2842205361 2842207546 157
304 iso_pu_bacteria 2842211629 2842214939 157
305 iso_pu_bacteria 2842217011 2842221917 157
306 iso_pu_bacteria 2842224351 2842227660 157
307 iso_pu_bacteria 2842229732 2842235553 157
308 iso_pu_bacteria 2842237096 2842241044 157
309 iso_pu_bacteria 2842243621 2842249164 157
310 iso_pu_bacteria 2842250916 2842254520 157
311 iso_pu_bacteria 2842257432 2842263119 157
312 iso_pu_bacteria 2842264693 2842269315 157
313 iso_pu_bacteria 2842271015 2842277773 157
314 iso_pu_bacteria 2842278818 2842280743 157
315 iso_pu_bacteria 2842285085 2842288646 157
316 iso_pu_bacteria 2842291075 2842294850 157
317 iso_pu_bacteria 2842304105 2842305684 157
318 iso_pu_bacteria 2842311132 2842311548 157
319 iso_pu_bacteria 2842317721 2842321236 157
320 iso_pu_bacteria 2842341865 2842346828 157
321 iso_pu_bacteria 2842363717 2842366139 157
322 iso_pu_bacteria 2842370503 2842375132 157
323 iso_pu_bacteria 2842377471 2842381249 157
324 iso_pu_bacteria 2842384541 2842388319 157
325 iso_pu_bacteria 2842395702 2842395808 157
326 iso_pu_bacteria 2842402390 2842406008 157
327 iso_pu_bacteria 2842409023 2842412592 157
328 iso_pu_bacteria 2842415677 2842419529 157
329 iso_pu_bacteria 2842422224 2842425888 157
330 iso_pu_bacteria 2842428310 2842433401 157
331 iso_pu_bacteria 2842434925 2842439544 157
332 iso_pu_bacteria 2842441272 2842446148 157
333 iso_pu_bacteria 2842447887 2842448614 157
334 iso_pu_bacteria 2842462802 2842467650 157
335 iso_pu_bacteria 2842469257 2842474386 157
336 iso_pu_bacteria 2842475841 2842480947 157
337 iso_pu_bacteria 2842482326 2842485245 157
338 iso_pu_bacteria 2842489311 2842491303 157
339 iso_pu_bacteria 2842495871 2842498627 157
340 iso_pu_bacteria 2842515876 2842519967 157
341 iso_pu_bacteria 2842521101 2842524644 157
342 iso_pu_bacteria 2842871566 2842872693 157
343 iso_pu_bacteria 2842922631 2842926407 157
344 iso_pu_bacteria 2844002411 2844004135 157
345 iso_pu_bacteria 2844009547 2844010074 157
346 iso_pu_bacteria 2844163670 2844164307 157
347 iso_pu_bacteria 2844454524 2844456846 157
348 iso_pu_bacteria 2847417321 2847420773 157
349 iso_pu_bacteria 2847670302 2847672948 157
350 iso_pu_bacteria 2847686936 2847689427 157
351 iso_pu_bacteria 2848992105 2848995601 157
352 iso_pu_bacteria 2850079185 2850085523 157
353 iso_pu_bacteria 2852387548 2852392064 157
354 iso_pu_bacteria 2854896431 2854897699 157
355 iso_pu_bacteria 2854911287 2854916578 157
356 iso_pu_bacteria 2854916844 2854922278 157
357 iso_pu_bacteria 2855825444 2855827322 157
358 iso_pu_bacteria 2855839649 2855842703 157
359 iso_pu_bacteria 2855872281 2855878138 157
360 iso_pu_bacteria 2856314179 2856320020 157
361 iso_pu_bacteria 2856320880 2856327882 157
362 iso_pu_bacteria 2856328259 2856332055 157
363 iso_pu_bacteria 2856334872 2856334879 157
364 iso_pu_bacteria 2856342000 2856345424 157
365 iso_pu_bacteria 2856349417 2856351348 157
366 iso_pu_bacteria 2856356410 2856358676 157
367 iso_pu_bacteria 2856364286 2856371232 157
368 iso_pu_bacteria 2857349434 2857354326 157
369 iso_pu_bacteria 2857367948 2857367997 157
370 iso_pu_bacteria 2857516855 2857519720 157
371 iso_pu_bacteria 2857531043 2857536195 157
372 iso_pu_bacteria 2858800743 2858803514 157
373 iso_pu_bacteria 2869162929 2869169165 157
374 iso_pu_bacteria 2869169390 2869171084 157
375 iso_pu_bacteria 2869234852 2869235944 157
376 iso_pu_bacteria 2869242130 2869244284 157
377 iso_pu_bacteria 2869249662 2869252357 157
378 iso_pu_bacteria 2869256925 2869263774 157
379 iso_pu_bacteria 2869264136 2869264357 157
380 iso_pu_bacteria 2869271264 2869273068 157
381 iso_pu_bacteria 2869278585 2869279832 157
382 iso_pu_bacteria 2869285874 2869292455 157
383 iso_pu_bacteria 2871429161 2871429270 157
384 iso_pu_bacteria 2871435913 2871437894 157
385 iso_pu_bacteria 2871444079 2871451728 157
386 iso_pu_bacteria 2871451962 2871459233 157
387 iso_pu_bacteria 2871459585 2871460437 157
388 iso_pu_bacteria 2871466892 2871470034 157
389 iso_pu_bacteria 2871474448 2871475843 157
390 iso_pu_bacteria 2871481445 2871484492 157
391 iso_pu_bacteria 2871488783 2871490791 157
392 iso_pu_bacteria 2871495908 2871499364 157
393 iso_pu_bacteria 2874102143 2874106365 157
394 iso_pu_bacteria 2874109183 2874112564 157
395 iso_pu_bacteria 2874116593 2874123573 157
396 iso_pu_bacteria 2874123672 2874129530 157
397 iso_pu_bacteria 2874131515 2874134877 157
398 iso_pu_bacteria 2874139085 2874145676 157
399 iso_pu_bacteria 2874146452 2874154176 157
400 iso_pu_bacteria 2874155637 2874161678 157
401 iso_pu_bacteria 2874162495 2874162581 157
402 iso_pu_bacteria 2874168670 2874171746 157
403 iso_pu_bacteria 2876363079 2876363261 157
404 iso_pu_bacteria 2876369609 2876372724 157
405 iso_pu_bacteria 2876377896 2876384940 157
406 iso_pu_bacteria 2876386047 2876391953 157
407 iso_pu_bacteria 2876392853 2876392939 157
408 iso_pu_bacteria 2876399893 2876399954 157
409 iso_pu_bacteria 2876406927 2876410545 157
410 iso_pu_bacteria 2876413966 2876419860 157
411 iso_pu_bacteria 2876420981 2876424965 157
412 iso_pu_bacteria 2878035449 2878035556 157
413 iso_pu_bacteria 2878730984 2878737255 157
414 iso_pu_bacteria 2878738818 2878740326 157
415 iso_pu_bacteria 2878745973 2878752798 157
416 iso_pu_bacteria 2878753008 2878755196 157
417 iso_pu_bacteria 2878760144 2878763554 157
418 iso_pu_bacteria 2878767105 2878770552 157
419 iso_pu_bacteria 2878774303 2878775235 157
420 iso_pu_bacteria 2878781027 2878786743 157
421 iso_pu_bacteria 2881147464 2881147603 157
422 iso_pu_bacteria 2881155292 2881158706 157
423 iso_pu_bacteria 2881161766 2881164380 157
424 iso_pu_bacteria 2881845957 2881852005 157
425 iso_pu_bacteria 2881853255 2881860014 157
426 iso_pu_bacteria 2881861095 2881863435 157
427 iso_pu_bacteria 2882632389 2882632783 157
428 iso_pu_bacteria 2882912400 2882913652 157
429 iso_pu_bacteria 2885305155 2885306240 157
430 iso_pu_bacteria 2885312484 2885314710 157
431 iso_pu_bacteria 2885318864 2885321230 157
432 iso_pu_bacteria 2885326080 2885329850 157
433 iso_pu_bacteria 2885334103 2885335622 157
434 iso_pu_bacteria 2885342637 2885345745 157
435 iso_pu_bacteria 2885350715 2885351930 157
436 iso_pu_bacteria 2888337043 2888342687 157
437 iso_pu_bacteria 2888343758 2888343797 157
438 iso_pu_bacteria 2888350351 2888352265 157
439 iso_pu_bacteria 2889010040 2889014249 157
440 iso_pu_bacteria 2889016732 2889021040 157
441 iso_pu_bacteria 2889790730 2889792718 157
442 iso_pu_bacteria 2889914905 2889916224 157
443 iso_pu_bacteria 2891048133 2891048221 157
444 iso_pu_bacteria 2891373044 2891377823 157
445 iso_pu_bacteria 2894652903 2894654397 157
446 iso_pu_bacteria 2896384573 2896390257 157
447 iso_pu_bacteria 2899792073 2899795393 157
448 iso_pu_bacteria 2899803654 2899807956 157
449 iso_pu_bacteria 2903448605 2903454664 157
450 iso_pu_bacteria 2903492973 2903494897 157
451 iso_pu_bacteria 2903492973 2903499324 157
452 iso_pu_bacteria 2903513507 2903518412 157
453 iso_pu_bacteria 2903521522 2903525211 157
454 iso_pu_bacteria 2903528002 2903532044 157
455 iso_pu_bacteria 2903540706 2903544169 157
456 iso_pu_bacteria 2904578770 2904583137 157
457 iso_pu_bacteria 2904659560 2904659645 157
458 iso_pu_bacteria 2906308376 2906315189 157
459 iso_pu_bacteria 2906321335 2906321445 157
460 iso_pu_bacteria 2906328253 2906334562 157
461 iso_pu_bacteria 2906354277 2906359558 157
462 iso_pu_bacteria 2906363423 2906366287 157
463 iso_pu_bacteria 2906370794 2906374484 157
464 iso_pu_bacteria 2906378014 2906381280 157
465 iso_pu_bacteria 2906386501 2906387095 157
466 iso_pu_bacteria 2906393657 2906399016 157
467 iso_pu_bacteria 2906401398 2906404600 157
468 iso_pu_bacteria 2906408224 2906412498 157
469 iso_pu_bacteria 2906414383 2906420796 157
470 iso_pu_bacteria 2906427513 2906434988 157
471 iso_pu_bacteria 2913295892 2913296387 157
472 iso_pu_bacteria 2913295892 2913297022 157
473 iso_pu_bacteria 2913308742 2913312192 157
474 iso_pu_bacteria 2915650412 2915652526 157
475 iso_pu_bacteria 2915980308 2915982485 157
476 iso_pu_bacteria 2915986958 2915992914 157
477 iso_pu_bacteria 2915993759 2915996523 157
478 iso_pu_bacteria 2916000859 2916001915 157
479 iso_pu_bacteria 2916007675 2916013320 157
480 iso_pu_bacteria 2916014648 2916018299 157
481 iso_pu_bacteria 2916021584 2916024360 157
482 iso_pu_bacteria 2916028427 2916031276 157
483 iso_pu_bacteria 2916035215 2916037701 157
484 iso_pu_bacteria 2916041962 2916045978 157
485 iso_pu_bacteria 2916048683 2916051691 157
486 iso_pu_bacteria 2916055098 2916058466 157
487 iso_pu_bacteria 2916061851 2916065072 157
488 iso_pu_bacteria 2916068649 2916076216 157
489 iso_pu_bacteria 2916076590 2916079601 157
490 iso_pu_bacteria 2917554339 2917558227 157
491 iso_pu_bacteria 2919100787 2919107903 157
492 iso_pu_bacteria 2919114240 2919118430 157
493 iso_pu_bacteria 2919119836 2919123751 157
494 iso_pu_bacteria 2919171160 2919176919 157
495 iso_pu_bacteria 2919408235 2919411420 157
496 iso_pu_bacteria 2920760137 2920760382 157
497 iso_pu_bacteria 2920822456 2920825885 157
498 iso_pu_bacteria 2921201388 2921201930 157
499 iso_pu_bacteria 2921208531 2921210979 157
500 iso_pu_bacteria 2921237296 2921239878 157
501 iso_pu_bacteria 2921244191 2921245865 157
502 iso_pu_bacteria 2921250672 2921254497 157
503 iso_pu_bacteria 2921257292 2921259077 157
504 iso_pu_bacteria 2921263974 2921267058 157
505 iso_pu_bacteria 2921282425 2921285616 157
506 iso_pu_bacteria 2921289301 2921290302 157
507 iso_pu_bacteria 2921296804 2921303309 157
508 iso_pu_bacteria 2922130491 2922133413 157
509 iso_pu_bacteria 2922151315 2922157722 157
510 iso_pu_bacteria 2922158528 2922165046 157
511 iso_pu_bacteria 2922172374 2922178226 157
512 iso_pu_bacteria 2922178524 2922183584 157
513 iso_pu_bacteria 2922185730 2922186870 157
514 iso_pu_bacteria 2923556063 2923560647 157
515 iso_pu_bacteria 2924144063 2924146678 157
516 iso_pu_bacteria 2924150972 2924155520 157
517 iso_pu_bacteria 2924158325 2924161637 157
518 iso_pu_bacteria 2924165586 2924169965 157
519 iso_pu_bacteria 2924172951 2924177277 157
520 iso_pu_bacteria 2924179722 2924180181 157
521 iso_pu_bacteria 2924186466 2924192461 157
522 iso_pu_bacteria 2924193448 2924193654 157
523 iso_pu_bacteria 2924200457 2924201838 157
524 iso_pu_bacteria 2924207177 2924210245 157
525 iso_pu_bacteria 2924214083 2924219596 157
526 iso_pu_bacteria 2924221636 2924226132 157
527 iso_pu_bacteria 2924228884 2924231723 157
528 iso_pu_bacteria 2924710171 2924717480 157
529 iso_pu_bacteria 2924718760 2924718809 157
530 iso_pu_bacteria 2924726620 2924732855 157
531 iso_pu_bacteria 2924733363 2924734305 157
532 iso_pu_bacteria 2924741084 2924743422 157
533 iso_pu_bacteria 2924748358 2924754388 157
534 iso_pu_bacteria 2924754689 2924758483 157
535 iso_pu_bacteria 2924762789 2924767688 157
536 iso_pu_bacteria 2924776078 2924777926 157
537 iso_pu_bacteria 2924784321 2924791416 157
538 iso_pu_bacteria 2926754445 2926754959 157
539 iso_pu_bacteria 2926760298 2926762124 157
540 iso_pu_bacteria 2928521798 2928523294 157
541 iso_pu_bacteria 2932401849 2932401852 157
542 iso_pu_bacteria 2933006813 2933010556 157
543 iso_pu_bacteria 2933011516 2933015772 157
544 iso_pu_bacteria 2933016740 2933018596 157
545 iso_pu_bacteria 2933570622 2933572190 157
546 iso_pu_bacteria 2933586486 2933592838 157
547 iso_pu_bacteria 2933594066 2933597490 157
548 iso_pu_bacteria 2933599457 2933602892 157
549 iso_pu_bacteria 2935894831 2935898071 157
550 iso_pu_bacteria 2935901341 2935903487 157
551 iso_pu_bacteria 2936367885 2936370039 157
552 iso_pu_bacteria 2936375103 2936379215 157
553 iso_pu_bacteria 2936381700 2936381809 157
554 iso_pu_bacteria 2936996657 2936997520 157
555 iso_pu_bacteria 2937002841 2937006780 157
556 iso_pu_bacteria 2937009748 2937013714 157
557 iso_pu_bacteria 2937016420 2937019069 157
558 iso_pu_bacteria 2937023124 2937025960 157
559 iso_pu_bacteria 2937029754 2937031914 157
560 iso_pu_bacteria 2937036028 2937036156 157
561 iso_pu_bacteria 2937042894 2937043988 157
562 iso_pu_bacteria 2937049772 2937051187 157
563 iso_pu_bacteria 2937056579 2937062134 157
564 iso_pu_bacteria 2937063883 2937067715 157
565 iso_pu_bacteria 2937071275 2937072733 157
566 iso_pu_bacteria 2937084907 2937087663 157
567 iso_pu_bacteria 2937091812 2937093944 157
568 iso_pu_bacteria 2937098957 2937101019 157
569 iso_pu_bacteria 2937106411 2937112636 157
570 iso_pu_bacteria 2937113482 2937116054 157
571 iso_pu_bacteria 2937119839 2937123198 157
572 iso_pu_bacteria 2937126314 2937127799 157
573 iso_pu_bacteria 2937813078 2937821731 157
574 iso_pu_bacteria 2937822353 2937826003 157
575 iso_pu_bacteria 2937836603 2937839113 157
576 iso_pu_bacteria 2937843397 2937843413 157
577 iso_pu_bacteria 2937848649 2937849845 157
578 iso_pu_bacteria 2937861824 2937863293 157
579 iso_pu_bacteria 2937868953 2937871093 157
580 iso_pu_bacteria 2937877337 2937884488 157
581 iso_pu_bacteria 2937891427 2937896008 157
582 iso_pu_bacteria 2937972304 2937980511 157
583 iso_pu_bacteria 2937980651 2937984911 157
584 iso_pu_bacteria 2937994558 2937998014 157
585 iso_pu_bacteria 2938014810 2938015674 157
586 iso_pu_bacteria 2941499720 2941501305 157
587 iso_pu_bacteria 2954011201 2954015567 157
588 iso_pu_bacteria 2957375807 2957381886 157
589 iso_pu_bacteria 2957382221 2957384633 157
590 iso_pu_bacteria 2957388812 2957391403 157
591 iso_pu_bacteria 2957395598 2957400473 157
592 iso_pu_bacteria 2957402308 2957404373 157
593 iso_pu_bacteria 2957408893 2957411881 157
594 iso_pu_bacteria 2957415311 2957416654 157
595 iso_pu_bacteria 2957422303 2957423804 157
596 iso_pu_bacteria 2957430029 2957434615 157
597 iso_pu_bacteria 2957437181 2957442143 157
598 iso_pu_bacteria 2957443900 2957447863 157
599 iso_pu_bacteria 2957450854 2957455085 157
600 iso_pu_bacteria 2957457609 2957461278 157
601 iso_pu_bacteria 2957464669 2957470863 157
602 iso_pu_bacteria 2957471148 2957471506 157
603 iso_pu_bacteria 2957478035 2957481738 157
604 iso_pu_bacteria 2957484790 2957490355 157
605 iso_pu_bacteria 2957491536 2957494190 157
606 iso_pu_bacteria 2957498199 2957503019 157
607 iso_pu_bacteria 2957505466 2957510168 157
608 iso_pu_bacteria 2958034702 2958035699 157
609 iso_pu_bacteria 2958041894 2958044730 157
610 iso_pu_bacteria 2958071322 2958076315 157
611 iso_pu_bacteria 2958084443 2958091799 157
612 iso_pu_bacteria 2958092219 2958095778 157
613 iso_pu_bacteria 2958100919 2958104155 157
614 iso_pu_bacteria 2958108152 2958108521 157
615 iso_pu_bacteria 2958115193 2958119685 157
616 iso_pu_bacteria 2958122699 2958129248 157
617 iso_pu_bacteria 2958130278 2958136855 157
618 iso_pu_bacteria 2958137437 2958140661 157
619 iso_pu_bacteria 2958144490 2958147288 157
620 iso_pu_bacteria 2958158011 2958159403 157
621 iso_pu_bacteria 2958165035 2958168489 157
622 iso_pu_bacteria 2958172287 2958175592 157
623 iso_pu_bacteria 2958179912 2958186738 157
624 iso_pu_bacteria 2960584000 2960590370 157
625 iso_pu_bacteria 2960591022 2960592179 157
626 iso_pu_bacteria 2960597568 2960599251 157
627 iso_pu_bacteria 2960603979 2960609709 157
628 iso_pu_bacteria 2960610863 2960613210 157
629 iso_pu_bacteria 2960617483 2960622253 157
630 iso_pu_bacteria 2960624210 2960626926 157
631 iso_pu_bacteria 2960631154 2960633459 157
632 iso_pu_bacteria 2960637947 2960642427 157
633 iso_pu_bacteria 2960645483 2960650266 157
634 iso_pu_bacteria 2960652885 2960658762 157
635 iso_pu_bacteria 2960660292 2960664328 157
636 iso_pu_bacteria 2960667422 2960671952 157
637 iso_pu_bacteria 2960674078 2960674677 157
638 iso_pu_bacteria 2960680706 2960682286 157
639 iso_pu_bacteria 2960687367 2960692719 157
640 iso_pu_bacteria 2960693952 2960700830 157
641 iso_pu_bacteria 2961077736 2961085239 157
642 iso_pu_bacteria 2961114664 2961114969 157
643 iso_pu_bacteria 2961127735 2961131925 157
644 iso_pu_bacteria 2961136820 2961141182 157
645 iso_pu_bacteria 2961163497 2961166953 157
646 iso_pu_bacteria 2961170736 2961176762 157
647 iso_pu_bacteria 2961183825 2961190055 157
648 iso_pu_bacteria 2963644680 2963644721 157
649 iso_pu_bacteria 2964607997 2964608574 157
650 iso_pu_bacteria 2964615318 2964615759 157
651 iso_pu_bacteria 2964621998 2964624757 157
652 iso_pu_bacteria 2964628898 2964633322 157
653 iso_pu_bacteria 2964636051 2964639838 157
654 iso_pu_bacteria 2964643177 2964645870 157
655 iso_pu_bacteria 2964649959 2964654161 157
656 iso_pu_bacteria 2964656573 2964662858 157
657 iso_pu_bacteria 2964663802 2964669081 157
658 iso_pu_bacteria 2964670856 2964675945 157
659 iso_pu_bacteria 2964678106 2964683122 157
660 iso_pu_bacteria 2964685014 2964688828 157
661 iso_pu_bacteria 2964691889 2964694581 157
662 iso_pu_bacteria 2964698721 2964701329 157
663 iso_pu_bacteria 2964705432 2964707945 157
664 iso_pu_bacteria 2964712639 2964712829 157
665 iso_pu_bacteria 2964719344 2964725004 157
666 iso_pu_bacteria 2965018300 2965021777 157
667 iso_pu_bacteria 2965025482 2965028863 157
668 iso_pu_bacteria 2965032056 2965034912 157
669 iso_pu_bacteria 2965040258 2965044199 157
670 iso_pu_bacteria 2965047637 2965050517 157
671 iso_pu_bacteria 2965062239 2965066105 157
672 iso_pu_bacteria 2965089291 2965090678 157
673 iso_pu_bacteria 2965102966 2965107155 157
674 iso_pu_bacteria 2965110997 2965116399 157
675 iso_pu_bacteria 2965119406 2965120197 157
676 iso_pu_bacteria 2967664464 2967667762 157
677 iso_pu_bacteria 2967671571 2967678503 157
678 iso_pu_bacteria 2967678726 2967679090 157
679 iso_pu_bacteria 2967686174 2967690304 157
680 iso_pu_bacteria 2967693043 2967695411 157
681 iso_pu_bacteria 2967699805 2967700928 157
682 iso_pu_bacteria 2967706974 2967711373 157
683 iso_pu_bacteria 2967714385 2967718905 157
684 iso_pu_bacteria 2967721400 2967727732 157
685 iso_pu_bacteria 2967728569 2967732022 157
686 iso_pu_bacteria 2967735183 2967739061 157
687 iso_pu_bacteria 2967742019 2967747168 157
688 iso_pu_bacteria 2967748971 2967752528 157
689 iso_pu_bacteria 2967755722 2967759852 157
690 iso_pu_bacteria 2967762386 2967764381 157
691 iso_pu_bacteria 2967769361 2967772845 157
692 iso_pu_bacteria 2967775926 2967776619 157
693 iso_pu_bacteria 2967996073 2968001129 157
694 iso_pu_bacteria 2968003550 2968007182 157
695 iso_pu_bacteria 2968016561 2968021612 157
696 iso_pu_bacteria 2968083720 2968089003 157
697 iso_pu_bacteria 2968091066 2968094108 157
698 iso_pu_bacteria 2968097103 2968100700 157
699 iso_pu_bacteria 2968110612 2968110697 157
700 iso_pu_bacteria 2968117919 2968121577 157
701 iso_pu_bacteria 2968128360 2968131316 157
702 iso_pu_bacteria 2968138860 2968142442 157
703 iso_pu_bacteria 2968171901 2968175359 157
704 iso_pu_bacteria 2970019648 2970025972 157
705 iso_pu_bacteria 2970026789 2970029905 157
706 iso_pu_bacteria 2970033650 2970039645 157
707 iso_pu_bacteria 2970040964 2970045120 157
708 iso_pu_bacteria 2970047711 2970048531 157
709 iso_pu_bacteria 2970054988 2970059391 157
710 iso_pu_bacteria 2970061556 2970068190 157
711 iso_pu_bacteria 2970068827 2970076034 157
712 iso_pu_bacteria 2970076120 2970078815 157
713 iso_pu_bacteria 2970082768 2970086332 157
714 iso_pu_bacteria 2970088815 2970093684 157
715 iso_pu_bacteria 2970095765 2970096467 157
716 iso_pu_bacteria 2970102677 2970105299 157
717 iso_pu_bacteria 2970109326 2970114168 157
718 iso_pu_bacteria 2970116247 2970116771 157
719 iso_pu_bacteria 2970122695 2970123900 157
720 iso_pu_bacteria 2970129317 2970133690 157
721 iso_pu_bacteria 2970136068 2970138198 157
722 iso_pu_bacteria 2970143518 2970143658 157
723 iso_pu_bacteria 2970149975 2970153404 157
724 iso_pu_bacteria 2970156795 2970157717 157
725 iso_pu_bacteria 2970164137 2970167250 157
726 iso_pu_bacteria 2970170962 2970174975 157
727 iso_pu_bacteria 2970177841 2970178200 157
728 iso_pu_bacteria 2970184632 2970190424 157
729 iso_pu_bacteria 2970191845 2970196526 157
730 iso_pu_bacteria 2970469710 2970476709 157
731 iso_pu_bacteria 2970489779 2970494167 157
732 iso_pu_bacteria 2970503327 2970509435 157
733 iso_pu_bacteria 2970510686 2970514247 157
734 iso_pu_bacteria 2970524798 2970525502 157
735 iso_pu_bacteria 2970532167 2970536091 157
736 iso_pu_bacteria 2970540015 2970541670 157
737 iso_pu_bacteria 2970547951 2970553776 157
738 iso_pu_bacteria 2970554993 2970558397 157
739 iso_pu_bacteria 2970593180 2970594431 157
740 iso_pu_bacteria 2970619444 2970626483 157
741 iso_pu_bacteria 2970627176 2970627681 157
742 iso_pu_bacteria 2977516862 2977518745 157
743 iso_pu_bacteria 2977523885 2977525479 157
744 iso_pu_bacteria 2977537788 2977540315 157
745 iso_pu_bacteria 2977544691 2977550684 157
746 iso_pu_bacteria 2977551784 2977553258 157
747 iso_pu_bacteria 2977558990 2977562853 157
748 iso_pu_bacteria 2977565890 2977570346 157
749 iso_pu_bacteria 2977572785 2977577499 157
750 iso_pu_bacteria 2977579622 2977585553 157
751 iso_pu_bacteria 2977821940 2977824336 157
752 iso_pu_bacteria 2977828996 2977831813 157
753 iso_pu_bacteria 2977843712 2977850044 157
754 iso_pu_bacteria 2977851361 2977855058 157
755 iso_pu_bacteria 2977858184 2977862938 157
756 iso_pu_bacteria 2977864932 2977868325 157
757 iso_pu_bacteria 2977872689 2977880004 157
758 iso_pu_bacteria 2977898635 2977903646 157
759 iso_pu_bacteria 2977907340 2977907453 157
760 iso_pu_bacteria 2977915119 2977915856 157
761 iso_pu_bacteria 2977922695 2977925104 157
762 iso_pu_bacteria 2977935797 2977940488 157
763 iso_pu_bacteria 2977942078 2977943658 157
764 iso_pu_bacteria 2977950692 2977953074 157
765 iso_pu_bacteria 2977957713 2977961243 157
766 iso_pu_bacteria 2977971508 2977979106 157
767 iso_pu_bacteria 2977986579 2977987547 157
768 iso_pu_bacteria 2979100975 2979104578 157
769 iso_pu_bacteria 2979710463 2979715500 157
770 iso_pu_bacteria 2979742915 2979742987 157
771 iso_pu_bacteria 2979764755 2979772150 157
772 iso_pu_bacteria 2979772303 2979773350 157
773 iso_pu_bacteria 2979779861 2979782383 157
774 iso_pu_bacteria 2979793036 2979795789 157
775 iso_pu_bacteria 2979808191 2979814222 157
776 iso_pu_bacteria 2984509177 2984513625 157
777 iso_pu_bacteria 2984518228 2984522794 157
778 iso_pu_bacteria 2984537506 2984542101 157
779 iso_pu_bacteria 2984601300 2984601531 157
780 iso_pu_bacteria 2987636660 2987642264 157
781 iso_pu_bacteria 2987645492 2987648518 157
782 iso_pu_bacteria 2987652177 2987658161 157
783 iso_pu_bacteria 2987659509 2987662965 157
784 iso_pu_bacteria 2987666974 2987668413 157
785 iso_pu_bacteria 2987673487 2987680091 157
786 iso_pu_bacteria 2989349275 2989355043 157
787 iso_pu_bacteria 2989771324 2989771722 157
788 iso_pu_bacteria 2989776772 2989780242 157
789 iso_pu_bacteria 2995392953 2995395580 157
790 iso_pu_bacteria 2996310559 2996311532 157
791 iso_pu_bacteria 2996336353 2996341532 157
792 iso_pu_bacteria 2996341866 2996346123 157
793 iso_pu_bacteria 2996348954 2996356133 157
794 iso_pu_bacteria 2996386984 2996393699 157
795 iso_pu_bacteria 2996887358 2996890364 157
796 iso_pu_bacteria 2996893221 2996896136 157
797 iso_pu_bacteria 3000135777 3000135921 157
798 iso_pu_bacteria 3002141150 3002143850 157
799 iso_pu_bacteria 3003930520 3003931104 157
800 iso_pu_bacteria 3004167301 3004172527 157
801 iso_pu_bacteria 3004188549 3004192017 157
802 iso_pu_bacteria 3004195979 3004197980 157
803 iso_pu_bacteria 3004203850 3004210350 157
804 iso_pu_bacteria 3004211236 3004216708 157
805 iso_pu_bacteria 3004218560 3004219741 157
806 iso_pu_bacteria 3004239961 3004241110 157
807 iso_pu_bacteria 3004248173 3004253180 157
808 iso_pu_bacteria 3004268573 3004269528 157
809 iso_pu_bacteria 3004275668 3004282447 157
810 iso_pu_bacteria 3004289098 3004293536 157
811 iso_pu_bacteria 3004334049 3004338078 157
812 iso_pu_bacteria 3005409236 3005415925 157
813 iso_pu_bacteria 3005416602 3005416922 157
814 iso_pu_bacteria 3005452660 3005456059 157
815 iso_pu_bacteria 637000159 637077648 157
816 iso_pu_bacteria 639633055 639650572 157
817 iso_pu_bacteria 648276728 648737144 157
818 iso_pu_bacteria 649633066 649869913 157
819 iso_pu_bacteria 650716007 650741237 157
820 iso_pu_bacteria 8002285264 8002290775 157
821 iso_pu_bacteria 8003570095 8003573702 157
822 iso_pu_bacteria 8003992118 8003995285 157
823 iso_pu_bacteria 8003999396 8004003023 157
824 iso_pu_bacteria 8004300914 8004302414 157
825 iso_pu_bacteria 8004312739 8004317300 157
826 iso_pu_bacteria 8004361976 8004365270 157
827 iso_pu_bacteria 8004374579 8004376775 157
828 iso_pu_bacteria 8004387939 8004395129 157
829 iso_pu_bacteria 8004395343 8004398159 157
830 iso_pu_bacteria 8004445564 8004451352 157
831 iso_pu_bacteria 8004633249 8004634624 157
832 iso_pu_bacteria 8004640170 8004646931 157
833 iso_pu_bacteria 8004695233 8004697081 157
834 iso_pu_bacteria 8004703790 8004707269 157
835 iso_pu_bacteria 8004714634 8004721450 157
836 iso_pu_bacteria 8004727605 8004729237 157
837 iso_pu_bacteria 8005246636 8005249403 157
838 iso_pu_bacteria 8005258706 8005262547 157
839 iso_pu_bacteria 8005275841 8005282568 157
840 iso_pu_bacteria 8005282627 8005286617 157
841 iso_pu_bacteria 8005289223 8005295213 157
842 iso_pu_bacteria 8005301065 8005306089 157
843 iso_pu_bacteria 8005307578 8005309659 157
844 iso_pu_bacteria 8005314921 8005315874 157
845 iso_pu_bacteria 8005321885 8005324891 157
846 iso_pu_bacteria 8005376324 8005381431 157
847 iso_pu_bacteria 8005382845 8005387644 157
848 iso_pu_bacteria 8005395548 8005400675 157
849 iso_pu_bacteria 8005430974 8005431921 157
850 iso_pu_bacteria 8005460587 8005465247 157
851 iso_pu_bacteria 8005484373 8005486960 157
852 iso_pu_bacteria 8005497431 8005497823 157
853 iso_pu_bacteria 8005542996 8005546793 157
854 iso_pu_bacteria 8005556819 8005561311 157
855 iso_pu_bacteria 8005563573 8005565934 157
856 iso_pu_bacteria 8005570704 8005571982 157
857 iso_pu_bacteria 8005619151 8005623558 157
858 iso_pu_bacteria 8005626139 8005630881 157
859 iso_pu_bacteria 8005658619 8005660860 157
860 iso_pu_bacteria 8005668836 8005669229 157
861 iso_pu_bacteria 8005682033 8005687396 157
862 iso_pu_bacteria 8005688590 8005694213 157
863 iso_pu_bacteria 8005695170 8005695864 157
864 iso_pu_bacteria 8018127388 8018128705 157
865 iso_pu_bacteria 8018150411 8018154978 157
866 iso_pu_bacteria 8018163183 8018164951 157
867 iso_pu_bacteria 8018176218 8018177608 157
868 iso_pu_bacteria 8023680758 8023686690 157
869 iso_pu_bacteria 8024479707 8024484509 157
870 iso_pu_bacteria 8024486573 8024490978 157
871 iso_pu_bacteria 8024501048 8024502136 157
872 iso_pu_bacteria 8046767195 8046768408 157
873 iso_pu_bacteria 8049293176 8049296221 157
874 iso_pu_bacteria 8049293176 8049298111 157
875 iso_pu_bacteria 8054460903 8054463741 157
876 iso_pu_bacteria 8054558443 8054561803 157
877 iso_pu_bacteria 8055431914 8055432902 157
878 iso_pu_bacteria 8055617313 8055617352 157
879 iso_pu_bacteria 8056375014 8056380543 157
880 iso_pu_bacteria 8056382006 8056383398 157
881 iso_pu_bacteria 8056875544 8056878328 157
882 iso_pu_bacteria 8057575449 8057581923 157
883 iso_pu_bacteria 8057874678 8057879427 157
884 3300006051 Ga0075364_10670092 Ga0075364_106700921 158
885 3300005578 Ga0068854_100671069 Ga0068854_1006710693 160
886 3300013307 Ga0157372_11930094 Ga0157372_119300941 160
887 3300046506 Ga0495583_0383331 Ga0495583_0383331_46_528 160
888 2010549000 RicEn_FSXC2569_b1 RicEn_192030 161
889 3300001915 JGI24741J21665_1062818 JGI24741J21665_10628181 161
890 3300001979 JGI24740J21852_10036962 JGI24740J21852_100369623 161
891 3300001979 JGI24740J21852_10049384 JGI24740J21852_100493842 161
892 3300001979 JGI24740J21852_10079623 JGI24740J21852_100796231 161
893 3300001979 JGI24740J21852_10108231 JGI24740J21852_101082311 161
894 3300001989 JGI24739J22299_10048442 JGI24739J22299_100484423 161
895 3300002067 JGI24735J21928_10041271 JGI24735J21928_100412712 161
896 3300002704 JGI25155J39150_1000018 JGI25155J39150_100001843 161
897 3300002705 JGI25156J39149_1000140 JGI25156J39149_10001408 161
898 3300002737 JGI25162J39368_1000253 JGI25162J39368_100025318 161
899 3300002737 JGI25162J39368_1000485 JGI25162J39368_100048515 161
900 3300002738 JGI25154J39366_1000069 JGI25154J39366_100006982 161
901 3300002738 JGI25154J39366_1000161 JGI25154J39366_10001615 161
902 3300002739 JGI25158J39367_1000014 JGI25158J39367_100001430 161
903 3300002739 JGI25158J39367_1010618 JGI25158J39367_10106182 161
904 3300002741 JGI25157J39369_1000108 JGI25157J39369_100010822 161
905 3300002741 JGI25157J39369_1001286 JGI25157J39369_10012862 161
906 3300002773 JGI25152J39213_1000229 JGI25152J39213_10002293 161
907 3300002773 JGI25152J39213_1002877 JGI25152J39213_10028773 161
908 3300002773 JGI25152J39213_1007990 JGI25152J39213_10079901 161
909 3300002773 JGI25152J39213_1036572 JGI25152J39213_10365722 161
910 3300002774 JGI25150J39212_1000018 JGI25150J39212_1000018122 161
911 3300002987 JGI25159J45721_1000176 JGI25159J45721_100017623 161
912 3300002987 JGI25159J45721_1000326 JGI25159J45721_10003264 161
913 3300002987 JGI25159J45721_1001680 JGI25159J45721_10016805 161
914 3300003187 JGI25151J46595_10000034 JGI25151J46595_1000003458 161
915 3300003187 JGI25151J46595_10001853 JGI25151J46595_100018536 161
916 3300003187 JGI25151J46595_10002548 JGI25151J46595_100025483 161
917 3300003187 JGI25151J46595_10004959 JGI25151J46595_100049592 161
918 3300003187 JGI25151J46595_10006983 JGI25151J46595_100069837 161
919 3300003187 JGI25151J46595_10016793 JGI25151J46595_100167933 161
920 3300003187 JGI25151J46595_10024001 JGI25151J46595_100240013 161
921 3300003203 JGI25406J46586_10022009 JGI25406J46586_100220094 161
922 3300003214 JGI25165J46597_1000019 JGI25165J46597_1000019220 161
923 3300003214 JGI25165J46597_1000536 JGI25165J46597_100053620 161
924 3300003214 JGI25165J46597_1001677 JGI25165J46597_10016775 161
925 3300003214 JGI25165J46597_1003663 JGI25165J46597_10036634 161
926 3300003215 JGI25153J46596_10009433 JGI25153J46596_100094333 161
927 3300003215 JGI25153J46596_10013005 JGI25153J46596_100130053 161
928 3300003215 JGI25153J46596_10016521 JGI25153J46596_100165212 161
929 3300003215 JGI25153J46596_10093972 JGI25153J46596_100939722 161
930 3300003320 rootH2_10030154 rootH2_100301542 161
931 3300003354 JGI25160J50197_1000027 JGI25160J50197_100002740 161
932 3300003354 JGI25160J50197_1000051 JGI25160J50197_1000051101 161
933 3300003354 JGI25160J50197_1001076 JGI25160J50197_100107610 161
934 3300003354 JGI25160J50197_1002609 JGI25160J50197_10026093 161
935 3300003354 JGI25160J50197_1039569 JGI25160J50197_10395691 161
936 3300003374 JGI25161J50226_1000011 JGI25161J50226_100001193 161
937 3300003374 JGI25161J50226_1000038 JGI25161J50226_100003840 161
938 3300003374 JGI25161J50226_1000757 JGI25161J50226_10007576 161
939 3300003578 Ga0006562J51391_1012861 Ga0006562J51391_10128614 161
940 3300003578 Ga0006562J51391_1012870 Ga0006562J51391_10128702 161
941 3300003693 Ga0032354_1025696 Ga0032354_10256962 161
942 3300003735 Ga0006780_1021509 Ga0006780_10215092 161
943 3300003762 Ga0055542_1002133 Ga0055542_10021337 161
944 3300003763 Ga0055529_1001568 Ga0055529_10015686 161
945 3300003771 Ga0055526_1001048 Ga0055526_10010483 161
946 3300003771 Ga0055526_1008864 Ga0055526_10088644 161
947 3300003771 Ga0055526_1014842 Ga0055526_10148424 161
948 3300003771 Ga0055526_1025515 Ga0055526_10255152 161
949 3300003771 Ga0055526_1034323 Ga0055526_10343233 161
950 3300003771 Ga0055526_1053599 Ga0055526_10535991 161
951 3300003775 Ga0055524_1004059 Ga0055524_10040592 161
952 3300003775 Ga0055524_1006311 Ga0055524_10063113 161
953 3300003775 Ga0055524_1012498 Ga0055524_10124982 161
954 3300003775 Ga0055524_1025292 Ga0055524_10252922 161
955 3300003775 Ga0055524_1038558 Ga0055524_10385583 161
956 3300003775 Ga0055524_1048165 Ga0055524_10481651 161
957 3300003781 Ga0055536_1000540 Ga0055536_100054022 161
958 3300003781 Ga0055536_1007552 Ga0055536_10075523 161
959 3300003790 Ga0055528_1000884 Ga0055528_100088417 161
960 3300003790 Ga0055528_1000979 Ga0055528_10009794 161
961 3300003790 Ga0055528_1004196 Ga0055528_10041965 161
962 3300003790 Ga0055528_1009005 Ga0055528_10090054 161
963 3300003790 Ga0055528_1009863 Ga0055528_10098631 161
964 3300003791 Ga0055530_10006351 Ga0055530_100063513 161
965 3300003792 Ga0055540_1002302 Ga0055540_10023025 161
966 3300003792 Ga0055540_1003597 Ga0055540_10035974 161
967 3300003792 Ga0055540_1008610 Ga0055540_10086103 161
968 3300003792 Ga0055540_1023085 Ga0055540_10230851 161
969 3300003792 Ga0055540_1024202 Ga0055540_10242023 161
970 3300003792 Ga0055540_1025163 Ga0055540_10251631 161
971 3300003794 Ga0055531_10004904 Ga0055531_100049042 161
972 3300003794 Ga0055531_10007527 Ga0055531_100075273 161
973 3300003856 Ga0058692_1003317 Ga0058692_10033173 161
974 3300003856 Ga0058692_1007328 Ga0058692_10073283 161
975 3300004625 Ga0055543_1000030 Ga0055543_100003048 161
976 3300004625 Ga0055543_1000041 Ga0055543_10000414 161
977 3300004625 Ga0055543_1000317 Ga0055543_100031720 161
978 3300004625 Ga0055543_1000416 Ga0055543_10004165 161
979 3300005262 Ga0065165_1000133 Ga0065165_100013326 161
980 3300005262 Ga0065165_1000135 Ga0065165_100013593 161
981 3300005262 Ga0065165_1010834 Ga0065165_10108343 161
982 3300005262 Ga0065165_1010844 Ga0065165_10108443 161
983 3300005289 Ga0065704_10204987 Ga0065704_102049872 161
984 3300005290 Ga0065712_10581084 Ga0065712_105810841 161
985 3300005327 Ga0070658_10276980 Ga0070658_102769802 161
986 3300005327 Ga0070658_10391938 Ga0070658_103919381 161
987 3300005331 Ga0070670_100000061 Ga0070670_10000006120 161
988 3300005337 Ga0070682_100639962 Ga0070682_1006399622 161
989 3300005339 Ga0070660_100066880 Ga0070660_1000668803 161
990 3300005339 Ga0070660_100571327 Ga0070660_1005713271 161
991 3300005339 Ga0070660_100584776 Ga0070660_1005847762 161
992 3300005339 Ga0070660_101202324 Ga0070660_1012023241 161
993 3300005340 Ga0070689_100578240 Ga0070689_1005782401 161
994 3300005347 Ga0070668_100101702 Ga0070668_1001017023 161
995 3300005347 Ga0070668_100120935 Ga0070668_1001209352 161
996 3300005347 Ga0070668_100139712 Ga0070668_1001397122 161
997 3300005353 Ga0070669_100315714 Ga0070669_1003157142 161
998 3300005355 Ga0070671_100324784 Ga0070671_1003247842 161
999 3300005364 Ga0070673_101271477 Ga0070673_1012714771 161
1000 3300005367 Ga0070667_100295986 Ga0070667_1002959862 161
1001 3300005455 Ga0070663_100052882 Ga0070663_1000528823 161
1002 3300005455 Ga0070663_100171861 Ga0070663_1001718613 161
1003 3300005455 Ga0070663_100243900 Ga0070663_1002439002 161
1004 3300005455 Ga0070663_100847189 Ga0070663_1008471892 161
1005 3300005456 Ga0070678_100490727 Ga0070678_1004907272 161
1006 3300005457 Ga0070662_100100915 Ga0070662_1001009152 161
1007 3300005457 Ga0070662_100328016 Ga0070662_1003280161 161
1008 3300005459 Ga0068867_100352987 Ga0068867_1003529873 161
1009 3300005471 Ga0070698_101396742 Ga0070698_1013967421 161
1010 3300005543 Ga0070672_100405630 Ga0070672_1004056302 161
1011 3300005548 Ga0070665_100013727 Ga0070665_1000137274 161
1012 3300005548 Ga0070665_100060359 Ga0070665_1000603593 161
1013 3300005548 Ga0070665_100093261 Ga0070665_1000932612 161
1014 3300005548 Ga0070665_100103373 Ga0070665_1001033733 161
1015 3300005548 Ga0070665_100204393 Ga0070665_1002043932 161
1016 3300005548 Ga0070665_100361308 Ga0070665_1003613082 161
1017 3300005548 Ga0070665_101440430 Ga0070665_1014404302 161
1018 3300005563 Ga0068855_100166759 Ga0068855_1001667593 161
1019 3300005563 Ga0068855_101297718 Ga0068855_1012977182 161
1020 3300005563 Ga0068855_101448286 Ga0068855_1014482862 161
1021 3300005564 Ga0070664_100431911 Ga0070664_1004319112 161
1022 3300005578 Ga0068854_100728815 Ga0068854_1007288151 161
1023 3300005578 Ga0068854_100943801 Ga0068854_1009438011 161
1024 3300005614 Ga0068856_100357583 Ga0068856_1003575832 161
1025 3300005614 Ga0068856_100726070 Ga0068856_1007260702 161
1026 3300005616 Ga0068852_100257629 Ga0068852_1002576292 161
1027 3300005616 Ga0068852_100501561 Ga0068852_1005015612 161
1028 3300005719 Ga0068861_101180966 Ga0068861_1011809662 161
1029 3300005834 Ga0068851_10050731 Ga0068851_100507313 161
1030 3300005840 Ga0068870_10286210 Ga0068870_102862102 161
1031 3300005843 Ga0068860_101205441 Ga0068860_1012054411 161
1032 3300005985 Ga0081539_10000429 Ga0081539_1000042935 161
1033 3300006038 Ga0075365_10000592 Ga0075365_100005926 161
1034 3300006038 Ga0075365_10004401 Ga0075365_100044011 161
1035 3300006038 Ga0075365_10009173 Ga0075365_100091735 161
1036 3300006038 Ga0075365_10023469 Ga0075365_100234692 161
1037 3300006038 Ga0075365_10067109 Ga0075365_100671093 161
1038 3300006038 Ga0075365_10094630 Ga0075365_100946303 161
1039 3300006038 Ga0075365_10104481 Ga0075365_101044813 161
1040 3300006038 Ga0075365_10182820 Ga0075365_101828202 161
1041 3300006038 Ga0075365_10234287 Ga0075365_102342872 161
1042 3300006038 Ga0075365_10258815 Ga0075365_102588152 161
1043 3300006038 Ga0075365_10305262 Ga0075365_103052622 161
1044 3300006042 Ga0075368_10001899 Ga0075368_100018998 161
1045 3300006042 Ga0075368_10046504 Ga0075368_100465041 161
1046 3300006042 Ga0075368_10056159 Ga0075368_100561592 161
1047 3300006042 Ga0075368_10072478 Ga0075368_100724783 161
1048 3300006042 Ga0075368_10099038 Ga0075368_100990382 161
1049 3300006042 Ga0075368_10177137 Ga0075368_101771371 161
1050 3300006048 Ga0075363_100002706 Ga0075363_1000027064 161
1051 3300006048 Ga0075363_100003123 Ga0075363_1000031237 161
1052 3300006048 Ga0075363_100066180 Ga0075363_1000661802 161
1053 3300006048 Ga0075363_100210933 Ga0075363_1002109332 161
1054 3300006048 Ga0075363_100292789 Ga0075363_1002927891 161
1055 3300006051 Ga0075364_10000006 Ga0075364_1000000641 161
1056 3300006051 Ga0075364_10011027 Ga0075364_100110272 161
1057 3300006051 Ga0075364_10054564 Ga0075364_100545642 161
1058 3300006051 Ga0075364_10130820 Ga0075364_101308201 161
1059 3300006051 Ga0075364_10242848 Ga0075364_102428482 161
1060 3300006051 Ga0075364_10253286 Ga0075364_102532862 161
1061 3300006051 Ga0075364_10497301 Ga0075364_104973012 161
1062 3300006051 Ga0075364_10556888 Ga0075364_105568881 161
1063 3300006177 Ga0075362_10000510 Ga0075362_100005105 161
1064 3300006177 Ga0075362_10002423 Ga0075362_100024233 161
1065 3300006177 Ga0075362_10060693 Ga0075362_100606931 161
1066 3300006177 Ga0075362_10101501 Ga0075362_101015012 161
1067 3300006177 Ga0075362_10332784 Ga0075362_103327842 161
1068 3300006177 Ga0075362_10423637 Ga0075362_104236371 161
1069 3300006178 Ga0075367_10000418 Ga0075367_1000041816 161
1070 3300006178 Ga0075367_10003403 Ga0075367_100034035 161
1071 3300006178 Ga0075367_10020967 Ga0075367_100209674 161
1072 3300006178 Ga0075367_10030824 Ga0075367_100308243 161
1073 3300006178 Ga0075367_10097782 Ga0075367_100977822 161
1074 3300006178 Ga0075367_10139884 Ga0075367_101398841 161
1075 3300006178 Ga0075367_10147096 Ga0075367_101470963 161
1076 3300006178 Ga0075367_10312120 Ga0075367_103121201 161
1077 3300006178 Ga0075367_10322702 Ga0075367_103227022 161
1078 3300006178 Ga0075367_10330042 Ga0075367_103300422 161
1079 3300006178 Ga0075367_10360621 Ga0075367_103606211 161
1080 3300006178 Ga0075367_10400875 Ga0075367_104008751 161
1081 3300006178 Ga0075367_10658915 Ga0075367_106589151 161
1082 3300006178 Ga0075367_10674073 Ga0075367_106740731 161
1083 3300006186 Ga0075369_10006597 Ga0075369_100065973 161
1084 3300006186 Ga0075369_10016932 Ga0075369_100169322 161
1085 3300006186 Ga0075369_10036926 Ga0075369_100369262 161
1086 3300006186 Ga0075369_10084045 Ga0075369_100840453 161
1087 3300006186 Ga0075369_10409351 Ga0075369_104093511 161
1088 3300006195 Ga0075366_10001216 Ga0075366_100012165 161
1089 3300006195 Ga0075366_10123373 Ga0075366_101233733 161
1090 3300006195 Ga0075366_10192516 Ga0075366_101925161 161
1091 3300006195 Ga0075366_10233157 Ga0075366_102331571 161
1092 3300006195 Ga0075366_10506088 Ga0075366_105060882 161
1093 3300006195 Ga0075366_11022923 Ga0075366_110229231 161
1094 3300006353 Ga0075370_10001979 Ga0075370_100019794 161
1095 3300006353 Ga0075370_10007019 Ga0075370_100070195 161
1096 3300006353 Ga0075370_10043874 Ga0075370_100438743 161
1097 3300006353 Ga0075370_10051128 Ga0075370_100511284 161
1098 3300006353 Ga0075370_10057045 Ga0075370_100570451 161
1099 3300006353 Ga0075370_10092246 Ga0075370_100922463 161
1100 3300006353 Ga0075370_10106112 Ga0075370_101061122 161
1101 3300006353 Ga0075370_10153797 Ga0075370_101537973 161
1102 3300006353 Ga0075370_10157872 Ga0075370_101578722 161
1103 3300006353 Ga0075370_10175669 Ga0075370_101756692 161
1104 3300006353 Ga0075370_10279551 Ga0075370_102795512 161
1105 3300006946 Ga0079104_1000207 Ga0079104_100020756 161
1106 3300006946 Ga0079104_1004038 Ga0079104_10040383 161
1107 3300006946 Ga0079104_1008945 Ga0079104_10089453 161
1108 3300006948 Ga0099826_10000468 Ga0099826_1000046810 161
1109 3300009011 Ga0105251_10025303 Ga0105251_100253033 161
1110 3300009036 Ga0105244_10053649 Ga0105244_100536493 161
1111 3300009036 Ga0105244_10070912 Ga0105244_100709121 161
1112 3300009036 Ga0105244_10299656 Ga0105244_102996562 161
1113 3300009092 Ga0105250_10043784 Ga0105250_100437842 161
1114 3300009092 Ga0105250_10100239 Ga0105250_101002392 161
1115 3300009093 Ga0105240_10000142 Ga0105240_1000014235 161
1116 3300009093 Ga0105240_10256742 Ga0105240_102567421 161
1117 3300009093 Ga0105240_10381420 Ga0105240_103814201 161
1118 3300009093 Ga0105240_10707692 Ga0105240_107076921 161
1119 3300009093 Ga0105240_11893129 Ga0105240_118931291 161
1120 3300009098 Ga0105245_10775113 Ga0105245_107751132 161
1121 3300009101 Ga0105247_10252899 Ga0105247_102528992 161
1122 3300009148 Ga0105243_10031735 Ga0105243_100317352 161
1123 3300009148 Ga0105243_10060917 Ga0105243_100609173 161
1124 3300009148 Ga0105243_10685295 Ga0105243_106852952 161
1125 3300009148 Ga0105243_10890296 Ga0105243_108902962 161
1126 3300009148 Ga0105243_11537287 Ga0105243_115372872 161
1127 3300009148 Ga0105243_11624785 Ga0105243_116247851 161
1128 3300009174 Ga0105241_10379515 Ga0105241_103795152 161
1129 3300009177 Ga0105248_10085321 Ga0105248_100853213 161
1130 3300009177 Ga0105248_10345475 Ga0105248_103454753 161
1131 3300009545 Ga0105237_10013922 Ga0105237_1001392210 161
1132 3300009545 Ga0105237_10211542 Ga0105237_102115423 161
1133 3300009545 Ga0105237_11085200 Ga0105237_110852002 161
1134 3300009545 Ga0105237_11517174 Ga0105237_115171741 161
1135 3300009551 Ga0105238_10002270 Ga0105238_100022702 161
1136 3300009551 Ga0105238_10545309 Ga0105238_105453091 161
1137 3300009551 Ga0105238_10662712 Ga0105238_106627123 161
1138 3300009551 Ga0105238_11765302 Ga0105238_117653021 161
1139 3300009553 Ga0105249_10195740 Ga0105249_101957402 161
1140 3300009553 Ga0105249_10215405 Ga0105249_102154053 161
1141 3300009553 Ga0105249_10562989 Ga0105249_105629892 161
1142 3300009765 Ga0123341_1000260 Ga0123341_100026012 161
1143 3300009766 Ga0123342_1011038 Ga0123342_10110383 161
1144 3300009766 Ga0123342_1023166 Ga0123342_10231663 161
1145 3300010375 Ga0105239_10001079 Ga0105239_1000107932 161
1146 3300010375 Ga0105239_10136688 Ga0105239_101366883 161
1147 3300010375 Ga0105239_10209803 Ga0105239_102098032 161
1148 3300010375 Ga0105239_10341653 Ga0105239_103416532 161
1149 3300010375 Ga0105239_10543586 Ga0105239_105435861 161
1150 3300010375 Ga0105239_10580700 Ga0105239_105807002 161
1151 3300010375 Ga0105239_11522269 Ga0105239_115222692 161
1152 3300011119 Ga0105246_10010820 Ga0105246_100108204 161
1153 3300011119 Ga0105246_10564924 Ga0105246_105649241 161
1154 3300013100 Ga0157373_10031709 Ga0157373_100317094 161
1155 3300013100 Ga0157373_10143527 Ga0157373_101435272 161
1156 3300013102 Ga0157371_10000071 Ga0157371_1000007135 161
1157 3300013102 Ga0157371_10283406 Ga0157371_102834062 161
1158 3300013104 Ga0157370_10000469 Ga0157370_1000046929 161
1159 3300013104 Ga0157370_10007351 Ga0157370_100073512 161
1160 3300013104 Ga0157370_10073494 Ga0157370_100734943 161
1161 3300013104 Ga0157370_10194986 Ga0157370_101949862 161
1162 3300013104 Ga0157370_11330431 Ga0157370_113304311 161
1163 3300013105 Ga0157369_10043197 Ga0157369_100431971 161
1164 3300013105 Ga0157369_10141547 Ga0157369_101415472 161
1165 3300013105 Ga0157369_10199524 Ga0157369_101995243 161
1166 3300013105 Ga0157369_10446502 Ga0157369_104465023 161
1167 3300013105 Ga0157369_10456722 Ga0157369_104567221 161
1168 3300013249 Ga0171463_1004 Ga0171463_1004151 161
1169 3300013297 Ga0157378_10224811 Ga0157378_102248112 161
1170 3300013306 Ga0163162_10136131 Ga0163162_101361312 161
1171 3300013306 Ga0163162_10281441 Ga0163162_102814413 161
1172 3300013306 Ga0163162_10589112 Ga0163162_105891121 161
1173 3300013307 Ga0157372_10257782 Ga0157372_102577823 161
1174 3300013307 Ga0157372_10416562 Ga0157372_104165622 161
1175 3300013307 Ga0157372_10858728 Ga0157372_108587282 161
1176 3300013307 Ga0157372_11409050 Ga0157372_114090501 161
1177 3300013308 Ga0157375_10398831 Ga0157375_103988313 161
1178 3300014325 Ga0163163_10285014 Ga0163163_102850143 161
1179 3300014497 Ga0182008_10038526 Ga0182008_100385263 161
1180 3300014497 Ga0182008_10045308 Ga0182008_100453083 161
1181 3300015261 Ga0182006_1044474 Ga0182006_10444742 161
1182 3300015262 Ga0182007_10002964 Ga0182007_100029645 161
1183 3300015265 Ga0182005_1023373 Ga0182005_10233732 161
1184 3300015690 Ga0183363_1306 Ga0183363_13064 161
1185 3300017792 Ga0163161_10170499 Ga0163161_101704993 161
1186 3300017792 Ga0163161_10269258 Ga0163161_102692583 161
1187 3300017792 Ga0163161_10523387 Ga0163161_105233871 161
1188 3300021320 Ga0214544_1000018 Ga0214544_1000018157 161
1189 3300021321 Ga0214542_1001855 Ga0214542_10018552 161
1190 3300021321 Ga0214542_1016122 Ga0214542_10161228 161
1191 3300021321 Ga0214542_1017131 Ga0214542_10171312 161
1192 3300021324 Ga0214545_1057813 Ga0214545_10578131 161
1193 3300021327 Ga0214543_1000005 Ga0214543_1000005100 161
1194 3300021327 Ga0214543_1000015 Ga0214543_100001531 161
1195 3300021327 Ga0214543_1000016 Ga0214543_1000016120 161
1196 3300021327 Ga0214543_1000195 Ga0214543_10001952 161
1197 3300022739 Ga0228711_1000004 Ga0228711_100000447 161
1198 3300022740 Ga0228710_1000264 Ga0228710_10002646 161
1199 3300025206 Ga0209435_100031 Ga0209435_10003143 161
1200 3300025208 Ga0209436_100013 Ga0209436_10001314 161
1201 3300025208 Ga0209436_104935 Ga0209436_1049352 161
1202 3300025208 Ga0209436_109069 Ga0209436_1090693 161
1203 3300025228 Ga0209672_103130 Ga0209672_1031303 161
1204 3300025233 Ga0209437_100179 Ga0209437_100179106 161
1205 3300025233 Ga0209437_100181 Ga0209437_100181105 161
1206 3300025233 Ga0209437_101277 Ga0209437_1012774 161
1207 3300025245 Ga0207425_1000035 Ga0207425_100003581 161
1208 3300025245 Ga0207425_1009611 Ga0207425_10096112 161
1209 3300025245 Ga0207425_1010263 Ga0207425_10102632 161
1210 3300025245 Ga0207425_1027973 Ga0207425_10279731 161
1211 3300025246 Ga0209646_1000102 Ga0209646_100010243 161
1212 3300025246 Ga0209646_1006752 Ga0209646_10067522 161
1213 3300025246 Ga0209646_1011821 Ga0209646_10118212 161
1214 3300025250 Ga0209026_1000013 Ga0209026_1000013175 161
1215 3300025250 Ga0209026_1000096 Ga0209026_100009643 161
1216 3300025253 Ga0209677_100455 Ga0209677_10045522 161
1217 3300025254 Ga0209148_1000032 Ga0209148_100003239 161
1218 3300025256 Ga0209759_1000058 Ga0209759_1000058141 161
1219 3300025256 Ga0209759_1000090 Ga0209759_100009043 161
1220 3300025258 Ga0209129_1000029 Ga0209129_100002981 161
1221 3300025258 Ga0209129_1000050 Ga0209129_1000050108 161
1222 3300025258 Ga0209129_1000377 Ga0209129_100037721 161
1223 3300025258 Ga0209129_1002478 Ga0209129_10024784 161
1224 3300025258 Ga0209129_1003900 Ga0209129_10039003 161
1225 3300025258 Ga0209129_1005885 Ga0209129_10058852 161
1226 3300025261 Ga0209233_1000034 Ga0209233_1000034404 161
1227 3300025261 Ga0209233_1000185 Ga0209233_1000185105 161
1228 3300025261 Ga0209233_1000212 Ga0209233_100021219 161
1229 3300025261 Ga0209233_1000445 Ga0209233_100044516 161
1230 3300025261 Ga0209233_1005424 Ga0209233_10054243 161
1231 3300025272 Ga0209455_1000098 Ga0209455_1000098130 161
1232 3300025272 Ga0209455_1007268 Ga0209455_10072683 161
1233 3300025273 Ga0209673_1000033 Ga0209673_1000033108 161
1234 3300025273 Ga0209673_1000050 Ga0209673_1000050154 161
1235 3300025273 Ga0209673_1000476 Ga0209673_100047635 161
1236 3300025273 Ga0209673_1001553 Ga0209673_10015532 161
1237 3300025273 Ga0209673_1001715 Ga0209673_10017158 161
1238 3300025273 Ga0209673_1003312 Ga0209673_10033124 161
1239 3300025273 Ga0209673_1009152 Ga0209673_10091522 161
1240 3300025273 Ga0209673_1010740 Ga0209673_10107403 161
1241 3300025273 Ga0209673_1029461 Ga0209673_10294612 161
1242 3300025284 Ga0209130_1000009 Ga0209130_1000009109 161
1243 3300025284 Ga0209130_1000027 Ga0209130_1000027174 161
1244 3300025284 Ga0209130_1000058 Ga0209130_1000058102 161
1245 3300025284 Ga0209130_1007773 Ga0209130_10077733 161
1246 3300025284 Ga0209130_1008855 Ga0209130_10088553 161
1247 3300025284 Ga0209130_1033594 Ga0209130_10335942 161
1248 3300025291 Ga0209675_1014761 Ga0209675_10147612 161
1249 3300025292 Ga0209676_1000406 Ga0209676_100040665 161
1250 3300025292 Ga0209676_1003843 Ga0209676_10038433 161
1251 3300025292 Ga0209676_1010085 Ga0209676_10100851 161
1252 3300025292 Ga0209676_1045954 Ga0209676_10459542 161
1253 3300025294 Ga0209025_1000042 Ga0209025_1000042124 161
1254 3300025294 Ga0209025_1000132 Ga0209025_1000132125 161
1255 3300025294 Ga0209025_1000241 Ga0209025_100024163 161
1256 3300025294 Ga0209025_1000453 Ga0209025_100045347 161
1257 3300025294 Ga0209025_1001274 Ga0209025_100127410 161
1258 3300025294 Ga0209025_1002759 Ga0209025_100275919 161
1259 3300025294 Ga0209025_1008059 Ga0209025_10080596 161
1260 3300025294 Ga0209025_1022149 Ga0209025_10221493 161
1261 3300025294 Ga0209025_1048453 Ga0209025_10484532 161
1262 3300025294 Ga0209025_1076352 Ga0209025_10763522 161
1263 3300025294 Ga0209025_1148251 Ga0209025_11482511 161
1264 3300025295 Ga0209564_1000111 Ga0209564_1000111155 161
1265 3300025295 Ga0209564_1000227 Ga0209564_100022720 161
1266 3300025295 Ga0209564_1000284 Ga0209564_100028449 161
1267 3300025295 Ga0209564_1002155 Ga0209564_10021552 161
1268 3300025295 Ga0209564_1009667 Ga0209564_10096674 161
1269 3300025295 Ga0209564_1017086 Ga0209564_10170862 161
1270 3300025297 Ga0209758_1000255 Ga0209758_100025522 161
1271 3300025297 Ga0209758_1000406 Ga0209758_10004068 161
1272 3300025297 Ga0209758_1000563 Ga0209758_100056335 161
1273 3300025297 Ga0209758_1001039 Ga0209758_100103921 161
1274 3300025297 Ga0209758_1001297 Ga0209758_100129720 161
1275 3300025297 Ga0209758_1003074 Ga0209758_100307410 161
1276 3300025297 Ga0209758_1017669 Ga0209758_10176693 161
1277 3300025297 Ga0209758_1021428 Ga0209758_10214283 161
1278 3300025297 Ga0209758_1021657 Ga0209758_10216573 161
1279 3300025297 Ga0209758_1021673 Ga0209758_10216731 161
1280 3300025297 Ga0209758_1035760 Ga0209758_10357602 161
1281 3300025297 Ga0209758_1058408 Ga0209758_10584082 161
1282 3300025298 Ga0209050_1004183 Ga0209050_10041833 161
1283 3300025298 Ga0209050_1009264 Ga0209050_10092644 161
1284 3300025299 Ga0209256_1000361 Ga0209256_100036177 161
1285 3300025299 Ga0209256_1001149 Ga0209256_100114913 161
1286 3300025299 Ga0209256_1001517 Ga0209256_100151713 161
1287 3300025299 Ga0209256_1002615 Ga0209256_100261515 161
1288 3300025299 Ga0209256_1003137 Ga0209256_10031373 161
1289 3300025299 Ga0209256_1003810 Ga0209256_100381011 161
1290 3300025299 Ga0209256_1010847 Ga0209256_10108472 161
1291 3300025299 Ga0209256_1055479 Ga0209256_10554792 161
1292 3300025299 Ga0209256_1081405 Ga0209256_10814051 161
1293 3300025302 Ga0207426_1000041 Ga0207426_100004147 161
1294 3300025302 Ga0207426_1000072 Ga0207426_1000072141 161
1295 3300025302 Ga0207426_1000131 Ga0207426_1000131102 161
1296 3300025302 Ga0207426_1000214 Ga0207426_1000214110 161
1297 3300025302 Ga0207426_1002342 Ga0207426_10023423 161
1298 3300025303 Ga0209051_1000118 Ga0209051_100011860 161
1299 3300025303 Ga0209051_1001684 Ga0209051_100168418 161
1300 3300025303 Ga0209051_1002434 Ga0209051_10024343 161
1301 3300025303 Ga0209051_1006052 Ga0209051_10060523 161
1302 3300025303 Ga0209051_1075092 Ga0209051_10750922 161
1303 3300025304 Ga0209257_1001639 Ga0209257_100163911 161
1304 3300025304 Ga0209257_1001825 Ga0209257_100182513 161
1305 3300025304 Ga0209257_1003745 Ga0209257_10037453 161
1306 3300025304 Ga0209257_1032140 Ga0209257_10321401 161
1307 3300025304 Ga0209257_1039424 Ga0209257_10394241 161
1308 3300025304 Ga0209257_1094812 Ga0209257_10948121 161
1309 3300025321 Ga0207656_10194928 Ga0207656_101949282 161
1310 3300025903 Ga0207680_10795888 Ga0207680_107958881 161
1311 3300025904 Ga0207647_10007088 Ga0207647_100070884 161
1312 3300025907 Ga0207645_10089984 Ga0207645_100899842 161
1313 3300025908 Ga0207643_10358138 Ga0207643_103581381 161
1314 3300025911 Ga0207654_10029870 Ga0207654_100298704 161
1315 3300025911 Ga0207654_10080358 Ga0207654_100803582 161
1316 3300025913 Ga0207695_10000234 Ga0207695_1000023435 161
1317 3300025913 Ga0207695_10071983 Ga0207695_100719833 161
1318 3300025913 Ga0207695_10331756 Ga0207695_103317563 161
1319 3300025913 Ga0207695_10847244 Ga0207695_108472442 161
1320 3300025913 Ga0207695_11503466 Ga0207695_115034661 161
1321 3300025914 Ga0207671_10000043 Ga0207671_1000004334 161
1322 3300025914 Ga0207671_10023356 Ga0207671_100233564 161
1323 3300025914 Ga0207671_10671813 Ga0207671_106718132 161
1324 3300025919 Ga0207657_10057261 Ga0207657_100572613 161
1325 3300025919 Ga0207657_10452758 Ga0207657_104527582 161
1326 3300025923 Ga0207681_10175757 Ga0207681_101757573 161
1327 3300025923 Ga0207681_10256917 Ga0207681_102569172 161
1328 3300025924 Ga0207694_10353883 Ga0207694_103538833 161
1329 3300025925 Ga0207650_10000207 Ga0207650_1000020747 161
1330 3300025927 Ga0207687_10623780 Ga0207687_106237802 161
1331 3300025927 Ga0207687_10745828 Ga0207687_107458281 161
1332 3300025933 Ga0207706_10176921 Ga0207706_101769212 161
1333 3300025934 Ga0207686_10695319 Ga0207686_106953192 161
1334 3300025935 Ga0207709_10145508 Ga0207709_101455083 161
1335 3300025935 Ga0207709_10224098 Ga0207709_102240982 161
1336 3300025938 Ga0207704_10513584 Ga0207704_105135842 161
1337 3300025940 Ga0207691_10972252 Ga0207691_109722522 161
1338 3300025941 Ga0207711_10479700 Ga0207711_104797002 161
1339 3300025942 Ga0207689_10418819 Ga0207689_104188193 161
1340 3300025945 Ga0207679_10591490 Ga0207679_105914902 161
1341 3300025949 Ga0207667_10159711 Ga0207667_101597113 161
1342 3300025949 Ga0207667_10499075 Ga0207667_104990752 161
1343 3300025949 Ga0207667_10545953 Ga0207667_105459531 161
1344 3300025961 Ga0207712_10427121 Ga0207712_104271212 161
1345 3300025972 Ga0207668_10013360 Ga0207668_100133604 161
1346 3300025972 Ga0207668_10091320 Ga0207668_100913203 161
1347 3300025972 Ga0207668_10147887 Ga0207668_101478873 161
1348 3300025972 Ga0207668_10250865 Ga0207668_102508652 161
1349 3300025972 Ga0207668_10681340 Ga0207668_106813402 161
1350 3300025981 Ga0207640_10283277 Ga0207640_102832772 161
1351 3300025981 Ga0207640_10444323 Ga0207640_104443232 161
1352 3300025981 Ga0207640_11023872 Ga0207640_110238721 161
1353 3300026041 Ga0207639_10004025 Ga0207639_100040254 161
1354 3300026041 Ga0207639_10362850 Ga0207639_103628502 161
1355 3300026041 Ga0207639_10557684 Ga0207639_105576843 161
1356 3300026067 Ga0207678_10023129 Ga0207678_100231296 161
1357 3300026067 Ga0207678_10187876 Ga0207678_101878764 161
1358 3300026067 Ga0207678_10193094 Ga0207678_101930942 161
1359 3300026067 Ga0207678_10265126 Ga0207678_102651263 161
1360 3300026067 Ga0207678_10434387 Ga0207678_104343873 161
1361 3300026078 Ga0207702_10045234 Ga0207702_100452344 161
1362 3300026078 Ga0207702_10102227 Ga0207702_101022271 161
1363 3300026078 Ga0207702_10245482 Ga0207702_102454822 161
1364 3300026089 Ga0207648_10399153 Ga0207648_103991532 161
1365 3300026116 Ga0207674_10477297 Ga0207674_104772973 161
1366 3300026116 Ga0207674_11517631 Ga0207674_115176311 161
1367 3300026118 Ga0207675_101350440 Ga0207675_1013504402 161
1368 3300026121 Ga0207683_10255124 Ga0207683_102551242 161
1369 3300027111 Ga0209281_1000028 Ga0209281_1000028298 161
1370 3300027111 Ga0209281_1000030 Ga0209281_1000030265 161
1371 3300027111 Ga0209281_1000857 Ga0209281_100085714 161
1372 3300027312 Ga0209371_1000037 Ga0209371_1000037212 161
1373 3300027312 Ga0209371_1001614 Ga0209371_100161410 161
1374 3300027312 Ga0209371_1021804 Ga0209371_10218043 161
1375 3300027665 Ga0209983_1023367 Ga0209983_10233673 161
1376 3300027666 Ga0209282_1000004 Ga0209282_1000004265 161
1377 3300027666 Ga0209282_1010364 Ga0209282_10103646 161
1378 3300027866 Ga0209813_10014181 Ga0209813_100141813 161
1379 3300027866 Ga0209813_10025670 Ga0209813_100256702 161
1380 3300027866 Ga0209813_10037922 Ga0209813_100379223 161
1381 3300027866 Ga0209813_10286423 Ga0209813_102864231 161
1382 3300028379 Ga0268266_10009893 Ga0268266_100098932 161
1383 3300028379 Ga0268266_10027268 Ga0268266_100272683 161
1384 3300028379 Ga0268266_10036851 Ga0268266_100368514 161
1385 3300028379 Ga0268266_10056837 Ga0268266_100568372 161
1386 3300028379 Ga0268266_10112977 Ga0268266_101129773 161
1387 3300028379 Ga0268266_10289288 Ga0268266_102892883 161
1388 3300028379 Ga0268266_10827908 Ga0268266_108279082 161
1389 3300028794 Ga0307515_10000136 Ga0307515_10000136163 161
1390 3300028794 Ga0307515_10001840 Ga0307515_1000184040 161
1391 3300028794 Ga0307515_10003402 Ga0307515_1000340215 161
1392 3300028794 Ga0307515_10050525 Ga0307515_100505251 161
1393 3300028794 Ga0307515_10186903 Ga0307515_101869033 161
1394 3300028794 Ga0307515_10342304 Ga0307515_103423043 161
1395 3300028794 Ga0307515_10496673 Ga0307515_104966731 161
1396 3300030500 Ga0268256_1000039 Ga0268256_100003996 161
1397 3300030500 Ga0268256_1032238 Ga0268256_10322382 161
1398 3300030500 Ga0268256_1042016 Ga0268256_10420162 161
1399 3300030744 Ga0316181_1054311 Ga0316181_10543111 161
1400 3300031456 Ga0307513_10010967 Ga0307513_100109672 161
1401 3300031456 Ga0307513_10377852 Ga0307513_103778522 161
1402 3300031548 Ga0307408_100012911 Ga0307408_1000129113 161
1403 3300031548 Ga0307408_100230484 Ga0307408_1002304842 161
1404 3300031548 Ga0307408_100469156 Ga0307408_1004691562 161
1405 3300031691 Ga0316579_10374278 Ga0316579_103742781 161
1406 3300031730 Ga0307516_10060302 Ga0307516_100603022 161
1407 3300031731 Ga0307405_10000203 Ga0307405_1000020320 161
1408 3300031731 Ga0307405_10053789 Ga0307405_100537893 161
1409 3300031731 Ga0307405_10492615 Ga0307405_104926151 161
1410 3300031731 Ga0307405_10612896 Ga0307405_106128962 161
1411 3300031731 Ga0307405_10723009 Ga0307405_107230091 161
1412 3300031824 Ga0307413_10307820 Ga0307413_103078203 161
1413 3300031824 Ga0307413_10552463 Ga0307413_105524632 161
1414 3300031852 Ga0307410_10211898 Ga0307410_102118981 161
1415 3300031852 Ga0307410_10634021 Ga0307410_106340212 161
1416 3300031901 Ga0307406_10019753 Ga0307406_100197533 161
1417 3300031901 Ga0307406_10691522 Ga0307406_106915221 161
1418 3300031901 Ga0307406_10967503 Ga0307406_109675031 161
1419 3300031903 Ga0307407_10299958 Ga0307407_102999583 161
1420 3300031903 Ga0307407_11088364 Ga0307407_110883642 161
1421 3300031911 Ga0307412_10000671 Ga0307412_100006719 161
1422 3300031911 Ga0307412_10050105 Ga0307412_100501052 161
1423 3300031911 Ga0307412_10224860 Ga0307412_102248602 161
1424 3300031911 Ga0307412_10496624 Ga0307412_104966242 161
1425 3300031911 Ga0307412_10866104 Ga0307412_108661041 161
1426 3300031967 Ga0315914_1000001 Ga0315914_1000001119 161
1427 3300031995 Ga0307409_100122337 Ga0307409_1001223371 161
1428 3300031995 Ga0307409_100234209 Ga0307409_1002342093 161
1429 3300031995 Ga0307409_100811955 Ga0307409_1008119552 161
1430 3300031995 Ga0307409_101057072 Ga0307409_1010570722 161
1431 3300031995 Ga0307409_102230496 Ga0307409_1022304961 161
1432 3300032002 Ga0307416_100210294 Ga0307416_1002102943 161
1433 3300032002 Ga0307416_100314458 Ga0307416_1003144583 161
1434 3300032002 Ga0307416_100702315 Ga0307416_1007023151 161
1435 3300032002 Ga0307416_101145900 Ga0307416_1011459002 161
1436 3300032002 Ga0307416_101435017 Ga0307416_1014350172 161
1437 3300032004 Ga0307414_10054702 Ga0307414_100547021 161
1438 3300032004 Ga0307414_10294614 Ga0307414_102946143 161
1439 3300032004 Ga0307414_10364487 Ga0307414_103644873 161
1440 3300032004 Ga0307414_10452460 Ga0307414_104524601 161
1441 3300032004 Ga0307414_10822952 Ga0307414_108229522 161
1442 3300032005 Ga0307411_10574965 Ga0307411_105749651 161
1443 3300033430 Ga0315913_1000364 Ga0315913_10003646 161
1444 3300033464 Ga0315915_1000002 Ga0315915_1000002266 161
1445 3300035692 Ga0373935_0164347 Ga0373935_0164347_756_1241 161
1446 3300035692 Ga0373935_0284707 Ga0373935_0284707_291_776 161
1447 3300035692 Ga0373935_1466639 Ga0373935_1466639_10_495 161
1448 3300035695 Ga0373927_0000074 Ga0373927_0000074_65694_66179 161
1449 3300037068 Ga0373925_0008542 Ga0373925_0008542_4217_4702 161
1450 3300037312 Ga0395899_0000014 Ga0395899_0000014_359348_359833 161
1451 3300037312 Ga0395899_0578189 Ga0395899_0578189_176_661 161
1452 3300037418 Ga0395900_0000007 Ga0395900_0000007_359367_359852 161
1453 3300037418 Ga0395900_0256182 Ga0395900_0256182_1061_1546 161
1454 3300037418 Ga0395900_0287462 Ga0395900_0287462_651_1136 161
1455 3300037418 Ga0395900_0487374 Ga0395900_0487374_73_561 161
1456 3300037418 Ga0395900_0534583 Ga0395900_0534583_536_1021 161
1457 3300037418 Ga0395900_0656906 Ga0395900_0656906_175_669 161
1458 3300037466 Ga0395898_0000011 Ga0395898_0000011_129009_129494 161
1459 3300037466 Ga0395898_0066132 Ga0395898_0066132_1705_2190 161
1460 3300037466 Ga0395898_0170613 Ga0395898_0170613_615_1100 161
1461 3300037466 Ga0395898_0845855 Ga0395898_0845855_131_619 161
1462 3300037471 Ga0395905_0000008 Ga0395905_0000008_359367_359852 161
1463 3300037471 Ga0395905_0003609 Ga0395905_0003609_15123_15740 161
1464 3300037471 Ga0395905_0062829 Ga0395905_0062829_2554_3048 161
1465 3300037471 Ga0395905_0081757 Ga0395905_0081757_859_1353 161
1466 3300037471 Ga0395905_0087746 Ga0395905_0087746_2260_2745 161
1467 3300037471 Ga0395905_0184733 Ga0395905_0184733_1026_1511 161
1468 3300037471 Ga0395905_0198464 Ga0395905_0198464_114_599 161
1469 3300038443 Ga0395901_0000020 Ga0395901_0000020_185425_185910 161
1470 3300038443 Ga0395901_0203247 Ga0395901_0203247_267_752 161
1471 3300038443 Ga0395901_0418062 Ga0395901_0418062_681_1166 161
1472 3300038443 Ga0395901_0735369 Ga0395901_0735369_305_793 161
1473 3300038443 Ga0395901_1494359 Ga0395901_1494359_56_541 161
1474 3300041413 Ga0439465_0002198 Ga0439465_0002198_3350_3859 161
1475 3300041413 Ga0439465_0028181 Ga0439465_0028181_396_881 161
1476 3300041413 Ga0439465_0196135 Ga0439465_0196135_17_526 161
1477 3300041413 Ga0439465_0216688 Ga0439465_0216688_180_665 161
1478 3300041413 Ga0439465_0249916 Ga0439465_0249916_131_643 161
1479 3300041441 Ga0451787_031617 Ga0451787_031617_2147_2656 161
1480 3300041443 Ga0451789_0616123 Ga0451789_0616123_126_611 161
1481 3300041444 Ga0451790_41710 Ga0451790_41710_53_538 161
1482 3300041451 Ga0451791_0907373 Ga0451791_0907373_341_826 161
1483 3300041451 Ga0451791_1393878 Ga0451791_1393878_195_692 161
1484 3300041453 Ga0451797_1310432 Ga0451797_1310432_73_558 161
1485 3300041491 Ga0451833_1319809 Ga0451833_1319809_15_500 161
1486 3300041492 Ga0451835_0218371 Ga0451835_0218371_44_553 161
1487 3300041493 Ga0451836_13108 Ga0451836_13108_150_659 161
1488 3300041494 Ga0451837_0471602 Ga0451837_0471602_384_893 161
1489 3300041494 Ga0451837_0562295 Ga0451837_0562295_282_791 161
1490 3300041496 Ga0451839_0562329 Ga0451839_0562329_38_547 161
1491 3300041497 Ga0451840_28572 Ga0451840_28572_281_790 161
1492 3300041498 Ga0451841_0541929 Ga0451841_0541929_339_824 161
1493 3300041498 Ga0451841_0881634 Ga0451841_0881634_791_1276 161
1494 3300041500 Ga0451844_02159 Ga0451844_02159_383_892 161
1495 3300041501 Ga0451845_0753293 Ga0451845_0753293_306_791 161
1496 3300041503 Ga0451847_0228755 Ga0451847_0228755_1270_1755 161
1497 3300041503 Ga0451847_0469452 Ga0451847_0469452_23_508 161
1498 3300041504 Ga0451848_06670 Ga0451848_06670_292_777 161
1499 3300041507 Ga0451851_0283834 Ga0451851_0283834_82_582 161
1500 3300041507 Ga0451851_0517594 Ga0451851_0517594_1213_1698 161
1501 3300041509 Ga0451843_1214210 Ga0451843_1214210_186_695 161
1502 3300041510 Ga0451854_30503 Ga0451854_30503_422_931 161
1503 3300041511 Ga0451855_0216161 Ga0451855_0216161_3013_3498 161
1504 3300041511 Ga0451855_0278802 Ga0451855_0278802_23_508 161
1505 3300041512 Ga0451853_2686657 Ga0451853_2686657_1496_2005 161
1506 3300041907 Ga0452268_02506 Ga0452268_02506_225_710 161
1507 3300041907 Ga0452268_31546 Ga0452268_31546_239_724 161
1508 3300042001 Ga0439441_059889 Ga0439441_059889_42_527 161
1509 3300042002 Ga0439442_105887 Ga0439442_105887_66_551 161
1510 3300042004 Ga0439445_0044398 Ga0439445_0044398_169_654 161
1511 3300042006 Ga0439432_049090 Ga0439432_049090_789_1286 161
1512 3300042007 Ga0439449_0020537 Ga0439449_0020537_1509_2018 161
1513 3300042136 Ga0450900_023943 Ga0450900_023943_359_850 161
1514 3300042157 Ga0439458_0050942 Ga0439458_0050942_85_570 161
1515 3300042435 Ga0439434_0006200 Ga0439434_0006200_1427_1936 161
1516 3300042531 Ga0450918_000624 Ga0450918_000624_122_631 161
1517 3300044658 Ga0466972_0039301 Ga0466972_0039301_613_1098 161
1518 3300044683 Ga0466965_0155215 Ga0466965_0155215_173_658 161
1519 3300044683 Ga0466965_0174919 Ga0466965_0174919_75_560 161
1520 3300044735 Ga0466968_0156700 Ga0466968_0156700_415_900 161
1521 3300044735 Ga0466968_0514774 Ga0466968_0514774_90_575 161
1522 3300044765 Ga0466970_0640706 Ga0466970_0640706_63_548 161
1523 3300044901 Ga0466960_0112323 Ga0466960_0112323_829_1314 161
1524 3300045049 Ga0466959_0395808 Ga0466959_0395808_39_548 161
1525 3300045051 Ga0451576_1303413 Ga0451576_1303413_143_697 161
1526 3300046459 Ga0495629_0037852 Ga0495629_0037852_198_707 161
1527 3300046460 Ga0495638_0000110 Ga0495638_0000110_15794_16279 161
1528 3300046460 Ga0495638_0012945 Ga0495638_0012945_4396_4881 161
1529 3300046460 Ga0495638_0028199 Ga0495638_0028199_2909_3394 161
1530 3300046460 Ga0495638_0426201 Ga0495638_0426201_45_611 161
1531 3300046460 Ga0495638_0465294 Ga0495638_0465294_104_589 161
1532 3300046471 Ga0495650_0095593 Ga0495650_0095593_345_854 161
1533 3300046476 Ga0495662_0004122 Ga0495662_0004122_1294_1803 161
1534 3300046492 Ga0495585_0008442 Ga0495585_0008442_457_966 161
1535 3300046492 Ga0495585_0245939 Ga0495585_0245939_91_576 161
1536 3300046500 Ga0495596_0025403 Ga0495596_0025403_1519_2028 161
1537 3300046501 Ga0495607_0023917 Ga0495607_0023917_800_1309 161
1538 3300046506 Ga0495583_0025141 Ga0495583_0025141_2461_2970 161
1539 3300046506 Ga0495583_0141152 Ga0495583_0141152_288_773 161
1540 3300046507 Ga0495606_0001739 Ga0495606_0001739_17679_18188 161
1541 3300046507 Ga0495606_0015600 Ga0495606_0015600_1715_2224 161
1542 3300046507 Ga0495606_0234470 Ga0495606_0234470_115_600 161
1543 3300046512 Ga0495610_0001935 Ga0495610_0001935_1858_2367 161
1544 3300046512 Ga0495610_0066907 Ga0495610_0066907_365_874 161
1545 3300046515 Ga0495620_0178898 Ga0495620_0178898_162_671 161
1546 3300046518 Ga0495631_0173697 Ga0495631_0173697_14_499 161
1547 3300046518 Ga0495631_0205993 Ga0495631_0205993_267_776 161
1548 3300046519 Ga0495632_0000347 Ga0495632_0000347_11278_11787 161
1549 3300046519 Ga0495632_0019297 Ga0495632_0019297_3144_3653 161
1550 3300046519 Ga0495632_0062337 Ga0495632_0062337_608_1093 161
1551 3300046520 Ga0495637_0117180 Ga0495637_0117180_115_600 161
1552 3300046522 Ga0495643_0015286 Ga0495643_0015286_1771_2280 161
1553 3300046522 Ga0495643_0027853 Ga0495643_0027853_818_1303 161
1554 3300046529 Ga0495652_0429760 Ga0495652_0429760_61_570 161
1555 3300046530 Ga0495654_0000143 Ga0495654_0000143_8584_9093 161
1556 3300046530 Ga0495654_0034316 Ga0495654_0034316_1134_1643 161
1557 3300046536 Ga0495587_0140782 Ga0495587_0140782_520_1029 161
1558 3300046538 Ga0495609_0030102 Ga0495609_0030102_1679_2164 161
1559 3300046538 Ga0495609_0047745 Ga0495609_0047745_128_637 161
1560 3300046557 Ga0495622_0025118 Ga0495622_0025118_84_593 161
1561 3300046557 Ga0495622_0115690 Ga0495622_0115690_703_1212 161
1562 3300046558 Ga0495633_0067416 Ga0495633_0067416_135_644 161
1563 3300046615 Ga0495656_0122164 Ga0495656_0122164_115_600 161
1564 3300046615 Ga0495656_0486606 Ga0495656_0486606_29_538 161
1565 3300046615 Ga0495656_0618489 Ga0495656_0618489_48_557 161
1566 3300046616 Ga0495668_0035633 Ga0495668_0035633_357_866 161
1567 3300046616 Ga0495668_0094268 Ga0495668_0094268_397_882 161
1568 3300046616 Ga0495668_0138825 Ga0495668_0138825_433_918 161
1569 3300046660 Ga0495625_0032377 Ga0495625_0032377_850_1335 161
1570 3300046660 Ga0495625_0171839 Ga0495625_0171839_727_1239 161
1571 3300046660 Ga0495625_0267893 Ga0495625_0267893_35_520 161
1572 3300046663 Ga0495635_0124869 Ga0495635_0124869_454_963 161
1573 3300046665 Ga0495661_0032290 Ga0495661_0032290_1277_1786 161
1574 3300046683 Ga0495658_0115609 Ga0495658_0115609_806_1315 161
1575 3300046691 Ga0495670_0013105 Ga0495670_0013105_2823_3308 161
1576 3300046692 Ga0495671_0033323 Ga0495671_0033323_1023_1532 161
1577 3300046810 Ga0495660_0080875 Ga0495660_0080875_401_910 161
1578 3300047317 Ga0495604_0019395 Ga0495604_0019395_2599_3108 161
1579 3300047318 Ga0495636_0091956 Ga0495636_0091956_534_1019 161
1580 3300047320 Ga0495672_0110440 Ga0495672_0110440_575_1060 161
1581 3300047321 Ga0495676_0819074 Ga0495676_0819074_93_578 161
1582 3300047443 Ga0495687_070586 Ga0495687_070586_213_698 161
1583 3300047445 Ga0495677_0195012 Ga0495677_0195012_219_704 161
1584 3300047470 Ga0495681_0091967 Ga0495681_0091967_782_1267 161
1585 3300047470 Ga0495681_0117388 Ga0495681_0117388_578_1087 161
1586 3300047472 Ga0495686_0000922 Ga0495686_0000922_33518_34027 161
1587 3300047472 Ga0495686_0002075 Ga0495686_0002075_7581_8090 161
1588 3300047472 Ga0495686_0006491 Ga0495686_0006491_5404_5913 161
1589 3300047472 Ga0495686_0033990 Ga0495686_0033990_167_652 161
1590 3300047472 Ga0495686_0093608 Ga0495686_0093608_642_1127 161
1591 3300048088 Ga0495602_0304557 Ga0495602_0304557_267_776 161
1592 3300048091 Ga0495626_0147980 Ga0495626_0147980_288_797 161
1593 3300048905 Ga0496102_0352497 Ga0496102_0352497_714_1199 161
1594 3300048905 Ga0496102_1758046 Ga0496102_1758046_32_517 161
1595 3300048906 Ga0496103_0178336 Ga0496103_0178336_333_818 161
1596 3300048907 Ga0496104_0261376 Ga0496104_0261376_599_1084 161
1597 3300048909 Ga0496106_1270917 Ga0496106_1270917_47_556 161
1598 3300048912 Ga0496109_0513229 Ga0496109_0513229_104_589 161
1599 3300048913 Ga0496110_0533748 Ga0496110_0533748_94_579 161
1600 3300048914 Ga0496111_0000447 Ga0496111_0000447_16999_17484 161
1601 3300048914 Ga0496111_0853401 Ga0496111_0853401_62_559 161
1602 3300048915 Ga0496112_0042936 Ga0496112_0042936_189_674 161
1603 3300048915 Ga0496112_0218361 Ga0496112_0218361_1111_1596 161
1604 3300048918 Ga0496115_0051128 Ga0496115_0051128_29_574 161
1605 3300048918 Ga0496115_0333921 Ga0496115_0333921_619_1104 161
1606 3300048919 Ga0496116_0000057 Ga0496116_0000057_148990_149505 161
1607 3300048919 Ga0496116_0004102 Ga0496116_0004102_8124_8633 161
1608 3300048919 Ga0496116_0005154 Ga0496116_0005154_9167_9652 161
1609 3300048919 Ga0496116_0155737 Ga0496116_0155737_51_560 161
1610 3300048920 Ga0496117_0000031 Ga0496117_0000031_259197_259706 161
1611 3300048920 Ga0496117_0001716 Ga0496117_0001716_2969_3478 161
1612 3300048920 Ga0496117_0003198 Ga0496117_0003198_3367_3876 161
1613 3300048920 Ga0496117_0055346 Ga0496117_0055346_2214_2723 161
1614 3300048920 Ga0496117_0146975 Ga0496117_0146975_116_601 161
1615 3300048920 Ga0496117_0189855 Ga0496117_0189855_614_1123 161
1616 3300048921 Ga0496118_0000208 Ga0496118_0000208_3598_4107 161
1617 3300048921 Ga0496118_0014561 Ga0496118_0014561_3569_4078 161
1618 3300048921 Ga0496118_0026276 Ga0496118_0026276_2732_3241 161
1619 3300048921 Ga0496118_0039076 Ga0496118_0039076_159_644 161
1620 3300048921 Ga0496118_0043584 Ga0496118_0043584_355_840 161
1621 3300048921 Ga0496118_0053043 Ga0496118_0053043_1198_1683 161
1622 3300048921 Ga0496118_0101758 Ga0496118_0101758_497_1006 161
1623 3300048921 Ga0496118_0246096 Ga0496118_0246096_16_501 161
1624 3300048921 Ga0496118_0483954 Ga0496118_0483954_77_562 161
1625 3300048921 Ga0496118_0487981 Ga0496118_0487981_74_589 161
1626 3300048922 Ga0496119_0014917 Ga0496119_0014917_4925_5410 161
1627 3300048922 Ga0496119_0035101 Ga0496119_0035101_15_524 161
1628 3300048922 Ga0496119_0049554 Ga0496119_0049554_1754_2263 161
1629 3300048922 Ga0496119_0083457 Ga0496119_0083457_710_1195 161
1630 3300048922 Ga0496119_0088348 Ga0496119_0088348_1253_1738 161
1631 3300048922 Ga0496119_0118815 Ga0496119_0118815_317_826 161
1632 3300048922 Ga0496119_0232717 Ga0496119_0232717_64_549 161
1633 3300048922 Ga0496119_0468903 Ga0496119_0468903_35_520 161
1634 3300048923 Ga0496120_0001350 Ga0496120_0001350_23689_24198 161
1635 3300048923 Ga0496120_0001677 Ga0496120_0001677_13941_14426 161
1636 3300048923 Ga0496120_0114344 Ga0496120_0114344_253_738 161
1637 3300048923 Ga0496120_0130251 Ga0496120_0130251_460_969 161
1638 3300048923 Ga0496120_0139297 Ga0496120_0139297_569_1078 161
1639 3300048923 Ga0496120_0204615 Ga0496120_0204615_109_594 161
1640 3300048923 Ga0496120_0244623 Ga0496120_0244623_193_702 161
1641 3300048924 Ga0496121_0000034 Ga0496121_0000034_200853_201362 161
1642 3300048924 Ga0496121_0000888 Ga0496121_0000888_50563_51048 161
1643 3300048924 Ga0496121_0002668 Ga0496121_0002668_26145_26654 161
1644 3300048924 Ga0496121_0018567 Ga0496121_0018567_4134_4619 161
1645 3300048924 Ga0496121_0039767 Ga0496121_0039767_2354_2869 161
1646 3300048924 Ga0496121_0066030 Ga0496121_0066030_163_672 161
1647 3300048924 Ga0496121_0110599 Ga0496121_0110599_233_742 161
1648 3300048924 Ga0496121_0221325 Ga0496121_0221325_157_651 161
1649 3300048924 Ga0496121_0266623 Ga0496121_0266623_150_659 161
1650 3300048924 Ga0496121_0419085 Ga0496121_0419085_310_795 161
1651 3300048924 Ga0496121_0537548 Ga0496121_0537548_13_501 161
1652 3300048924 Ga0496121_0675887 Ga0496121_0675887_74_583 161
1653 3300048925 Ga0496122_0000023 Ga0496122_0000023_259185_259694 161
1654 3300048925 Ga0496122_0000082 Ga0496122_0000082_98795_99280 161
1655 3300048925 Ga0496122_0000286 Ga0496122_0000286_108603_109112 161
1656 3300048925 Ga0496122_0004894 Ga0496122_0004894_2157_2672 161
1657 3300048925 Ga0496122_0018350 Ga0496122_0018350_1678_2163 161
1658 3300048925 Ga0496122_0026286 Ga0496122_0026286_1662_2171 161
1659 3300048925 Ga0496122_0087471 Ga0496122_0087471_889_1374 161
1660 3300048925 Ga0496122_0095309 Ga0496122_0095309_22_507 161
1661 3300048925 Ga0496122_0170011 Ga0496122_0170011_809_1300 161
1662 3300048926 Ga0496123_0000027 Ga0496123_0000027_121342_121851 161
1663 3300048926 Ga0496123_0000066 Ga0496123_0000066_111429_111938 161
1664 3300048926 Ga0496123_0000067 Ga0496123_0000067_109880_110365 161
1665 3300048926 Ga0496123_0013117 Ga0496123_0013117_1607_2116 161
1666 3300048926 Ga0496123_0041094 Ga0496123_0041094_1261_1746 161
1667 3300048926 Ga0496123_0046501 Ga0496123_0046501_1615_2130 161
1668 3300048926 Ga0496123_0061041 Ga0496123_0061041_1792_2343 161
1669 3300048926 Ga0496123_0063420 Ga0496123_0063420_504_989 161
1670 3300048926 Ga0496123_0076632 Ga0496123_0076632_1378_1887 161
1671 3300048926 Ga0496123_0091216 Ga0496123_0091216_333_848 161
1672 3300048926 Ga0496123_0098893 Ga0496123_0098893_578_1087 161
1673 3300048927 Ga0496124_0000174 Ga0496124_0000174_108184_108669 161
1674 3300048927 Ga0496124_0003251 Ga0496124_0003251_9305_9814 161
1675 3300048927 Ga0496124_0006284 Ga0496124_0006284_9194_9679 161
1676 3300048927 Ga0496124_0009223 Ga0496124_0009223_3187_3696 161
1677 3300048927 Ga0496124_0015603 Ga0496124_0015603_6688_7197 161
1678 3300048927 Ga0496124_0022211 Ga0496124_0022211_895_1380 161
1679 3300048927 Ga0496124_0028978 Ga0496124_0028978_3302_3787 161
1680 3300048927 Ga0496124_0037583 Ga0496124_0037583_10_519 161
1681 3300048927 Ga0496124_0038925 Ga0496124_0038925_1834_2343 161
1682 3300048927 Ga0496124_0121559 Ga0496124_0121559_1484_2029 161
1683 3300048927 Ga0496124_0153605 Ga0496124_0153605_363_848 161
1684 3300048927 Ga0496124_0190362 Ga0496124_0190362_733_1242 161
1685 3300048927 Ga0496124_0218741 Ga0496124_0218741_327_824 161
1686 3300048927 Ga0496124_0307385 Ga0496124_0307385_78_575 161
1687 3300048928 Ga0496125_0000030 Ga0496125_0000030_173145_173654 161
1688 3300048928 Ga0496125_0000279 Ga0496125_0000279_94287_94784 161
1689 3300048928 Ga0496125_0000288 Ga0496125_0000288_30688_31197 161
1690 3300048928 Ga0496125_0006344 Ga0496125_0006344_9529_10014 161
1691 3300048928 Ga0496125_0061583 Ga0496125_0061583_1869_2378 161
1692 3300048928 Ga0496125_0077477 Ga0496125_0077477_736_1245 161
1693 3300048928 Ga0496125_0142884 Ga0496125_0142884_335_820 161
1694 3300048928 Ga0496125_0176690 Ga0496125_0176690_248_733 161
1695 3300048928 Ga0496125_0415216 Ga0496125_0415216_53_550 161
1696 3300048929 Ga0496126_0000115 Ga0496126_0000115_149077_149592 161
1697 3300048929 Ga0496126_0000258 Ga0496126_0000258_110802_111311 161
1698 3300048929 Ga0496126_0032272 Ga0496126_0032272_2161_2658 161
1699 3300048929 Ga0496126_0059518 Ga0496126_0059518_1880_2389 161
1700 3300048929 Ga0496126_0073711 Ga0496126_0073711_1068_1553 161
1701 3300048929 Ga0496126_0106372 Ga0496126_0106372_1204_1713 161
1702 3300048929 Ga0496126_0175746 Ga0496126_0175746_1285_1794 161
1703 3300048929 Ga0496126_0238009 Ga0496126_0238009_500_985 161
1704 3300048929 Ga0496126_0248570 Ga0496126_0248570_515_1000 161
1705 3300048929 Ga0496126_0297042 Ga0496126_0297042_691_1176 161
1706 3300048929 Ga0496126_0465308 Ga0496126_0465308_472_981 161
1707 3300048929 Ga0496126_1090073 Ga0496126_1090073_33_518 161
1708 3300049523 Ga0501300_019550 Ga0501300_019550_25_510 161
1709 3300049568 Ga0501031_0000831 Ga0501031_0000831_5055_5552 161
1710 3300049568 Ga0501031_0024325 Ga0501031_0024325_1843_2346 161
1711 3300049568 Ga0501031_0032259 Ga0501031_0032259_1318_1827 161
1712 3300049568 Ga0501031_0052719 Ga0501031_0052719_292_777 161
1713 3300049568 Ga0501031_0143196 Ga0501031_0143196_1020_1505 161
1714 3300049569 Ga0501032_0000019 Ga0501032_0000019_68532_69029 161
1715 3300049569 Ga0501032_0000102 Ga0501032_0000102_48029_48526 161
1716 3300049569 Ga0501032_0002196 Ga0501032_0002196_5405_5890 161
1717 3300049569 Ga0501032_0011699 Ga0501032_0011699_5093_5596 161
1718 3300049569 Ga0501032_0013398 Ga0501032_0013398_5260_5766 161
1719 3300049569 Ga0501032_0020932 Ga0501032_0020932_1366_1851 161
1720 3300049569 Ga0501032_0032000 Ga0501032_0032000_1879_2364 161
1721 3300049569 Ga0501032_0050455 Ga0501032_0050455_334_819 161
1722 3300049569 Ga0501032_0580689 Ga0501032_0580689_89_574 161
1723 3300049569 Ga0501032_0754517 Ga0501032_0754517_72_575 161
1724 3300049570 Ga0501033_0000133 Ga0501033_0000133_48031_48528 161
1725 3300049570 Ga0501033_0000185 Ga0501033_0000185_36745_37230 161
1726 3300049570 Ga0501033_0003165 Ga0501033_0003165_181_678 161
1727 3300049570 Ga0501033_0008082 Ga0501033_0008082_1983_2468 161
1728 3300049570 Ga0501033_0015786 Ga0501033_0015786_1241_1744 161
1729 3300049570 Ga0501033_0024075 Ga0501033_0024075_2978_3463 161
1730 3300049570 Ga0501033_0089980 Ga0501033_0089980_1681_2184 161
1731 3300049570 Ga0501033_0216610 Ga0501033_0216610_377_862 161
1732 3300049570 Ga0501033_0310137 Ga0501033_0310137_121_630 161
1733 3300049570 Ga0501033_0399009 Ga0501033_0399009_149_655 161
1734 3300049570 Ga0501033_0968875 Ga0501033_0968875_18_503 161
1735 3300049571 Ga0501034_0000130 Ga0501034_0000130_52932_53429 161
1736 3300049571 Ga0501034_0000296 Ga0501034_0000296_48029_48526 161
1737 3300049571 Ga0501034_0000611 Ga0501034_0000611_771_1268 161
1738 3300049571 Ga0501034_0011862 Ga0501034_0011862_8445_8942 161
1739 3300049571 Ga0501034_0013933 Ga0501034_0013933_1015_1500 161
1740 3300049571 Ga0501034_0033876 Ga0501034_0033876_3981_4484 161
1741 3300049571 Ga0501034_0056088 Ga0501034_0056088_2703_3188 161
1742 3300049571 Ga0501034_0089007 Ga0501034_0089007_2266_2751 161
1743 3300049571 Ga0501034_0111233 Ga0501034_0111233_440_949 161
1744 3300049571 Ga0501034_0125911 Ga0501034_0125911_469_954 161
1745 3300049571 Ga0501034_0168146 Ga0501034_0168146_438_923 161
1746 3300049571 Ga0501034_0207269 Ga0501034_0207269_464_970 161
1747 3300049571 Ga0501034_0392880 Ga0501034_0392880_331_831 161
1748 3300049571 Ga0501034_0395688 Ga0501034_0395688_165_650 161
1749 3300049571 Ga0501034_0406609 Ga0501034_0406609_343_828 161
1750 3300049571 Ga0501034_0618241 Ga0501034_0618241_416_901 161
1751 3300049571 Ga0501034_0738934 Ga0501034_0738934_352_837 161
1752 3300049571 Ga0501034_1208711 Ga0501034_1208711_94_579 161
1753 3300049571 Ga0501034_1458588 Ga0501034_1458588_21_506 161
1754 3300049572 Ga0501036_0000034 Ga0501036_0000034_48029_48526 161
1755 3300049572 Ga0501036_0020290 Ga0501036_0020290_3263_3769 161
1756 3300049572 Ga0501036_0024429 Ga0501036_0024429_3323_3826 161
1757 3300049572 Ga0501036_0030905 Ga0501036_0030905_3881_4378 161
1758 3300049572 Ga0501036_0061705 Ga0501036_0061705_1393_1899 161
1759 3300049572 Ga0501036_0115820 Ga0501036_0115820_826_1311 161
1760 3300049572 Ga0501036_0199776 Ga0501036_0199776_395_880 161
1761 3300049572 Ga0501036_0210707 Ga0501036_0210707_642_1127 161
1762 3300049572 Ga0501036_0945732 Ga0501036_0945732_38_532 161
1763 3300049573 Ga0501037_0000079 Ga0501037_0000079_48029_48526 161
1764 3300049573 Ga0501037_0000089 Ga0501037_0000089_72180_72665 161
1765 3300049573 Ga0501037_0023331 Ga0501037_0023331_3958_4455 161
1766 3300049573 Ga0501037_0039467 Ga0501037_0039467_2278_2781 161
1767 3300049573 Ga0501037_0082089 Ga0501037_0082089_1379_1864 161
1768 3300049573 Ga0501037_0216648 Ga0501037_0216648_427_936 161
1769 3300049573 Ga0501037_0444244 Ga0501037_0444244_236_721 161
1770 3300049573 Ga0501037_0602240 Ga0501037_0602240_41_541 161
1771 3300049574 Ga0501038_0000063 Ga0501038_0000063_39830_40327 161
1772 3300049574 Ga0501038_0000478 Ga0501038_0000478_15677_16174 161
1773 3300049574 Ga0501038_0008634 Ga0501038_0008634_3173_3679 161
1774 3300049574 Ga0501038_0028340 Ga0501038_0028340_582_1067 161
1775 3300049574 Ga0501038_0093901 Ga0501038_0093901_221_727 161
1776 3300049574 Ga0501038_0104265 Ga0501038_0104265_1035_1520 161
1777 3300049574 Ga0501038_0145772 Ga0501038_0145772_74_559 161
1778 3300049574 Ga0501038_0356263 Ga0501038_0356263_145_654 161
1779 3300049574 Ga0501038_0356932 Ga0501038_0356932_88_594 161
1780 3300049575 Ga0501039_0000028 Ga0501039_0000028_86140_86637 161
1781 3300049575 Ga0501039_0000058 Ga0501039_0000058_39830_40327 161
1782 3300049575 Ga0501039_0143657 Ga0501039_0143657_189_674 161
1783 3300049575 Ga0501039_0151499 Ga0501039_0151499_714_1199 161
1784 3300049575 Ga0501039_0477382 Ga0501039_0477382_420_905 161
1785 3300049575 Ga0501039_0520285 Ga0501039_0520285_282_767 161
1786 3300049576 Ga0501040_0336600 Ga0501040_0336600_455_958 161
1787 3300049577 Ga0501041_0529004 Ga0501041_0529004_234_737 161
1788 3300049578 Ga0501042_0675925 Ga0501042_0675925_168_665 161
1789 3300049579 Ga0501043_0000007 Ga0501043_0000007_138597_139082 161
1790 3300049579 Ga0501043_0000113 Ga0501043_0000113_72794_73291 161
1791 3300049579 Ga0501043_0000355 Ga0501043_0000355_20891_21388 161
1792 3300049579 Ga0501043_0023562 Ga0501043_0023562_2047_2550 161
1793 3300049579 Ga0501043_0107791 Ga0501043_0107791_1581_2066 161
1794 3300049579 Ga0501043_0150489 Ga0501043_0150489_1172_1681 161
1795 3300049579 Ga0501043_0377465 Ga0501043_0377465_400_885 161
1796 3300049579 Ga0501043_0422719 Ga0501043_0422719_194_679 161
1797 3300049580 Ga0501046_0074876 Ga0501046_0074876_280_783 161
1798 3300049581 Ga0501047_0000969 Ga0501047_0000969_8148_8645 161
1799 3300049581 Ga0501047_0005048 Ga0501047_0005048_4985_5488 161
1800 3300049581 Ga0501047_0009690 Ga0501047_0009690_4302_4787 161
1801 3300049581 Ga0501047_0014312 Ga0501047_0014312_2053_2538 161
1802 3300049581 Ga0501047_0022132 Ga0501047_0022132_592_1077 161
1803 3300049581 Ga0501047_0175568 Ga0501047_0175568_166_651 161
1804 3300049581 Ga0501047_0180407 Ga0501047_0180407_385_870 161
1805 3300049581 Ga0501047_0199065 Ga0501047_0199065_1022_1507 161
1806 3300049581 Ga0501047_0285388 Ga0501047_0285388_37_585 161
1807 3300049581 Ga0501047_0558421 Ga0501047_0558421_118_603 161
1808 3300049581 Ga0501047_0633710 Ga0501047_0633710_110_607 161
1809 3300049582 Ga0501048_0057912 Ga0501048_0057912_1371_1874 161
1810 3300049582 Ga0501048_0747413 Ga0501048_0747413_150_656 161
1811 3300049583 Ga0501067_0072755 Ga0501067_0072755_1210_1695 161
1812 3300049584 Ga0501068_0005603 Ga0501068_0005603_5106_5609 161
1813 3300049584 Ga0501068_0119051 Ga0501068_0119051_1096_1602 161
1814 3300049585 Ga0501069_0000001 Ga0501069_0000001_256104_256589 161
1815 3300049585 Ga0501069_0009230 Ga0501069_0009230_3097_3582 161
1816 3300049585 Ga0501069_0025263 Ga0501069_0025263_1977_2462 161
1817 3300049585 Ga0501069_0028526 Ga0501069_0028526_1277_1783 161
1818 3300049585 Ga0501069_0140327 Ga0501069_0140327_66_551 161
1819 3300049585 Ga0501069_0376150 Ga0501069_0376150_225_728 161
1820 3300049586 Ga0501070_0000789 Ga0501070_0000789_11362_11847 161
1821 3300049586 Ga0501070_0001012 Ga0501070_0001012_2837_3322 161
1822 3300049586 Ga0501070_0003595 Ga0501070_0003595_342_827 161
1823 3300049586 Ga0501070_0033843 Ga0501070_0033843_1496_1999 161
1824 3300049586 Ga0501070_0046330 Ga0501070_0046330_818_1303 161
1825 3300049586 Ga0501070_0061369 Ga0501070_0061369_1747_2232 161
1826 3300049586 Ga0501070_0076869 Ga0501070_0076869_1788_2273 161
1827 3300049586 Ga0501070_0102806 Ga0501070_0102806_115_621 161
1828 3300049586 Ga0501070_0133106 Ga0501070_0133106_1417_1914 161
1829 3300049586 Ga0501070_0252646 Ga0501070_0252646_289_777 161
1830 3300049586 Ga0501070_0833925 Ga0501070_0833925_185_670 161
1831 3300049586 Ga0501070_0847477 Ga0501070_0847477_124_630 161
1832 3300049587 Ga0501071_0047076 Ga0501071_0047076_2594_3079 161
1833 3300049587 Ga0501071_0803087 Ga0501071_0803087_30_515 161
1834 3300049588 Ga0501072_0544756 Ga0501072_0544756_32_517 161
1835 3300049588 Ga0501072_0851653 Ga0501072_0851653_184_681 161
1836 3300049589 Ga0501073_0011583 Ga0501073_0011583_5769_6254 161
1837 3300049589 Ga0501073_0034527 Ga0501073_0034527_1715_2206 161
1838 3300049589 Ga0501073_0164719 Ga0501073_0164719_11_517 161
1839 3300049589 Ga0501073_0264810 Ga0501073_0264810_231_716 161
1840 3300049590 Ga0501074_0000003 Ga0501074_0000003_13463_13948 161
1841 3300049590 Ga0501074_0012185 Ga0501074_0012185_2925_3410 161
1842 3300049590 Ga0501074_0032625 Ga0501074_0032625_650_1156 161
1843 3300049590 Ga0501074_0068543 Ga0501074_0068543_218_703 161
1844 3300049590 Ga0501074_0494006 Ga0501074_0494006_242_727 161
1845 3300049671 Ga0501238_046359 Ga0501238_046359_90_599 161
1846 3300049741 Ga0501079_1076655 Ga0501079_1076655_102_605 161
1847 3300049742 Ga0501080_0000090 Ga0501080_0000090_57026_57511 161
1848 3300049742 Ga0501080_0002221 Ga0501080_0002221_4379_4864 161
1849 3300049742 Ga0501080_0017506 Ga0501080_0017506_4937_5440 161
1850 3300049742 Ga0501080_0021242 Ga0501080_0021242_1327_1812 161
1851 3300049742 Ga0501080_0028515 Ga0501080_0028515_4081_4566 161
1852 3300049742 Ga0501080_0081908 Ga0501080_0081908_291_776 161
1853 3300049742 Ga0501080_0258070 Ga0501080_0258070_167_673 161
1854 3300049744 Ga0501083_0000012 Ga0501083_0000012_39430_39915 161
1855 3300049744 Ga0501083_0092675 Ga0501083_0092675_1383_1898 161
1856 3300049763 Ga0501266_014742 Ga0501266_014742_377_862 161
1857 3300049776 Ga0501280_001648 Ga0501280_001648_2455_2940 161
1858 3300049776 Ga0501280_001986 Ga0501280_001986_2375_2860 161
1859 3300049822 Ga0501035_0000037 Ga0501035_0000037_42841_43326 161
1860 3300049822 Ga0501035_0000143 Ga0501035_0000143_86124_86621 161
1861 3300049822 Ga0501035_0000203 Ga0501035_0000203_48031_48528 161
1862 3300049822 Ga0501035_0000529 Ga0501035_0000529_30727_31212 161
1863 3300049822 Ga0501035_0001061 Ga0501035_0001061_66_551 161
1864 3300049822 Ga0501035_0001616 Ga0501035_0001616_9459_9944 161
1865 3300049822 Ga0501035_0006787 Ga0501035_0006787_6898_7383 161
1866 3300049822 Ga0501035_0022057 Ga0501035_0022057_14_514 161
1867 3300049822 Ga0501035_0022420 Ga0501035_0022420_695_1198 161
1868 3300049822 Ga0501035_0073893 Ga0501035_0073893_899_1408 161
1869 3300049822 Ga0501035_0094304 Ga0501035_0094304_1061_1546 161
1870 3300049822 Ga0501035_0493833 Ga0501035_0493833_429_923 161
1871 3300049822 Ga0501035_0589024 Ga0501035_0589024_156_641 161
1872 3300049822 Ga0501035_0830144 Ga0501035_0830144_210_710 161
1873 3300049823 Ga0501044_0000018 Ga0501044_0000018_181867_182352 161
1874 3300049823 Ga0501044_0000142 Ga0501044_0000142_48029_48526 161
1875 3300049823 Ga0501044_0008899 Ga0501044_0008899_10330_10827 161
1876 3300049823 Ga0501044_0034593 Ga0501044_0034593_721_1227 161
1877 3300049823 Ga0501044_0038672 Ga0501044_0038672_4286_4771 161
1878 3300049823 Ga0501044_0050480 Ga0501044_0050480_3527_4012 161
1879 3300049823 Ga0501044_0094578 Ga0501044_0094578_1269_1772 161
1880 3300049823 Ga0501044_0188088 Ga0501044_0188088_1240_1743 161
1881 3300049823 Ga0501044_0307646 Ga0501044_0307646_299_796 161
1882 3300049823 Ga0501044_0314997 Ga0501044_0314997_351_836 161
1883 3300049823 Ga0501044_0316730 Ga0501044_0316730_104_613 161
1884 3300049823 Ga0501044_0316810 Ga0501044_0316810_608_1108 161
1885 3300049823 Ga0501044_0330106 Ga0501044_0330106_781_1266 161
1886 3300049823 Ga0501044_0405368 Ga0501044_0405368_107_610 161
1887 3300049823 Ga0501044_0465105 Ga0501044_0465105_219_704 161
1888 3300049823 Ga0501044_0660312 Ga0501044_0660312_283_768 161
1889 3300049823 Ga0501044_1002814 Ga0501044_1002814_124_609 161
1890 3300049824 Ga0501045_0001774 Ga0501045_0001774_4945_5448 161
1891 3300049824 Ga0501045_0317041 Ga0501045_0317041_205_702 161
1892 3300049824 Ga0501045_0745925 Ga0501045_0745925_148_633 161
1893 3300050489 nmdc:mga03683_201857_c1 nmdc:mga03683_201857_c1_108_593 161
1894 3300050489 nmdc:mga03683_208704_c1 nmdc:mga03683_208704_c1_56_541 161
1895 3300050489 nmdc:mga03683_3182_c1 nmdc:mga03683_3182_c1_363_848 161
1896 3300050489 nmdc:mga03683_328154_c1 nmdc:mga03683_328154_c1_187_672 161
1897 3300050489 nmdc:mga03683_6840_c1 nmdc:mga03683_6840_c1_1954_2463 161
1898 3300050489 nmdc:mga03683_811_c1 nmdc:mga03683_811_c1_7071_7580 161
1899 3300050490 nmdc:mga03n38_188260_c1 nmdc:mga03n38_188260_c1_496_981 161
1900 3300050490 nmdc:mga03n38_378752_c1 nmdc:mga03n38_378752_c1_229_714 161
1901 3300050490 nmdc:mga03n38_71982_c1 nmdc:mga03n38_71982_c1_506_991 161
1902 3300050490 nmdc:mga03n38_83643_c1 nmdc:mga03n38_83643_c1_387_896 161
1903 3300050491 nmdc:mga00v17_102223_c1 nmdc:mga00v17_102223_c1_1164_1673 161
1904 3300050491 nmdc:mga00v17_15_c1 nmdc:mga00v17_15_c1_7250_7759 161
1905 3300050491 nmdc:mga00v17_26228_c1 nmdc:mga00v17_26228_c1_2400_2909 161
1906 3300050491 nmdc:mga00v17_584912_c1 nmdc:mga00v17_584912_c1_123_677 161
1907 3300050491 nmdc:mga00v17_8647_c1 nmdc:mga00v17_8647_c1_3674_4159 161
1908 3300050491 nmdc:mga00v17_89_c1 nmdc:mga00v17_89_c1_42251_42736 161
1909 3300050492 nmdc:mga0yw44_140008_c1 nmdc:mga0yw44_140008_c1_1033_1518 161
1910 3300050492 nmdc:mga0yw44_183296_c1 nmdc:mga0yw44_183296_c1_209_694 161
1911 3300050492 nmdc:mga0yw44_23657_c1 nmdc:mga0yw44_23657_c1_1534_2043 161
1912 3300050492 nmdc:mga0yw44_401659_c1 nmdc:mga0yw44_401659_c1_377_862 161
1913 3300050492 nmdc:mga0yw44_5630_c1 nmdc:mga0yw44_5630_c1_525_1010 161
1914 3300050493 nmdc:mga0k408_308704_c1 nmdc:mga0k408_308704_c1_63_572 161
1915 3300050493 nmdc:mga0k408_375785_c1 nmdc:mga0k408_375785_c1_258_743 161
1916 3300050493 nmdc:mga0k408_588902_c1 nmdc:mga0k408_588902_c1_76_561 161
1917 3300050493 nmdc:mga0k408_6366_c1 nmdc:mga0k408_6366_c1_3577_4086 161
1918 3300050493 nmdc:mga0k408_77366_c1 nmdc:mga0k408_77366_c1_298_807 161
1919 3300050494 nmdc:mga06z11_126586_c1 nmdc:mga06z11_126586_c1_856_1341 161
1920 3300050494 nmdc:mga06z11_176227_c1 nmdc:mga06z11_176227_c1_310_825 161
1921 3300050494 nmdc:mga06z11_22195_c1 nmdc:mga06z11_22195_c1_1627_2136 161
1922 3300050494 nmdc:mga06z11_38443_c1 nmdc:mga06z11_38443_c1_800_1285 161
1923 3300050494 nmdc:mga06z11_48863_c1 nmdc:mga06z11_48863_c1_172_657 161
1924 3300050494 nmdc:mga06z11_48902_c1 nmdc:mga06z11_48902_c1_568_1053 161
1925 3300050494 nmdc:mga06z11_95147_c1 nmdc:mga06z11_95147_c1_419_928 161
1926 3300050495 nmdc:mga04h51_113833_c1 nmdc:mga04h51_113833_c1_429_914 161
1927 3300050495 nmdc:mga04h51_126921_c1 nmdc:mga04h51_126921_c1_103_612 161
1928 3300050495 nmdc:mga04h51_73206_c1 nmdc:mga04h51_73206_c1_421_906 161
1929 3300050495 nmdc:mga04h51_74946_c1 nmdc:mga04h51_74946_c1_11_496 161
1930 3300050496 nmdc:mga07m45_292368_c1 nmdc:mga07m45_292368_c1_432_917 161
1931 3300050496 nmdc:mga07m45_338145_c1 nmdc:mga07m45_338145_c1_370_855 161
1932 3300050496 nmdc:mga07m45_4831_c1 nmdc:mga07m45_4831_c1_1515_2000 161
1933 3300050496 nmdc:mga07m45_6173_c1 nmdc:mga07m45_6173_c1_2736_3245 161
1934 3300050516 nmdc:mga0sz30_2214_c2 nmdc:mga0sz30_2214_c2_1645_2154 161
1935 3300050516 nmdc:mga0sz30_2494_c1 nmdc:mga0sz30_2494_c1_359_868 161
1936 3300050516 nmdc:mga0sz30_4223_c1 nmdc:mga0sz30_4223_c1_1280_1789 161
1937 3300050516 nmdc:mga0sz30_65238_c1 nmdc:mga0sz30_65238_c1_377_862 161
1938 3300050516 nmdc:mga0sz30_74182_c1 nmdc:mga0sz30_74182_c1_362_847 161
1939 3300053077 Ga0495601_0143683 Ga0495601_0143683_903_1412 161
1940 3300053079 Ga0500610_0044800 Ga0500610_0044800_293_778 161
1941 3300053079 Ga0500610_0110793 Ga0500610_0110793_31_516 161
1942 3300053083 Ga0495655_0112419 Ga0495655_0112419_190_675 161
1943 3300053086 Ga0500578_0099734 Ga0500578_0099734_1133_1642 161
1944 3300053087 Ga0500643_025102 Ga0500643_025102_552_1064 161
1945 3300053108 Ga0500562_046931 Ga0500562_046931_322_807 161
1946 3300053109 Ga0500569_045348 Ga0500569_045348_196_705 161
1947 3300053116 Ga0500592_054822 Ga0500592_054822_67_552 161
1948 3300053119 Ga0500595_020626 Ga0500595_020626_1058_1543 161
1949 3300053122 Ga0500608_018114 Ga0500608_018114_1901_2386 161
1950 3300053125 Ga0500618_000528 Ga0500618_000528_8869_9378 161
1951 3300053125 Ga0500618_000573 Ga0500618_000573_14033_14542 161
1952 3300053125 Ga0500618_006786 Ga0500618_006786_1201_1710 161
1953 3300053125 Ga0500618_038091 Ga0500618_038091_205_714 161
1954 3300053134 Ga0500658_0002828 Ga0500658_0002828_6130_6639 161
1955 3300053134 Ga0500658_0100561 Ga0500658_0100561_445_930 161
1956 3300053136 Ga0500559_0012657 Ga0500559_0012657_199_693 161
1957 3300053137 Ga0500561_0000030 Ga0500561_0000030_3386_3895 161
1958 3300053139 Ga0500568_0000421 Ga0500568_0000421_15797_16282 161
1959 3300053139 Ga0500568_0000607 Ga0500568_0000607_11788_12273 161
1960 3300053139 Ga0500568_0000640 Ga0500568_0000640_6134_6619 161
1961 3300053140 Ga0500573_0013675 Ga0500573_0013675_3205_3714 161
1962 3300053140 Ga0500573_0024212 Ga0500573_0024212_470_979 161
1963 3300053148 Ga0500590_000839 Ga0500590_000839_1067_1576 161
1964 3300053151 Ga0500604_0000684 Ga0500604_0000684_8522_9019 161
1965 3300053151 Ga0500604_0015547 Ga0500604_0015547_449_934 161
1966 3300053151 Ga0500604_0050226 Ga0500604_0050226_18_503 161
1967 3300053153 Ga0500616_0000583 Ga0500616_0000583_29424_29933 161
1968 3300053153 Ga0500616_0001279 Ga0500616_0001279_7762_8247 161
1969 3300053153 Ga0500616_0027523 Ga0500616_0027523_327_812 161
1970 3300053153 Ga0500616_0048098 Ga0500616_0048098_641_1126 161
1971 3300053153 Ga0500616_0104269 Ga0500616_0104269_211_696 161
1972 3300053153 Ga0500616_0189142 Ga0500616_0189142_365_874 161
1973 3300053156 Ga0500622_0000541 Ga0500622_0000541_12554_13048 161
1974 3300053156 Ga0500622_0000962 Ga0500622_0000962_11832_12317 161
1975 3300053157 Ga0500624_001087 Ga0500624_001087_3963_4472 161
1976 3300053158 Ga0500627_0031040 Ga0500627_0031040_910_1395 161
1977 3300053161 Ga0500634_0062389 Ga0500634_0062389_315_824 161
1978 3300053177 Ga0500636_0000025 Ga0500636_0000025_51417_51932 161
1979 3300053727 Ga0500611_011078 Ga0500611_011078_609_1094 161
1980 3300059477 Ga0587084_012437 Ga0587084_012437_272_781 161
1981 3300059490 Ga0587066_012837 Ga0587066_012837_628_1137 161
1982 3300059490 Ga0587066_041647 Ga0587066_041647_85_594 161
1983 3300059491 Ga0587070_045005 Ga0587070_045005_267_776 161
1984 3300059492 Ga0587073_0020523 Ga0587073_0020523_275_784 161
1985 3300059492 Ga0587073_0210759 Ga0587073_0210759_12_521 161
1986 3300059493 Ga0587077_023247 Ga0587077_023247_338_847 161
1987 3300059493 Ga0587077_048248 Ga0587077_048248_383_868 161
1988 3300059493 Ga0587077_068672 Ga0587077_068672_266_775 161
1989 3300059493 Ga0587077_076300 Ga0587077_076300_264_749 161
1990 3300059503 Ga0587080_036364 Ga0587080_036364_97_606 161
1991 3300059503 Ga0587080_125430 Ga0587080_125430_27_512 161
1992 3300059504 Ga0587082_019304 Ga0587082_019304_310_819 161
1993 3300059504 Ga0587082_025181 Ga0587082_025181_182_727 161
1994 3300059505 Ga0587083_0031082 Ga0587083_0031082_271_780 161
1995 3300059507 Ga0587086_026272 Ga0587086_026272_86_595 161
1996 3300059508 Ga0587088_026264 Ga0587088_026264_278_787 161
1997 3300059508 Ga0587088_031222 Ga0587088_031222_373_882 161
1998 3300059510 Ga0587090_008592 Ga0587090_008592_591_1100 161
1999 3300059510 Ga0587090_020816 Ga0587090_020816_75_584 161
2000 3300059511 Ga0587091_047505 Ga0587091_047505_278_787 161
2001 3300059511 Ga0587091_127142 Ga0587091_127142_123_608 161
2002 3300059513 Ga0587094_027488 Ga0587094_027488_272_781 161
2003 3300059604 Ga0587098_019801 Ga0587098_019801_85_594 161
2004 3300059605 Ga0587106_029697 Ga0587106_029697_101_610 161
2005 3300059623 Ga0587101_017071 Ga0587101_017071_275_784 161
2006 3300059624 Ga0587109_050145 Ga0587109_050145_85_594 161
2007 3300059624 Ga0587109_142633 Ga0587109_142633_25_510 161
2008 3300059626 Ga0587115_015762 Ga0587115_015762_353_862 161
2009 3300059628 Ga0587122_009880 Ga0587122_009880_111_620 161
2010 3300059630 Ga0587128_013341 Ga0587128_013341_638_1147 161
2011 3300059630 Ga0587128_032618 Ga0587128_032618_275_784 161
2012 3300059639 Ga0587062_007581 Ga0587062_007581_680_1189 161
2013 3300059639 Ga0587062_031311 Ga0587062_031311_226_735 161
2014 3300059640 Ga0587067_033485 Ga0587067_033485_330_839 161
2015 3300059640 Ga0587067_038145 Ga0587067_038145_12_521 161
2016 3300059641 Ga0587068_012550 Ga0587068_012550_511_1020 161
2017 3300059643 Ga0587072_016120 Ga0587072_016120_50_559 161
2018 3300059643 Ga0587072_044876 Ga0587072_044876_86_595 161
2019 3300059643 Ga0587072_048542 Ga0587072_048542_271_780 161
2020 3300059643 Ga0587072_052449 Ga0587072_052449_254_739 161
2021 3300059644 Ga0587075_027659 Ga0587075_027659_275_784 161
2022 3300059644 Ga0587075_049075 Ga0587075_049075_100_585 161
2023 3300059645 Ga0587076_012829 Ga0587076_012829_476_985 161
2024 3300059647 Ga0587079_087446 Ga0587079_087446_198_683 161
2025 3300059649 Ga0587102_016744 Ga0587102_016744_12_521 161
2026 3300059652 Ga0587107_017107 Ga0587107_017107_86_595 161
2027 3300059652 Ga0587107_034344 Ga0587107_034344_12_497 161
2028 3300059653 Ga0587108_011115 Ga0587108_011115_12_521 161
2029 3300059655 Ga0587114_025361 Ga0587114_025361_86_595 161
2030 3300060346 Ga0587111_0052522 Ga0587111_0052522_330_815 161
2031 3300060353 Ga0501082_0034353 Ga0501082_0034353_381_896 161
2032 3300060353 Ga0501082_0088000 Ga0501082_0088000_1419_1904 161
2033 3300060353 Ga0501082_0786025 Ga0501082_0786025_24_509 161
2034 3300060353 Ga0501082_0896214 Ga0501082_0896214_268_753 161
2035 iso_pu_bacteria 2512047086 2512534537 161
2036 iso_pu_bacteria 2838675328 2838678599 161
2037 iso_pu_bacteria 2838724970 2838728379 161
2038 iso_pu_bacteria 2842298080 2842302590 161
2039 iso_pu_bacteria 2842357229 2842358908 161
2040 iso_pu_bacteria 2842502639 2842507558 161
2041 iso_pu_bacteria 2842509118 2842514728 161
2042 iso_pu_bacteria 2850079185 2850082587 161
2043 iso_pu_bacteria 2899845264 2899849371 161
2044 iso_pu_bacteria 2919166419 2919170517 161
2045 iso_pu_bacteria 2929138655 2929141885 161
2046 iso_pu_bacteria 2937078374 2937081991 161
2047 iso_pu_bacteria 2958064165 2958066714 161
2048 iso_pu_bacteria 2977530762 2977535138 161
2049 iso_pu_bacteria 2978969890 2978972680 161
2050 iso_pu_bacteria 2979089926 2979092606 161
2051 iso_pu_bacteria 2979095461 2979100003 161
2052 iso_pu_bacteria 2984587000 2984590932 161
2053 iso_pu_bacteria 3005445848 3005449808 161
2054 iso_pu_bacteria 8005645114 8005645158 161

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

35

171

0.97

PF02915

Rubrerythrin

Rubrerythrin

36

165

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fvb-assembly1.cif.gz_A crystal structure of ferritin (bacterioferritin) from brucella melitensis 0.9916 2 159
5zur-assembly1.cif.gz_B achromobacter dh1f bacterioferritin 0.9912 1 155
8sqq-assembly1.cif.gz_A crystal structure of bacterioferritin (bfr) from brucella abortus (apo cubic form 2, f16l mutant) 0.991 2 159
3bkn-assembly1.cif.gz_A the structure of mycobacterial bacterioferritin 0.9898 1 155
2wtl-assembly1.cif.gz_A crystal structure of bfra from m. tuberculosis 0.9884 2 155
ID Description Score Start End Superfamily
3fvbA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9916 2 159 1.20.1260.10
5zurA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9912 1 153 1.20.1260.10
3gvyA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9883 1 157 1.20.1260.10
5xx9B00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9872 1 157 1.20.1260.10
3uoix00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9867 1 155 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A1M3AFY0-F1-model_v4 deleted 1 1 141
AF-A0A167GY78-F1-model_v4 deleted 0.9985 1 139
AF-A0A258LLL3-F1-model_v4 Bacterioferritin 0.9979 1 133 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037
AF-A0A4R2CUK1-F1-model_v4 Bacterioferritin (EC 1.16.3.1) 0.996 1 156 GO:0004322
GO:0005829
GO:0006880
GO:0008199
GO:0015093
GO:0020037
AF-A0A258DYD7-F1-model_v4 Bacterioferritin 0.9956 1 118 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037

Feature Viewer

pLDDT pTM Quality
95.68 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map