F496324
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2054 | 1293 | 1153 | 161 |
Family's Representative Sequence
| Representative Sequence | 3300046460|Ga0495638_0426201|Ga0495638_0426201_45_611 |
| Length | 188 |
| Sequence | VPKRVRRTSFLTWIASGNCASNTGAGTKKGEKQVIERLNEALFLELGAVNQYWVHFRLLEDWGYTKLAKKERAESIEEMHHADRIVARIIFLEGHPNLQTLAPLRIGQNVKEVLESDLAGEYDARTSYRKSREICQELGDYVTMQLFEDLLKDEEGHIDFLETQLDLLADIGDGKYGQLNADSADEAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 3 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 4 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 5 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 6 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 7 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 8 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 9 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 10 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 11 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 12 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 13 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 14 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 15 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 16 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 17 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 18 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 19 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 20 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 21 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 22 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 23 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 24 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 25 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 26 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 27 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 28 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 29 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 30 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 31 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 32 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 33 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 34 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 35 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 36 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 37 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 38 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 39 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 40 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 41 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 42 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 43 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 44 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 45 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 46 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 47 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 48 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 49 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 50 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 51 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 52 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 53 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 54 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 55 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 56 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 57 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 58 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 59 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 60 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 61 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 62 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 63 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 64 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 65 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 66 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 67 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 68 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 69 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 70 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 71 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 72 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 73 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 74 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 75 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 76 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 77 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 78 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 79 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 80 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 81 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 82 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 83 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 84 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 85 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 86 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 87 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 88 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 89 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 90 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 91 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 92 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 93 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 94 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 95 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 96 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 97 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 98 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 99 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 100 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 101 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 102 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 103 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 104 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 105 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 106 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 107 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 108 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 109 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 110 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 111 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 112 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 113 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 114 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 115 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 116 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 117 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 118 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 119 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 120 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 121 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 122 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 123 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 124 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 125 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 126 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 127 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 128 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 129 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 130 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 131 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 132 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 133 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 134 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 135 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 136 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 137 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 138 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 139 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 140 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 141 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 142 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 143 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 144 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 145 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 146 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 147 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 148 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 149 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 150 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 151 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 152 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 153 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 154 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 155 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 156 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 157 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 158 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 159 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 160 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 161 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 162 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 163 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 164 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 165 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 166 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 167 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 168 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 169 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 170 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 171 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 172 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 173 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 174 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 175 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 176 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 177 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 178 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 179 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 180 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 181 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 182 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 183 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 184 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 185 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 186 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 187 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 188 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 189 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 190 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 191 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 192 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 193 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 194 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 195 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 196 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 197 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 198 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 199 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 200 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 201 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 202 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 203 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 204 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 205 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 206 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 207 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 208 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 209 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 210 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 211 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 212 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 213 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 214 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 215 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 216 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 217 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 218 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 219 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 220 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 221 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 222 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 223 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 224 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 225 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 226 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 227 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 228 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 229 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 230 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 231 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 232 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 233 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 234 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 235 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 236 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 237 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 238 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 239 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 240 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 241 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 242 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 243 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 244 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 245 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 246 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 247 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 248 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 249 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 250 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 251 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 252 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 253 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 254 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 255 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 256 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 257 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 258 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 259 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 260 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 261 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 262 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 263 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 264 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 265 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 266 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 267 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 268 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 269 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 270 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 271 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 272 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 273 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 274 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 275 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 276 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 277 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 278 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 279 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 280 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 281 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 282 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 283 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 284 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 285 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 286 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 287 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 288 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 289 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 290 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 291 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 292 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 293 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 294 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 295 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 296 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 297 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 298 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 299 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 300 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 301 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 302 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 303 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 304 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 305 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 306 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 307 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 308 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 309 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 310 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 311 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 312 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 313 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 314 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 315 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 316 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 317 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 318 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 319 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 320 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 321 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 322 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 323 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 324 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 325 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 326 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 327 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 328 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 329 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 330 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 331 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 332 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 333 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 334 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 335 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 336 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 337 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 338 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 339 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 340 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 341 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 342 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 343 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 344 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 345 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 346 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 347 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 348 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 349 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 350 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 351 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 352 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 353 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 354 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 355 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 356 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 357 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 358 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 359 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 360 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 361 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 362 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 363 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 364 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 365 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 366 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 367 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 368 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 369 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 370 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 371 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 372 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 373 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 374 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 375 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 376 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 377 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 378 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 379 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 380 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 381 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 382 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 383 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 384 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 385 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 386 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 387 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 388 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 389 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 390 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 391 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 392 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 393 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 394 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 395 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 396 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 397 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 398 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 399 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 400 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 401 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 402 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 403 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 404 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 405 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 406 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 407 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 408 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 409 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 410 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 411 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 412 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 413 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 414 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 415 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 416 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 417 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 418 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 419 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 420 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 421 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 422 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 423 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 424 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 425 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 426 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 427 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 428 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 429 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 430 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 431 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 432 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 433 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 434 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 435 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 436 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 437 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 438 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 439 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 440 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 441 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 442 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 443 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 444 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 445 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 446 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 447 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 448 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 449 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 450 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 451 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 452 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 453 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 454 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 455 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 456 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 457 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 458 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 459 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 460 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 461 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 462 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 463 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 464 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 465 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 466 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 467 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 468 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 469 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 470 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 471 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 472 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 473 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 474 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 475 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 476 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 477 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 478 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 479 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 480 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 481 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 482 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 483 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 484 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 485 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 486 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 487 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 488 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 489 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 490 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 491 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 492 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 493 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 494 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 495 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 496 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 497 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 498 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 499 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 500 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 501 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 502 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 503 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 504 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 505 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 506 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 507 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 508 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 509 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 510 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 511 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 512 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 513 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 514 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 515 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 516 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 517 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 518 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 519 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 520 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 521 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 522 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 523 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 524 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 525 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 526 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 527 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 528 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 529 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 530 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 531 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 532 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 533 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 534 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 535 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 536 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 537 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 538 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 539 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 540 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 541 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 542 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 543 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 544 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 545 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 546 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 547 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 548 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 549 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 550 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 551 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 552 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 553 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 554 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 555 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 556 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 557 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 558 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 559 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 560 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 561 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 562 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 563 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 564 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 565 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 566 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 567 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 568 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 569 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 570 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 571 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 572 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 573 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 574 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 575 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 576 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 577 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 578 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 579 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 580 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 581 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 582 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 583 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 584 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 585 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 586 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 587 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 588 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 589 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 590 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 591 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 592 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 593 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 594 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 595 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 596 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 597 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 598 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 599 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 600 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 601 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 602 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 603 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 604 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 605 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 606 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 607 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 608 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 609 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 610 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 611 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 612 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 613 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 614 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 615 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 616 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 617 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 618 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 619 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 620 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 621 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 622 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 623 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 624 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 625 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 626 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 627 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 628 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 629 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 630 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 631 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 632 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 633 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 634 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 635 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 636 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 637 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 638 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 639 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 640 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 641 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 642 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 643 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 644 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 645 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 646 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 647 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 648 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 649 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 650 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 651 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 652 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 653 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 654 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 655 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 656 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 657 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 658 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 659 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 660 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 661 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 662 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 663 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 664 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 665 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 666 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 667 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 668 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 669 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 670 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 671 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 672 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 673 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 674 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 675 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 676 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 677 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 678 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 679 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 680 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 681 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 682 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 683 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 684 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 685 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 686 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 687 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 688 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 689 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 690 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 691 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 692 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 693 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 694 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 695 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 696 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 697 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 698 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 699 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 700 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 701 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 702 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 703 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 704 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 705 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 706 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 707 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 708 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 709 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 710 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 711 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 712 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 713 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 714 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 715 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 716 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 717 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 718 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 719 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 720 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 721 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 722 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 723 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 724 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 725 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 726 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 727 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 728 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 729 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 730 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 731 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 732 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 733 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 734 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 735 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 736 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 737 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 738 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 739 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 740 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 741 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 742 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 743 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 744 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 745 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 746 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 747 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 748 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 749 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 750 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 751 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 752 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 753 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 754 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 755 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 756 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 757 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 758 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 759 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 760 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 761 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 762 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 763 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 764 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 765 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 766 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 767 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 768 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 769 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 770 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 771 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 772 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 773 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 774 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 775 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 776 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 777 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 778 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 779 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 780 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 781 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 782 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 783 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 784 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 785 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 786 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 787 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 788 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 789 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 790 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 791 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 792 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 793 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 794 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 795 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 796 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 797 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 798 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 799 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 800 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 801 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 802 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 803 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 804 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 805 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 806 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 807 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 808 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 809 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 810 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 811 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 812 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 813 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 814 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 815 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 816 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 817 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 818 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 819 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 820 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 821 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 822 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 823 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 824 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 825 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 826 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 827 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 828 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 829 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 830 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 831 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 832 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 833 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 834 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 835 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 836 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 837 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 838 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 839 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 840 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 841 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 842 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 843 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 844 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 845 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 846 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 847 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 848 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 849 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 850 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 851 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 852 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 853 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 854 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 855 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 856 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 857 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 858 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 859 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 860 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 861 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 862 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 863 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 864 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 865 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 866 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 867 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 868 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 869 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 870 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 871 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 872 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 873 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 874 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 875 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 876 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 877 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 878 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 879 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 880 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 881 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 882 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 883 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 884 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 885 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 886 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 887 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 888 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 889 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 890 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 891 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 892 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 893 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 894 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 895 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 896 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 897 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 898 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 899 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 900 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 901 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 902 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 903 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 904 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 905 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 906 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 907 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 908 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 909 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 910 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 911 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 912 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 913 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 914 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 915 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 916 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 917 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 918 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 919 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 920 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 921 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 922 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 923 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 924 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 925 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 926 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 927 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 928 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 929 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 930 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 931 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 932 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 933 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 934 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 935 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 936 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 937 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 938 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 939 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 940 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 941 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 942 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 943 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 944 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 945 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 946 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 947 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 948 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 949 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 950 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 951 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 952 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 953 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 954 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 955 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 956 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 957 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 958 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 959 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 960 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 961 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 962 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 963 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 964 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 965 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 966 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 967 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 968 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 969 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 970 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 971 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 972 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 973 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 974 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 975 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 976 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 977 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 978 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 979 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 980 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 981 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 982 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 983 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 984 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 985 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 986 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 987 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 988 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 989 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 990 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 991 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 992 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 993 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 994 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 995 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 996 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 997 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 998 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 999 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 1000 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 1001 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 1002 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 1003 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 1004 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 1005 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 1006 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 1007 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 1008 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 1009 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 1010 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 1011 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 1012 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 1013 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 1014 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 1015 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 1016 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 1017 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 1018 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 1019 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 1020 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 1021 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 1022 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 1023 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 1024 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 1025 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 1026 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 1027 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 1028 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 1029 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 1030 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 1031 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 1032 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 1033 | 3300041493 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaT | Metatranscriptome | Unclassified |
| 1034 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 1035 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 1036 | 3300041497 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT | Metatranscriptome | Unclassified |
| 1037 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 1038 | 3300041500 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaT | Metatranscriptome | Unclassified |
| 1039 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 1040 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 1041 | 3300041504 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaT | Metatranscriptome | Unclassified |
| 1042 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 1043 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 1044 | 3300041510 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT | Metatranscriptome | Unclassified |
| 1045 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 1046 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 1047 | 3300041907 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run | Metatranscriptome | Unclassified |
| 1048 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 1049 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 1050 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 1051 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 1052 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 1053 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 1054 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 1055 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 1056 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 1057 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 1058 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 1059 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 1060 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 1061 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 1062 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 1063 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 1064 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 1065 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 1066 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 1067 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 1068 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 1069 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 1070 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 1071 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 1072 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 1073 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 1074 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 1075 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 1076 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 1077 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 1078 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 1079 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 1080 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 1081 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 1082 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 1083 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 1084 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 1085 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 1086 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 1087 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 1088 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 1089 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 1090 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 1091 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 1092 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 1093 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 1094 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 1095 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 1096 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 1097 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 1098 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 1099 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 1100 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 1101 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 1102 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 1103 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 1104 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 1105 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 1106 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 1107 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 1108 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 1109 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 1110 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 1111 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 1112 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 1113 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 1114 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 1115 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 1116 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 1117 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 1118 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 1119 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 1120 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 1121 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 1122 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 1123 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 1124 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 1125 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 1126 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1127 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1128 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1129 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1130 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1131 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1132 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1133 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1134 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1135 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1136 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1137 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1138 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1139 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1140 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1141 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1142 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1143 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1144 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1145 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1146 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1147 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1148 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1149 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 1150 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1151 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1152 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1153 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 1154 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 1155 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1156 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1157 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1158 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 1159 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 1160 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 1161 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 1162 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 1163 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 1164 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 1165 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 1166 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 1167 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 1168 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 1169 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 1170 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 1171 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 1172 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 1173 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 1174 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 1175 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 1176 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 1177 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 1178 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 1179 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 1180 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 1181 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 1182 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 1183 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 1184 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 1185 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 1186 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 1187 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 1188 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 1189 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 1190 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 1191 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 1192 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1193 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1194 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1195 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1196 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1197 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1198 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1199 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1200 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1201 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1202 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1203 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1204 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1205 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1206 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1207 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1208 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1209 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1210 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1211 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1212 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1213 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1214 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1215 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1216 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1217 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1218 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1219 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1220 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1221 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1222 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1223 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1224 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1225 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 1226 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 1227 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 1228 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 1229 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 1230 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 1231 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 1232 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 1233 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 1234 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 1235 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 1236 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 1237 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 1238 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 1239 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 1240 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 1241 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 1242 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 1243 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 1244 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 1245 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 1246 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 1247 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 1248 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 1249 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 1250 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 1251 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 1252 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 1253 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 1254 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 1255 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 1256 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 1257 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 1258 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 1259 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 1260 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 1261 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 1262 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 1263 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 1264 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 1265 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 1266 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 1267 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 1268 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 1269 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 1270 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 1271 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 1272 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 1273 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 1274 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 1275 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1276 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 1277 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 1278 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 1279 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 1280 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 1281 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 1282 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 1283 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 1284 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1285 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 1286 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 1287 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 1288 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 1289 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1290 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1291 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 1292 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 1293 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 53.07 |
| Metatranscriptomes | 3.07 |
| Isolates | 43.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.24 |
| Bulb | 0 |
| Endosphere | 16.46 |
| Nodule | 33.89 |
| Rhizoplane | 1.51 |
| Rhizosphere | 33.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_FSXC2569_b1 | 2010549000 | Bacteria | 851 |
| 2 | JGI24741J21665_1062818 | 3300001915 | Bacteria | 549 |
| 3 | JGI24740J21852_10036962 | 3300001979 | Bacteria | 1511 |
| 4 | JGI24740J21852_10049384 | 3300001979 | Bacteria | 1216 |
| 5 | JGI24740J21852_10079623 | 3300001979 | Bacteria | 861 |
| 6 | JGI24740J21852_10108231 | 3300001979 | Bacteria | 703 |
| 7 | JGI24739J22299_10048442 | 3300001989 | Bacteria | 1382 |
| 8 | JGI24735J21928_10041271 | 3300002067 | Bacteria | 1345 |
| 9 | JGI25155J39150_1000018 | 3300002704 | Bacteria | 157606 |
| 10 | JGI25156J39149_1000140 | 3300002705 | Bacteria | 53384 |
| 11 | JGI25162J39368_1000253 | 3300002737 | Bacteria | 51894 |
| 12 | JGI25162J39368_1000485 | 3300002737 | Bacteria | 30412 |
| 13 | JGI25154J39366_1000069 | 3300002738 | Bacteria | 96438 |
| 14 | JGI25154J39366_1000161 | 3300002738 | Bacteria | 51880 |
| 15 | JGI25158J39367_1000014 | 3300002739 | Bacteria | 47475 |
| 16 | JGI25158J39367_1010618 | 3300002739 | Bacteria | 1241 |
| 17 | JGI25157J39369_1000108 | 3300002741 | Bacteria | 69980 |
| 18 | JGI25157J39369_1001286 | 3300002741 | Bacteria | 10081 |
| 19 | JGI25152J39213_1000229 | 3300002773 | Bacteria | 37906 |
| 20 | JGI25152J39213_1002877 | 3300002773 | Bacteria | 6157 |
| 21 | JGI25152J39213_1007990 | 3300002773 | Bacteria | 2674 |
| 22 | JGI25152J39213_1036572 | 3300002773 | Bacteria | 718 |
| 23 | JGI25150J39212_1000018 | 3300002774 | Bacteria | 146535 |
| 24 | JGI25159J45721_1000176 | 3300002987 | Bacteria | 29633 |
| 25 | JGI25159J45721_1000326 | 3300002987 | Bacteria | 22165 |
| 26 | JGI25159J45721_1001680 | 3300002987 | Bacteria | 8968 |
| 27 | JGI25151J46595_10000034 | 3300003187 | Bacteria | 192271 |
| 28 | JGI25151J46595_10001853 | 3300003187 | Bacteria | 13603 |
| 29 | JGI25151J46595_10002548 | 3300003187 | Bacteria | 10807 |
| 30 | JGI25151J46595_10004959 | 3300003187 | Bacteria | 6947 |
| 31 | JGI25151J46595_10006983 | 3300003187 | Bacteria | 5590 |
| 32 | JGI25151J46595_10016793 | 3300003187 | Bacteria | 3193 |
| 33 | JGI25151J46595_10024001 | 3300003187 | Bacteria | 2501 |
| 34 | JGI25406J46586_10022009 | 3300003203 | Bacteria | 2550 |
| 35 | JGI25165J46597_1000019 | 3300003214 | Bacteria | 371528 |
| 36 | JGI25165J46597_1000536 | 3300003214 | Bacteria | 35271 |
| 37 | JGI25165J46597_1001677 | 3300003214 | Bacteria | 10057 |
| 38 | JGI25165J46597_1003663 | 3300003214 | Bacteria | 3673 |
| 39 | JGI25153J46596_10009433 | 3300003215 | Bacteria | 4535 |
| 40 | JGI25153J46596_10013005 | 3300003215 | Bacteria | 3548 |
| 41 | JGI25153J46596_10016521 | 3300003215 | Bacteria | 2950 |
| 42 | JGI25153J46596_10093972 | 3300003215 | Bacteria | 718 |
| 43 | rootH2_10030154 | 3300003320 | Bacteria | 2246 |
| 44 | JGI25160J50197_1000027 | 3300003354 | Bacteria | 182809 |
| 45 | JGI25160J50197_1000051 | 3300003354 | Bacteria | 132923 |
| 46 | JGI25160J50197_1001076 | 3300003354 | Bacteria | 14001 |
| 47 | JGI25160J50197_1002609 | 3300003354 | Bacteria | 8313 |
| 48 | JGI25160J50197_1039569 | 3300003354 | Bacteria | 1102 |
| 49 | JGI25161J50226_1000011 | 3300003374 | Bacteria | 210140 |
| 50 | JGI25161J50226_1000038 | 3300003374 | Bacteria | 131804 |
| 51 | JGI25161J50226_1000757 | 3300003374 | Bacteria | 12368 |
| 52 | Ga0006562J51391_1012861 | 3300003578 | Bacteria | 1981 |
| 53 | Ga0006562J51391_1012870 | 3300003578 | Bacteria | 1930 |
| 54 | Ga0032354_1025696 | 3300003693 | Bacteria | 1194 |
| 55 | Ga0006780_1021509 | 3300003735 | Bacteria | 1174 |
| 56 | Ga0055542_1002133 | 3300003762 | Bacteria | 7218 |
| 57 | Ga0055529_1001568 | 3300003763 | Bacteria | 6426 |
| 58 | Ga0055526_1001048 | 3300003771 | Bacteria | 20191 |
| 59 | Ga0055526_1008864 | 3300003771 | Bacteria | 4940 |
| 60 | Ga0055526_1014842 | 3300003771 | Bacteria | 3170 |
| 61 | Ga0055526_1025515 | 3300003771 | Bacteria | 1895 |
| 62 | Ga0055526_1034323 | 3300003771 | Bacteria | 1388 |
| 63 | Ga0055526_1053599 | 3300003771 | Bacteria | 902 |
| 64 | Ga0055524_1004059 | 3300003775 | Bacteria | 6878 |
| 65 | Ga0055524_1006311 | 3300003775 | Bacteria | 5155 |
| 66 | Ga0055524_1012498 | 3300003775 | Bacteria | 3256 |
| 67 | Ga0055524_1025292 | 3300003775 | Bacteria | 1862 |
| 68 | Ga0055524_1038558 | 3300003775 | Bacteria | 1248 |
| 69 | Ga0055524_1048165 | 3300003775 | Bacteria | 996 |
| 70 | Ga0055536_1000540 | 3300003781 | Bacteria | 25879 |
| 71 | Ga0055536_1007552 | 3300003781 | Bacteria | 4841 |
| 72 | Ga0055528_1000884 | 3300003790 | Bacteria | 20244 |
| 73 | Ga0055528_1000979 | 3300003790 | Bacteria | 18966 |
| 74 | Ga0055528_1004196 | 3300003790 | Bacteria | 7000 |
| 75 | Ga0055528_1009005 | 3300003790 | Bacteria | 4213 |
| 76 | Ga0055528_1009863 | 3300003790 | Bacteria | 3947 |
| 77 | Ga0055530_10006351 | 3300003791 | Bacteria | 5303 |
| 78 | Ga0055540_1002302 | 3300003792 | Bacteria | 10267 |
| 79 | Ga0055540_1003597 | 3300003792 | Bacteria | 7401 |
| 80 | Ga0055540_1008610 | 3300003792 | Bacteria | 3652 |
| 81 | Ga0055540_1023085 | 3300003792 | Bacteria | 1575 |
| 82 | Ga0055540_1024202 | 3300003792 | Bacteria | 1511 |
| 83 | Ga0055540_1025163 | 3300003792 | Bacteria | 1463 |
| 84 | Ga0055531_10004904 | 3300003794 | Bacteria | 7961 |
| 85 | Ga0055531_10007527 | 3300003794 | Bacteria | 5916 |
| 86 | Ga0058692_1003317 | 3300003856 | Bacteria | 5004 |
| 87 | Ga0058692_1007328 | 3300003856 | Bacteria | 2938 |
| 88 | Ga0055543_1000030 | 3300004625 | Bacteria | 130849 |
| 89 | Ga0055543_1000041 | 3300004625 | Bacteria | 118501 |
| 90 | Ga0055543_1000317 | 3300004625 | Bacteria | 33524 |
| 91 | Ga0055543_1000416 | 3300004625 | Bacteria | 26883 |
| 92 | Ga0065165_1000133 | 3300005262 | Bacteria | 128540 |
| 93 | Ga0065165_1000135 | 3300005262 | Bacteria | 127785 |
| 94 | Ga0065165_1010834 | 3300005262 | Bacteria | 3885 |
| 95 | Ga0065165_1010844 | 3300005262 | Bacteria | 3881 |
| 96 | Ga0065704_10204987 | 3300005289 | Bacteria | 1131 |
| 97 | Ga0065712_10581084 | 3300005290 | Bacteria | 601 |
| 98 | Ga0070658_10276980 | 3300005327 | Bacteria | 1427 |
| 99 | Ga0070658_10391938 | 3300005327 | Bacteria | 1192 |
| 100 | Ga0070670_100000061 | 3300005331 | Bacteria | 113254 |
| 101 | Ga0070682_100639962 | 3300005337 | Bacteria | 845 |
| 102 | Ga0070660_100066880 | 3300005339 | Bacteria | 2799 |
| 103 | Ga0070660_100571327 | 3300005339 | Bacteria | 944 |
| 104 | Ga0070660_100584776 | 3300005339 | Bacteria | 933 |
| 105 | Ga0070660_101202324 | 3300005339 | Bacteria | 643 |
| 106 | Ga0070689_100578240 | 3300005340 | Bacteria | 971 |
| 107 | Ga0070668_100101702 | 3300005347 | Bacteria | 2278 |
| 108 | Ga0070668_100120935 | 3300005347 | Bacteria | 2093 |
| 109 | Ga0070668_100139712 | 3300005347 | Bacteria | 1951 |
| 110 | Ga0070669_100315714 | 3300005353 | Bacteria | 1261 |
| 111 | Ga0070671_100324784 | 3300005355 | Bacteria | 1311 |
| 112 | Ga0070673_101271477 | 3300005364 | Bacteria | 691 |
| 113 | Ga0070667_100295986 | 3300005367 | Bacteria | 1456 |
| 114 | Ga0070663_100052882 | 3300005455 | Bacteria | 2898 |
| 115 | Ga0070663_100171861 | 3300005455 | Bacteria | 1676 |
| 116 | Ga0070663_100243900 | 3300005455 | Bacteria | 1419 |
| 117 | Ga0070663_100847189 | 3300005455 | Bacteria | 787 |
| 118 | Ga0070678_100490727 | 3300005456 | Bacteria | 1082 |
| 119 | Ga0070662_100100915 | 3300005457 | Bacteria | 2184 |
| 120 | Ga0070662_100328016 | 3300005457 | Bacteria | 1250 |
| 121 | Ga0068867_100352987 | 3300005459 | Bacteria | 1228 |
| 122 | Ga0070698_101396742 | 3300005471 | Bacteria | 651 |
| 123 | Ga0070672_100405630 | 3300005543 | Bacteria | 1169 |
| 124 | Ga0070665_100013727 | 3300005548 | Bacteria | 8153 |
| 125 | Ga0070665_100060359 | 3300005548 | Bacteria | 3801 |
| 126 | Ga0070665_100093261 | 3300005548 | Bacteria | 3015 |
| 127 | Ga0070665_100103373 | 3300005548 | Bacteria | 2852 |
| 128 | Ga0070665_100204393 | 3300005548 | Bacteria | 1976 |
| 129 | Ga0070665_100361308 | 3300005548 | Bacteria | 1458 |
| 130 | Ga0070665_101440430 | 3300005548 | Bacteria | 698 |
| 131 | Ga0068855_100166759 | 3300005563 | Bacteria | 2496 |
| 132 | Ga0068855_101297718 | 3300005563 | Bacteria | 754 |
| 133 | Ga0068855_101448286 | 3300005563 | Bacteria | 707 |
| 134 | Ga0070664_100431911 | 3300005564 | Bacteria | 1207 |
| 135 | Ga0068854_100671069 | 3300005578 | Bacteria | 892 |
| 136 | Ga0068854_100728815 | 3300005578 | Bacteria | 858 |
| 137 | Ga0068854_100943801 | 3300005578 | Bacteria | 760 |
| 138 | Ga0068856_100357583 | 3300005614 | Bacteria | 1479 |
| 139 | Ga0068856_100726070 | 3300005614 | Bacteria | 1014 |
| 140 | Ga0068852_100257629 | 3300005616 | Bacteria | 1674 |
| 141 | Ga0068852_100501561 | 3300005616 | Bacteria | 1208 |
| 142 | Ga0068861_101180966 | 3300005719 | Bacteria | 739 |
| 143 | Ga0068851_10050731 | 3300005834 | Bacteria | 2107 |
| 144 | Ga0068870_10286210 | 3300005840 | Bacteria | 1035 |
| 145 | Ga0068860_101205441 | 3300005843 | Bacteria | 777 |
| 146 | Ga0081539_10000429 | 3300005985 | Bacteria | 89452 |
| 147 | Ga0075365_10000592 | 3300006038 | Bacteria | 14151 |
| 148 | Ga0075365_10004401 | 3300006038 | Bacteria | 7460 |
| 149 | Ga0075365_10009173 | 3300006038 | Bacteria | 5669 |
| 150 | Ga0075365_10023469 | 3300006038 | Bacteria | 3881 |
| 151 | Ga0075365_10067109 | 3300006038 | Bacteria | 2408 |
| 152 | Ga0075365_10094630 | 3300006038 | Bacteria | 2039 |
| 153 | Ga0075365_10104481 | 3300006038 | Bacteria | 1942 |
| 154 | Ga0075365_10182820 | 3300006038 | Bacteria | 1466 |
| 155 | Ga0075365_10234287 | 3300006038 | Bacteria | 1289 |
| 156 | Ga0075365_10258815 | 3300006038 | Bacteria | 1223 |
| 157 | Ga0075365_10305262 | 3300006038 | Bacteria | 1120 |
| 158 | Ga0075368_10001899 | 3300006042 | Bacteria | 6713 |
| 159 | Ga0075368_10046504 | 3300006042 | Bacteria | 1716 |
| 160 | Ga0075368_10056159 | 3300006042 | Bacteria | 1571 |
| 161 | Ga0075368_10072478 | 3300006042 | Bacteria | 1393 |
| 162 | Ga0075368_10099038 | 3300006042 | Bacteria | 1196 |
| 163 | Ga0075368_10177137 | 3300006042 | Bacteria | 898 |
| 164 | Ga0075363_100002706 | 3300006048 | Bacteria | 7334 |
| 165 | Ga0075363_100003123 | 3300006048 | Bacteria | 6956 |
| 166 | Ga0075363_100066180 | 3300006048 | Bacteria | 1955 |
| 167 | Ga0075363_100210933 | 3300006048 | Bacteria | 1111 |
| 168 | Ga0075363_100292789 | 3300006048 | Bacteria | 944 |
| 169 | Ga0075364_10000006 | 3300006051 | Bacteria | 86571 |
| 170 | Ga0075364_10011027 | 3300006051 | Bacteria | 5483 |
| 171 | Ga0075364_10054564 | 3300006051 | Bacteria | 2614 |
| 172 | Ga0075364_10130820 | 3300006051 | Bacteria | 1684 |
| 173 | Ga0075364_10242848 | 3300006051 | Bacteria | 1223 |
| 174 | Ga0075364_10253286 | 3300006051 | Bacteria | 1196 |
| 175 | Ga0075364_10497301 | 3300006051 | Bacteria | 833 |
| 176 | Ga0075364_10556888 | 3300006051 | Bacteria | 784 |
| 177 | Ga0075364_10670092 | 3300006051 | Bacteria | 708 |
| 178 | Ga0075362_10000510 | 3300006177 | Bacteria | 11371 |
| 179 | Ga0075362_10002423 | 3300006177 | Bacteria | 6259 |
| 180 | Ga0075362_10060693 | 3300006177 | Bacteria | 1709 |
| 181 | Ga0075362_10101501 | 3300006177 | Bacteria | 1346 |
| 182 | Ga0075362_10332784 | 3300006177 | Bacteria | 758 |
| 183 | Ga0075362_10423637 | 3300006177 | Bacteria | 673 |
| 184 | Ga0075367_10000418 | 3300006178 | Bacteria | 15724 |
| 185 | Ga0075367_10003403 | 3300006178 | Bacteria | 7583 |
| 186 | Ga0075367_10020967 | 3300006178 | Bacteria | 3647 |
| 187 | Ga0075367_10030824 | 3300006178 | Bacteria | 3077 |
| 188 | Ga0075367_10097782 | 3300006178 | Bacteria | 1791 |
| 189 | Ga0075367_10139884 | 3300006178 | Bacteria | 1499 |
| 190 | Ga0075367_10147096 | 3300006178 | Bacteria | 1461 |
| 191 | Ga0075367_10312120 | 3300006178 | Bacteria | 990 |
| 192 | Ga0075367_10322702 | 3300006178 | Bacteria | 973 |
| 193 | Ga0075367_10330042 | 3300006178 | Bacteria | 962 |
| 194 | Ga0075367_10360621 | 3300006178 | Bacteria | 918 |
| 195 | Ga0075367_10400875 | 3300006178 | Bacteria | 868 |
| 196 | Ga0075367_10658915 | 3300006178 | Bacteria | 665 |
| 197 | Ga0075367_10674073 | 3300006178 | Bacteria | 657 |
| 198 | Ga0075369_10006597 | 3300006186 | Bacteria | 4394 |
| 199 | Ga0075369_10016932 | 3300006186 | Bacteria | 2949 |
| 200 | Ga0075369_10036926 | 3300006186 | Bacteria | 2080 |
| 201 | Ga0075369_10084045 | 3300006186 | Bacteria | 1414 |
| 202 | Ga0075369_10409351 | 3300006186 | Bacteria | 640 |
| 203 | Ga0075366_10001216 | 3300006195 | Bacteria | 12781 |
| 204 | Ga0075366_10123373 | 3300006195 | Bacteria | 1562 |
| 205 | Ga0075366_10192516 | 3300006195 | Bacteria | 1239 |
| 206 | Ga0075366_10233157 | 3300006195 | Bacteria | 1122 |
| 207 | Ga0075366_10506088 | 3300006195 | Bacteria | 747 |
| 208 | Ga0075366_11022923 | 3300006195 | Bacteria | 516 |
| 209 | Ga0075370_10001979 | 3300006353 | Bacteria | 9280 |
| 210 | Ga0075370_10007019 | 3300006353 | Bacteria | 5712 |
| 211 | Ga0075370_10043874 | 3300006353 | Bacteria | 2528 |
| 212 | Ga0075370_10051128 | 3300006353 | Bacteria | 2344 |
| 213 | Ga0075370_10057045 | 3300006353 | Bacteria | 2219 |
| 214 | Ga0075370_10092246 | 3300006353 | Bacteria | 1748 |
| 215 | Ga0075370_10106112 | 3300006353 | Bacteria | 1629 |
| 216 | Ga0075370_10153797 | 3300006353 | Bacteria | 1348 |
| 217 | Ga0075370_10157872 | 3300006353 | Bacteria | 1330 |
| 218 | Ga0075370_10175669 | 3300006353 | Bacteria | 1260 |
| 219 | Ga0075370_10279551 | 3300006353 | Bacteria | 991 |
| 220 | Ga0079104_1000207 | 3300006946 | Bacteria | 82261 |
| 221 | Ga0079104_1004038 | 3300006946 | Bacteria | 6485 |
| 222 | Ga0079104_1008945 | 3300006946 | Bacteria | 3437 |
| 223 | Ga0099826_10000468 | 3300006948 | Bacteria | 19486 |
| 224 | Ga0105251_10025303 | 3300009011 | Bacteria | 3037 |
| 225 | Ga0105244_10053649 | 3300009036 | Bacteria | 2048 |
| 226 | Ga0105244_10070912 | 3300009036 | Bacteria | 1738 |
| 227 | Ga0105244_10299656 | 3300009036 | Bacteria | 744 |
| 228 | Ga0105250_10043784 | 3300009092 | Bacteria | 1794 |
| 229 | Ga0105250_10100239 | 3300009092 | Bacteria | 1181 |
| 230 | Ga0105240_10000142 | 3300009093 | Bacteria | 146932 |
| 231 | Ga0105240_10256742 | 3300009093 | Bacteria | 2018 |
| 232 | Ga0105240_10381420 | 3300009093 | Bacteria | 1592 |
| 233 | Ga0105240_10707692 | 3300009093 | Bacteria | 1099 |
| 234 | Ga0105240_11893129 | 3300009093 | Bacteria | 621 |
| 235 | Ga0105245_10775113 | 3300009098 | Bacteria | 996 |
| 236 | Ga0105247_10252899 | 3300009101 | Bacteria | 1205 |
| 237 | Ga0105243_10031735 | 3300009148 | Bacteria | 4075 |
| 238 | Ga0105243_10060917 | 3300009148 | Bacteria | 3016 |
| 239 | Ga0105243_10685295 | 3300009148 | Bacteria | 997 |
| 240 | Ga0105243_10890296 | 3300009148 | Bacteria | 885 |
| 241 | Ga0105243_11537287 | 3300009148 | Bacteria | 690 |
| 242 | Ga0105243_11624785 | 3300009148 | Bacteria | 673 |
| 243 | Ga0105241_10379515 | 3300009174 | Bacteria | 1235 |
| 244 | Ga0105248_10085321 | 3300009177 | Bacteria | 3553 |
| 245 | Ga0105248_10345475 | 3300009177 | Bacteria | 1675 |
| 246 | Ga0105237_10013922 | 3300009545 | Bacteria | 8416 |
| 247 | Ga0105237_10211542 | 3300009545 | Bacteria | 1939 |
| 248 | Ga0105237_11085200 | 3300009545 | Bacteria | 807 |
| 249 | Ga0105237_11517174 | 3300009545 | Bacteria | 677 |
| 250 | Ga0105238_10002270 | 3300009551 | Bacteria | 19365 |
| 251 | Ga0105238_10545309 | 3300009551 | Bacteria | 1164 |
| 252 | Ga0105238_10662712 | 3300009551 | Bacteria | 1054 |
| 253 | Ga0105238_11765302 | 3300009551 | Bacteria | 650 |
| 254 | Ga0105249_10195740 | 3300009553 | Bacteria | 1975 |
| 255 | Ga0105249_10215405 | 3300009553 | Bacteria | 1887 |
| 256 | Ga0105249_10562989 | 3300009553 | Bacteria | 1191 |
| 257 | Ga0123341_1000260 | 3300009765 | Bacteria | 28683 |
| 258 | Ga0123342_1011038 | 3300009766 | Bacteria | 10076 |
| 259 | Ga0123342_1023166 | 3300009766 | Bacteria | 4080 |
| 260 | Ga0105239_10001079 | 3300010375 | Bacteria | 37830 |
| 261 | Ga0105239_10136688 | 3300010375 | Bacteria | 2729 |
| 262 | Ga0105239_10209803 | 3300010375 | Bacteria | 2183 |
| 263 | Ga0105239_10341653 | 3300010375 | Bacteria | 1689 |
| 264 | Ga0105239_10543586 | 3300010375 | Bacteria | 1323 |
| 265 | Ga0105239_10580700 | 3300010375 | Bacteria | 1278 |
| 266 | Ga0105239_11522269 | 3300010375 | Bacteria | 773 |
| 267 | Ga0105246_10010820 | 3300011119 | Bacteria | 5653 |
| 268 | Ga0105246_10564924 | 3300011119 | Bacteria | 977 |
| 269 | Ga0157373_10031709 | 3300013100 | Bacteria | 3804 |
| 270 | Ga0157373_10143527 | 3300013100 | Bacteria | 1679 |
| 271 | Ga0157371_10000071 | 3300013102 | Bacteria | 164088 |
| 272 | Ga0157371_10283406 | 3300013102 | Bacteria | 1197 |
| 273 | Ga0157370_10000469 | 3300013104 | Bacteria | 50288 |
| 274 | Ga0157370_10007351 | 3300013104 | Bacteria | 12018 |
| 275 | Ga0157370_10073494 | 3300013104 | Bacteria | 3226 |
| 276 | Ga0157370_10194986 | 3300013104 | Bacteria | 1880 |
| 277 | Ga0157370_11330431 | 3300013104 | Bacteria | 647 |
| 278 | Ga0157369_10043197 | 3300013105 | Bacteria | 4914 |
| 279 | Ga0157369_10141547 | 3300013105 | Bacteria | 2545 |
| 280 | Ga0157369_10199524 | 3300013105 | Bacteria | 2100 |
| 281 | Ga0157369_10446502 | 3300013105 | Bacteria | 1339 |
| 282 | Ga0157369_10456722 | 3300013105 | Bacteria | 1323 |
| 283 | Ga0171463_1004 | 3300013249 | Bacteria | 437207 |
| 284 | Ga0157378_10224811 | 3300013297 | Bacteria | 1786 |
| 285 | Ga0163162_10136131 | 3300013306 | Bacteria | 2567 |
| 286 | Ga0163162_10281441 | 3300013306 | Bacteria | 1795 |
| 287 | Ga0163162_10589112 | 3300013306 | Bacteria | 1239 |
| 288 | Ga0157372_10257782 | 3300013307 | Bacteria | 2025 |
| 289 | Ga0157372_10416562 | 3300013307 | Bacteria | 1565 |
| 290 | Ga0157372_10858728 | 3300013307 | Bacteria | 1053 |
| 291 | Ga0157372_11409050 | 3300013307 | Bacteria | 803 |
| 292 | Ga0157372_11930094 | 3300013307 | Bacteria | 679 |
| 293 | Ga0157375_10398831 | 3300013308 | Bacteria | 1542 |
| 294 | Ga0163163_10285014 | 3300014325 | Bacteria | 1704 |
| 295 | Ga0182008_10038526 | 3300014497 | Bacteria | 2391 |
| 296 | Ga0182008_10045308 | 3300014497 | Bacteria | 2187 |
| 297 | Ga0182006_1044474 | 3300015261 | Bacteria | 1731 |
| 298 | Ga0182007_10002964 | 3300015262 | Bacteria | 8228 |
| 299 | Ga0182005_1023373 | 3300015265 | Bacteria | 1690 |
| 300 | Ga0183363_1306 | 3300015690 | Bacteria | 6749 |
| 301 | Ga0163161_10170499 | 3300017792 | Bacteria | 1664 |
| 302 | Ga0163161_10269258 | 3300017792 | Bacteria | 1333 |
| 303 | Ga0163161_10523387 | 3300017792 | Bacteria | 969 |
| 304 | Ga0214544_1000018 | 3300021320 | Bacteria | 187095 |
| 305 | Ga0214542_1001855 | 3300021321 | Bacteria | 43676 |
| 306 | Ga0214542_1016122 | 3300021321 | Bacteria | 7406 |
| 307 | Ga0214542_1017131 | 3300021321 | Bacteria | 6685 |
| 308 | Ga0214545_1057813 | 3300021324 | Bacteria | 656 |
| 309 | Ga0214543_1000005 | 3300021327 | Bacteria | 454523 |
| 310 | Ga0214543_1000015 | 3300021327 | Bacteria | 305679 |
| 311 | Ga0214543_1000016 | 3300021327 | Bacteria | 295257 |
| 312 | Ga0214543_1000195 | 3300021327 | Bacteria | 89886 |
| 313 | Ga0228711_1000004 | 3300022739 | Bacteria | 250146 |
| 314 | Ga0228710_1000264 | 3300022740 | Bacteria | 57413 |
| 315 | Ga0209435_100031 | 3300025206 | Bacteria | 164115 |
| 316 | Ga0209436_100013 | 3300025208 | Bacteria | 131492 |
| 317 | Ga0209436_104935 | 3300025208 | Bacteria | 3194 |
| 318 | Ga0209436_109069 | 3300025208 | Bacteria | 1925 |
| 319 | Ga0209672_103130 | 3300025228 | Bacteria | 3565 |
| 320 | Ga0209437_100179 | 3300025233 | Bacteria | 134210 |
| 321 | Ga0209437_100181 | 3300025233 | Bacteria | 132953 |
| 322 | Ga0209437_101277 | 3300025233 | Bacteria | 6820 |
| 323 | Ga0207425_1000035 | 3300025245 | Bacteria | 225942 |
| 324 | Ga0207425_1009611 | 3300025245 | Bacteria | 2396 |
| 325 | Ga0207425_1010263 | 3300025245 | Bacteria | 2287 |
| 326 | Ga0207425_1027973 | 3300025245 | Bacteria | 1146 |
| 327 | Ga0209646_1000102 | 3300025246 | Bacteria | 164115 |
| 328 | Ga0209646_1006752 | 3300025246 | Bacteria | 1910 |
| 329 | Ga0209646_1011821 | 3300025246 | Bacteria | 1347 |
| 330 | Ga0209026_1000013 | 3300025250 | Bacteria | 415633 |
| 331 | Ga0209026_1000096 | 3300025250 | Bacteria | 164115 |
| 332 | Ga0209677_100455 | 3300025253 | Bacteria | 23764 |
| 333 | Ga0209148_1000032 | 3300025254 | Bacteria | 557660 |
| 334 | Ga0209759_1000058 | 3300025256 | Bacteria | 203580 |
| 335 | Ga0209759_1000090 | 3300025256 | Bacteria | 164115 |
| 336 | Ga0209129_1000029 | 3300025258 | Bacteria | 401149 |
| 337 | Ga0209129_1000050 | 3300025258 | Bacteria | 267408 |
| 338 | Ga0209129_1000377 | 3300025258 | Bacteria | 36213 |
| 339 | Ga0209129_1002478 | 3300025258 | Bacteria | 9017 |
| 340 | Ga0209129_1003900 | 3300025258 | Bacteria | 6202 |
| 341 | Ga0209129_1005885 | 3300025258 | Bacteria | 4162 |
| 342 | Ga0209233_1000034 | 3300025261 | Bacteria | 578898 |
| 343 | Ga0209233_1000185 | 3300025261 | Bacteria | 133788 |
| 344 | Ga0209233_1000212 | 3300025261 | Bacteria | 110364 |
| 345 | Ga0209233_1000445 | 3300025261 | Bacteria | 28225 |
| 346 | Ga0209233_1005424 | 3300025261 | Bacteria | 4233 |
| 347 | Ga0209455_1000098 | 3300025272 | Bacteria | 213890 |
| 348 | Ga0209455_1007268 | 3300025272 | Bacteria | 3148 |
| 349 | Ga0209673_1000033 | 3300025273 | Bacteria | 335369 |
| 350 | Ga0209673_1000050 | 3300025273 | Bacteria | 285287 |
| 351 | Ga0209673_1000476 | 3300025273 | Bacteria | 66898 |
| 352 | Ga0209673_1001553 | 3300025273 | Bacteria | 20717 |
| 353 | Ga0209673_1001715 | 3300025273 | Bacteria | 18534 |
| 354 | Ga0209673_1003312 | 3300025273 | Bacteria | 9646 |
| 355 | Ga0209673_1009152 | 3300025273 | Bacteria | 4323 |
| 356 | Ga0209673_1010740 | 3300025273 | Bacteria | 3835 |
| 357 | Ga0209673_1029461 | 3300025273 | Bacteria | 1748 |
| 358 | Ga0209130_1000009 | 3300025284 | Bacteria | 498952 |
| 359 | Ga0209130_1000027 | 3300025284 | Bacteria | 327700 |
| 360 | Ga0209130_1000058 | 3300025284 | Bacteria | 210250 |
| 361 | Ga0209130_1007773 | 3300025284 | Bacteria | 3256 |
| 362 | Ga0209130_1008855 | 3300025284 | Bacteria | 2927 |
| 363 | Ga0209130_1033594 | 3300025284 | Bacteria | 1038 |
| 364 | Ga0209675_1014761 | 3300025291 | Bacteria | 2360 |
| 365 | Ga0209676_1000406 | 3300025292 | Bacteria | 77603 |
| 366 | Ga0209676_1003843 | 3300025292 | Bacteria | 8812 |
| 367 | Ga0209676_1010085 | 3300025292 | Bacteria | 3984 |
| 368 | Ga0209676_1045954 | 3300025292 | Bacteria | 1184 |
| 369 | Ga0209025_1000042 | 3300025294 | Bacteria | 370577 |
| 370 | Ga0209025_1000132 | 3300025294 | Bacteria | 197432 |
| 371 | Ga0209025_1000241 | 3300025294 | Bacteria | 128329 |
| 372 | Ga0209025_1000453 | 3300025294 | Bacteria | 80110 |
| 373 | Ga0209025_1001274 | 3300025294 | Bacteria | 34655 |
| 374 | Ga0209025_1002759 | 3300025294 | Bacteria | 17753 |
| 375 | Ga0209025_1008059 | 3300025294 | Bacteria | 7671 |
| 376 | Ga0209025_1022149 | 3300025294 | Bacteria | 3385 |
| 377 | Ga0209025_1048453 | 3300025294 | Bacteria | 1722 |
| 378 | Ga0209025_1076352 | 3300025294 | Bacteria | 1161 |
| 379 | Ga0209025_1148251 | 3300025294 | Bacteria | 652 |
| 380 | Ga0209564_1000111 | 3300025295 | Bacteria | 212210 |
| 381 | Ga0209564_1000227 | 3300025295 | Bacteria | 125497 |
| 382 | Ga0209564_1000284 | 3300025295 | Bacteria | 102684 |
| 383 | Ga0209564_1002155 | 3300025295 | Bacteria | 16608 |
| 384 | Ga0209564_1009667 | 3300025295 | Bacteria | 4554 |
| 385 | Ga0209564_1017086 | 3300025295 | Bacteria | 2850 |
| 386 | Ga0209758_1000255 | 3300025297 | Bacteria | 106892 |
| 387 | Ga0209758_1000406 | 3300025297 | Bacteria | 73962 |
| 388 | Ga0209758_1000563 | 3300025297 | Bacteria | 58374 |
| 389 | Ga0209758_1001039 | 3300025297 | Bacteria | 36357 |
| 390 | Ga0209758_1001297 | 3300025297 | Bacteria | 30633 |
| 391 | Ga0209758_1003074 | 3300025297 | Bacteria | 15852 |
| 392 | Ga0209758_1017669 | 3300025297 | Bacteria | 3535 |
| 393 | Ga0209758_1021428 | 3300025297 | Bacteria | 3013 |
| 394 | Ga0209758_1021657 | 3300025297 | Bacteria | 2988 |
| 395 | Ga0209758_1021673 | 3300025297 | Bacteria | 2986 |
| 396 | Ga0209758_1035760 | 3300025297 | Bacteria | 1952 |
| 397 | Ga0209758_1058408 | 3300025297 | Bacteria | 1290 |
| 398 | Ga0209050_1004183 | 3300025298 | Bacteria | 9993 |
| 399 | Ga0209050_1009264 | 3300025298 | Bacteria | 5070 |
| 400 | Ga0209256_1000361 | 3300025299 | Bacteria | 73723 |
| 401 | Ga0209256_1001149 | 3300025299 | Bacteria | 30019 |
| 402 | Ga0209256_1001517 | 3300025299 | Bacteria | 23446 |
| 403 | Ga0209256_1002615 | 3300025299 | Bacteria | 14241 |
| 404 | Ga0209256_1003137 | 3300025299 | Bacteria | 12038 |
| 405 | Ga0209256_1003810 | 3300025299 | Bacteria | 10107 |
| 406 | Ga0209256_1010847 | 3300025299 | Bacteria | 3746 |
| 407 | Ga0209256_1055479 | 3300025299 | Bacteria | 941 |
| 408 | Ga0209256_1081405 | 3300025299 | Bacteria | 707 |
| 409 | Ga0207426_1000041 | 3300025302 | Bacteria | 433536 |
| 410 | Ga0207426_1000072 | 3300025302 | Bacteria | 327700 |
| 411 | Ga0207426_1000131 | 3300025302 | Bacteria | 210250 |
| 412 | Ga0207426_1000214 | 3300025302 | Bacteria | 137296 |
| 413 | Ga0207426_1002342 | 3300025302 | Bacteria | 12374 |
| 414 | Ga0209051_1000118 | 3300025303 | Bacteria | 149426 |
| 415 | Ga0209051_1001684 | 3300025303 | Bacteria | 17792 |
| 416 | Ga0209051_1002434 | 3300025303 | Bacteria | 13370 |
| 417 | Ga0209051_1006052 | 3300025303 | Bacteria | 6906 |
| 418 | Ga0209051_1075092 | 3300025303 | Bacteria | 999 |
| 419 | Ga0209257_1001639 | 3300025304 | Bacteria | 25617 |
| 420 | Ga0209257_1001825 | 3300025304 | Bacteria | 23289 |
| 421 | Ga0209257_1003745 | 3300025304 | Bacteria | 12591 |
| 422 | Ga0209257_1032140 | 3300025304 | Bacteria | 1668 |
| 423 | Ga0209257_1039424 | 3300025304 | Bacteria | 1420 |
| 424 | Ga0209257_1094812 | 3300025304 | Bacteria | 738 |
| 425 | Ga0207656_10194928 | 3300025321 | Bacteria | 977 |
| 426 | Ga0207680_10795888 | 3300025903 | Bacteria | 678 |
| 427 | Ga0207647_10007088 | 3300025904 | Bacteria | 8131 |
| 428 | Ga0207645_10089984 | 3300025907 | Bacteria | 1974 |
| 429 | Ga0207643_10358138 | 3300025908 | Bacteria | 917 |
| 430 | Ga0207654_10029870 | 3300025911 | Bacteria | 2988 |
| 431 | Ga0207654_10080358 | 3300025911 | Bacteria | 1960 |
| 432 | Ga0207695_10000234 | 3300025913 | Bacteria | 146987 |
| 433 | Ga0207695_10071983 | 3300025913 | Bacteria | 3529 |
| 434 | Ga0207695_10331756 | 3300025913 | Bacteria | 1410 |
| 435 | Ga0207695_10847244 | 3300025913 | Bacteria | 794 |
| 436 | Ga0207695_11503466 | 3300025913 | Bacteria | 554 |
| 437 | Ga0207671_10000043 | 3300025914 | Bacteria | 206915 |
| 438 | Ga0207671_10023356 | 3300025914 | Bacteria | 4663 |
| 439 | Ga0207671_10671813 | 3300025914 | Bacteria | 824 |
| 440 | Ga0207657_10057261 | 3300025919 | Bacteria | 3359 |
| 441 | Ga0207657_10452758 | 3300025919 | Bacteria | 1007 |
| 442 | Ga0207681_10175757 | 3300025923 | Bacteria | 1627 |
| 443 | Ga0207681_10256917 | 3300025923 | Bacteria | 1366 |
| 444 | Ga0207694_10353883 | 3300025924 | Bacteria | 1216 |
| 445 | Ga0207650_10000207 | 3300025925 | Bacteria | 67267 |
| 446 | Ga0207687_10623780 | 3300025927 | Bacteria | 910 |
| 447 | Ga0207687_10745828 | 3300025927 | Bacteria | 833 |
| 448 | Ga0207706_10176921 | 3300025933 | Bacteria | 1874 |
| 449 | Ga0207686_10695319 | 3300025934 | Bacteria | 808 |
| 450 | Ga0207709_10145508 | 3300025935 | Bacteria | 1635 |
| 451 | Ga0207709_10224098 | 3300025935 | Bacteria | 1358 |
| 452 | Ga0207704_10513584 | 3300025938 | Bacteria | 968 |
| 453 | Ga0207691_10972252 | 3300025940 | Bacteria | 709 |
| 454 | Ga0207711_10479700 | 3300025941 | Bacteria | 1158 |
| 455 | Ga0207689_10418819 | 3300025942 | Bacteria | 1117 |
| 456 | Ga0207679_10591490 | 3300025945 | Bacteria | 999 |
| 457 | Ga0207667_10159711 | 3300025949 | Bacteria | 2319 |
| 458 | Ga0207667_10499075 | 3300025949 | Bacteria | 1235 |
| 459 | Ga0207667_10545953 | 3300025949 | Bacteria | 1172 |
| 460 | Ga0207712_10427121 | 3300025961 | Bacteria | 1119 |
| 461 | Ga0207668_10013360 | 3300025972 | Bacteria | 5053 |
| 462 | Ga0207668_10091320 | 3300025972 | Bacteria | 2238 |
| 463 | Ga0207668_10147887 | 3300025972 | Bacteria | 1815 |
| 464 | Ga0207668_10250865 | 3300025972 | Bacteria | 1437 |
| 465 | Ga0207668_10681340 | 3300025972 | Bacteria | 902 |
| 466 | Ga0207640_10283277 | 3300025981 | Bacteria | 1303 |
| 467 | Ga0207640_10444323 | 3300025981 | Bacteria | 1067 |
| 468 | Ga0207640_11023872 | 3300025981 | Bacteria | 727 |
| 469 | Ga0207639_10004025 | 3300026041 | Bacteria | 9917 |
| 470 | Ga0207639_10362850 | 3300026041 | Bacteria | 1297 |
| 471 | Ga0207639_10557684 | 3300026041 | Bacteria | 1052 |
| 472 | Ga0207678_10023129 | 3300026067 | Bacteria | 5438 |
| 473 | Ga0207678_10187876 | 3300026067 | Bacteria | 1765 |
| 474 | Ga0207678_10193094 | 3300026067 | Bacteria | 1740 |
| 475 | Ga0207678_10265126 | 3300026067 | Bacteria | 1472 |
| 476 | Ga0207678_10434387 | 3300026067 | Bacteria | 1140 |
| 477 | Ga0207702_10045234 | 3300026078 | Bacteria | 3703 |
| 478 | Ga0207702_10102227 | 3300026078 | Bacteria | 2532 |
| 479 | Ga0207702_10245482 | 3300026078 | Bacteria | 1679 |
| 480 | Ga0207648_10399153 | 3300026089 | Bacteria | 1246 |
| 481 | Ga0207674_10477297 | 3300026116 | Bacteria | 1205 |
| 482 | Ga0207674_11517631 | 3300026116 | Bacteria | 639 |
| 483 | Ga0207675_101350440 | 3300026118 | Bacteria | 733 |
| 484 | Ga0207683_10255124 | 3300026121 | Bacteria | 1601 |
| 485 | Ga0209281_1000028 | 3300027111 | Bacteria | 440027 |
| 486 | Ga0209281_1000030 | 3300027111 | Bacteria | 425931 |
| 487 | Ga0209281_1000857 | 3300027111 | Bacteria | 26596 |
| 488 | Ga0209371_1000037 | 3300027312 | Bacteria | 367074 |
| 489 | Ga0209371_1001614 | 3300027312 | Bacteria | 14629 |
| 490 | Ga0209371_1021804 | 3300027312 | Bacteria | 1545 |
| 491 | Ga0209983_1023367 | 3300027665 | Bacteria | 1298 |
| 492 | Ga0209282_1000004 | 3300027666 | Bacteria | 425931 |
| 493 | Ga0209282_1010364 | 3300027666 | Bacteria | 5896 |
| 494 | Ga0209813_10014181 | 3300027866 | Bacteria | 2143 |
| 495 | Ga0209813_10025670 | 3300027866 | Bacteria | 1697 |
| 496 | Ga0209813_10037922 | 3300027866 | Bacteria | 1454 |
| 497 | Ga0209813_10286423 | 3300027866 | Bacteria | 636 |
| 498 | Ga0268266_10009893 | 3300028379 | Bacteria | 8381 |
| 499 | Ga0268266_10027268 | 3300028379 | Bacteria | 4858 |
| 500 | Ga0268266_10036851 | 3300028379 | Bacteria | 4166 |
| 501 | Ga0268266_10056837 | 3300028379 | Bacteria | 3366 |
| 502 | Ga0268266_10112977 | 3300028379 | Bacteria | 2408 |
| 503 | Ga0268266_10289288 | 3300028379 | Bacteria | 1526 |
| 504 | Ga0268266_10827908 | 3300028379 | Bacteria | 894 |
| 505 | Ga0307515_10000136 | 3300028794 | Bacteria | 174265 |
| 506 | Ga0307515_10001840 | 3300028794 | Bacteria | 47276 |
| 507 | Ga0307515_10003402 | 3300028794 | Bacteria | 33496 |
| 508 | Ga0307515_10050525 | 3300028794 | Bacteria | 6224 |
| 509 | Ga0307515_10186903 | 3300028794 | Bacteria | 1998 |
| 510 | Ga0307515_10342304 | 3300028794 | Bacteria | 1147 |
| 511 | Ga0307515_10496673 | 3300028794 | Bacteria | 831 |
| 512 | Ga0268256_1000039 | 3300030500 | Bacteria | 354969 |
| 513 | Ga0268256_1032238 | 3300030500 | Bacteria | 1250 |
| 514 | Ga0268256_1042016 | 3300030500 | Bacteria | 1017 |
| 515 | Ga0316181_1054311 | 3300030744 | Bacteria | 709 |
| 516 | Ga0307513_10010967 | 3300031456 | Bacteria | 11309 |
| 517 | Ga0307513_10377852 | 3300031456 | Bacteria | 1157 |
| 518 | Ga0307408_100012911 | 3300031548 | Bacteria | 5538 |
| 519 | Ga0307408_100230484 | 3300031548 | Bacteria | 1517 |
| 520 | Ga0307408_100469156 | 3300031548 | Bacteria | 1096 |
| 521 | Ga0316579_10374278 | 3300031691 | Bacteria | 689 |
| 522 | Ga0307516_10060302 | 3300031730 | Bacteria | 3687 |
| 523 | Ga0307405_10000203 | 3300031731 | Bacteria | 21655 |
| 524 | Ga0307405_10053789 | 3300031731 | Bacteria | 2510 |
| 525 | Ga0307405_10492615 | 3300031731 | Bacteria | 981 |
| 526 | Ga0307405_10612896 | 3300031731 | Bacteria | 890 |
| 527 | Ga0307405_10723009 | 3300031731 | Bacteria | 827 |
| 528 | Ga0307413_10307820 | 3300031824 | Bacteria | 1204 |
| 529 | Ga0307413_10552463 | 3300031824 | Bacteria | 934 |
| 530 | Ga0307410_10211898 | 3300031852 | Bacteria | 1485 |
| 531 | Ga0307410_10634021 | 3300031852 | Bacteria | 895 |
| 532 | Ga0307406_10019753 | 3300031901 | Bacteria | 3958 |
| 533 | Ga0307406_10691522 | 3300031901 | Bacteria | 851 |
| 534 | Ga0307406_10967503 | 3300031901 | Bacteria | 728 |
| 535 | Ga0307407_10299958 | 3300031903 | Bacteria | 1120 |
| 536 | Ga0307407_11088364 | 3300031903 | Bacteria | 621 |
| 537 | Ga0307412_10000671 | 3300031911 | Bacteria | 19855 |
| 538 | Ga0307412_10050105 | 3300031911 | Bacteria | 2755 |
| 539 | Ga0307412_10224860 | 3300031911 | Bacteria | 1441 |
| 540 | Ga0307412_10496624 | 3300031911 | Bacteria | 1015 |
| 541 | Ga0307412_10866104 | 3300031911 | Bacteria | 789 |
| 542 | Ga0315914_1000001 | 3300031967 | Bacteria | 416633 |
| 543 | Ga0307409_100122337 | 3300031995 | Bacteria | 2207 |
| 544 | Ga0307409_100234209 | 3300031995 | Bacteria | 1667 |
| 545 | Ga0307409_100811955 | 3300031995 | Bacteria | 944 |
| 546 | Ga0307409_101057072 | 3300031995 | Bacteria | 832 |
| 547 | Ga0307409_102230496 | 3300031995 | Bacteria | 577 |
| 548 | Ga0307416_100210294 | 3300032002 | Bacteria | 1855 |
| 549 | Ga0307416_100314458 | 3300032002 | Bacteria | 1565 |
| 550 | Ga0307416_100702315 | 3300032002 | Bacteria | 1101 |
| 551 | Ga0307416_101145900 | 3300032002 | Bacteria | 883 |
| 552 | Ga0307416_101435017 | 3300032002 | Bacteria | 796 |
| 553 | Ga0307414_10054702 | 3300032004 | Bacteria | 2791 |
| 554 | Ga0307414_10294614 | 3300032004 | Bacteria | 1369 |
| 555 | Ga0307414_10364487 | 3300032004 | Bacteria | 1244 |
| 556 | Ga0307414_10452460 | 3300032004 | Bacteria | 1126 |
| 557 | Ga0307414_10822952 | 3300032004 | Bacteria | 848 |
| 558 | Ga0307411_10574965 | 3300032005 | Bacteria | 965 |
| 559 | Ga0315913_1000364 | 3300033430 | Bacteria | 38616 |
| 560 | Ga0315915_1000002 | 3300033464 | Bacteria | 425854 |
| 561 | Ga0373935_0164347 | 3300035692 | Bacteria | 1515 |
| 562 | Ga0373935_0284707 | 3300035692 | Bacteria | 1164 |
| 563 | Ga0373935_1466639 | 3300035692 | Bacteria | 510 |
| 564 | Ga0373927_0000074 | 3300035695 | Bacteria | 72943 |
| 565 | Ga0373925_0008542 | 3300037068 | Bacteria | 7463 |
| 566 | Ga0395899_0000014 | 3300037312 | Bacteria | 488813 |
| 567 | Ga0395899_0578189 | 3300037312 | Bacteria | 718 |
| 568 | Ga0395900_0000007 | 3300037418 | Bacteria | 488860 |
| 569 | Ga0395900_0256182 | 3300037418 | Bacteria | 1749 |
| 570 | Ga0395900_0287462 | 3300037418 | Bacteria | 1634 |
| 571 | Ga0395900_0487374 | 3300037418 | Bacteria | 1185 |
| 572 | Ga0395900_0534583 | 3300037418 | Bacteria | 1119 |
| 573 | Ga0395900_0656906 | 3300037418 | Bacteria | 985 |
| 574 | Ga0395898_0000011 | 3300037466 | Bacteria | 488860 |
| 575 | Ga0395898_0066132 | 3300037466 | Bacteria | 3504 |
| 576 | Ga0395898_0170613 | 3300037466 | Bacteria | 2080 |
| 577 | Ga0395898_0845855 | 3300037466 | Bacteria | 854 |
| 578 | Ga0395905_0000008 | 3300037471 | Bacteria | 488860 |
| 579 | Ga0395905_0003609 | 3300037471 | Bacteria | 16455 |
| 580 | Ga0395905_0062829 | 3300037471 | Bacteria | 3473 |
| 581 | Ga0395905_0081757 | 3300037471 | Bacteria | 3027 |
| 582 | Ga0395905_0087746 | 3300037471 | Bacteria | 2916 |
| 583 | Ga0395905_0184733 | 3300037471 | Bacteria | 1957 |
| 584 | Ga0395905_0198464 | 3300037471 | Bacteria | 1881 |
| 585 | Ga0395901_0000020 | 3300038443 | Bacteria | 314918 |
| 586 | Ga0395901_0203247 | 3300038443 | Bacteria | 2076 |
| 587 | Ga0395901_0418062 | 3300038443 | Bacteria | 1375 |
| 588 | Ga0395901_0735369 | 3300038443 | Bacteria | 981 |
| 589 | Ga0395901_1494359 | 3300038443 | Bacteria | 632 |
| 590 | Ga0439465_0002198 | 3300041413 | Bacteria | 6395 |
| 591 | Ga0439465_0028181 | 3300041413 | Bacteria | 1780 |
| 592 | Ga0439465_0196135 | 3300041413 | Bacteria | 734 |
| 593 | Ga0439465_0216688 | 3300041413 | Bacteria | 701 |
| 594 | Ga0439465_0249916 | 3300041413 | Bacteria | 656 |
| 595 | Ga0451787_031617 | 3300041441 | Bacteria | 2785 |
| 596 | Ga0451789_0616123 | 3300041443 | Bacteria | 636 |
| 597 | Ga0451790_41710 | 3300041444 | Bacteria | 835 |
| 598 | Ga0451791_0907373 | 3300041451 | Bacteria | 1697 |
| 599 | Ga0451791_1393878 | 3300041451 | Bacteria | 975 |
| 600 | Ga0451797_1310432 | 3300041453 | Bacteria | 819 |
| 601 | Ga0451833_1319809 | 3300041491 | Bacteria | 1021 |
| 602 | Ga0451835_0218371 | 3300041492 | Bacteria | 723 |
| 603 | Ga0451836_13108 | 3300041493 | Bacteria | 932 |
| 604 | Ga0451837_0471602 | 3300041494 | Bacteria | 1174 |
| 605 | Ga0451837_0562295 | 3300041494 | Bacteria | 2544 |
| 606 | Ga0451839_0562329 | 3300041496 | Bacteria | 581 |
| 607 | Ga0451840_28572 | 3300041497 | Bacteria | 1023 |
| 608 | Ga0451841_0541929 | 3300041498 | Bacteria | 1181 |
| 609 | Ga0451841_0881634 | 3300041498 | Bacteria | 1298 |
| 610 | Ga0451844_02159 | 3300041500 | Bacteria | 1056 |
| 611 | Ga0451845_0753293 | 3300041501 | Bacteria | 802 |
| 612 | Ga0451847_0228755 | 3300041503 | Bacteria | 2112 |
| 613 | Ga0451847_0469452 | 3300041503 | Bacteria | 846 |
| 614 | Ga0451848_06670 | 3300041504 | Bacteria | 799 |
| 615 | Ga0451851_0283834 | 3300041507 | Bacteria | 922 |
| 616 | Ga0451851_0517594 | 3300041507 | Bacteria | 2003 |
| 617 | Ga0451843_1214210 | 3300041509 | Bacteria | 1028 |
| 618 | Ga0451854_30503 | 3300041510 | Bacteria | 1210 |
| 619 | Ga0451855_0216161 | 3300041511 | Bacteria | 3739 |
| 620 | Ga0451855_0278802 | 3300041511 | Bacteria | 1015 |
| 621 | Ga0451853_2686657 | 3300041512 | Bacteria | 2451 |
| 622 | Ga0452268_02506 | 3300041907 | Bacteria | 944 |
| 623 | Ga0452268_31546 | 3300041907 | Bacteria | 746 |
| 624 | Ga0439441_059889 | 3300042001 | Bacteria | 800 |
| 625 | Ga0439442_105887 | 3300042002 | Bacteria | 611 |
| 626 | Ga0439445_0044398 | 3300042004 | Bacteria | 1187 |
| 627 | Ga0439432_049090 | 3300042006 | Bacteria | 1320 |
| 628 | Ga0439449_0020537 | 3300042007 | Bacteria | 2474 |
| 629 | Ga0450900_023943 | 3300042136 | Bacteria | 864 |
| 630 | Ga0439458_0050942 | 3300042157 | Bacteria | 1022 |
| 631 | Ga0439434_0006200 | 3300042435 | Bacteria | 3489 |
| 632 | Ga0450918_000624 | 3300042531 | Bacteria | 7595 |
| 633 | Ga0466972_0039301 | 3300044658 | Bacteria | 2309 |
| 634 | Ga0466965_0155215 | 3300044683 | Bacteria | 1198 |
| 635 | Ga0466965_0174919 | 3300044683 | Bacteria | 1131 |
| 636 | Ga0466968_0156700 | 3300044735 | Bacteria | 1049 |
| 637 | Ga0466968_0514774 | 3300044735 | Bacteria | 597 |
| 638 | Ga0466970_0640706 | 3300044765 | Bacteria | 618 |
| 639 | Ga0466960_0112323 | 3300044901 | Bacteria | 1417 |
| 640 | Ga0466959_0395808 | 3300045049 | Bacteria | 939 |
| 641 | Ga0451576_1303413 | 3300045051 | Bacteria | 757 |
| 642 | Ga0495629_0037852 | 3300046459 | Bacteria | 3399 |
| 643 | Ga0495638_0000110 | 3300046460 | Bacteria | 131410 |
| 644 | Ga0495638_0012945 | 3300046460 | Bacteria | 5695 |
| 645 | Ga0495638_0028199 | 3300046460 | Bacteria | 3627 |
| 646 | Ga0495638_0426201 | 3300046460 | Bacteria | 683 |
| 647 | Ga0495638_0465294 | 3300046460 | Bacteria | 643 |
| 648 | Ga0495650_0095593 | 3300046471 | Bacteria | 1123 |
| 649 | Ga0495605_0008847 | 3300046474 | Bacteria | 5677 |
| 650 | Ga0495662_0004122 | 3300046476 | Bacteria | 7322 |
| 651 | Ga0495585_0008442 | 3300046492 | Bacteria | 6242 |
| 652 | Ga0495585_0245939 | 3300046492 | Bacteria | 894 |
| 653 | Ga0495596_0025403 | 3300046500 | Bacteria | 2394 |
| 654 | Ga0495607_0023917 | 3300046501 | Bacteria | 3817 |
| 655 | Ga0495583_0025141 | 3300046506 | Bacteria | 2980 |
| 656 | Ga0495583_0141152 | 3300046506 | Bacteria | 1003 |
| 657 | Ga0495583_0383331 | 3300046506 | Bacteria | 553 |
| 658 | Ga0495606_0001739 | 3300046507 | Bacteria | 27980 |
| 659 | Ga0495606_0015600 | 3300046507 | Bacteria | 5843 |
| 660 | Ga0495606_0234470 | 3300046507 | Bacteria | 1027 |
| 661 | Ga0495610_0001935 | 3300046512 | Bacteria | 17840 |
| 662 | Ga0495610_0066907 | 3300046512 | Bacteria | 1690 |
| 663 | Ga0495620_0178898 | 3300046515 | Bacteria | 820 |
| 664 | Ga0495631_0173697 | 3300046518 | Bacteria | 924 |
| 665 | Ga0495631_0205993 | 3300046518 | Bacteria | 841 |
| 666 | Ga0495632_0000347 | 3300046519 | Bacteria | 44084 |
| 667 | Ga0495632_0019297 | 3300046519 | Bacteria | 3718 |
| 668 | Ga0495632_0062337 | 3300046519 | Bacteria | 1808 |
| 669 | Ga0495637_0063642 | 3300046520 | Bacteria | 1507 |
| 670 | Ga0495637_0117180 | 3300046520 | Bacteria | 1028 |
| 671 | Ga0495643_0015286 | 3300046522 | Bacteria | 4539 |
| 672 | Ga0495643_0027853 | 3300046522 | Bacteria | 3171 |
| 673 | Ga0495652_0429760 | 3300046529 | Bacteria | 929 |
| 674 | Ga0495654_0000143 | 3300046530 | Bacteria | 74495 |
| 675 | Ga0495654_0034316 | 3300046530 | Bacteria | 2561 |
| 676 | Ga0495587_0140782 | 3300046536 | Bacteria | 1377 |
| 677 | Ga0495609_0030102 | 3300046538 | Bacteria | 2471 |
| 678 | Ga0495609_0047745 | 3300046538 | Bacteria | 1915 |
| 679 | Ga0495622_0025118 | 3300046557 | Bacteria | 2783 |
| 680 | Ga0495622_0115690 | 3300046557 | Bacteria | 1226 |
| 681 | Ga0495633_0067416 | 3300046558 | Bacteria | 1671 |
| 682 | Ga0495656_0122164 | 3300046615 | Bacteria | 1231 |
| 683 | Ga0495656_0486606 | 3300046615 | Bacteria | 653 |
| 684 | Ga0495656_0618489 | 3300046615 | Bacteria | 580 |
| 685 | Ga0495668_0035633 | 3300046616 | Bacteria | 2789 |
| 686 | Ga0495668_0094268 | 3300046616 | Bacteria | 1639 |
| 687 | Ga0495668_0138825 | 3300046616 | Bacteria | 1330 |
| 688 | Ga0495625_0032377 | 3300046660 | Bacteria | 3877 |
| 689 | Ga0495625_0171839 | 3300046660 | Bacteria | 1447 |
| 690 | Ga0495625_0267893 | 3300046660 | Bacteria | 1103 |
| 691 | Ga0495635_0124869 | 3300046663 | Bacteria | 1755 |
| 692 | Ga0495661_0032290 | 3300046665 | Bacteria | 3311 |
| 693 | Ga0495658_0115609 | 3300046683 | Bacteria | 1617 |
| 694 | Ga0495670_0013105 | 3300046691 | Bacteria | 4077 |
| 695 | Ga0495671_0033323 | 3300046692 | Bacteria | 2625 |
| 696 | Ga0495660_0080875 | 3300046810 | Bacteria | 1704 |
| 697 | Ga0495604_0019395 | 3300047317 | Bacteria | 5442 |
| 698 | Ga0495636_0091956 | 3300047318 | Bacteria | 1318 |
| 699 | Ga0495672_0110440 | 3300047320 | Bacteria | 1477 |
| 700 | Ga0495676_0819074 | 3300047321 | Bacteria | 599 |
| 701 | Ga0495687_070586 | 3300047443 | Bacteria | 1402 |
| 702 | Ga0495677_0195012 | 3300047445 | Bacteria | 787 |
| 703 | Ga0495681_0091967 | 3300047470 | Bacteria | 1338 |
| 704 | Ga0495681_0117388 | 3300047470 | Bacteria | 1146 |
| 705 | Ga0495686_0000922 | 3300047472 | Bacteria | 36620 |
| 706 | Ga0495686_0002075 | 3300047472 | Bacteria | 19695 |
| 707 | Ga0495686_0006491 | 3300047472 | Bacteria | 8938 |
| 708 | Ga0495686_0033990 | 3300047472 | Bacteria | 3287 |
| 709 | Ga0495686_0093608 | 3300047472 | Bacteria | 1822 |
| 710 | Ga0495602_0304557 | 3300048088 | Bacteria | 1165 |
| 711 | Ga0495626_0147980 | 3300048091 | Bacteria | 992 |
| 712 | Ga0496102_0352497 | 3300048905 | Bacteria | 1386 |
| 713 | Ga0496102_1758046 | 3300048905 | Bacteria | 537 |
| 714 | Ga0496103_0178336 | 3300048906 | Bacteria | 1365 |
| 715 | Ga0496104_0261376 | 3300048907 | Bacteria | 1644 |
| 716 | Ga0496106_1270917 | 3300048909 | Bacteria | 572 |
| 717 | Ga0496109_0513229 | 3300048912 | Bacteria | 1131 |
| 718 | Ga0496110_0533748 | 3300048913 | Bacteria | 1067 |
| 719 | Ga0496111_0000447 | 3300048914 | Bacteria | 20952 |
| 720 | Ga0496111_0853401 | 3300048914 | Bacteria | 657 |
| 721 | Ga0496112_0042936 | 3300048915 | Bacteria | 4425 |
| 722 | Ga0496112_0218361 | 3300048915 | Bacteria | 1863 |
| 723 | Ga0496115_0051128 | 3300048918 | Bacteria | 3313 |
| 724 | Ga0496115_0333921 | 3300048918 | Bacteria | 1238 |
| 725 | Ga0496116_0000057 | 3300048919 | Bacteria | 281652 |
| 726 | Ga0496116_0004102 | 3300048919 | Bacteria | 14061 |
| 727 | Ga0496116_0005154 | 3300048919 | Bacteria | 12270 |
| 728 | Ga0496116_0155737 | 3300048919 | Bacteria | 1261 |
| 729 | Ga0496117_0000031 | 3300048920 | Bacteria | 381048 |
| 730 | Ga0496117_0001716 | 3300048920 | Bacteria | 30323 |
| 731 | Ga0496117_0003198 | 3300048920 | Bacteria | 19389 |
| 732 | Ga0496117_0055346 | 3300048920 | Bacteria | 2772 |
| 733 | Ga0496117_0146975 | 3300048920 | Bacteria | 1402 |
| 734 | Ga0496117_0189855 | 3300048920 | Bacteria | 1171 |
| 735 | Ga0496118_0000208 | 3300048921 | Bacteria | 102645 |
| 736 | Ga0496118_0014561 | 3300048921 | Bacteria | 7353 |
| 737 | Ga0496118_0026276 | 3300048921 | Bacteria | 4966 |
| 738 | Ga0496118_0039076 | 3300048921 | Bacteria | 3792 |
| 739 | Ga0496118_0043584 | 3300048921 | Bacteria | 3524 |
| 740 | Ga0496118_0053043 | 3300048921 | Bacteria | 3087 |
| 741 | Ga0496118_0101758 | 3300048921 | Bacteria | 1939 |
| 742 | Ga0496118_0246096 | 3300048921 | Bacteria | 1020 |
| 743 | Ga0496118_0483954 | 3300048921 | Bacteria | 620 |
| 744 | Ga0496118_0487981 | 3300048921 | Bacteria | 616 |
| 745 | Ga0496119_0014917 | 3300048922 | Bacteria | 6039 |
| 746 | Ga0496119_0035101 | 3300048922 | Bacteria | 3291 |
| 747 | Ga0496119_0049554 | 3300048922 | Bacteria | 2595 |
| 748 | Ga0496119_0083457 | 3300048922 | Bacteria | 1835 |
| 749 | Ga0496119_0088348 | 3300048922 | Bacteria | 1767 |
| 750 | Ga0496119_0118815 | 3300048922 | Bacteria | 1456 |
| 751 | Ga0496119_0232717 | 3300048922 | Bacteria | 937 |
| 752 | Ga0496119_0468903 | 3300048922 | Bacteria | 590 |
| 753 | Ga0496120_0001350 | 3300048923 | Bacteria | 30183 |
| 754 | Ga0496120_0001677 | 3300048923 | Bacteria | 25420 |
| 755 | Ga0496120_0114344 | 3300048923 | Bacteria | 1405 |
| 756 | Ga0496120_0130251 | 3300048923 | Bacteria | 1289 |
| 757 | Ga0496120_0139297 | 3300048923 | Bacteria | 1233 |
| 758 | Ga0496120_0204615 | 3300048923 | Bacteria | 953 |
| 759 | Ga0496120_0244623 | 3300048923 | Bacteria | 845 |
| 760 | Ga0496121_0000034 | 3300048924 | Bacteria | 377095 |
| 761 | Ga0496121_0000888 | 3300048924 | Bacteria | 53958 |
| 762 | Ga0496121_0002668 | 3300048924 | Bacteria | 26718 |
| 763 | Ga0496121_0018567 | 3300048924 | Bacteria | 7005 |
| 764 | Ga0496121_0039767 | 3300048924 | Bacteria | 4136 |
| 765 | Ga0496121_0066030 | 3300048924 | Bacteria | 2940 |
| 766 | Ga0496121_0110599 | 3300048924 | Bacteria | 2096 |
| 767 | Ga0496121_0221325 | 3300048924 | Bacteria | 1333 |
| 768 | Ga0496121_0266623 | 3300048924 | Bacteria | 1179 |
| 769 | Ga0496121_0419085 | 3300048924 | Bacteria | 872 |
| 770 | Ga0496121_0537548 | 3300048924 | Bacteria | 734 |
| 771 | Ga0496121_0675887 | 3300048924 | Bacteria | 625 |
| 772 | Ga0496122_0000023 | 3300048925 | Bacteria | 381035 |
| 773 | Ga0496122_0000082 | 3300048925 | Bacteria | 209159 |
| 774 | Ga0496122_0000286 | 3300048925 | Bacteria | 112940 |
| 775 | Ga0496122_0004894 | 3300048925 | Bacteria | 16255 |
| 776 | Ga0496122_0018350 | 3300048925 | Bacteria | 6473 |
| 777 | Ga0496122_0026286 | 3300048925 | Bacteria | 5022 |
| 778 | Ga0496122_0087471 | 3300048925 | Bacteria | 2140 |
| 779 | Ga0496122_0095309 | 3300048925 | Bacteria | 2011 |
| 780 | Ga0496122_0170011 | 3300048925 | Bacteria | 1315 |
| 781 | Ga0496123_0000027 | 3300048926 | Bacteria | 306773 |
| 782 | Ga0496123_0000066 | 3300048926 | Bacteria | 210327 |
| 783 | Ga0496123_0000067 | 3300048926 | Bacteria | 209159 |
| 784 | Ga0496123_0013117 | 3300048926 | Bacteria | 6990 |
| 785 | Ga0496123_0041094 | 3300048926 | Bacteria | 3210 |
| 786 | Ga0496123_0046501 | 3300048926 | Bacteria | 2943 |
| 787 | Ga0496123_0061041 | 3300048926 | Bacteria | 2426 |
| 788 | Ga0496123_0063420 | 3300048926 | Bacteria | 2361 |
| 789 | Ga0496123_0076632 | 3300048926 | Bacteria | 2057 |
| 790 | Ga0496123_0091216 | 3300048926 | Bacteria | 1808 |
| 791 | Ga0496123_0098893 | 3300048926 | Bacteria | 1704 |
| 792 | Ga0496124_0000174 | 3300048927 | Bacteria | 129228 |
| 793 | Ga0496124_0003251 | 3300048927 | Bacteria | 20064 |
| 794 | Ga0496124_0006284 | 3300048927 | Bacteria | 12983 |
| 795 | Ga0496124_0009223 | 3300048927 | Bacteria | 10176 |
| 796 | Ga0496124_0015603 | 3300048927 | Bacteria | 7270 |
| 797 | Ga0496124_0022211 | 3300048927 | Bacteria | 5824 |
| 798 | Ga0496124_0028978 | 3300048927 | Bacteria | 4942 |
| 799 | Ga0496124_0037583 | 3300048927 | Bacteria | 4209 |
| 800 | Ga0496124_0038925 | 3300048927 | Bacteria | 4125 |
| 801 | Ga0496124_0121559 | 3300048927 | Bacteria | 2086 |
| 802 | Ga0496124_0153605 | 3300048927 | Bacteria | 1803 |
| 803 | Ga0496124_0190362 | 3300048927 | Bacteria | 1571 |
| 804 | Ga0496124_0218741 | 3300048927 | Bacteria | 1434 |
| 805 | Ga0496124_0307385 | 3300048927 | Bacteria | 1142 |
| 806 | Ga0496125_0000030 | 3300048928 | Bacteria | 375023 |
| 807 | Ga0496125_0000279 | 3300048928 | Bacteria | 102551 |
| 808 | Ga0496125_0000288 | 3300048928 | Bacteria | 99681 |
| 809 | Ga0496125_0006344 | 3300048928 | Bacteria | 12831 |
| 810 | Ga0496125_0061583 | 3300048928 | Bacteria | 3008 |
| 811 | Ga0496125_0077477 | 3300048928 | Bacteria | 2562 |
| 812 | Ga0496125_0142884 | 3300048928 | Bacteria | 1660 |
| 813 | Ga0496125_0176690 | 3300048928 | Bacteria | 1427 |
| 814 | Ga0496125_0415216 | 3300048928 | Bacteria | 782 |
| 815 | Ga0496126_0000115 | 3300048929 | Bacteria | 188546 |
| 816 | Ga0496126_0000258 | 3300048929 | Bacteria | 113843 |
| 817 | Ga0496126_0032272 | 3300048929 | Bacteria | 4935 |
| 818 | Ga0496126_0059518 | 3300048929 | Bacteria | 3440 |
| 819 | Ga0496126_0073711 | 3300048929 | Bacteria | 3034 |
| 820 | Ga0496126_0106372 | 3300048929 | Bacteria | 2448 |
| 821 | Ga0496126_0175746 | 3300048929 | Bacteria | 1821 |
| 822 | Ga0496126_0238009 | 3300048929 | Bacteria | 1522 |
| 823 | Ga0496126_0248570 | 3300048929 | Bacteria | 1483 |
| 824 | Ga0496126_0297042 | 3300048929 | Bacteria | 1334 |
| 825 | Ga0496126_0465308 | 3300048929 | Bacteria | 1015 |
| 826 | Ga0496126_1090073 | 3300048929 | Bacteria | 594 |
| 827 | Ga0501300_019550 | 3300049523 | Bacteria | 989 |
| 828 | Ga0501031_0000831 | 3300049568 | Bacteria | 18554 |
| 829 | Ga0501031_0024325 | 3300049568 | Bacteria | 3947 |
| 830 | Ga0501031_0032259 | 3300049568 | Bacteria | 3415 |
| 831 | Ga0501031_0052719 | 3300049568 | Bacteria | 2651 |
| 832 | Ga0501031_0143196 | 3300049568 | Bacteria | 1562 |
| 833 | Ga0501032_0000019 | 3300049569 | Bacteria | 155168 |
| 834 | Ga0501032_0000102 | 3300049569 | Bacteria | 72452 |
| 835 | Ga0501032_0002196 | 3300049569 | Bacteria | 15348 |
| 836 | Ga0501032_0011699 | 3300049569 | Bacteria | 6290 |
| 837 | Ga0501032_0013398 | 3300049569 | Bacteria | 5833 |
| 838 | Ga0501032_0020932 | 3300049569 | Bacteria | 4551 |
| 839 | Ga0501032_0032000 | 3300049569 | Bacteria | 3606 |
| 840 | Ga0501032_0050455 | 3300049569 | Bacteria | 2806 |
| 841 | Ga0501032_0580689 | 3300049569 | Bacteria | 714 |
| 842 | Ga0501032_0754517 | 3300049569 | Bacteria | 615 |
| 843 | Ga0501033_0000133 | 3300049570 | Bacteria | 72459 |
| 844 | Ga0501033_0000185 | 3300049570 | Bacteria | 59836 |
| 845 | Ga0501033_0003165 | 3300049570 | Bacteria | 13674 |
| 846 | Ga0501033_0008082 | 3300049570 | Bacteria | 8151 |
| 847 | Ga0501033_0015786 | 3300049570 | Bacteria | 5724 |
| 848 | Ga0501033_0024075 | 3300049570 | Bacteria | 4594 |
| 849 | Ga0501033_0089980 | 3300049570 | Bacteria | 2245 |
| 850 | Ga0501033_0216610 | 3300049570 | Bacteria | 1364 |
| 851 | Ga0501033_0310137 | 3300049570 | Bacteria | 1109 |
| 852 | Ga0501033_0399009 | 3300049570 | Bacteria | 959 |
| 853 | Ga0501033_0968875 | 3300049570 | Bacteria | 570 |
| 854 | Ga0501034_0000130 | 3300049571 | Bacteria | 139568 |
| 855 | Ga0501034_0000296 | 3300049571 | Bacteria | 88355 |
| 856 | Ga0501034_0000611 | 3300049571 | Bacteria | 56186 |
| 857 | Ga0501034_0011862 | 3300049571 | Bacteria | 9018 |
| 858 | Ga0501034_0013933 | 3300049571 | Bacteria | 8278 |
| 859 | Ga0501034_0033876 | 3300049571 | Bacteria | 5178 |
| 860 | Ga0501034_0056088 | 3300049571 | Bacteria | 3965 |
| 861 | Ga0501034_0089007 | 3300049571 | Bacteria | 3085 |
| 862 | Ga0501034_0111233 | 3300049571 | Bacteria | 2729 |
| 863 | Ga0501034_0125911 | 3300049571 | Bacteria | 2547 |
| 864 | Ga0501034_0168146 | 3300049571 | Bacteria | 2161 |
| 865 | Ga0501034_0207269 | 3300049571 | Bacteria | 1916 |
| 866 | Ga0501034_0392880 | 3300049571 | Bacteria | 1311 |
| 867 | Ga0501034_0395688 | 3300049571 | Bacteria | 1305 |
| 868 | Ga0501034_0406609 | 3300049571 | Bacteria | 1283 |
| 869 | Ga0501034_0618241 | 3300049571 | Bacteria | 987 |
| 870 | Ga0501034_0738934 | 3300049571 | Bacteria | 880 |
| 871 | Ga0501034_1208711 | 3300049571 | Bacteria | 634 |
| 872 | Ga0501034_1458588 | 3300049571 | Bacteria | 559 |
| 873 | Ga0501036_0000034 | 3300049572 | Bacteria | 88355 |
| 874 | Ga0501036_0020290 | 3300049572 | Bacteria | 5582 |
| 875 | Ga0501036_0024429 | 3300049572 | Bacteria | 5094 |
| 876 | Ga0501036_0030905 | 3300049572 | Bacteria | 4526 |
| 877 | Ga0501036_0061705 | 3300049572 | Bacteria | 3175 |
| 878 | Ga0501036_0115820 | 3300049572 | Bacteria | 2264 |
| 879 | Ga0501036_0199776 | 3300049572 | Bacteria | 1682 |
| 880 | Ga0501036_0210707 | 3300049572 | Bacteria | 1633 |
| 881 | Ga0501036_0945732 | 3300049572 | Bacteria | 706 |
| 882 | Ga0501037_0000079 | 3300049573 | Bacteria | 88355 |
| 883 | Ga0501037_0000089 | 3300049573 | Bacteria | 85102 |
| 884 | Ga0501037_0023331 | 3300049573 | Bacteria | 4575 |
| 885 | Ga0501037_0039467 | 3300049573 | Bacteria | 3475 |
| 886 | Ga0501037_0082089 | 3300049573 | Bacteria | 2336 |
| 887 | Ga0501037_0216648 | 3300049573 | Bacteria | 1348 |
| 888 | Ga0501037_0444244 | 3300049573 | Bacteria | 885 |
| 889 | Ga0501037_0602240 | 3300049573 | Bacteria | 738 |
| 890 | Ga0501038_0000063 | 3300049574 | Bacteria | 88355 |
| 891 | Ga0501038_0000478 | 3300049574 | Bacteria | 35183 |
| 892 | Ga0501038_0008634 | 3300049574 | Bacteria | 9354 |
| 893 | Ga0501038_0028340 | 3300049574 | Bacteria | 4975 |
| 894 | Ga0501038_0093901 | 3300049574 | Bacteria | 2508 |
| 895 | Ga0501038_0104265 | 3300049574 | Bacteria | 2357 |
| 896 | Ga0501038_0145772 | 3300049574 | Bacteria | 1933 |
| 897 | Ga0501038_0356263 | 3300049574 | Bacteria | 1139 |
| 898 | Ga0501038_0356932 | 3300049574 | Bacteria | 1137 |
| 899 | Ga0501039_0000028 | 3300049575 | Bacteria | 139568 |
| 900 | Ga0501039_0000058 | 3300049575 | Bacteria | 88355 |
| 901 | Ga0501039_0143657 | 3300049575 | Bacteria | 1875 |
| 902 | Ga0501039_0151499 | 3300049575 | Bacteria | 1822 |
| 903 | Ga0501039_0477382 | 3300049575 | Bacteria | 979 |
| 904 | Ga0501039_0520285 | 3300049575 | Bacteria | 934 |
| 905 | Ga0501040_0336600 | 3300049576 | Bacteria | 1080 |
| 906 | Ga0501041_0529004 | 3300049577 | Bacteria | 751 |
| 907 | Ga0501042_0675925 | 3300049578 | Bacteria | 751 |
| 908 | Ga0501043_0000007 | 3300049579 | Bacteria | 224595 |
| 909 | Ga0501043_0000113 | 3300049579 | Bacteria | 76112 |
| 910 | Ga0501043_0000355 | 3300049579 | Bacteria | 41664 |
| 911 | Ga0501043_0023562 | 3300049579 | Bacteria | 4827 |
| 912 | Ga0501043_0107791 | 3300049579 | Bacteria | 2188 |
| 913 | Ga0501043_0150489 | 3300049579 | Bacteria | 1821 |
| 914 | Ga0501043_0377465 | 3300049579 | Bacteria | 1074 |
| 915 | Ga0501043_0422719 | 3300049579 | Bacteria | 1004 |
| 916 | Ga0501046_0074876 | 3300049580 | Bacteria | 2625 |
| 917 | Ga0501047_0000969 | 3300049581 | Bacteria | 28952 |
| 918 | Ga0501047_0005048 | 3300049581 | Bacteria | 12387 |
| 919 | Ga0501047_0009690 | 3300049581 | Bacteria | 9107 |
| 920 | Ga0501047_0014312 | 3300049581 | Bacteria | 7545 |
| 921 | Ga0501047_0022132 | 3300049581 | Bacteria | 6107 |
| 922 | Ga0501047_0175568 | 3300049581 | Bacteria | 2010 |
| 923 | Ga0501047_0180407 | 3300049581 | Bacteria | 1978 |
| 924 | Ga0501047_0199065 | 3300049581 | Bacteria | 1864 |
| 925 | Ga0501047_0285388 | 3300049581 | Bacteria | 1495 |
| 926 | Ga0501047_0558421 | 3300049581 | Bacteria | 969 |
| 927 | Ga0501047_0633710 | 3300049581 | Bacteria | 889 |
| 928 | Ga0501048_0057912 | 3300049582 | Bacteria | 2747 |
| 929 | Ga0501048_0747413 | 3300049582 | Bacteria | 703 |
| 930 | Ga0501067_0072755 | 3300049583 | Bacteria | 1904 |
| 931 | Ga0501068_0005603 | 3300049584 | Bacteria | 6878 |
| 932 | Ga0501068_0119051 | 3300049584 | Bacteria | 1646 |
| 933 | Ga0501069_0000001 | 3300049585 | Bacteria | 289100 |
| 934 | Ga0501069_0009230 | 3300049585 | Bacteria | 5205 |
| 935 | Ga0501069_0025263 | 3300049585 | Bacteria | 3245 |
| 936 | Ga0501069_0028526 | 3300049585 | Bacteria | 3061 |
| 937 | Ga0501069_0140327 | 3300049585 | Bacteria | 1386 |
| 938 | Ga0501069_0376150 | 3300049585 | Bacteria | 839 |
| 939 | Ga0501070_0000789 | 3300049586 | Bacteria | 28809 |
| 940 | Ga0501070_0001012 | 3300049586 | Bacteria | 25214 |
| 941 | Ga0501070_0003595 | 3300049586 | Bacteria | 13407 |
| 942 | Ga0501070_0033843 | 3300049586 | Bacteria | 4276 |
| 943 | Ga0501070_0046330 | 3300049586 | Bacteria | 3616 |
| 944 | Ga0501070_0061369 | 3300049586 | Bacteria | 3114 |
| 945 | Ga0501070_0076869 | 3300049586 | Bacteria | 2763 |
| 946 | Ga0501070_0102806 | 3300049586 | Bacteria | 2363 |
| 947 | Ga0501070_0133106 | 3300049586 | Bacteria | 2053 |
| 948 | Ga0501070_0252646 | 3300049586 | Bacteria | 1442 |
| 949 | Ga0501070_0833925 | 3300049586 | Bacteria | 722 |
| 950 | Ga0501070_0847477 | 3300049586 | Bacteria | 715 |
| 951 | Ga0501071_0047076 | 3300049587 | Bacteria | 3098 |
| 952 | Ga0501071_0803087 | 3300049587 | Bacteria | 725 |
| 953 | Ga0501072_0544756 | 3300049588 | Bacteria | 917 |
| 954 | Ga0501072_0851653 | 3300049588 | Bacteria | 713 |
| 955 | Ga0501073_0011583 | 3300049589 | Bacteria | 6446 |
| 956 | Ga0501073_0034527 | 3300049589 | Bacteria | 3599 |
| 957 | Ga0501073_0164719 | 3300049589 | Bacteria | 1535 |
| 958 | Ga0501073_0264810 | 3300049589 | Bacteria | 1186 |
| 959 | Ga0501074_0000003 | 3300049590 | Bacteria | 116101 |
| 960 | Ga0501074_0012185 | 3300049590 | Bacteria | 6250 |
| 961 | Ga0501074_0032625 | 3300049590 | Bacteria | 3772 |
| 962 | Ga0501074_0068543 | 3300049590 | Bacteria | 2550 |
| 963 | Ga0501074_0494006 | 3300049590 | Bacteria | 867 |
| 964 | Ga0501238_046359 | 3300049671 | Bacteria | 646 |
| 965 | Ga0501079_1076655 | 3300049741 | Bacteria | 633 |
| 966 | Ga0501080_0000090 | 3300049742 | Bacteria | 61585 |
| 967 | Ga0501080_0002221 | 3300049742 | Bacteria | 16875 |
| 968 | Ga0501080_0017506 | 3300049742 | Bacteria | 6627 |
| 969 | Ga0501080_0021242 | 3300049742 | Bacteria | 6008 |
| 970 | Ga0501080_0028515 | 3300049742 | Bacteria | 5195 |
| 971 | Ga0501080_0081908 | 3300049742 | Bacteria | 2998 |
| 972 | Ga0501080_0258070 | 3300049742 | Bacteria | 1588 |
| 973 | Ga0501083_0000012 | 3300049744 | Bacteria | 178668 |
| 974 | Ga0501083_0092675 | 3300049744 | Bacteria | 1994 |
| 975 | Ga0501266_014742 | 3300049763 | Bacteria | 1027 |
| 976 | Ga0501280_001648 | 3300049776 | Bacteria | 3994 |
| 977 | Ga0501280_001986 | 3300049776 | Bacteria | 3556 |
| 978 | Ga0501035_0000037 | 3300049822 | Bacteria | 160921 |
| 979 | Ga0501035_0000143 | 3300049822 | Bacteria | 86821 |
| 980 | Ga0501035_0000203 | 3300049822 | Bacteria | 72435 |
| 981 | Ga0501035_0000529 | 3300049822 | Bacteria | 42811 |
| 982 | Ga0501035_0001061 | 3300049822 | Bacteria | 28803 |
| 983 | Ga0501035_0001616 | 3300049822 | Bacteria | 22785 |
| 984 | Ga0501035_0006787 | 3300049822 | Bacteria | 10696 |
| 985 | Ga0501035_0022057 | 3300049822 | Bacteria | 5850 |
| 986 | Ga0501035_0022420 | 3300049822 | Bacteria | 5798 |
| 987 | Ga0501035_0073893 | 3300049822 | Bacteria | 3016 |
| 988 | Ga0501035_0094304 | 3300049822 | Bacteria | 2632 |
| 989 | Ga0501035_0493833 | 3300049822 | Bacteria | 1008 |
| 990 | Ga0501035_0589024 | 3300049822 | Bacteria | 907 |
| 991 | Ga0501035_0830144 | 3300049822 | Bacteria | 736 |
| 992 | Ga0501044_0000018 | 3300049823 | Bacteria | 225885 |
| 993 | Ga0501044_0000142 | 3300049823 | Bacteria | 88355 |
| 994 | Ga0501044_0008899 | 3300049823 | Bacteria | 10973 |
| 995 | Ga0501044_0034593 | 3300049823 | Bacteria | 5297 |
| 996 | Ga0501044_0038672 | 3300049823 | Bacteria | 4981 |
| 997 | Ga0501044_0050480 | 3300049823 | Bacteria | 4292 |
| 998 | Ga0501044_0094578 | 3300049823 | Bacteria | 3012 |
| 999 | Ga0501044_0188088 | 3300049823 | Bacteria | 2029 |
| 1000 | Ga0501044_0307646 | 3300049823 | Bacteria | 1512 |
| 1001 | Ga0501044_0314997 | 3300049823 | Bacteria | 1490 |
| 1002 | Ga0501044_0316730 | 3300049823 | Bacteria | 1485 |
| 1003 | Ga0501044_0316810 | 3300049823 | Bacteria | 1485 |
| 1004 | Ga0501044_0330106 | 3300049823 | Bacteria | 1448 |
| 1005 | Ga0501044_0405368 | 3300049823 | Bacteria | 1275 |
| 1006 | Ga0501044_0465105 | 3300049823 | Bacteria | 1170 |
| 1007 | Ga0501044_0660312 | 3300049823 | Bacteria | 934 |
| 1008 | Ga0501044_1002814 | 3300049823 | Bacteria | 707 |
| 1009 | Ga0501045_0001774 | 3300049824 | Bacteria | 14567 |
| 1010 | Ga0501045_0317041 | 3300049824 | Bacteria | 1160 |
| 1011 | Ga0501045_0745925 | 3300049824 | Bacteria | 722 |
| 1012 | nmdc:mga03683_201857_c1 | 3300050489 | Bacteria | 913 |
| 1013 | nmdc:mga03683_208704_c1 | 3300050489 | Bacteria | 898 |
| 1014 | nmdc:mga03683_3182_c1 | 3300050489 | Bacteria | 5242 |
| 1015 | nmdc:mga03683_328154_c1 | 3300050489 | Bacteria | 721 |
| 1016 | nmdc:mga03683_6840_c1 | 3300050489 | Bacteria | 3926 |
| 1017 | nmdc:mga03683_811_c1 | 3300050489 | Bacteria | 8951 |
| 1018 | nmdc:mga03n38_188260_c1 | 3300050490 | Bacteria | 1062 |
| 1019 | nmdc:mga03n38_378752_c1 | 3300050490 | Bacteria | 775 |
| 1020 | nmdc:mga03n38_71982_c1 | 3300050490 | Bacteria | 1602 |
| 1021 | nmdc:mga03n38_83643_c1 | 3300050490 | Bacteria | 1505 |
| 1022 | nmdc:mga00v17_102223_c1 | 3300050491 | Bacteria | 1810 |
| 1023 | nmdc:mga00v17_15_c1 | 3300050491 | Bacteria | 126234 |
| 1024 | nmdc:mga00v17_26228_c1 | 3300050491 | Bacteria | 3394 |
| 1025 | nmdc:mga00v17_584912_c1 | 3300050491 | Bacteria | 720 |
| 1026 | nmdc:mga00v17_8647_c1 | 3300050491 | Bacteria | 5483 |
| 1027 | nmdc:mga00v17_89_c1 | 3300050491 | Bacteria | 55686 |
| 1028 | nmdc:mga0yw44_140008_c1 | 3300050492 | Bacteria | 1572 |
| 1029 | nmdc:mga0yw44_183296_c1 | 3300050492 | Bacteria | 1379 |
| 1030 | nmdc:mga0yw44_23657_c1 | 3300050492 | Bacteria | 3465 |
| 1031 | nmdc:mga0yw44_401659_c1 | 3300050492 | Bacteria | 927 |
| 1032 | nmdc:mga0yw44_5630_c1 | 3300050492 | Bacteria | 5957 |
| 1033 | nmdc:mga0k408_308704_c1 | 3300050493 | Bacteria | 944 |
| 1034 | nmdc:mga0k408_375785_c1 | 3300050493 | Bacteria | 847 |
| 1035 | nmdc:mga0k408_588902_c1 | 3300050493 | Bacteria | 656 |
| 1036 | nmdc:mga0k408_6366_c1 | 3300050493 | Bacteria | 6301 |
| 1037 | nmdc:mga0k408_77366_c1 | 3300050493 | Bacteria | 1946 |
| 1038 | nmdc:mga06z11_126586_c1 | 3300050494 | Bacteria | 1430 |
| 1039 | nmdc:mga06z11_176227_c1 | 3300050494 | Bacteria | 1230 |
| 1040 | nmdc:mga06z11_22195_c1 | 3300050494 | Bacteria | 2961 |
| 1041 | nmdc:mga06z11_38443_c1 | 3300050494 | Bacteria | 2377 |
| 1042 | nmdc:mga06z11_48863_c1 | 3300050494 | Bacteria | 2155 |
| 1043 | nmdc:mga06z11_48902_c1 | 3300050494 | Bacteria | 2154 |
| 1044 | nmdc:mga06z11_95147_c1 | 3300050494 | Bacteria | 1625 |
| 1045 | nmdc:mga04h51_113833_c1 | 3300050495 | Bacteria | 1000 |
| 1046 | nmdc:mga04h51_126921_c1 | 3300050495 | Bacteria | 956 |
| 1047 | nmdc:mga04h51_73206_c1 | 3300050495 | Bacteria | 1201 |
| 1048 | nmdc:mga04h51_74946_c1 | 3300050495 | Bacteria | 1190 |
| 1049 | nmdc:mga07m45_292368_c1 | 3300050496 | Bacteria | 948 |
| 1050 | nmdc:mga07m45_338145_c1 | 3300050496 | Bacteria | 875 |
| 1051 | nmdc:mga07m45_4831_c1 | 3300050496 | Bacteria | 6627 |
| 1052 | nmdc:mga07m45_6173_c1 | 3300050496 | Bacteria | 6042 |
| 1053 | nmdc:mga0sz30_2214_c2 | 3300050516 | Bacteria | 3232 |
| 1054 | nmdc:mga0sz30_2494_c1 | 3300050516 | Bacteria | 6559 |
| 1055 | nmdc:mga0sz30_4223_c1 | 3300050516 | Bacteria | 5178 |
| 1056 | nmdc:mga0sz30_65238_c1 | 3300050516 | Bacteria | 1561 |
| 1057 | nmdc:mga0sz30_74182_c1 | 3300050516 | Bacteria | 1467 |
| 1058 | Ga0495601_0143683 | 3300053077 | Bacteria | 1557 |
| 1059 | Ga0500610_0044800 | 3300053079 | Bacteria | 2296 |
| 1060 | Ga0500610_0110793 | 3300053079 | Bacteria | 1412 |
| 1061 | Ga0495655_0112419 | 3300053083 | Bacteria | 820 |
| 1062 | Ga0500578_0099734 | 3300053086 | Bacteria | 1838 |
| 1063 | Ga0500643_025102 | 3300053087 | Bacteria | 1883 |
| 1064 | Ga0500562_046931 | 3300053108 | Bacteria | 1152 |
| 1065 | Ga0500569_045348 | 3300053109 | Bacteria | 1305 |
| 1066 | Ga0500592_054822 | 3300053116 | Bacteria | 650 |
| 1067 | Ga0500595_020626 | 3300053119 | Bacteria | 2368 |
| 1068 | Ga0500608_018114 | 3300053122 | Bacteria | 3210 |
| 1069 | Ga0500618_000528 | 3300053125 | Bacteria | 23979 |
| 1070 | Ga0500618_000573 | 3300053125 | Bacteria | 22735 |
| 1071 | Ga0500618_006786 | 3300053125 | Bacteria | 3327 |
| 1072 | Ga0500618_038091 | 3300053125 | Bacteria | 1110 |
| 1073 | Ga0500658_0002828 | 3300053134 | Bacteria | 6661 |
| 1074 | Ga0500658_0100561 | 3300053134 | Bacteria | 1261 |
| 1075 | Ga0500559_0012657 | 3300053136 | Bacteria | 3582 |
| 1076 | Ga0500561_0000030 | 3300053137 | Bacteria | 29291 |
| 1077 | Ga0500568_0000421 | 3300053139 | Bacteria | 31992 |
| 1078 | Ga0500568_0000607 | 3300053139 | Bacteria | 25984 |
| 1079 | Ga0500568_0000640 | 3300053139 | Bacteria | 25250 |
| 1080 | Ga0500573_0013675 | 3300053140 | Bacteria | 4578 |
| 1081 | Ga0500573_0024212 | 3300053140 | Bacteria | 3490 |
| 1082 | Ga0500590_000839 | 3300053148 | Bacteria | 11548 |
| 1083 | Ga0500604_0000684 | 3300053151 | Bacteria | 9290 |
| 1084 | Ga0500604_0015547 | 3300053151 | Bacteria | 2086 |
| 1085 | Ga0500604_0050226 | 3300053151 | Bacteria | 1285 |
| 1086 | Ga0500616_0000583 | 3300053153 | Bacteria | 44437 |
| 1087 | Ga0500616_0001279 | 3300053153 | Bacteria | 25126 |
| 1088 | Ga0500616_0027523 | 3300053153 | Bacteria | 3139 |
| 1089 | Ga0500616_0048098 | 3300053153 | Bacteria | 2262 |
| 1090 | Ga0500616_0104269 | 3300053153 | Bacteria | 1380 |
| 1091 | Ga0500616_0189142 | 3300053153 | Bacteria | 920 |
| 1092 | Ga0500622_0000541 | 3300053156 | Bacteria | 34818 |
| 1093 | Ga0500622_0000962 | 3300053156 | Bacteria | 24454 |
| 1094 | Ga0500624_001087 | 3300053157 | Bacteria | 5176 |
| 1095 | Ga0500627_0031040 | 3300053158 | Bacteria | 2241 |
| 1096 | Ga0500634_0062389 | 3300053161 | Bacteria | 1974 |
| 1097 | Ga0500636_0000025 | 3300053177 | Bacteria | 86697 |
| 1098 | Ga0500611_011078 | 3300053727 | Bacteria | 1480 |
| 1099 | Ga0587084_012437 | 3300059477 | Bacteria | 1153 |
| 1100 | Ga0587066_012837 | 3300059490 | Bacteria | 1258 |
| 1101 | Ga0587066_041647 | 3300059490 | Bacteria | 868 |
| 1102 | Ga0587070_045005 | 3300059491 | Bacteria | 860 |
| 1103 | Ga0587073_0020523 | 3300059492 | Bacteria | 1261 |
| 1104 | Ga0587073_0210759 | 3300059492 | Bacteria | 588 |
| 1105 | Ga0587077_023247 | 3300059493 | Bacteria | 1118 |
| 1106 | Ga0587077_048248 | 3300059493 | Bacteria | 881 |
| 1107 | Ga0587077_068672 | 3300059493 | Bacteria | 786 |
| 1108 | Ga0587077_076300 | 3300059493 | Bacteria | 760 |
| 1109 | Ga0587080_036364 | 3300059503 | Bacteria | 880 |
| 1110 | Ga0587080_125430 | 3300059503 | Bacteria | 573 |
| 1111 | Ga0587082_019304 | 3300059504 | Bacteria | 1093 |
| 1112 | Ga0587082_025181 | 3300059504 | Bacteria | 999 |
| 1113 | Ga0587083_0031082 | 3300059505 | Bacteria | 1063 |
| 1114 | Ga0587086_026272 | 3300059507 | Bacteria | 829 |
| 1115 | Ga0587088_026264 | 3300059508 | Bacteria | 1010 |
| 1116 | Ga0587088_031222 | 3300059508 | Bacteria | 953 |
| 1117 | Ga0587090_008592 | 3300059510 | Bacteria | 1374 |
| 1118 | Ga0587090_020816 | 3300059510 | Bacteria | 1024 |
| 1119 | Ga0587091_047505 | 3300059511 | Bacteria | 870 |
| 1120 | Ga0587091_127142 | 3300059511 | Bacteria | 625 |
| 1121 | Ga0587094_027488 | 3300059513 | Bacteria | 864 |
| 1122 | Ga0587098_019801 | 3300059604 | Bacteria | 845 |
| 1123 | Ga0587106_029697 | 3300059605 | Bacteria | 870 |
| 1124 | Ga0587101_017071 | 3300059623 | Bacteria | 1001 |
| 1125 | Ga0587109_050145 | 3300059624 | Bacteria | 853 |
| 1126 | Ga0587109_142633 | 3300059624 | Bacteria | 586 |
| 1127 | Ga0587115_015762 | 3300059626 | Bacteria | 1004 |
| 1128 | Ga0587122_009880 | 3300059628 | Bacteria | 890 |
| 1129 | Ga0587128_013341 | 3300059630 | Bacteria | 1158 |
| 1130 | Ga0587128_032618 | 3300059630 | Bacteria | 871 |
| 1131 | Ga0587062_007581 | 3300059639 | Bacteria | 1271 |
| 1132 | Ga0587062_031311 | 3300059639 | Bacteria | 816 |
| 1133 | Ga0587067_033485 | 3300059640 | Bacteria | 961 |
| 1134 | Ga0587067_038145 | 3300059640 | Bacteria | 921 |
| 1135 | Ga0587068_012550 | 3300059641 | Bacteria | 1294 |
| 1136 | Ga0587072_016120 | 3300059643 | Bacteria | 1276 |
| 1137 | Ga0587072_044876 | 3300059643 | Bacteria | 869 |
| 1138 | Ga0587072_048542 | 3300059643 | Bacteria | 844 |
| 1139 | Ga0587072_052449 | 3300059643 | Bacteria | 821 |
| 1140 | Ga0587075_027659 | 3300059644 | Bacteria | 884 |
| 1141 | Ga0587075_049075 | 3300059644 | Bacteria | 731 |
| 1142 | Ga0587076_012829 | 3300059645 | Bacteria | 1259 |
| 1143 | Ga0587079_087446 | 3300059647 | Bacteria | 723 |
| 1144 | Ga0587102_016744 | 3300059649 | Bacteria | 791 |
| 1145 | Ga0587107_017107 | 3300059652 | Bacteria | 967 |
| 1146 | Ga0587107_034344 | 3300059652 | Bacteria | 789 |
| 1147 | Ga0587108_011115 | 3300059653 | Bacteria | 763 |
| 1148 | Ga0587114_025361 | 3300059655 | Bacteria | 869 |
| 1149 | Ga0587111_0052522 | 3300060346 | Bacteria | 904 |
| 1150 | Ga0501082_0034353 | 3300060353 | Bacteria | 4373 |
| 1151 | Ga0501082_0088000 | 3300060353 | Bacteria | 2680 |
| 1152 | Ga0501082_0786025 | 3300060353 | Bacteria | 833 |
| 1153 | Ga0501082_0896214 | 3300060353 | Bacteria | 776 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046474 | Ga0495605_0008847 | Ga0495605_0008847_4495_4956 | 153 |
| 2 | 3300046520 | Ga0495637_0063642 | Ga0495637_0063642_811_1299 | 154 |
| 3 | iso_pu_bacteria | 2802429606 | 2805934065 | 156 |
| 4 | iso_pu_bacteria | 2503198000 | 2503198039 | 157 |
| 5 | iso_pu_bacteria | 2508501122 | 2509109527 | 157 |
| 6 | iso_pu_bacteria | 2508501122 | 2509110718 | 157 |
| 7 | iso_pu_bacteria | 2508501123 | 2509113629 | 157 |
| 8 | iso_pu_bacteria | 2508501127 | 2509140291 | 157 |
| 9 | iso_pu_bacteria | 2508501127 | 2509143867 | 157 |
| 10 | iso_pu_bacteria | 2509276018 | 2509370596 | 157 |
| 11 | iso_pu_bacteria | 2509276019 | 2509377383 | 157 |
| 12 | iso_pu_bacteria | 2509276019 | 2509378149 | 157 |
| 13 | iso_pu_bacteria | 2509276021 | 2509389276 | 157 |
| 14 | iso_pu_bacteria | 2509276022 | 2509392966 | 157 |
| 15 | iso_pu_bacteria | 2509276033 | 2509446332 | 157 |
| 16 | iso_pu_bacteria | 2510065019 | 2510135384 | 157 |
| 17 | iso_pu_bacteria | 2510065057 | 2510305395 | 157 |
| 18 | iso_pu_bacteria | 2510065059 | 2510314385 | 157 |
| 19 | iso_pu_bacteria | 2510461069 | 2510842809 | 157 |
| 20 | iso_pu_bacteria | 2510461076 | 2510896837 | 157 |
| 21 | iso_pu_bacteria | 2510917022 | 2511135880 | 157 |
| 22 | iso_pu_bacteria | 2510917026 | 2511172729 | 157 |
| 23 | iso_pu_bacteria | 2510917028 | 2511182955 | 157 |
| 24 | iso_pu_bacteria | 2510917030 | 2511199394 | 157 |
| 25 | iso_pu_bacteria | 2511231027 | 2511389492 | 157 |
| 26 | iso_pu_bacteria | 2511231052 | 2511498414 | 157 |
| 27 | iso_pu_bacteria | 2512875016 | 2512934477 | 157 |
| 28 | iso_pu_bacteria | 2512875024 | 2512962826 | 157 |
| 29 | iso_pu_bacteria | 2512875026 | 2512973635 | 157 |
| 30 | iso_pu_bacteria | 2513237084 | 2513572921 | 157 |
| 31 | iso_pu_bacteria | 2513237085 | 2513580454 | 157 |
| 32 | iso_pu_bacteria | 2513237086 | 2513586060 | 157 |
| 33 | iso_pu_bacteria | 2513237088 | 2513596934 | 157 |
| 34 | iso_pu_bacteria | 2513237089 | 2513601846 | 157 |
| 35 | iso_pu_bacteria | 2513237090 | 2513609505 | 157 |
| 36 | iso_pu_bacteria | 2513237091 | 2513615654 | 157 |
| 37 | iso_pu_bacteria | 2513237093 | 2513634957 | 157 |
| 38 | iso_pu_bacteria | 2513237103 | 2513711483 | 157 |
| 39 | iso_pu_bacteria | 2513237138 | 2513865211 | 157 |
| 40 | iso_pu_bacteria | 2513237140 | 2513884231 | 157 |
| 41 | iso_pu_bacteria | 2513237143 | 2513903574 | 157 |
| 42 | iso_pu_bacteria | 2513237144 | 2513912854 | 157 |
| 43 | iso_pu_bacteria | 2513237146 | 2513928649 | 157 |
| 44 | iso_pu_bacteria | 2513237156 | 2513984120 | 157 |
| 45 | iso_pu_bacteria | 2513237159 | 2513998329 | 157 |
| 46 | iso_pu_bacteria | 2513237160 | 2514003570 | 157 |
| 47 | iso_pu_bacteria | 2513237162 | 2514019547 | 157 |
| 48 | iso_pu_bacteria | 2513237164 | 2514037502 | 157 |
| 49 | iso_pu_bacteria | 2513237351 | 2514586367 | 157 |
| 50 | iso_pu_bacteria | 2515075009 | 2515114554 | 157 |
| 51 | iso_pu_bacteria | 2515154107 | 2515611001 | 157 |
| 52 | iso_pu_bacteria | 2515154113 | 2515635029 | 157 |
| 53 | iso_pu_bacteria | 2515154114 | 2515644408 | 157 |
| 54 | iso_pu_bacteria | 2515154116 | 2515657512 | 157 |
| 55 | iso_pu_bacteria | 2515154134 | 2515741735 | 157 |
| 56 | iso_pu_bacteria | 2516143018 | 2516205531 | 157 |
| 57 | iso_pu_bacteria | 2516653046 | 2516894695 | 157 |
| 58 | iso_pu_bacteria | 2516653077 | 2517038195 | 157 |
| 59 | iso_pu_bacteria | 2516653085 | 2517078473 | 157 |
| 60 | iso_pu_bacteria | 2517093000 | 2517097212 | 157 |
| 61 | iso_pu_bacteria | 2517287029 | 2517408398 | 157 |
| 62 | iso_pu_bacteria | 2517487022 | 2517571361 | 157 |
| 63 | iso_pu_bacteria | 2523231067 | 2523466550 | 157 |
| 64 | iso_pu_bacteria | 2524023207 | 2524450495 | 157 |
| 65 | iso_pu_bacteria | 2524023209 | 2524461147 | 157 |
| 66 | iso_pu_bacteria | 2529292951 | 2530647221 | 157 |
| 67 | iso_pu_bacteria | 2534681786 | 2535486529 | 157 |
| 68 | iso_pu_bacteria | 2534681796 | 2535519139 | 157 |
| 69 | iso_pu_bacteria | 2537561587 | 2537873608 | 157 |
| 70 | iso_pu_bacteria | 2551306084 | 2551675848 | 157 |
| 71 | iso_pu_bacteria | 2551306085 | 2551689652 | 157 |
| 72 | iso_pu_bacteria | 2551306086 | 2551691566 | 157 |
| 73 | iso_pu_bacteria | 2551306087 | 2551698009 | 157 |
| 74 | iso_pu_bacteria | 2551306089 | 2551711777 | 157 |
| 75 | iso_pu_bacteria | 2551306090 | 2551716144 | 157 |
| 76 | iso_pu_bacteria | 2551306090 | 2551721422 | 157 |
| 77 | iso_pu_bacteria | 2551306091 | 2551731009 | 157 |
| 78 | iso_pu_bacteria | 2551306092 | 2551737147 | 157 |
| 79 | iso_pu_bacteria | 2551306093 | 2551742054 | 157 |
| 80 | iso_pu_bacteria | 2554235003 | 2554248933 | 157 |
| 81 | iso_pu_bacteria | 2558860100 | 2558862091 | 157 |
| 82 | iso_pu_bacteria | 2558860100 | 2558867351 | 157 |
| 83 | iso_pu_bacteria | 2558860242 | 2559296021 | 157 |
| 84 | iso_pu_bacteria | 2558860983 | 2561467190 | 157 |
| 85 | iso_pu_bacteria | 2582581283 | 2585166549 | 157 |
| 86 | iso_pu_bacteria | 2582581294 | 2585201622 | 157 |
| 87 | iso_pu_bacteria | 2582581298 | 2585224069 | 157 |
| 88 | iso_pu_bacteria | 2582581299 | 2585233479 | 157 |
| 89 | iso_pu_bacteria | 2582581304 | 2585257241 | 157 |
| 90 | iso_pu_bacteria | 2582581306 | 2585267123 | 157 |
| 91 | iso_pu_bacteria | 2582581307 | 2585272031 | 157 |
| 92 | iso_pu_bacteria | 2582581308 | 2585279666 | 157 |
| 93 | iso_pu_bacteria | 2582581315 | 2585327503 | 157 |
| 94 | iso_pu_bacteria | 2582581316 | 2585333960 | 157 |
| 95 | iso_pu_bacteria | 2582581865 | 2585388175 | 157 |
| 96 | iso_pu_bacteria | 2582581866 | 2585396222 | 157 |
| 97 | iso_pu_bacteria | 2582581867 | 2585399866 | 157 |
| 98 | iso_pu_bacteria | 2585427526 | 2585529229 | 157 |
| 99 | iso_pu_bacteria | 2585427527 | 2585535746 | 157 |
| 100 | iso_pu_bacteria | 2585427528 | 2585543045 | 157 |
| 101 | iso_pu_bacteria | 2585427529 | 2585549769 | 157 |
| 102 | iso_pu_bacteria | 2585427530 | 2585551122 | 157 |
| 103 | iso_pu_bacteria | 2585427531 | 2585563424 | 157 |
| 104 | iso_pu_bacteria | 2585427590 | 2585820954 | 157 |
| 105 | iso_pu_bacteria | 2585427593 | 2585839186 | 157 |
| 106 | iso_pu_bacteria | 2585427594 | 2585845002 | 157 |
| 107 | iso_pu_bacteria | 2585427608 | 2585897154 | 157 |
| 108 | iso_pu_bacteria | 2585427609 | 2585909069 | 157 |
| 109 | iso_pu_bacteria | 2585427633 | 2585998041 | 157 |
| 110 | iso_pu_bacteria | 2585427634 | 2586002621 | 157 |
| 111 | iso_pu_bacteria | 2585428125 | 2587984483 | 157 |
| 112 | iso_pu_bacteria | 2588253730 | 2588520647 | 157 |
| 113 | iso_pu_bacteria | 2597489875 | 2597810128 | 157 |
| 114 | iso_pu_bacteria | 2597489875 | 2597813014 | 157 |
| 115 | iso_pu_bacteria | 2599185156 | 2599335805 | 157 |
| 116 | iso_pu_bacteria | 2599185170 | 2599419998 | 157 |
| 117 | iso_pu_bacteria | 2599185210 | 2599603186 | 157 |
| 118 | iso_pu_bacteria | 2599185236 | 2599722606 | 157 |
| 119 | iso_pu_bacteria | 2599185301 | 2599935759 | 157 |
| 120 | iso_pu_bacteria | 2599185352 | 2600193412 | 157 |
| 121 | iso_pu_bacteria | 2600254933 | 2600377406 | 157 |
| 122 | iso_pu_bacteria | 2600255279 | 2601610909 | 157 |
| 123 | iso_pu_bacteria | 2600255308 | 2601747683 | 157 |
| 124 | iso_pu_bacteria | 2615840624 | 2616297454 | 157 |
| 125 | iso_pu_bacteria | 2615840626 | 2616306455 | 157 |
| 126 | iso_pu_bacteria | 2615840698 | 2616551059 | 157 |
| 127 | iso_pu_bacteria | 2617270742 | 2617382292 | 157 |
| 128 | iso_pu_bacteria | 2643221550 | 2643770635 | 157 |
| 129 | iso_pu_bacteria | 2643221551 | 2643777559 | 157 |
| 130 | iso_pu_bacteria | 2643221555 | 2643796007 | 157 |
| 131 | iso_pu_bacteria | 2643221557 | 2643808110 | 157 |
| 132 | iso_pu_bacteria | 2643221558 | 2643814859 | 157 |
| 133 | iso_pu_bacteria | 2643221564 | 2643838225 | 157 |
| 134 | iso_pu_bacteria | 2643221568 | 2643854886 | 157 |
| 135 | iso_pu_bacteria | 2643221580 | 2643909812 | 157 |
| 136 | iso_pu_bacteria | 2643221582 | 2643921545 | 157 |
| 137 | iso_pu_bacteria | 2643221591 | 2643965812 | 157 |
| 138 | iso_pu_bacteria | 2643221595 | 2643984997 | 157 |
| 139 | iso_pu_bacteria | 2643221599 | 2644002575 | 157 |
| 140 | iso_pu_bacteria | 2643221607 | 2644052399 | 157 |
| 141 | iso_pu_bacteria | 2643221610 | 2644068701 | 157 |
| 142 | iso_pu_bacteria | 2643221623 | 2644130433 | 157 |
| 143 | iso_pu_bacteria | 2643221626 | 2644150380 | 157 |
| 144 | iso_pu_bacteria | 2643221627 | 2644154073 | 157 |
| 145 | iso_pu_bacteria | 2643221629 | 2644165825 | 157 |
| 146 | iso_pu_bacteria | 2643221634 | 2644194716 | 157 |
| 147 | iso_pu_bacteria | 2643221636 | 2644201218 | 157 |
| 148 | iso_pu_bacteria | 2643221637 | 2644209630 | 157 |
| 149 | iso_pu_bacteria | 2643221643 | 2644240397 | 157 |
| 150 | iso_pu_bacteria | 2643221653 | 2644299697 | 157 |
| 151 | iso_pu_bacteria | 2643221655 | 2644312984 | 157 |
| 152 | iso_pu_bacteria | 2643221659 | 2644336532 | 157 |
| 153 | iso_pu_bacteria | 2643221662 | 2644348572 | 157 |
| 154 | iso_pu_bacteria | 2643221668 | 2644379544 | 157 |
| 155 | iso_pu_bacteria | 2643221674 | 2644413027 | 157 |
| 156 | iso_pu_bacteria | 2643221675 | 2644419771 | 157 |
| 157 | iso_pu_bacteria | 2643221680 | 2644453128 | 157 |
| 158 | iso_pu_bacteria | 2643221686 | 2644484677 | 157 |
| 159 | iso_pu_bacteria | 2643221688 | 2644494835 | 157 |
| 160 | iso_pu_bacteria | 2643221689 | 2644499457 | 157 |
| 161 | iso_pu_bacteria | 2643221693 | 2644521599 | 157 |
| 162 | iso_pu_bacteria | 2643221698 | 2644546178 | 157 |
| 163 | iso_pu_bacteria | 2643221712 | 2644618714 | 157 |
| 164 | iso_pu_bacteria | 2643221718 | 2644653158 | 157 |
| 165 | iso_pu_bacteria | 2643221719 | 2644657925 | 157 |
| 166 | iso_pu_bacteria | 2643221723 | 2644677138 | 157 |
| 167 | iso_pu_bacteria | 2643221726 | 2644688844 | 157 |
| 168 | iso_pu_bacteria | 2657244999 | 2657682462 | 157 |
| 169 | iso_pu_bacteria | 2657244999 | 2657685729 | 157 |
| 170 | iso_pu_bacteria | 2667528174 | 2671116062 | 157 |
| 171 | iso_pu_bacteria | 2687453392 | 2688595352 | 157 |
| 172 | iso_pu_bacteria | 2690316117 | 2692320003 | 157 |
| 173 | iso_pu_bacteria | 2693429783 | 2694630351 | 157 |
| 174 | iso_pu_bacteria | 2693429784 | 2694637863 | 157 |
| 175 | iso_pu_bacteria | 2718217882 | 2719183090 | 157 |
| 176 | iso_pu_bacteria | 2718217927 | 2719387810 | 157 |
| 177 | iso_pu_bacteria | 2718217997 | 2719667432 | 157 |
| 178 | iso_pu_bacteria | 2718218009 | 2719733807 | 157 |
| 179 | iso_pu_bacteria | 2718218199 | 2720493852 | 157 |
| 180 | iso_pu_bacteria | 2718218232 | 2720615313 | 157 |
| 181 | iso_pu_bacteria | 2718218233 | 2720622101 | 157 |
| 182 | iso_pu_bacteria | 2718218235 | 2720633455 | 157 |
| 183 | iso_pu_bacteria | 2718218269 | 2720777153 | 157 |
| 184 | iso_pu_bacteria | 2718218363 | 2721149202 | 157 |
| 185 | iso_pu_bacteria | 2718218365 | 2721160606 | 157 |
| 186 | iso_pu_bacteria | 2718218366 | 2721166015 | 157 |
| 187 | iso_pu_bacteria | 2718218423 | 2721401443 | 157 |
| 188 | iso_pu_bacteria | 2721755514 | 2722842185 | 157 |
| 189 | iso_pu_bacteria | 2721755556 | 2723028751 | 157 |
| 190 | iso_pu_bacteria | 2721755684 | 2723562364 | 157 |
| 191 | iso_pu_bacteria | 2721755685 | 2723569060 | 157 |
| 192 | iso_pu_bacteria | 2721755686 | 2723572571 | 157 |
| 193 | iso_pu_bacteria | 2721755809 | 2724040257 | 157 |
| 194 | iso_pu_bacteria | 2721755810 | 2724046563 | 157 |
| 195 | iso_pu_bacteria | 2721755819 | 2724091760 | 157 |
| 196 | iso_pu_bacteria | 2721755822 | 2724106325 | 157 |
| 197 | iso_pu_bacteria | 2721755823 | 2724112132 | 157 |
| 198 | iso_pu_bacteria | 2724679232 | 2725945741 | 157 |
| 199 | iso_pu_bacteria | 2728369352 | 2730109687 | 157 |
| 200 | iso_pu_bacteria | 2728369365 | 2730166325 | 157 |
| 201 | iso_pu_bacteria | 2728369397 | 2730300238 | 157 |
| 202 | iso_pu_bacteria | 2738541293 | 2738801084 | 157 |
| 203 | iso_pu_bacteria | 2738541317 | 2738946983 | 157 |
| 204 | iso_pu_bacteria | 2738541333 | 2739037741 | 157 |
| 205 | iso_pu_bacteria | 2738543024 | 2739307613 | 157 |
| 206 | iso_pu_bacteria | 2738543031 | 2739348394 | 157 |
| 207 | iso_pu_bacteria | 2751185800 | 2753356903 | 157 |
| 208 | iso_pu_bacteria | 2751185821 | 2753462509 | 157 |
| 209 | iso_pu_bacteria | 2756170246 | 2756674574 | 157 |
| 210 | iso_pu_bacteria | 2757320392 | 2757571925 | 157 |
| 211 | iso_pu_bacteria | 2758568016 | 2758639225 | 157 |
| 212 | iso_pu_bacteria | 2765235802 | 2765466278 | 157 |
| 213 | iso_pu_bacteria | 2765235942 | 2766064124 | 157 |
| 214 | iso_pu_bacteria | 2767802442 | 2770195654 | 157 |
| 215 | iso_pu_bacteria | 2775506902 | 2776271452 | 157 |
| 216 | iso_pu_bacteria | 2775506904 | 2776280038 | 157 |
| 217 | iso_pu_bacteria | 2775507049 | 2776915497 | 157 |
| 218 | iso_pu_bacteria | 2775507266 | 2778179184 | 157 |
| 219 | iso_pu_bacteria | 2791355082 | 2792582191 | 157 |
| 220 | iso_pu_bacteria | 2791355082 | 2792583738 | 157 |
| 221 | iso_pu_bacteria | 2791355091 | 2792621965 | 157 |
| 222 | iso_pu_bacteria | 2791355092 | 2792628778 | 157 |
| 223 | iso_pu_bacteria | 2791355094 | 2792639911 | 157 |
| 224 | iso_pu_bacteria | 2791355123 | 2792746549 | 157 |
| 225 | iso_pu_bacteria | 2791355253 | 2793281802 | 157 |
| 226 | iso_pu_bacteria | 2791355256 | 2793295503 | 157 |
| 227 | iso_pu_bacteria | 2791355259 | 2793317608 | 157 |
| 228 | iso_pu_bacteria | 2791355260 | 2793320849 | 157 |
| 229 | iso_pu_bacteria | 2791355261 | 2793327418 | 157 |
| 230 | iso_pu_bacteria | 2791355262 | 2793332363 | 157 |
| 231 | iso_pu_bacteria | 2791355263 | 2793338957 | 157 |
| 232 | iso_pu_bacteria | 2791355264 | 2793346727 | 157 |
| 233 | iso_pu_bacteria | 2791355265 | 2793356101 | 157 |
| 234 | iso_pu_bacteria | 2791355266 | 2793359246 | 157 |
| 235 | iso_pu_bacteria | 2791355267 | 2793366031 | 157 |
| 236 | iso_pu_bacteria | 2802428858 | 2802717271 | 157 |
| 237 | iso_pu_bacteria | 2802428859 | 2802724739 | 157 |
| 238 | iso_pu_bacteria | 2802428860 | 2802729491 | 157 |
| 239 | iso_pu_bacteria | 2802428861 | 2802736837 | 157 |
| 240 | iso_pu_bacteria | 2802428862 | 2802743242 | 157 |
| 241 | iso_pu_bacteria | 2802428863 | 2802749632 | 157 |
| 242 | iso_pu_bacteria | 2802429268 | 2804753647 | 157 |
| 243 | iso_pu_bacteria | 2802429268 | 2804755007 | 157 |
| 244 | iso_pu_bacteria | 2802429605 | 2805926338 | 157 |
| 245 | iso_pu_bacteria | 2802429633 | 2806047715 | 157 |
| 246 | iso_pu_bacteria | 2802429634 | 2806055291 | 157 |
| 247 | iso_pu_bacteria | 2802429635 | 2806062172 | 157 |
| 248 | iso_pu_bacteria | 2802429636 | 2806070069 | 157 |
| 249 | iso_pu_bacteria | 2802429637 | 2806076631 | 157 |
| 250 | iso_pu_bacteria | 2808606387 | 2808988153 | 157 |
| 251 | iso_pu_bacteria | 2818991272 | 2819244473 | 157 |
| 252 | iso_pu_bacteria | 2818991439 | 2819561031 | 157 |
| 253 | iso_pu_bacteria | 2818991448 | 2819611939 | 157 |
| 254 | iso_pu_bacteria | 2818991453 | 2819638522 | 157 |
| 255 | iso_pu_bacteria | 2818991461 | 2819688326 | 157 |
| 256 | iso_pu_bacteria | 2821123053 | 2821129254 | 157 |
| 257 | iso_pu_bacteria | 2837651117 | 2837651560 | 157 |
| 258 | iso_pu_bacteria | 2838016132 | 2838018197 | 157 |
| 259 | iso_pu_bacteria | 2838022645 | 2838023877 | 157 |
| 260 | iso_pu_bacteria | 2838029111 | 2838034201 | 157 |
| 261 | iso_pu_bacteria | 2838035591 | 2838040205 | 157 |
| 262 | iso_pu_bacteria | 2838042994 | 2838046711 | 157 |
| 263 | iso_pu_bacteria | 2838048938 | 2838050944 | 157 |
| 264 | iso_pu_bacteria | 2838061910 | 2838062711 | 157 |
| 265 | iso_pu_bacteria | 2838068647 | 2838072256 | 157 |
| 266 | iso_pu_bacteria | 2838074704 | 2838078227 | 157 |
| 267 | iso_pu_bacteria | 2838661181 | 2838667021 | 157 |
| 268 | iso_pu_bacteria | 2838668709 | 2838672292 | 157 |
| 269 | iso_pu_bacteria | 2838680041 | 2838683749 | 157 |
| 270 | iso_pu_bacteria | 2838686498 | 2838693305 | 157 |
| 271 | iso_pu_bacteria | 2838694306 | 2838698277 | 157 |
| 272 | iso_pu_bacteria | 2838701080 | 2838704839 | 157 |
| 273 | iso_pu_bacteria | 2838707686 | 2838711392 | 157 |
| 274 | iso_pu_bacteria | 2838714209 | 2838718313 | 157 |
| 275 | iso_pu_bacteria | 2838719591 | 2838722895 | 157 |
| 276 | iso_pu_bacteria | 2838729681 | 2838735299 | 157 |
| 277 | iso_pu_bacteria | 2838736955 | 2838742121 | 157 |
| 278 | iso_pu_bacteria | 2838742623 | 2838748152 | 157 |
| 279 | iso_pu_bacteria | 2839993093 | 2839995491 | 157 |
| 280 | iso_pu_bacteria | 2840764183 | 2840768100 | 157 |
| 281 | iso_pu_bacteria | 2841734538 | 2841735820 | 157 |
| 282 | iso_pu_bacteria | 2841840854 | 2841845977 | 157 |
| 283 | iso_pu_bacteria | 2841846520 | 2841850451 | 157 |
| 284 | iso_pu_bacteria | 2841851746 | 2841857371 | 157 |
| 285 | iso_pu_bacteria | 2841859092 | 2841863296 | 157 |
| 286 | iso_pu_bacteria | 2841864319 | 2841867624 | 157 |
| 287 | iso_pu_bacteria | 2842077413 | 2842081193 | 157 |
| 288 | iso_pu_bacteria | 2842110456 | 2842116555 | 157 |
| 289 | iso_pu_bacteria | 2842118031 | 2842122030 | 157 |
| 290 | iso_pu_bacteria | 2842124991 | 2842129039 | 157 |
| 291 | iso_pu_bacteria | 2842130223 | 2842133492 | 157 |
| 292 | iso_pu_bacteria | 2842140634 | 2842145658 | 157 |
| 293 | iso_pu_bacteria | 2842146304 | 2842148925 | 157 |
| 294 | iso_pu_bacteria | 2842152218 | 2842155597 | 157 |
| 295 | iso_pu_bacteria | 2842156927 | 2842162454 | 157 |
| 296 | iso_pu_bacteria | 2842163707 | 2842166845 | 157 |
| 297 | iso_pu_bacteria | 2842170452 | 2842174445 | 157 |
| 298 | iso_pu_bacteria | 2842175837 | 2842179106 | 157 |
| 299 | iso_pu_bacteria | 2842180545 | 2842186094 | 157 |
| 300 | iso_pu_bacteria | 2842187318 | 2842190737 | 157 |
| 301 | iso_pu_bacteria | 2842192696 | 2842194755 | 157 |
| 302 | iso_pu_bacteria | 2842198810 | 2842201231 | 157 |
| 303 | iso_pu_bacteria | 2842205361 | 2842207546 | 157 |
| 304 | iso_pu_bacteria | 2842211629 | 2842214939 | 157 |
| 305 | iso_pu_bacteria | 2842217011 | 2842221917 | 157 |
| 306 | iso_pu_bacteria | 2842224351 | 2842227660 | 157 |
| 307 | iso_pu_bacteria | 2842229732 | 2842235553 | 157 |
| 308 | iso_pu_bacteria | 2842237096 | 2842241044 | 157 |
| 309 | iso_pu_bacteria | 2842243621 | 2842249164 | 157 |
| 310 | iso_pu_bacteria | 2842250916 | 2842254520 | 157 |
| 311 | iso_pu_bacteria | 2842257432 | 2842263119 | 157 |
| 312 | iso_pu_bacteria | 2842264693 | 2842269315 | 157 |
| 313 | iso_pu_bacteria | 2842271015 | 2842277773 | 157 |
| 314 | iso_pu_bacteria | 2842278818 | 2842280743 | 157 |
| 315 | iso_pu_bacteria | 2842285085 | 2842288646 | 157 |
| 316 | iso_pu_bacteria | 2842291075 | 2842294850 | 157 |
| 317 | iso_pu_bacteria | 2842304105 | 2842305684 | 157 |
| 318 | iso_pu_bacteria | 2842311132 | 2842311548 | 157 |
| 319 | iso_pu_bacteria | 2842317721 | 2842321236 | 157 |
| 320 | iso_pu_bacteria | 2842341865 | 2842346828 | 157 |
| 321 | iso_pu_bacteria | 2842363717 | 2842366139 | 157 |
| 322 | iso_pu_bacteria | 2842370503 | 2842375132 | 157 |
| 323 | iso_pu_bacteria | 2842377471 | 2842381249 | 157 |
| 324 | iso_pu_bacteria | 2842384541 | 2842388319 | 157 |
| 325 | iso_pu_bacteria | 2842395702 | 2842395808 | 157 |
| 326 | iso_pu_bacteria | 2842402390 | 2842406008 | 157 |
| 327 | iso_pu_bacteria | 2842409023 | 2842412592 | 157 |
| 328 | iso_pu_bacteria | 2842415677 | 2842419529 | 157 |
| 329 | iso_pu_bacteria | 2842422224 | 2842425888 | 157 |
| 330 | iso_pu_bacteria | 2842428310 | 2842433401 | 157 |
| 331 | iso_pu_bacteria | 2842434925 | 2842439544 | 157 |
| 332 | iso_pu_bacteria | 2842441272 | 2842446148 | 157 |
| 333 | iso_pu_bacteria | 2842447887 | 2842448614 | 157 |
| 334 | iso_pu_bacteria | 2842462802 | 2842467650 | 157 |
| 335 | iso_pu_bacteria | 2842469257 | 2842474386 | 157 |
| 336 | iso_pu_bacteria | 2842475841 | 2842480947 | 157 |
| 337 | iso_pu_bacteria | 2842482326 | 2842485245 | 157 |
| 338 | iso_pu_bacteria | 2842489311 | 2842491303 | 157 |
| 339 | iso_pu_bacteria | 2842495871 | 2842498627 | 157 |
| 340 | iso_pu_bacteria | 2842515876 | 2842519967 | 157 |
| 341 | iso_pu_bacteria | 2842521101 | 2842524644 | 157 |
| 342 | iso_pu_bacteria | 2842871566 | 2842872693 | 157 |
| 343 | iso_pu_bacteria | 2842922631 | 2842926407 | 157 |
| 344 | iso_pu_bacteria | 2844002411 | 2844004135 | 157 |
| 345 | iso_pu_bacteria | 2844009547 | 2844010074 | 157 |
| 346 | iso_pu_bacteria | 2844163670 | 2844164307 | 157 |
| 347 | iso_pu_bacteria | 2844454524 | 2844456846 | 157 |
| 348 | iso_pu_bacteria | 2847417321 | 2847420773 | 157 |
| 349 | iso_pu_bacteria | 2847670302 | 2847672948 | 157 |
| 350 | iso_pu_bacteria | 2847686936 | 2847689427 | 157 |
| 351 | iso_pu_bacteria | 2848992105 | 2848995601 | 157 |
| 352 | iso_pu_bacteria | 2850079185 | 2850085523 | 157 |
| 353 | iso_pu_bacteria | 2852387548 | 2852392064 | 157 |
| 354 | iso_pu_bacteria | 2854896431 | 2854897699 | 157 |
| 355 | iso_pu_bacteria | 2854911287 | 2854916578 | 157 |
| 356 | iso_pu_bacteria | 2854916844 | 2854922278 | 157 |
| 357 | iso_pu_bacteria | 2855825444 | 2855827322 | 157 |
| 358 | iso_pu_bacteria | 2855839649 | 2855842703 | 157 |
| 359 | iso_pu_bacteria | 2855872281 | 2855878138 | 157 |
| 360 | iso_pu_bacteria | 2856314179 | 2856320020 | 157 |
| 361 | iso_pu_bacteria | 2856320880 | 2856327882 | 157 |
| 362 | iso_pu_bacteria | 2856328259 | 2856332055 | 157 |
| 363 | iso_pu_bacteria | 2856334872 | 2856334879 | 157 |
| 364 | iso_pu_bacteria | 2856342000 | 2856345424 | 157 |
| 365 | iso_pu_bacteria | 2856349417 | 2856351348 | 157 |
| 366 | iso_pu_bacteria | 2856356410 | 2856358676 | 157 |
| 367 | iso_pu_bacteria | 2856364286 | 2856371232 | 157 |
| 368 | iso_pu_bacteria | 2857349434 | 2857354326 | 157 |
| 369 | iso_pu_bacteria | 2857367948 | 2857367997 | 157 |
| 370 | iso_pu_bacteria | 2857516855 | 2857519720 | 157 |
| 371 | iso_pu_bacteria | 2857531043 | 2857536195 | 157 |
| 372 | iso_pu_bacteria | 2858800743 | 2858803514 | 157 |
| 373 | iso_pu_bacteria | 2869162929 | 2869169165 | 157 |
| 374 | iso_pu_bacteria | 2869169390 | 2869171084 | 157 |
| 375 | iso_pu_bacteria | 2869234852 | 2869235944 | 157 |
| 376 | iso_pu_bacteria | 2869242130 | 2869244284 | 157 |
| 377 | iso_pu_bacteria | 2869249662 | 2869252357 | 157 |
| 378 | iso_pu_bacteria | 2869256925 | 2869263774 | 157 |
| 379 | iso_pu_bacteria | 2869264136 | 2869264357 | 157 |
| 380 | iso_pu_bacteria | 2869271264 | 2869273068 | 157 |
| 381 | iso_pu_bacteria | 2869278585 | 2869279832 | 157 |
| 382 | iso_pu_bacteria | 2869285874 | 2869292455 | 157 |
| 383 | iso_pu_bacteria | 2871429161 | 2871429270 | 157 |
| 384 | iso_pu_bacteria | 2871435913 | 2871437894 | 157 |
| 385 | iso_pu_bacteria | 2871444079 | 2871451728 | 157 |
| 386 | iso_pu_bacteria | 2871451962 | 2871459233 | 157 |
| 387 | iso_pu_bacteria | 2871459585 | 2871460437 | 157 |
| 388 | iso_pu_bacteria | 2871466892 | 2871470034 | 157 |
| 389 | iso_pu_bacteria | 2871474448 | 2871475843 | 157 |
| 390 | iso_pu_bacteria | 2871481445 | 2871484492 | 157 |
| 391 | iso_pu_bacteria | 2871488783 | 2871490791 | 157 |
| 392 | iso_pu_bacteria | 2871495908 | 2871499364 | 157 |
| 393 | iso_pu_bacteria | 2874102143 | 2874106365 | 157 |
| 394 | iso_pu_bacteria | 2874109183 | 2874112564 | 157 |
| 395 | iso_pu_bacteria | 2874116593 | 2874123573 | 157 |
| 396 | iso_pu_bacteria | 2874123672 | 2874129530 | 157 |
| 397 | iso_pu_bacteria | 2874131515 | 2874134877 | 157 |
| 398 | iso_pu_bacteria | 2874139085 | 2874145676 | 157 |
| 399 | iso_pu_bacteria | 2874146452 | 2874154176 | 157 |
| 400 | iso_pu_bacteria | 2874155637 | 2874161678 | 157 |
| 401 | iso_pu_bacteria | 2874162495 | 2874162581 | 157 |
| 402 | iso_pu_bacteria | 2874168670 | 2874171746 | 157 |
| 403 | iso_pu_bacteria | 2876363079 | 2876363261 | 157 |
| 404 | iso_pu_bacteria | 2876369609 | 2876372724 | 157 |
| 405 | iso_pu_bacteria | 2876377896 | 2876384940 | 157 |
| 406 | iso_pu_bacteria | 2876386047 | 2876391953 | 157 |
| 407 | iso_pu_bacteria | 2876392853 | 2876392939 | 157 |
| 408 | iso_pu_bacteria | 2876399893 | 2876399954 | 157 |
| 409 | iso_pu_bacteria | 2876406927 | 2876410545 | 157 |
| 410 | iso_pu_bacteria | 2876413966 | 2876419860 | 157 |
| 411 | iso_pu_bacteria | 2876420981 | 2876424965 | 157 |
| 412 | iso_pu_bacteria | 2878035449 | 2878035556 | 157 |
| 413 | iso_pu_bacteria | 2878730984 | 2878737255 | 157 |
| 414 | iso_pu_bacteria | 2878738818 | 2878740326 | 157 |
| 415 | iso_pu_bacteria | 2878745973 | 2878752798 | 157 |
| 416 | iso_pu_bacteria | 2878753008 | 2878755196 | 157 |
| 417 | iso_pu_bacteria | 2878760144 | 2878763554 | 157 |
| 418 | iso_pu_bacteria | 2878767105 | 2878770552 | 157 |
| 419 | iso_pu_bacteria | 2878774303 | 2878775235 | 157 |
| 420 | iso_pu_bacteria | 2878781027 | 2878786743 | 157 |
| 421 | iso_pu_bacteria | 2881147464 | 2881147603 | 157 |
| 422 | iso_pu_bacteria | 2881155292 | 2881158706 | 157 |
| 423 | iso_pu_bacteria | 2881161766 | 2881164380 | 157 |
| 424 | iso_pu_bacteria | 2881845957 | 2881852005 | 157 |
| 425 | iso_pu_bacteria | 2881853255 | 2881860014 | 157 |
| 426 | iso_pu_bacteria | 2881861095 | 2881863435 | 157 |
| 427 | iso_pu_bacteria | 2882632389 | 2882632783 | 157 |
| 428 | iso_pu_bacteria | 2882912400 | 2882913652 | 157 |
| 429 | iso_pu_bacteria | 2885305155 | 2885306240 | 157 |
| 430 | iso_pu_bacteria | 2885312484 | 2885314710 | 157 |
| 431 | iso_pu_bacteria | 2885318864 | 2885321230 | 157 |
| 432 | iso_pu_bacteria | 2885326080 | 2885329850 | 157 |
| 433 | iso_pu_bacteria | 2885334103 | 2885335622 | 157 |
| 434 | iso_pu_bacteria | 2885342637 | 2885345745 | 157 |
| 435 | iso_pu_bacteria | 2885350715 | 2885351930 | 157 |
| 436 | iso_pu_bacteria | 2888337043 | 2888342687 | 157 |
| 437 | iso_pu_bacteria | 2888343758 | 2888343797 | 157 |
| 438 | iso_pu_bacteria | 2888350351 | 2888352265 | 157 |
| 439 | iso_pu_bacteria | 2889010040 | 2889014249 | 157 |
| 440 | iso_pu_bacteria | 2889016732 | 2889021040 | 157 |
| 441 | iso_pu_bacteria | 2889790730 | 2889792718 | 157 |
| 442 | iso_pu_bacteria | 2889914905 | 2889916224 | 157 |
| 443 | iso_pu_bacteria | 2891048133 | 2891048221 | 157 |
| 444 | iso_pu_bacteria | 2891373044 | 2891377823 | 157 |
| 445 | iso_pu_bacteria | 2894652903 | 2894654397 | 157 |
| 446 | iso_pu_bacteria | 2896384573 | 2896390257 | 157 |
| 447 | iso_pu_bacteria | 2899792073 | 2899795393 | 157 |
| 448 | iso_pu_bacteria | 2899803654 | 2899807956 | 157 |
| 449 | iso_pu_bacteria | 2903448605 | 2903454664 | 157 |
| 450 | iso_pu_bacteria | 2903492973 | 2903494897 | 157 |
| 451 | iso_pu_bacteria | 2903492973 | 2903499324 | 157 |
| 452 | iso_pu_bacteria | 2903513507 | 2903518412 | 157 |
| 453 | iso_pu_bacteria | 2903521522 | 2903525211 | 157 |
| 454 | iso_pu_bacteria | 2903528002 | 2903532044 | 157 |
| 455 | iso_pu_bacteria | 2903540706 | 2903544169 | 157 |
| 456 | iso_pu_bacteria | 2904578770 | 2904583137 | 157 |
| 457 | iso_pu_bacteria | 2904659560 | 2904659645 | 157 |
| 458 | iso_pu_bacteria | 2906308376 | 2906315189 | 157 |
| 459 | iso_pu_bacteria | 2906321335 | 2906321445 | 157 |
| 460 | iso_pu_bacteria | 2906328253 | 2906334562 | 157 |
| 461 | iso_pu_bacteria | 2906354277 | 2906359558 | 157 |
| 462 | iso_pu_bacteria | 2906363423 | 2906366287 | 157 |
| 463 | iso_pu_bacteria | 2906370794 | 2906374484 | 157 |
| 464 | iso_pu_bacteria | 2906378014 | 2906381280 | 157 |
| 465 | iso_pu_bacteria | 2906386501 | 2906387095 | 157 |
| 466 | iso_pu_bacteria | 2906393657 | 2906399016 | 157 |
| 467 | iso_pu_bacteria | 2906401398 | 2906404600 | 157 |
| 468 | iso_pu_bacteria | 2906408224 | 2906412498 | 157 |
| 469 | iso_pu_bacteria | 2906414383 | 2906420796 | 157 |
| 470 | iso_pu_bacteria | 2906427513 | 2906434988 | 157 |
| 471 | iso_pu_bacteria | 2913295892 | 2913296387 | 157 |
| 472 | iso_pu_bacteria | 2913295892 | 2913297022 | 157 |
| 473 | iso_pu_bacteria | 2913308742 | 2913312192 | 157 |
| 474 | iso_pu_bacteria | 2915650412 | 2915652526 | 157 |
| 475 | iso_pu_bacteria | 2915980308 | 2915982485 | 157 |
| 476 | iso_pu_bacteria | 2915986958 | 2915992914 | 157 |
| 477 | iso_pu_bacteria | 2915993759 | 2915996523 | 157 |
| 478 | iso_pu_bacteria | 2916000859 | 2916001915 | 157 |
| 479 | iso_pu_bacteria | 2916007675 | 2916013320 | 157 |
| 480 | iso_pu_bacteria | 2916014648 | 2916018299 | 157 |
| 481 | iso_pu_bacteria | 2916021584 | 2916024360 | 157 |
| 482 | iso_pu_bacteria | 2916028427 | 2916031276 | 157 |
| 483 | iso_pu_bacteria | 2916035215 | 2916037701 | 157 |
| 484 | iso_pu_bacteria | 2916041962 | 2916045978 | 157 |
| 485 | iso_pu_bacteria | 2916048683 | 2916051691 | 157 |
| 486 | iso_pu_bacteria | 2916055098 | 2916058466 | 157 |
| 487 | iso_pu_bacteria | 2916061851 | 2916065072 | 157 |
| 488 | iso_pu_bacteria | 2916068649 | 2916076216 | 157 |
| 489 | iso_pu_bacteria | 2916076590 | 2916079601 | 157 |
| 490 | iso_pu_bacteria | 2917554339 | 2917558227 | 157 |
| 491 | iso_pu_bacteria | 2919100787 | 2919107903 | 157 |
| 492 | iso_pu_bacteria | 2919114240 | 2919118430 | 157 |
| 493 | iso_pu_bacteria | 2919119836 | 2919123751 | 157 |
| 494 | iso_pu_bacteria | 2919171160 | 2919176919 | 157 |
| 495 | iso_pu_bacteria | 2919408235 | 2919411420 | 157 |
| 496 | iso_pu_bacteria | 2920760137 | 2920760382 | 157 |
| 497 | iso_pu_bacteria | 2920822456 | 2920825885 | 157 |
| 498 | iso_pu_bacteria | 2921201388 | 2921201930 | 157 |
| 499 | iso_pu_bacteria | 2921208531 | 2921210979 | 157 |
| 500 | iso_pu_bacteria | 2921237296 | 2921239878 | 157 |
| 501 | iso_pu_bacteria | 2921244191 | 2921245865 | 157 |
| 502 | iso_pu_bacteria | 2921250672 | 2921254497 | 157 |
| 503 | iso_pu_bacteria | 2921257292 | 2921259077 | 157 |
| 504 | iso_pu_bacteria | 2921263974 | 2921267058 | 157 |
| 505 | iso_pu_bacteria | 2921282425 | 2921285616 | 157 |
| 506 | iso_pu_bacteria | 2921289301 | 2921290302 | 157 |
| 507 | iso_pu_bacteria | 2921296804 | 2921303309 | 157 |
| 508 | iso_pu_bacteria | 2922130491 | 2922133413 | 157 |
| 509 | iso_pu_bacteria | 2922151315 | 2922157722 | 157 |
| 510 | iso_pu_bacteria | 2922158528 | 2922165046 | 157 |
| 511 | iso_pu_bacteria | 2922172374 | 2922178226 | 157 |
| 512 | iso_pu_bacteria | 2922178524 | 2922183584 | 157 |
| 513 | iso_pu_bacteria | 2922185730 | 2922186870 | 157 |
| 514 | iso_pu_bacteria | 2923556063 | 2923560647 | 157 |
| 515 | iso_pu_bacteria | 2924144063 | 2924146678 | 157 |
| 516 | iso_pu_bacteria | 2924150972 | 2924155520 | 157 |
| 517 | iso_pu_bacteria | 2924158325 | 2924161637 | 157 |
| 518 | iso_pu_bacteria | 2924165586 | 2924169965 | 157 |
| 519 | iso_pu_bacteria | 2924172951 | 2924177277 | 157 |
| 520 | iso_pu_bacteria | 2924179722 | 2924180181 | 157 |
| 521 | iso_pu_bacteria | 2924186466 | 2924192461 | 157 |
| 522 | iso_pu_bacteria | 2924193448 | 2924193654 | 157 |
| 523 | iso_pu_bacteria | 2924200457 | 2924201838 | 157 |
| 524 | iso_pu_bacteria | 2924207177 | 2924210245 | 157 |
| 525 | iso_pu_bacteria | 2924214083 | 2924219596 | 157 |
| 526 | iso_pu_bacteria | 2924221636 | 2924226132 | 157 |
| 527 | iso_pu_bacteria | 2924228884 | 2924231723 | 157 |
| 528 | iso_pu_bacteria | 2924710171 | 2924717480 | 157 |
| 529 | iso_pu_bacteria | 2924718760 | 2924718809 | 157 |
| 530 | iso_pu_bacteria | 2924726620 | 2924732855 | 157 |
| 531 | iso_pu_bacteria | 2924733363 | 2924734305 | 157 |
| 532 | iso_pu_bacteria | 2924741084 | 2924743422 | 157 |
| 533 | iso_pu_bacteria | 2924748358 | 2924754388 | 157 |
| 534 | iso_pu_bacteria | 2924754689 | 2924758483 | 157 |
| 535 | iso_pu_bacteria | 2924762789 | 2924767688 | 157 |
| 536 | iso_pu_bacteria | 2924776078 | 2924777926 | 157 |
| 537 | iso_pu_bacteria | 2924784321 | 2924791416 | 157 |
| 538 | iso_pu_bacteria | 2926754445 | 2926754959 | 157 |
| 539 | iso_pu_bacteria | 2926760298 | 2926762124 | 157 |
| 540 | iso_pu_bacteria | 2928521798 | 2928523294 | 157 |
| 541 | iso_pu_bacteria | 2932401849 | 2932401852 | 157 |
| 542 | iso_pu_bacteria | 2933006813 | 2933010556 | 157 |
| 543 | iso_pu_bacteria | 2933011516 | 2933015772 | 157 |
| 544 | iso_pu_bacteria | 2933016740 | 2933018596 | 157 |
| 545 | iso_pu_bacteria | 2933570622 | 2933572190 | 157 |
| 546 | iso_pu_bacteria | 2933586486 | 2933592838 | 157 |
| 547 | iso_pu_bacteria | 2933594066 | 2933597490 | 157 |
| 548 | iso_pu_bacteria | 2933599457 | 2933602892 | 157 |
| 549 | iso_pu_bacteria | 2935894831 | 2935898071 | 157 |
| 550 | iso_pu_bacteria | 2935901341 | 2935903487 | 157 |
| 551 | iso_pu_bacteria | 2936367885 | 2936370039 | 157 |
| 552 | iso_pu_bacteria | 2936375103 | 2936379215 | 157 |
| 553 | iso_pu_bacteria | 2936381700 | 2936381809 | 157 |
| 554 | iso_pu_bacteria | 2936996657 | 2936997520 | 157 |
| 555 | iso_pu_bacteria | 2937002841 | 2937006780 | 157 |
| 556 | iso_pu_bacteria | 2937009748 | 2937013714 | 157 |
| 557 | iso_pu_bacteria | 2937016420 | 2937019069 | 157 |
| 558 | iso_pu_bacteria | 2937023124 | 2937025960 | 157 |
| 559 | iso_pu_bacteria | 2937029754 | 2937031914 | 157 |
| 560 | iso_pu_bacteria | 2937036028 | 2937036156 | 157 |
| 561 | iso_pu_bacteria | 2937042894 | 2937043988 | 157 |
| 562 | iso_pu_bacteria | 2937049772 | 2937051187 | 157 |
| 563 | iso_pu_bacteria | 2937056579 | 2937062134 | 157 |
| 564 | iso_pu_bacteria | 2937063883 | 2937067715 | 157 |
| 565 | iso_pu_bacteria | 2937071275 | 2937072733 | 157 |
| 566 | iso_pu_bacteria | 2937084907 | 2937087663 | 157 |
| 567 | iso_pu_bacteria | 2937091812 | 2937093944 | 157 |
| 568 | iso_pu_bacteria | 2937098957 | 2937101019 | 157 |
| 569 | iso_pu_bacteria | 2937106411 | 2937112636 | 157 |
| 570 | iso_pu_bacteria | 2937113482 | 2937116054 | 157 |
| 571 | iso_pu_bacteria | 2937119839 | 2937123198 | 157 |
| 572 | iso_pu_bacteria | 2937126314 | 2937127799 | 157 |
| 573 | iso_pu_bacteria | 2937813078 | 2937821731 | 157 |
| 574 | iso_pu_bacteria | 2937822353 | 2937826003 | 157 |
| 575 | iso_pu_bacteria | 2937836603 | 2937839113 | 157 |
| 576 | iso_pu_bacteria | 2937843397 | 2937843413 | 157 |
| 577 | iso_pu_bacteria | 2937848649 | 2937849845 | 157 |
| 578 | iso_pu_bacteria | 2937861824 | 2937863293 | 157 |
| 579 | iso_pu_bacteria | 2937868953 | 2937871093 | 157 |
| 580 | iso_pu_bacteria | 2937877337 | 2937884488 | 157 |
| 581 | iso_pu_bacteria | 2937891427 | 2937896008 | 157 |
| 582 | iso_pu_bacteria | 2937972304 | 2937980511 | 157 |
| 583 | iso_pu_bacteria | 2937980651 | 2937984911 | 157 |
| 584 | iso_pu_bacteria | 2937994558 | 2937998014 | 157 |
| 585 | iso_pu_bacteria | 2938014810 | 2938015674 | 157 |
| 586 | iso_pu_bacteria | 2941499720 | 2941501305 | 157 |
| 587 | iso_pu_bacteria | 2954011201 | 2954015567 | 157 |
| 588 | iso_pu_bacteria | 2957375807 | 2957381886 | 157 |
| 589 | iso_pu_bacteria | 2957382221 | 2957384633 | 157 |
| 590 | iso_pu_bacteria | 2957388812 | 2957391403 | 157 |
| 591 | iso_pu_bacteria | 2957395598 | 2957400473 | 157 |
| 592 | iso_pu_bacteria | 2957402308 | 2957404373 | 157 |
| 593 | iso_pu_bacteria | 2957408893 | 2957411881 | 157 |
| 594 | iso_pu_bacteria | 2957415311 | 2957416654 | 157 |
| 595 | iso_pu_bacteria | 2957422303 | 2957423804 | 157 |
| 596 | iso_pu_bacteria | 2957430029 | 2957434615 | 157 |
| 597 | iso_pu_bacteria | 2957437181 | 2957442143 | 157 |
| 598 | iso_pu_bacteria | 2957443900 | 2957447863 | 157 |
| 599 | iso_pu_bacteria | 2957450854 | 2957455085 | 157 |
| 600 | iso_pu_bacteria | 2957457609 | 2957461278 | 157 |
| 601 | iso_pu_bacteria | 2957464669 | 2957470863 | 157 |
| 602 | iso_pu_bacteria | 2957471148 | 2957471506 | 157 |
| 603 | iso_pu_bacteria | 2957478035 | 2957481738 | 157 |
| 604 | iso_pu_bacteria | 2957484790 | 2957490355 | 157 |
| 605 | iso_pu_bacteria | 2957491536 | 2957494190 | 157 |
| 606 | iso_pu_bacteria | 2957498199 | 2957503019 | 157 |
| 607 | iso_pu_bacteria | 2957505466 | 2957510168 | 157 |
| 608 | iso_pu_bacteria | 2958034702 | 2958035699 | 157 |
| 609 | iso_pu_bacteria | 2958041894 | 2958044730 | 157 |
| 610 | iso_pu_bacteria | 2958071322 | 2958076315 | 157 |
| 611 | iso_pu_bacteria | 2958084443 | 2958091799 | 157 |
| 612 | iso_pu_bacteria | 2958092219 | 2958095778 | 157 |
| 613 | iso_pu_bacteria | 2958100919 | 2958104155 | 157 |
| 614 | iso_pu_bacteria | 2958108152 | 2958108521 | 157 |
| 615 | iso_pu_bacteria | 2958115193 | 2958119685 | 157 |
| 616 | iso_pu_bacteria | 2958122699 | 2958129248 | 157 |
| 617 | iso_pu_bacteria | 2958130278 | 2958136855 | 157 |
| 618 | iso_pu_bacteria | 2958137437 | 2958140661 | 157 |
| 619 | iso_pu_bacteria | 2958144490 | 2958147288 | 157 |
| 620 | iso_pu_bacteria | 2958158011 | 2958159403 | 157 |
| 621 | iso_pu_bacteria | 2958165035 | 2958168489 | 157 |
| 622 | iso_pu_bacteria | 2958172287 | 2958175592 | 157 |
| 623 | iso_pu_bacteria | 2958179912 | 2958186738 | 157 |
| 624 | iso_pu_bacteria | 2960584000 | 2960590370 | 157 |
| 625 | iso_pu_bacteria | 2960591022 | 2960592179 | 157 |
| 626 | iso_pu_bacteria | 2960597568 | 2960599251 | 157 |
| 627 | iso_pu_bacteria | 2960603979 | 2960609709 | 157 |
| 628 | iso_pu_bacteria | 2960610863 | 2960613210 | 157 |
| 629 | iso_pu_bacteria | 2960617483 | 2960622253 | 157 |
| 630 | iso_pu_bacteria | 2960624210 | 2960626926 | 157 |
| 631 | iso_pu_bacteria | 2960631154 | 2960633459 | 157 |
| 632 | iso_pu_bacteria | 2960637947 | 2960642427 | 157 |
| 633 | iso_pu_bacteria | 2960645483 | 2960650266 | 157 |
| 634 | iso_pu_bacteria | 2960652885 | 2960658762 | 157 |
| 635 | iso_pu_bacteria | 2960660292 | 2960664328 | 157 |
| 636 | iso_pu_bacteria | 2960667422 | 2960671952 | 157 |
| 637 | iso_pu_bacteria | 2960674078 | 2960674677 | 157 |
| 638 | iso_pu_bacteria | 2960680706 | 2960682286 | 157 |
| 639 | iso_pu_bacteria | 2960687367 | 2960692719 | 157 |
| 640 | iso_pu_bacteria | 2960693952 | 2960700830 | 157 |
| 641 | iso_pu_bacteria | 2961077736 | 2961085239 | 157 |
| 642 | iso_pu_bacteria | 2961114664 | 2961114969 | 157 |
| 643 | iso_pu_bacteria | 2961127735 | 2961131925 | 157 |
| 644 | iso_pu_bacteria | 2961136820 | 2961141182 | 157 |
| 645 | iso_pu_bacteria | 2961163497 | 2961166953 | 157 |
| 646 | iso_pu_bacteria | 2961170736 | 2961176762 | 157 |
| 647 | iso_pu_bacteria | 2961183825 | 2961190055 | 157 |
| 648 | iso_pu_bacteria | 2963644680 | 2963644721 | 157 |
| 649 | iso_pu_bacteria | 2964607997 | 2964608574 | 157 |
| 650 | iso_pu_bacteria | 2964615318 | 2964615759 | 157 |
| 651 | iso_pu_bacteria | 2964621998 | 2964624757 | 157 |
| 652 | iso_pu_bacteria | 2964628898 | 2964633322 | 157 |
| 653 | iso_pu_bacteria | 2964636051 | 2964639838 | 157 |
| 654 | iso_pu_bacteria | 2964643177 | 2964645870 | 157 |
| 655 | iso_pu_bacteria | 2964649959 | 2964654161 | 157 |
| 656 | iso_pu_bacteria | 2964656573 | 2964662858 | 157 |
| 657 | iso_pu_bacteria | 2964663802 | 2964669081 | 157 |
| 658 | iso_pu_bacteria | 2964670856 | 2964675945 | 157 |
| 659 | iso_pu_bacteria | 2964678106 | 2964683122 | 157 |
| 660 | iso_pu_bacteria | 2964685014 | 2964688828 | 157 |
| 661 | iso_pu_bacteria | 2964691889 | 2964694581 | 157 |
| 662 | iso_pu_bacteria | 2964698721 | 2964701329 | 157 |
| 663 | iso_pu_bacteria | 2964705432 | 2964707945 | 157 |
| 664 | iso_pu_bacteria | 2964712639 | 2964712829 | 157 |
| 665 | iso_pu_bacteria | 2964719344 | 2964725004 | 157 |
| 666 | iso_pu_bacteria | 2965018300 | 2965021777 | 157 |
| 667 | iso_pu_bacteria | 2965025482 | 2965028863 | 157 |
| 668 | iso_pu_bacteria | 2965032056 | 2965034912 | 157 |
| 669 | iso_pu_bacteria | 2965040258 | 2965044199 | 157 |
| 670 | iso_pu_bacteria | 2965047637 | 2965050517 | 157 |
| 671 | iso_pu_bacteria | 2965062239 | 2965066105 | 157 |
| 672 | iso_pu_bacteria | 2965089291 | 2965090678 | 157 |
| 673 | iso_pu_bacteria | 2965102966 | 2965107155 | 157 |
| 674 | iso_pu_bacteria | 2965110997 | 2965116399 | 157 |
| 675 | iso_pu_bacteria | 2965119406 | 2965120197 | 157 |
| 676 | iso_pu_bacteria | 2967664464 | 2967667762 | 157 |
| 677 | iso_pu_bacteria | 2967671571 | 2967678503 | 157 |
| 678 | iso_pu_bacteria | 2967678726 | 2967679090 | 157 |
| 679 | iso_pu_bacteria | 2967686174 | 2967690304 | 157 |
| 680 | iso_pu_bacteria | 2967693043 | 2967695411 | 157 |
| 681 | iso_pu_bacteria | 2967699805 | 2967700928 | 157 |
| 682 | iso_pu_bacteria | 2967706974 | 2967711373 | 157 |
| 683 | iso_pu_bacteria | 2967714385 | 2967718905 | 157 |
| 684 | iso_pu_bacteria | 2967721400 | 2967727732 | 157 |
| 685 | iso_pu_bacteria | 2967728569 | 2967732022 | 157 |
| 686 | iso_pu_bacteria | 2967735183 | 2967739061 | 157 |
| 687 | iso_pu_bacteria | 2967742019 | 2967747168 | 157 |
| 688 | iso_pu_bacteria | 2967748971 | 2967752528 | 157 |
| 689 | iso_pu_bacteria | 2967755722 | 2967759852 | 157 |
| 690 | iso_pu_bacteria | 2967762386 | 2967764381 | 157 |
| 691 | iso_pu_bacteria | 2967769361 | 2967772845 | 157 |
| 692 | iso_pu_bacteria | 2967775926 | 2967776619 | 157 |
| 693 | iso_pu_bacteria | 2967996073 | 2968001129 | 157 |
| 694 | iso_pu_bacteria | 2968003550 | 2968007182 | 157 |
| 695 | iso_pu_bacteria | 2968016561 | 2968021612 | 157 |
| 696 | iso_pu_bacteria | 2968083720 | 2968089003 | 157 |
| 697 | iso_pu_bacteria | 2968091066 | 2968094108 | 157 |
| 698 | iso_pu_bacteria | 2968097103 | 2968100700 | 157 |
| 699 | iso_pu_bacteria | 2968110612 | 2968110697 | 157 |
| 700 | iso_pu_bacteria | 2968117919 | 2968121577 | 157 |
| 701 | iso_pu_bacteria | 2968128360 | 2968131316 | 157 |
| 702 | iso_pu_bacteria | 2968138860 | 2968142442 | 157 |
| 703 | iso_pu_bacteria | 2968171901 | 2968175359 | 157 |
| 704 | iso_pu_bacteria | 2970019648 | 2970025972 | 157 |
| 705 | iso_pu_bacteria | 2970026789 | 2970029905 | 157 |
| 706 | iso_pu_bacteria | 2970033650 | 2970039645 | 157 |
| 707 | iso_pu_bacteria | 2970040964 | 2970045120 | 157 |
| 708 | iso_pu_bacteria | 2970047711 | 2970048531 | 157 |
| 709 | iso_pu_bacteria | 2970054988 | 2970059391 | 157 |
| 710 | iso_pu_bacteria | 2970061556 | 2970068190 | 157 |
| 711 | iso_pu_bacteria | 2970068827 | 2970076034 | 157 |
| 712 | iso_pu_bacteria | 2970076120 | 2970078815 | 157 |
| 713 | iso_pu_bacteria | 2970082768 | 2970086332 | 157 |
| 714 | iso_pu_bacteria | 2970088815 | 2970093684 | 157 |
| 715 | iso_pu_bacteria | 2970095765 | 2970096467 | 157 |
| 716 | iso_pu_bacteria | 2970102677 | 2970105299 | 157 |
| 717 | iso_pu_bacteria | 2970109326 | 2970114168 | 157 |
| 718 | iso_pu_bacteria | 2970116247 | 2970116771 | 157 |
| 719 | iso_pu_bacteria | 2970122695 | 2970123900 | 157 |
| 720 | iso_pu_bacteria | 2970129317 | 2970133690 | 157 |
| 721 | iso_pu_bacteria | 2970136068 | 2970138198 | 157 |
| 722 | iso_pu_bacteria | 2970143518 | 2970143658 | 157 |
| 723 | iso_pu_bacteria | 2970149975 | 2970153404 | 157 |
| 724 | iso_pu_bacteria | 2970156795 | 2970157717 | 157 |
| 725 | iso_pu_bacteria | 2970164137 | 2970167250 | 157 |
| 726 | iso_pu_bacteria | 2970170962 | 2970174975 | 157 |
| 727 | iso_pu_bacteria | 2970177841 | 2970178200 | 157 |
| 728 | iso_pu_bacteria | 2970184632 | 2970190424 | 157 |
| 729 | iso_pu_bacteria | 2970191845 | 2970196526 | 157 |
| 730 | iso_pu_bacteria | 2970469710 | 2970476709 | 157 |
| 731 | iso_pu_bacteria | 2970489779 | 2970494167 | 157 |
| 732 | iso_pu_bacteria | 2970503327 | 2970509435 | 157 |
| 733 | iso_pu_bacteria | 2970510686 | 2970514247 | 157 |
| 734 | iso_pu_bacteria | 2970524798 | 2970525502 | 157 |
| 735 | iso_pu_bacteria | 2970532167 | 2970536091 | 157 |
| 736 | iso_pu_bacteria | 2970540015 | 2970541670 | 157 |
| 737 | iso_pu_bacteria | 2970547951 | 2970553776 | 157 |
| 738 | iso_pu_bacteria | 2970554993 | 2970558397 | 157 |
| 739 | iso_pu_bacteria | 2970593180 | 2970594431 | 157 |
| 740 | iso_pu_bacteria | 2970619444 | 2970626483 | 157 |
| 741 | iso_pu_bacteria | 2970627176 | 2970627681 | 157 |
| 742 | iso_pu_bacteria | 2977516862 | 2977518745 | 157 |
| 743 | iso_pu_bacteria | 2977523885 | 2977525479 | 157 |
| 744 | iso_pu_bacteria | 2977537788 | 2977540315 | 157 |
| 745 | iso_pu_bacteria | 2977544691 | 2977550684 | 157 |
| 746 | iso_pu_bacteria | 2977551784 | 2977553258 | 157 |
| 747 | iso_pu_bacteria | 2977558990 | 2977562853 | 157 |
| 748 | iso_pu_bacteria | 2977565890 | 2977570346 | 157 |
| 749 | iso_pu_bacteria | 2977572785 | 2977577499 | 157 |
| 750 | iso_pu_bacteria | 2977579622 | 2977585553 | 157 |
| 751 | iso_pu_bacteria | 2977821940 | 2977824336 | 157 |
| 752 | iso_pu_bacteria | 2977828996 | 2977831813 | 157 |
| 753 | iso_pu_bacteria | 2977843712 | 2977850044 | 157 |
| 754 | iso_pu_bacteria | 2977851361 | 2977855058 | 157 |
| 755 | iso_pu_bacteria | 2977858184 | 2977862938 | 157 |
| 756 | iso_pu_bacteria | 2977864932 | 2977868325 | 157 |
| 757 | iso_pu_bacteria | 2977872689 | 2977880004 | 157 |
| 758 | iso_pu_bacteria | 2977898635 | 2977903646 | 157 |
| 759 | iso_pu_bacteria | 2977907340 | 2977907453 | 157 |
| 760 | iso_pu_bacteria | 2977915119 | 2977915856 | 157 |
| 761 | iso_pu_bacteria | 2977922695 | 2977925104 | 157 |
| 762 | iso_pu_bacteria | 2977935797 | 2977940488 | 157 |
| 763 | iso_pu_bacteria | 2977942078 | 2977943658 | 157 |
| 764 | iso_pu_bacteria | 2977950692 | 2977953074 | 157 |
| 765 | iso_pu_bacteria | 2977957713 | 2977961243 | 157 |
| 766 | iso_pu_bacteria | 2977971508 | 2977979106 | 157 |
| 767 | iso_pu_bacteria | 2977986579 | 2977987547 | 157 |
| 768 | iso_pu_bacteria | 2979100975 | 2979104578 | 157 |
| 769 | iso_pu_bacteria | 2979710463 | 2979715500 | 157 |
| 770 | iso_pu_bacteria | 2979742915 | 2979742987 | 157 |
| 771 | iso_pu_bacteria | 2979764755 | 2979772150 | 157 |
| 772 | iso_pu_bacteria | 2979772303 | 2979773350 | 157 |
| 773 | iso_pu_bacteria | 2979779861 | 2979782383 | 157 |
| 774 | iso_pu_bacteria | 2979793036 | 2979795789 | 157 |
| 775 | iso_pu_bacteria | 2979808191 | 2979814222 | 157 |
| 776 | iso_pu_bacteria | 2984509177 | 2984513625 | 157 |
| 777 | iso_pu_bacteria | 2984518228 | 2984522794 | 157 |
| 778 | iso_pu_bacteria | 2984537506 | 2984542101 | 157 |
| 779 | iso_pu_bacteria | 2984601300 | 2984601531 | 157 |
| 780 | iso_pu_bacteria | 2987636660 | 2987642264 | 157 |
| 781 | iso_pu_bacteria | 2987645492 | 2987648518 | 157 |
| 782 | iso_pu_bacteria | 2987652177 | 2987658161 | 157 |
| 783 | iso_pu_bacteria | 2987659509 | 2987662965 | 157 |
| 784 | iso_pu_bacteria | 2987666974 | 2987668413 | 157 |
| 785 | iso_pu_bacteria | 2987673487 | 2987680091 | 157 |
| 786 | iso_pu_bacteria | 2989349275 | 2989355043 | 157 |
| 787 | iso_pu_bacteria | 2989771324 | 2989771722 | 157 |
| 788 | iso_pu_bacteria | 2989776772 | 2989780242 | 157 |
| 789 | iso_pu_bacteria | 2995392953 | 2995395580 | 157 |
| 790 | iso_pu_bacteria | 2996310559 | 2996311532 | 157 |
| 791 | iso_pu_bacteria | 2996336353 | 2996341532 | 157 |
| 792 | iso_pu_bacteria | 2996341866 | 2996346123 | 157 |
| 793 | iso_pu_bacteria | 2996348954 | 2996356133 | 157 |
| 794 | iso_pu_bacteria | 2996386984 | 2996393699 | 157 |
| 795 | iso_pu_bacteria | 2996887358 | 2996890364 | 157 |
| 796 | iso_pu_bacteria | 2996893221 | 2996896136 | 157 |
| 797 | iso_pu_bacteria | 3000135777 | 3000135921 | 157 |
| 798 | iso_pu_bacteria | 3002141150 | 3002143850 | 157 |
| 799 | iso_pu_bacteria | 3003930520 | 3003931104 | 157 |
| 800 | iso_pu_bacteria | 3004167301 | 3004172527 | 157 |
| 801 | iso_pu_bacteria | 3004188549 | 3004192017 | 157 |
| 802 | iso_pu_bacteria | 3004195979 | 3004197980 | 157 |
| 803 | iso_pu_bacteria | 3004203850 | 3004210350 | 157 |
| 804 | iso_pu_bacteria | 3004211236 | 3004216708 | 157 |
| 805 | iso_pu_bacteria | 3004218560 | 3004219741 | 157 |
| 806 | iso_pu_bacteria | 3004239961 | 3004241110 | 157 |
| 807 | iso_pu_bacteria | 3004248173 | 3004253180 | 157 |
| 808 | iso_pu_bacteria | 3004268573 | 3004269528 | 157 |
| 809 | iso_pu_bacteria | 3004275668 | 3004282447 | 157 |
| 810 | iso_pu_bacteria | 3004289098 | 3004293536 | 157 |
| 811 | iso_pu_bacteria | 3004334049 | 3004338078 | 157 |
| 812 | iso_pu_bacteria | 3005409236 | 3005415925 | 157 |
| 813 | iso_pu_bacteria | 3005416602 | 3005416922 | 157 |
| 814 | iso_pu_bacteria | 3005452660 | 3005456059 | 157 |
| 815 | iso_pu_bacteria | 637000159 | 637077648 | 157 |
| 816 | iso_pu_bacteria | 639633055 | 639650572 | 157 |
| 817 | iso_pu_bacteria | 648276728 | 648737144 | 157 |
| 818 | iso_pu_bacteria | 649633066 | 649869913 | 157 |
| 819 | iso_pu_bacteria | 650716007 | 650741237 | 157 |
| 820 | iso_pu_bacteria | 8002285264 | 8002290775 | 157 |
| 821 | iso_pu_bacteria | 8003570095 | 8003573702 | 157 |
| 822 | iso_pu_bacteria | 8003992118 | 8003995285 | 157 |
| 823 | iso_pu_bacteria | 8003999396 | 8004003023 | 157 |
| 824 | iso_pu_bacteria | 8004300914 | 8004302414 | 157 |
| 825 | iso_pu_bacteria | 8004312739 | 8004317300 | 157 |
| 826 | iso_pu_bacteria | 8004361976 | 8004365270 | 157 |
| 827 | iso_pu_bacteria | 8004374579 | 8004376775 | 157 |
| 828 | iso_pu_bacteria | 8004387939 | 8004395129 | 157 |
| 829 | iso_pu_bacteria | 8004395343 | 8004398159 | 157 |
| 830 | iso_pu_bacteria | 8004445564 | 8004451352 | 157 |
| 831 | iso_pu_bacteria | 8004633249 | 8004634624 | 157 |
| 832 | iso_pu_bacteria | 8004640170 | 8004646931 | 157 |
| 833 | iso_pu_bacteria | 8004695233 | 8004697081 | 157 |
| 834 | iso_pu_bacteria | 8004703790 | 8004707269 | 157 |
| 835 | iso_pu_bacteria | 8004714634 | 8004721450 | 157 |
| 836 | iso_pu_bacteria | 8004727605 | 8004729237 | 157 |
| 837 | iso_pu_bacteria | 8005246636 | 8005249403 | 157 |
| 838 | iso_pu_bacteria | 8005258706 | 8005262547 | 157 |
| 839 | iso_pu_bacteria | 8005275841 | 8005282568 | 157 |
| 840 | iso_pu_bacteria | 8005282627 | 8005286617 | 157 |
| 841 | iso_pu_bacteria | 8005289223 | 8005295213 | 157 |
| 842 | iso_pu_bacteria | 8005301065 | 8005306089 | 157 |
| 843 | iso_pu_bacteria | 8005307578 | 8005309659 | 157 |
| 844 | iso_pu_bacteria | 8005314921 | 8005315874 | 157 |
| 845 | iso_pu_bacteria | 8005321885 | 8005324891 | 157 |
| 846 | iso_pu_bacteria | 8005376324 | 8005381431 | 157 |
| 847 | iso_pu_bacteria | 8005382845 | 8005387644 | 157 |
| 848 | iso_pu_bacteria | 8005395548 | 8005400675 | 157 |
| 849 | iso_pu_bacteria | 8005430974 | 8005431921 | 157 |
| 850 | iso_pu_bacteria | 8005460587 | 8005465247 | 157 |
| 851 | iso_pu_bacteria | 8005484373 | 8005486960 | 157 |
| 852 | iso_pu_bacteria | 8005497431 | 8005497823 | 157 |
| 853 | iso_pu_bacteria | 8005542996 | 8005546793 | 157 |
| 854 | iso_pu_bacteria | 8005556819 | 8005561311 | 157 |
| 855 | iso_pu_bacteria | 8005563573 | 8005565934 | 157 |
| 856 | iso_pu_bacteria | 8005570704 | 8005571982 | 157 |
| 857 | iso_pu_bacteria | 8005619151 | 8005623558 | 157 |
| 858 | iso_pu_bacteria | 8005626139 | 8005630881 | 157 |
| 859 | iso_pu_bacteria | 8005658619 | 8005660860 | 157 |
| 860 | iso_pu_bacteria | 8005668836 | 8005669229 | 157 |
| 861 | iso_pu_bacteria | 8005682033 | 8005687396 | 157 |
| 862 | iso_pu_bacteria | 8005688590 | 8005694213 | 157 |
| 863 | iso_pu_bacteria | 8005695170 | 8005695864 | 157 |
| 864 | iso_pu_bacteria | 8018127388 | 8018128705 | 157 |
| 865 | iso_pu_bacteria | 8018150411 | 8018154978 | 157 |
| 866 | iso_pu_bacteria | 8018163183 | 8018164951 | 157 |
| 867 | iso_pu_bacteria | 8018176218 | 8018177608 | 157 |
| 868 | iso_pu_bacteria | 8023680758 | 8023686690 | 157 |
| 869 | iso_pu_bacteria | 8024479707 | 8024484509 | 157 |
| 870 | iso_pu_bacteria | 8024486573 | 8024490978 | 157 |
| 871 | iso_pu_bacteria | 8024501048 | 8024502136 | 157 |
| 872 | iso_pu_bacteria | 8046767195 | 8046768408 | 157 |
| 873 | iso_pu_bacteria | 8049293176 | 8049296221 | 157 |
| 874 | iso_pu_bacteria | 8049293176 | 8049298111 | 157 |
| 875 | iso_pu_bacteria | 8054460903 | 8054463741 | 157 |
| 876 | iso_pu_bacteria | 8054558443 | 8054561803 | 157 |
| 877 | iso_pu_bacteria | 8055431914 | 8055432902 | 157 |
| 878 | iso_pu_bacteria | 8055617313 | 8055617352 | 157 |
| 879 | iso_pu_bacteria | 8056375014 | 8056380543 | 157 |
| 880 | iso_pu_bacteria | 8056382006 | 8056383398 | 157 |
| 881 | iso_pu_bacteria | 8056875544 | 8056878328 | 157 |
| 882 | iso_pu_bacteria | 8057575449 | 8057581923 | 157 |
| 883 | iso_pu_bacteria | 8057874678 | 8057879427 | 157 |
| 884 | 3300006051 | Ga0075364_10670092 | Ga0075364_106700921 | 158 |
| 885 | 3300005578 | Ga0068854_100671069 | Ga0068854_1006710693 | 160 |
| 886 | 3300013307 | Ga0157372_11930094 | Ga0157372_119300941 | 160 |
| 887 | 3300046506 | Ga0495583_0383331 | Ga0495583_0383331_46_528 | 160 |
| 888 | 2010549000 | RicEn_FSXC2569_b1 | RicEn_192030 | 161 |
| 889 | 3300001915 | JGI24741J21665_1062818 | JGI24741J21665_10628181 | 161 |
| 890 | 3300001979 | JGI24740J21852_10036962 | JGI24740J21852_100369623 | 161 |
| 891 | 3300001979 | JGI24740J21852_10049384 | JGI24740J21852_100493842 | 161 |
| 892 | 3300001979 | JGI24740J21852_10079623 | JGI24740J21852_100796231 | 161 |
| 893 | 3300001979 | JGI24740J21852_10108231 | JGI24740J21852_101082311 | 161 |
| 894 | 3300001989 | JGI24739J22299_10048442 | JGI24739J22299_100484423 | 161 |
| 895 | 3300002067 | JGI24735J21928_10041271 | JGI24735J21928_100412712 | 161 |
| 896 | 3300002704 | JGI25155J39150_1000018 | JGI25155J39150_100001843 | 161 |
| 897 | 3300002705 | JGI25156J39149_1000140 | JGI25156J39149_10001408 | 161 |
| 898 | 3300002737 | JGI25162J39368_1000253 | JGI25162J39368_100025318 | 161 |
| 899 | 3300002737 | JGI25162J39368_1000485 | JGI25162J39368_100048515 | 161 |
| 900 | 3300002738 | JGI25154J39366_1000069 | JGI25154J39366_100006982 | 161 |
| 901 | 3300002738 | JGI25154J39366_1000161 | JGI25154J39366_10001615 | 161 |
| 902 | 3300002739 | JGI25158J39367_1000014 | JGI25158J39367_100001430 | 161 |
| 903 | 3300002739 | JGI25158J39367_1010618 | JGI25158J39367_10106182 | 161 |
| 904 | 3300002741 | JGI25157J39369_1000108 | JGI25157J39369_100010822 | 161 |
| 905 | 3300002741 | JGI25157J39369_1001286 | JGI25157J39369_10012862 | 161 |
| 906 | 3300002773 | JGI25152J39213_1000229 | JGI25152J39213_10002293 | 161 |
| 907 | 3300002773 | JGI25152J39213_1002877 | JGI25152J39213_10028773 | 161 |
| 908 | 3300002773 | JGI25152J39213_1007990 | JGI25152J39213_10079901 | 161 |
| 909 | 3300002773 | JGI25152J39213_1036572 | JGI25152J39213_10365722 | 161 |
| 910 | 3300002774 | JGI25150J39212_1000018 | JGI25150J39212_1000018122 | 161 |
| 911 | 3300002987 | JGI25159J45721_1000176 | JGI25159J45721_100017623 | 161 |
| 912 | 3300002987 | JGI25159J45721_1000326 | JGI25159J45721_10003264 | 161 |
| 913 | 3300002987 | JGI25159J45721_1001680 | JGI25159J45721_10016805 | 161 |
| 914 | 3300003187 | JGI25151J46595_10000034 | JGI25151J46595_1000003458 | 161 |
| 915 | 3300003187 | JGI25151J46595_10001853 | JGI25151J46595_100018536 | 161 |
| 916 | 3300003187 | JGI25151J46595_10002548 | JGI25151J46595_100025483 | 161 |
| 917 | 3300003187 | JGI25151J46595_10004959 | JGI25151J46595_100049592 | 161 |
| 918 | 3300003187 | JGI25151J46595_10006983 | JGI25151J46595_100069837 | 161 |
| 919 | 3300003187 | JGI25151J46595_10016793 | JGI25151J46595_100167933 | 161 |
| 920 | 3300003187 | JGI25151J46595_10024001 | JGI25151J46595_100240013 | 161 |
| 921 | 3300003203 | JGI25406J46586_10022009 | JGI25406J46586_100220094 | 161 |
| 922 | 3300003214 | JGI25165J46597_1000019 | JGI25165J46597_1000019220 | 161 |
| 923 | 3300003214 | JGI25165J46597_1000536 | JGI25165J46597_100053620 | 161 |
| 924 | 3300003214 | JGI25165J46597_1001677 | JGI25165J46597_10016775 | 161 |
| 925 | 3300003214 | JGI25165J46597_1003663 | JGI25165J46597_10036634 | 161 |
| 926 | 3300003215 | JGI25153J46596_10009433 | JGI25153J46596_100094333 | 161 |
| 927 | 3300003215 | JGI25153J46596_10013005 | JGI25153J46596_100130053 | 161 |
| 928 | 3300003215 | JGI25153J46596_10016521 | JGI25153J46596_100165212 | 161 |
| 929 | 3300003215 | JGI25153J46596_10093972 | JGI25153J46596_100939722 | 161 |
| 930 | 3300003320 | rootH2_10030154 | rootH2_100301542 | 161 |
| 931 | 3300003354 | JGI25160J50197_1000027 | JGI25160J50197_100002740 | 161 |
| 932 | 3300003354 | JGI25160J50197_1000051 | JGI25160J50197_1000051101 | 161 |
| 933 | 3300003354 | JGI25160J50197_1001076 | JGI25160J50197_100107610 | 161 |
| 934 | 3300003354 | JGI25160J50197_1002609 | JGI25160J50197_10026093 | 161 |
| 935 | 3300003354 | JGI25160J50197_1039569 | JGI25160J50197_10395691 | 161 |
| 936 | 3300003374 | JGI25161J50226_1000011 | JGI25161J50226_100001193 | 161 |
| 937 | 3300003374 | JGI25161J50226_1000038 | JGI25161J50226_100003840 | 161 |
| 938 | 3300003374 | JGI25161J50226_1000757 | JGI25161J50226_10007576 | 161 |
| 939 | 3300003578 | Ga0006562J51391_1012861 | Ga0006562J51391_10128614 | 161 |
| 940 | 3300003578 | Ga0006562J51391_1012870 | Ga0006562J51391_10128702 | 161 |
| 941 | 3300003693 | Ga0032354_1025696 | Ga0032354_10256962 | 161 |
| 942 | 3300003735 | Ga0006780_1021509 | Ga0006780_10215092 | 161 |
| 943 | 3300003762 | Ga0055542_1002133 | Ga0055542_10021337 | 161 |
| 944 | 3300003763 | Ga0055529_1001568 | Ga0055529_10015686 | 161 |
| 945 | 3300003771 | Ga0055526_1001048 | Ga0055526_10010483 | 161 |
| 946 | 3300003771 | Ga0055526_1008864 | Ga0055526_10088644 | 161 |
| 947 | 3300003771 | Ga0055526_1014842 | Ga0055526_10148424 | 161 |
| 948 | 3300003771 | Ga0055526_1025515 | Ga0055526_10255152 | 161 |
| 949 | 3300003771 | Ga0055526_1034323 | Ga0055526_10343233 | 161 |
| 950 | 3300003771 | Ga0055526_1053599 | Ga0055526_10535991 | 161 |
| 951 | 3300003775 | Ga0055524_1004059 | Ga0055524_10040592 | 161 |
| 952 | 3300003775 | Ga0055524_1006311 | Ga0055524_10063113 | 161 |
| 953 | 3300003775 | Ga0055524_1012498 | Ga0055524_10124982 | 161 |
| 954 | 3300003775 | Ga0055524_1025292 | Ga0055524_10252922 | 161 |
| 955 | 3300003775 | Ga0055524_1038558 | Ga0055524_10385583 | 161 |
| 956 | 3300003775 | Ga0055524_1048165 | Ga0055524_10481651 | 161 |
| 957 | 3300003781 | Ga0055536_1000540 | Ga0055536_100054022 | 161 |
| 958 | 3300003781 | Ga0055536_1007552 | Ga0055536_10075523 | 161 |
| 959 | 3300003790 | Ga0055528_1000884 | Ga0055528_100088417 | 161 |
| 960 | 3300003790 | Ga0055528_1000979 | Ga0055528_10009794 | 161 |
| 961 | 3300003790 | Ga0055528_1004196 | Ga0055528_10041965 | 161 |
| 962 | 3300003790 | Ga0055528_1009005 | Ga0055528_10090054 | 161 |
| 963 | 3300003790 | Ga0055528_1009863 | Ga0055528_10098631 | 161 |
| 964 | 3300003791 | Ga0055530_10006351 | Ga0055530_100063513 | 161 |
| 965 | 3300003792 | Ga0055540_1002302 | Ga0055540_10023025 | 161 |
| 966 | 3300003792 | Ga0055540_1003597 | Ga0055540_10035974 | 161 |
| 967 | 3300003792 | Ga0055540_1008610 | Ga0055540_10086103 | 161 |
| 968 | 3300003792 | Ga0055540_1023085 | Ga0055540_10230851 | 161 |
| 969 | 3300003792 | Ga0055540_1024202 | Ga0055540_10242023 | 161 |
| 970 | 3300003792 | Ga0055540_1025163 | Ga0055540_10251631 | 161 |
| 971 | 3300003794 | Ga0055531_10004904 | Ga0055531_100049042 | 161 |
| 972 | 3300003794 | Ga0055531_10007527 | Ga0055531_100075273 | 161 |
| 973 | 3300003856 | Ga0058692_1003317 | Ga0058692_10033173 | 161 |
| 974 | 3300003856 | Ga0058692_1007328 | Ga0058692_10073283 | 161 |
| 975 | 3300004625 | Ga0055543_1000030 | Ga0055543_100003048 | 161 |
| 976 | 3300004625 | Ga0055543_1000041 | Ga0055543_10000414 | 161 |
| 977 | 3300004625 | Ga0055543_1000317 | Ga0055543_100031720 | 161 |
| 978 | 3300004625 | Ga0055543_1000416 | Ga0055543_10004165 | 161 |
| 979 | 3300005262 | Ga0065165_1000133 | Ga0065165_100013326 | 161 |
| 980 | 3300005262 | Ga0065165_1000135 | Ga0065165_100013593 | 161 |
| 981 | 3300005262 | Ga0065165_1010834 | Ga0065165_10108343 | 161 |
| 982 | 3300005262 | Ga0065165_1010844 | Ga0065165_10108443 | 161 |
| 983 | 3300005289 | Ga0065704_10204987 | Ga0065704_102049872 | 161 |
| 984 | 3300005290 | Ga0065712_10581084 | Ga0065712_105810841 | 161 |
| 985 | 3300005327 | Ga0070658_10276980 | Ga0070658_102769802 | 161 |
| 986 | 3300005327 | Ga0070658_10391938 | Ga0070658_103919381 | 161 |
| 987 | 3300005331 | Ga0070670_100000061 | Ga0070670_10000006120 | 161 |
| 988 | 3300005337 | Ga0070682_100639962 | Ga0070682_1006399622 | 161 |
| 989 | 3300005339 | Ga0070660_100066880 | Ga0070660_1000668803 | 161 |
| 990 | 3300005339 | Ga0070660_100571327 | Ga0070660_1005713271 | 161 |
| 991 | 3300005339 | Ga0070660_100584776 | Ga0070660_1005847762 | 161 |
| 992 | 3300005339 | Ga0070660_101202324 | Ga0070660_1012023241 | 161 |
| 993 | 3300005340 | Ga0070689_100578240 | Ga0070689_1005782401 | 161 |
| 994 | 3300005347 | Ga0070668_100101702 | Ga0070668_1001017023 | 161 |
| 995 | 3300005347 | Ga0070668_100120935 | Ga0070668_1001209352 | 161 |
| 996 | 3300005347 | Ga0070668_100139712 | Ga0070668_1001397122 | 161 |
| 997 | 3300005353 | Ga0070669_100315714 | Ga0070669_1003157142 | 161 |
| 998 | 3300005355 | Ga0070671_100324784 | Ga0070671_1003247842 | 161 |
| 999 | 3300005364 | Ga0070673_101271477 | Ga0070673_1012714771 | 161 |
| 1000 | 3300005367 | Ga0070667_100295986 | Ga0070667_1002959862 | 161 |
| 1001 | 3300005455 | Ga0070663_100052882 | Ga0070663_1000528823 | 161 |
| 1002 | 3300005455 | Ga0070663_100171861 | Ga0070663_1001718613 | 161 |
| 1003 | 3300005455 | Ga0070663_100243900 | Ga0070663_1002439002 | 161 |
| 1004 | 3300005455 | Ga0070663_100847189 | Ga0070663_1008471892 | 161 |
| 1005 | 3300005456 | Ga0070678_100490727 | Ga0070678_1004907272 | 161 |
| 1006 | 3300005457 | Ga0070662_100100915 | Ga0070662_1001009152 | 161 |
| 1007 | 3300005457 | Ga0070662_100328016 | Ga0070662_1003280161 | 161 |
| 1008 | 3300005459 | Ga0068867_100352987 | Ga0068867_1003529873 | 161 |
| 1009 | 3300005471 | Ga0070698_101396742 | Ga0070698_1013967421 | 161 |
| 1010 | 3300005543 | Ga0070672_100405630 | Ga0070672_1004056302 | 161 |
| 1011 | 3300005548 | Ga0070665_100013727 | Ga0070665_1000137274 | 161 |
| 1012 | 3300005548 | Ga0070665_100060359 | Ga0070665_1000603593 | 161 |
| 1013 | 3300005548 | Ga0070665_100093261 | Ga0070665_1000932612 | 161 |
| 1014 | 3300005548 | Ga0070665_100103373 | Ga0070665_1001033733 | 161 |
| 1015 | 3300005548 | Ga0070665_100204393 | Ga0070665_1002043932 | 161 |
| 1016 | 3300005548 | Ga0070665_100361308 | Ga0070665_1003613082 | 161 |
| 1017 | 3300005548 | Ga0070665_101440430 | Ga0070665_1014404302 | 161 |
| 1018 | 3300005563 | Ga0068855_100166759 | Ga0068855_1001667593 | 161 |
| 1019 | 3300005563 | Ga0068855_101297718 | Ga0068855_1012977182 | 161 |
| 1020 | 3300005563 | Ga0068855_101448286 | Ga0068855_1014482862 | 161 |
| 1021 | 3300005564 | Ga0070664_100431911 | Ga0070664_1004319112 | 161 |
| 1022 | 3300005578 | Ga0068854_100728815 | Ga0068854_1007288151 | 161 |
| 1023 | 3300005578 | Ga0068854_100943801 | Ga0068854_1009438011 | 161 |
| 1024 | 3300005614 | Ga0068856_100357583 | Ga0068856_1003575832 | 161 |
| 1025 | 3300005614 | Ga0068856_100726070 | Ga0068856_1007260702 | 161 |
| 1026 | 3300005616 | Ga0068852_100257629 | Ga0068852_1002576292 | 161 |
| 1027 | 3300005616 | Ga0068852_100501561 | Ga0068852_1005015612 | 161 |
| 1028 | 3300005719 | Ga0068861_101180966 | Ga0068861_1011809662 | 161 |
| 1029 | 3300005834 | Ga0068851_10050731 | Ga0068851_100507313 | 161 |
| 1030 | 3300005840 | Ga0068870_10286210 | Ga0068870_102862102 | 161 |
| 1031 | 3300005843 | Ga0068860_101205441 | Ga0068860_1012054411 | 161 |
| 1032 | 3300005985 | Ga0081539_10000429 | Ga0081539_1000042935 | 161 |
| 1033 | 3300006038 | Ga0075365_10000592 | Ga0075365_100005926 | 161 |
| 1034 | 3300006038 | Ga0075365_10004401 | Ga0075365_100044011 | 161 |
| 1035 | 3300006038 | Ga0075365_10009173 | Ga0075365_100091735 | 161 |
| 1036 | 3300006038 | Ga0075365_10023469 | Ga0075365_100234692 | 161 |
| 1037 | 3300006038 | Ga0075365_10067109 | Ga0075365_100671093 | 161 |
| 1038 | 3300006038 | Ga0075365_10094630 | Ga0075365_100946303 | 161 |
| 1039 | 3300006038 | Ga0075365_10104481 | Ga0075365_101044813 | 161 |
| 1040 | 3300006038 | Ga0075365_10182820 | Ga0075365_101828202 | 161 |
| 1041 | 3300006038 | Ga0075365_10234287 | Ga0075365_102342872 | 161 |
| 1042 | 3300006038 | Ga0075365_10258815 | Ga0075365_102588152 | 161 |
| 1043 | 3300006038 | Ga0075365_10305262 | Ga0075365_103052622 | 161 |
| 1044 | 3300006042 | Ga0075368_10001899 | Ga0075368_100018998 | 161 |
| 1045 | 3300006042 | Ga0075368_10046504 | Ga0075368_100465041 | 161 |
| 1046 | 3300006042 | Ga0075368_10056159 | Ga0075368_100561592 | 161 |
| 1047 | 3300006042 | Ga0075368_10072478 | Ga0075368_100724783 | 161 |
| 1048 | 3300006042 | Ga0075368_10099038 | Ga0075368_100990382 | 161 |
| 1049 | 3300006042 | Ga0075368_10177137 | Ga0075368_101771371 | 161 |
| 1050 | 3300006048 | Ga0075363_100002706 | Ga0075363_1000027064 | 161 |
| 1051 | 3300006048 | Ga0075363_100003123 | Ga0075363_1000031237 | 161 |
| 1052 | 3300006048 | Ga0075363_100066180 | Ga0075363_1000661802 | 161 |
| 1053 | 3300006048 | Ga0075363_100210933 | Ga0075363_1002109332 | 161 |
| 1054 | 3300006048 | Ga0075363_100292789 | Ga0075363_1002927891 | 161 |
| 1055 | 3300006051 | Ga0075364_10000006 | Ga0075364_1000000641 | 161 |
| 1056 | 3300006051 | Ga0075364_10011027 | Ga0075364_100110272 | 161 |
| 1057 | 3300006051 | Ga0075364_10054564 | Ga0075364_100545642 | 161 |
| 1058 | 3300006051 | Ga0075364_10130820 | Ga0075364_101308201 | 161 |
| 1059 | 3300006051 | Ga0075364_10242848 | Ga0075364_102428482 | 161 |
| 1060 | 3300006051 | Ga0075364_10253286 | Ga0075364_102532862 | 161 |
| 1061 | 3300006051 | Ga0075364_10497301 | Ga0075364_104973012 | 161 |
| 1062 | 3300006051 | Ga0075364_10556888 | Ga0075364_105568881 | 161 |
| 1063 | 3300006177 | Ga0075362_10000510 | Ga0075362_100005105 | 161 |
| 1064 | 3300006177 | Ga0075362_10002423 | Ga0075362_100024233 | 161 |
| 1065 | 3300006177 | Ga0075362_10060693 | Ga0075362_100606931 | 161 |
| 1066 | 3300006177 | Ga0075362_10101501 | Ga0075362_101015012 | 161 |
| 1067 | 3300006177 | Ga0075362_10332784 | Ga0075362_103327842 | 161 |
| 1068 | 3300006177 | Ga0075362_10423637 | Ga0075362_104236371 | 161 |
| 1069 | 3300006178 | Ga0075367_10000418 | Ga0075367_1000041816 | 161 |
| 1070 | 3300006178 | Ga0075367_10003403 | Ga0075367_100034035 | 161 |
| 1071 | 3300006178 | Ga0075367_10020967 | Ga0075367_100209674 | 161 |
| 1072 | 3300006178 | Ga0075367_10030824 | Ga0075367_100308243 | 161 |
| 1073 | 3300006178 | Ga0075367_10097782 | Ga0075367_100977822 | 161 |
| 1074 | 3300006178 | Ga0075367_10139884 | Ga0075367_101398841 | 161 |
| 1075 | 3300006178 | Ga0075367_10147096 | Ga0075367_101470963 | 161 |
| 1076 | 3300006178 | Ga0075367_10312120 | Ga0075367_103121201 | 161 |
| 1077 | 3300006178 | Ga0075367_10322702 | Ga0075367_103227022 | 161 |
| 1078 | 3300006178 | Ga0075367_10330042 | Ga0075367_103300422 | 161 |
| 1079 | 3300006178 | Ga0075367_10360621 | Ga0075367_103606211 | 161 |
| 1080 | 3300006178 | Ga0075367_10400875 | Ga0075367_104008751 | 161 |
| 1081 | 3300006178 | Ga0075367_10658915 | Ga0075367_106589151 | 161 |
| 1082 | 3300006178 | Ga0075367_10674073 | Ga0075367_106740731 | 161 |
| 1083 | 3300006186 | Ga0075369_10006597 | Ga0075369_100065973 | 161 |
| 1084 | 3300006186 | Ga0075369_10016932 | Ga0075369_100169322 | 161 |
| 1085 | 3300006186 | Ga0075369_10036926 | Ga0075369_100369262 | 161 |
| 1086 | 3300006186 | Ga0075369_10084045 | Ga0075369_100840453 | 161 |
| 1087 | 3300006186 | Ga0075369_10409351 | Ga0075369_104093511 | 161 |
| 1088 | 3300006195 | Ga0075366_10001216 | Ga0075366_100012165 | 161 |
| 1089 | 3300006195 | Ga0075366_10123373 | Ga0075366_101233733 | 161 |
| 1090 | 3300006195 | Ga0075366_10192516 | Ga0075366_101925161 | 161 |
| 1091 | 3300006195 | Ga0075366_10233157 | Ga0075366_102331571 | 161 |
| 1092 | 3300006195 | Ga0075366_10506088 | Ga0075366_105060882 | 161 |
| 1093 | 3300006195 | Ga0075366_11022923 | Ga0075366_110229231 | 161 |
| 1094 | 3300006353 | Ga0075370_10001979 | Ga0075370_100019794 | 161 |
| 1095 | 3300006353 | Ga0075370_10007019 | Ga0075370_100070195 | 161 |
| 1096 | 3300006353 | Ga0075370_10043874 | Ga0075370_100438743 | 161 |
| 1097 | 3300006353 | Ga0075370_10051128 | Ga0075370_100511284 | 161 |
| 1098 | 3300006353 | Ga0075370_10057045 | Ga0075370_100570451 | 161 |
| 1099 | 3300006353 | Ga0075370_10092246 | Ga0075370_100922463 | 161 |
| 1100 | 3300006353 | Ga0075370_10106112 | Ga0075370_101061122 | 161 |
| 1101 | 3300006353 | Ga0075370_10153797 | Ga0075370_101537973 | 161 |
| 1102 | 3300006353 | Ga0075370_10157872 | Ga0075370_101578722 | 161 |
| 1103 | 3300006353 | Ga0075370_10175669 | Ga0075370_101756692 | 161 |
| 1104 | 3300006353 | Ga0075370_10279551 | Ga0075370_102795512 | 161 |
| 1105 | 3300006946 | Ga0079104_1000207 | Ga0079104_100020756 | 161 |
| 1106 | 3300006946 | Ga0079104_1004038 | Ga0079104_10040383 | 161 |
| 1107 | 3300006946 | Ga0079104_1008945 | Ga0079104_10089453 | 161 |
| 1108 | 3300006948 | Ga0099826_10000468 | Ga0099826_1000046810 | 161 |
| 1109 | 3300009011 | Ga0105251_10025303 | Ga0105251_100253033 | 161 |
| 1110 | 3300009036 | Ga0105244_10053649 | Ga0105244_100536493 | 161 |
| 1111 | 3300009036 | Ga0105244_10070912 | Ga0105244_100709121 | 161 |
| 1112 | 3300009036 | Ga0105244_10299656 | Ga0105244_102996562 | 161 |
| 1113 | 3300009092 | Ga0105250_10043784 | Ga0105250_100437842 | 161 |
| 1114 | 3300009092 | Ga0105250_10100239 | Ga0105250_101002392 | 161 |
| 1115 | 3300009093 | Ga0105240_10000142 | Ga0105240_1000014235 | 161 |
| 1116 | 3300009093 | Ga0105240_10256742 | Ga0105240_102567421 | 161 |
| 1117 | 3300009093 | Ga0105240_10381420 | Ga0105240_103814201 | 161 |
| 1118 | 3300009093 | Ga0105240_10707692 | Ga0105240_107076921 | 161 |
| 1119 | 3300009093 | Ga0105240_11893129 | Ga0105240_118931291 | 161 |
| 1120 | 3300009098 | Ga0105245_10775113 | Ga0105245_107751132 | 161 |
| 1121 | 3300009101 | Ga0105247_10252899 | Ga0105247_102528992 | 161 |
| 1122 | 3300009148 | Ga0105243_10031735 | Ga0105243_100317352 | 161 |
| 1123 | 3300009148 | Ga0105243_10060917 | Ga0105243_100609173 | 161 |
| 1124 | 3300009148 | Ga0105243_10685295 | Ga0105243_106852952 | 161 |
| 1125 | 3300009148 | Ga0105243_10890296 | Ga0105243_108902962 | 161 |
| 1126 | 3300009148 | Ga0105243_11537287 | Ga0105243_115372872 | 161 |
| 1127 | 3300009148 | Ga0105243_11624785 | Ga0105243_116247851 | 161 |
| 1128 | 3300009174 | Ga0105241_10379515 | Ga0105241_103795152 | 161 |
| 1129 | 3300009177 | Ga0105248_10085321 | Ga0105248_100853213 | 161 |
| 1130 | 3300009177 | Ga0105248_10345475 | Ga0105248_103454753 | 161 |
| 1131 | 3300009545 | Ga0105237_10013922 | Ga0105237_1001392210 | 161 |
| 1132 | 3300009545 | Ga0105237_10211542 | Ga0105237_102115423 | 161 |
| 1133 | 3300009545 | Ga0105237_11085200 | Ga0105237_110852002 | 161 |
| 1134 | 3300009545 | Ga0105237_11517174 | Ga0105237_115171741 | 161 |
| 1135 | 3300009551 | Ga0105238_10002270 | Ga0105238_100022702 | 161 |
| 1136 | 3300009551 | Ga0105238_10545309 | Ga0105238_105453091 | 161 |
| 1137 | 3300009551 | Ga0105238_10662712 | Ga0105238_106627123 | 161 |
| 1138 | 3300009551 | Ga0105238_11765302 | Ga0105238_117653021 | 161 |
| 1139 | 3300009553 | Ga0105249_10195740 | Ga0105249_101957402 | 161 |
| 1140 | 3300009553 | Ga0105249_10215405 | Ga0105249_102154053 | 161 |
| 1141 | 3300009553 | Ga0105249_10562989 | Ga0105249_105629892 | 161 |
| 1142 | 3300009765 | Ga0123341_1000260 | Ga0123341_100026012 | 161 |
| 1143 | 3300009766 | Ga0123342_1011038 | Ga0123342_10110383 | 161 |
| 1144 | 3300009766 | Ga0123342_1023166 | Ga0123342_10231663 | 161 |
| 1145 | 3300010375 | Ga0105239_10001079 | Ga0105239_1000107932 | 161 |
| 1146 | 3300010375 | Ga0105239_10136688 | Ga0105239_101366883 | 161 |
| 1147 | 3300010375 | Ga0105239_10209803 | Ga0105239_102098032 | 161 |
| 1148 | 3300010375 | Ga0105239_10341653 | Ga0105239_103416532 | 161 |
| 1149 | 3300010375 | Ga0105239_10543586 | Ga0105239_105435861 | 161 |
| 1150 | 3300010375 | Ga0105239_10580700 | Ga0105239_105807002 | 161 |
| 1151 | 3300010375 | Ga0105239_11522269 | Ga0105239_115222692 | 161 |
| 1152 | 3300011119 | Ga0105246_10010820 | Ga0105246_100108204 | 161 |
| 1153 | 3300011119 | Ga0105246_10564924 | Ga0105246_105649241 | 161 |
| 1154 | 3300013100 | Ga0157373_10031709 | Ga0157373_100317094 | 161 |
| 1155 | 3300013100 | Ga0157373_10143527 | Ga0157373_101435272 | 161 |
| 1156 | 3300013102 | Ga0157371_10000071 | Ga0157371_1000007135 | 161 |
| 1157 | 3300013102 | Ga0157371_10283406 | Ga0157371_102834062 | 161 |
| 1158 | 3300013104 | Ga0157370_10000469 | Ga0157370_1000046929 | 161 |
| 1159 | 3300013104 | Ga0157370_10007351 | Ga0157370_100073512 | 161 |
| 1160 | 3300013104 | Ga0157370_10073494 | Ga0157370_100734943 | 161 |
| 1161 | 3300013104 | Ga0157370_10194986 | Ga0157370_101949862 | 161 |
| 1162 | 3300013104 | Ga0157370_11330431 | Ga0157370_113304311 | 161 |
| 1163 | 3300013105 | Ga0157369_10043197 | Ga0157369_100431971 | 161 |
| 1164 | 3300013105 | Ga0157369_10141547 | Ga0157369_101415472 | 161 |
| 1165 | 3300013105 | Ga0157369_10199524 | Ga0157369_101995243 | 161 |
| 1166 | 3300013105 | Ga0157369_10446502 | Ga0157369_104465023 | 161 |
| 1167 | 3300013105 | Ga0157369_10456722 | Ga0157369_104567221 | 161 |
| 1168 | 3300013249 | Ga0171463_1004 | Ga0171463_1004151 | 161 |
| 1169 | 3300013297 | Ga0157378_10224811 | Ga0157378_102248112 | 161 |
| 1170 | 3300013306 | Ga0163162_10136131 | Ga0163162_101361312 | 161 |
| 1171 | 3300013306 | Ga0163162_10281441 | Ga0163162_102814413 | 161 |
| 1172 | 3300013306 | Ga0163162_10589112 | Ga0163162_105891121 | 161 |
| 1173 | 3300013307 | Ga0157372_10257782 | Ga0157372_102577823 | 161 |
| 1174 | 3300013307 | Ga0157372_10416562 | Ga0157372_104165622 | 161 |
| 1175 | 3300013307 | Ga0157372_10858728 | Ga0157372_108587282 | 161 |
| 1176 | 3300013307 | Ga0157372_11409050 | Ga0157372_114090501 | 161 |
| 1177 | 3300013308 | Ga0157375_10398831 | Ga0157375_103988313 | 161 |
| 1178 | 3300014325 | Ga0163163_10285014 | Ga0163163_102850143 | 161 |
| 1179 | 3300014497 | Ga0182008_10038526 | Ga0182008_100385263 | 161 |
| 1180 | 3300014497 | Ga0182008_10045308 | Ga0182008_100453083 | 161 |
| 1181 | 3300015261 | Ga0182006_1044474 | Ga0182006_10444742 | 161 |
| 1182 | 3300015262 | Ga0182007_10002964 | Ga0182007_100029645 | 161 |
| 1183 | 3300015265 | Ga0182005_1023373 | Ga0182005_10233732 | 161 |
| 1184 | 3300015690 | Ga0183363_1306 | Ga0183363_13064 | 161 |
| 1185 | 3300017792 | Ga0163161_10170499 | Ga0163161_101704993 | 161 |
| 1186 | 3300017792 | Ga0163161_10269258 | Ga0163161_102692583 | 161 |
| 1187 | 3300017792 | Ga0163161_10523387 | Ga0163161_105233871 | 161 |
| 1188 | 3300021320 | Ga0214544_1000018 | Ga0214544_1000018157 | 161 |
| 1189 | 3300021321 | Ga0214542_1001855 | Ga0214542_10018552 | 161 |
| 1190 | 3300021321 | Ga0214542_1016122 | Ga0214542_10161228 | 161 |
| 1191 | 3300021321 | Ga0214542_1017131 | Ga0214542_10171312 | 161 |
| 1192 | 3300021324 | Ga0214545_1057813 | Ga0214545_10578131 | 161 |
| 1193 | 3300021327 | Ga0214543_1000005 | Ga0214543_1000005100 | 161 |
| 1194 | 3300021327 | Ga0214543_1000015 | Ga0214543_100001531 | 161 |
| 1195 | 3300021327 | Ga0214543_1000016 | Ga0214543_1000016120 | 161 |
| 1196 | 3300021327 | Ga0214543_1000195 | Ga0214543_10001952 | 161 |
| 1197 | 3300022739 | Ga0228711_1000004 | Ga0228711_100000447 | 161 |
| 1198 | 3300022740 | Ga0228710_1000264 | Ga0228710_10002646 | 161 |
| 1199 | 3300025206 | Ga0209435_100031 | Ga0209435_10003143 | 161 |
| 1200 | 3300025208 | Ga0209436_100013 | Ga0209436_10001314 | 161 |
| 1201 | 3300025208 | Ga0209436_104935 | Ga0209436_1049352 | 161 |
| 1202 | 3300025208 | Ga0209436_109069 | Ga0209436_1090693 | 161 |
| 1203 | 3300025228 | Ga0209672_103130 | Ga0209672_1031303 | 161 |
| 1204 | 3300025233 | Ga0209437_100179 | Ga0209437_100179106 | 161 |
| 1205 | 3300025233 | Ga0209437_100181 | Ga0209437_100181105 | 161 |
| 1206 | 3300025233 | Ga0209437_101277 | Ga0209437_1012774 | 161 |
| 1207 | 3300025245 | Ga0207425_1000035 | Ga0207425_100003581 | 161 |
| 1208 | 3300025245 | Ga0207425_1009611 | Ga0207425_10096112 | 161 |
| 1209 | 3300025245 | Ga0207425_1010263 | Ga0207425_10102632 | 161 |
| 1210 | 3300025245 | Ga0207425_1027973 | Ga0207425_10279731 | 161 |
| 1211 | 3300025246 | Ga0209646_1000102 | Ga0209646_100010243 | 161 |
| 1212 | 3300025246 | Ga0209646_1006752 | Ga0209646_10067522 | 161 |
| 1213 | 3300025246 | Ga0209646_1011821 | Ga0209646_10118212 | 161 |
| 1214 | 3300025250 | Ga0209026_1000013 | Ga0209026_1000013175 | 161 |
| 1215 | 3300025250 | Ga0209026_1000096 | Ga0209026_100009643 | 161 |
| 1216 | 3300025253 | Ga0209677_100455 | Ga0209677_10045522 | 161 |
| 1217 | 3300025254 | Ga0209148_1000032 | Ga0209148_100003239 | 161 |
| 1218 | 3300025256 | Ga0209759_1000058 | Ga0209759_1000058141 | 161 |
| 1219 | 3300025256 | Ga0209759_1000090 | Ga0209759_100009043 | 161 |
| 1220 | 3300025258 | Ga0209129_1000029 | Ga0209129_100002981 | 161 |
| 1221 | 3300025258 | Ga0209129_1000050 | Ga0209129_1000050108 | 161 |
| 1222 | 3300025258 | Ga0209129_1000377 | Ga0209129_100037721 | 161 |
| 1223 | 3300025258 | Ga0209129_1002478 | Ga0209129_10024784 | 161 |
| 1224 | 3300025258 | Ga0209129_1003900 | Ga0209129_10039003 | 161 |
| 1225 | 3300025258 | Ga0209129_1005885 | Ga0209129_10058852 | 161 |
| 1226 | 3300025261 | Ga0209233_1000034 | Ga0209233_1000034404 | 161 |
| 1227 | 3300025261 | Ga0209233_1000185 | Ga0209233_1000185105 | 161 |
| 1228 | 3300025261 | Ga0209233_1000212 | Ga0209233_100021219 | 161 |
| 1229 | 3300025261 | Ga0209233_1000445 | Ga0209233_100044516 | 161 |
| 1230 | 3300025261 | Ga0209233_1005424 | Ga0209233_10054243 | 161 |
| 1231 | 3300025272 | Ga0209455_1000098 | Ga0209455_1000098130 | 161 |
| 1232 | 3300025272 | Ga0209455_1007268 | Ga0209455_10072683 | 161 |
| 1233 | 3300025273 | Ga0209673_1000033 | Ga0209673_1000033108 | 161 |
| 1234 | 3300025273 | Ga0209673_1000050 | Ga0209673_1000050154 | 161 |
| 1235 | 3300025273 | Ga0209673_1000476 | Ga0209673_100047635 | 161 |
| 1236 | 3300025273 | Ga0209673_1001553 | Ga0209673_10015532 | 161 |
| 1237 | 3300025273 | Ga0209673_1001715 | Ga0209673_10017158 | 161 |
| 1238 | 3300025273 | Ga0209673_1003312 | Ga0209673_10033124 | 161 |
| 1239 | 3300025273 | Ga0209673_1009152 | Ga0209673_10091522 | 161 |
| 1240 | 3300025273 | Ga0209673_1010740 | Ga0209673_10107403 | 161 |
| 1241 | 3300025273 | Ga0209673_1029461 | Ga0209673_10294612 | 161 |
| 1242 | 3300025284 | Ga0209130_1000009 | Ga0209130_1000009109 | 161 |
| 1243 | 3300025284 | Ga0209130_1000027 | Ga0209130_1000027174 | 161 |
| 1244 | 3300025284 | Ga0209130_1000058 | Ga0209130_1000058102 | 161 |
| 1245 | 3300025284 | Ga0209130_1007773 | Ga0209130_10077733 | 161 |
| 1246 | 3300025284 | Ga0209130_1008855 | Ga0209130_10088553 | 161 |
| 1247 | 3300025284 | Ga0209130_1033594 | Ga0209130_10335942 | 161 |
| 1248 | 3300025291 | Ga0209675_1014761 | Ga0209675_10147612 | 161 |
| 1249 | 3300025292 | Ga0209676_1000406 | Ga0209676_100040665 | 161 |
| 1250 | 3300025292 | Ga0209676_1003843 | Ga0209676_10038433 | 161 |
| 1251 | 3300025292 | Ga0209676_1010085 | Ga0209676_10100851 | 161 |
| 1252 | 3300025292 | Ga0209676_1045954 | Ga0209676_10459542 | 161 |
| 1253 | 3300025294 | Ga0209025_1000042 | Ga0209025_1000042124 | 161 |
| 1254 | 3300025294 | Ga0209025_1000132 | Ga0209025_1000132125 | 161 |
| 1255 | 3300025294 | Ga0209025_1000241 | Ga0209025_100024163 | 161 |
| 1256 | 3300025294 | Ga0209025_1000453 | Ga0209025_100045347 | 161 |
| 1257 | 3300025294 | Ga0209025_1001274 | Ga0209025_100127410 | 161 |
| 1258 | 3300025294 | Ga0209025_1002759 | Ga0209025_100275919 | 161 |
| 1259 | 3300025294 | Ga0209025_1008059 | Ga0209025_10080596 | 161 |
| 1260 | 3300025294 | Ga0209025_1022149 | Ga0209025_10221493 | 161 |
| 1261 | 3300025294 | Ga0209025_1048453 | Ga0209025_10484532 | 161 |
| 1262 | 3300025294 | Ga0209025_1076352 | Ga0209025_10763522 | 161 |
| 1263 | 3300025294 | Ga0209025_1148251 | Ga0209025_11482511 | 161 |
| 1264 | 3300025295 | Ga0209564_1000111 | Ga0209564_1000111155 | 161 |
| 1265 | 3300025295 | Ga0209564_1000227 | Ga0209564_100022720 | 161 |
| 1266 | 3300025295 | Ga0209564_1000284 | Ga0209564_100028449 | 161 |
| 1267 | 3300025295 | Ga0209564_1002155 | Ga0209564_10021552 | 161 |
| 1268 | 3300025295 | Ga0209564_1009667 | Ga0209564_10096674 | 161 |
| 1269 | 3300025295 | Ga0209564_1017086 | Ga0209564_10170862 | 161 |
| 1270 | 3300025297 | Ga0209758_1000255 | Ga0209758_100025522 | 161 |
| 1271 | 3300025297 | Ga0209758_1000406 | Ga0209758_10004068 | 161 |
| 1272 | 3300025297 | Ga0209758_1000563 | Ga0209758_100056335 | 161 |
| 1273 | 3300025297 | Ga0209758_1001039 | Ga0209758_100103921 | 161 |
| 1274 | 3300025297 | Ga0209758_1001297 | Ga0209758_100129720 | 161 |
| 1275 | 3300025297 | Ga0209758_1003074 | Ga0209758_100307410 | 161 |
| 1276 | 3300025297 | Ga0209758_1017669 | Ga0209758_10176693 | 161 |
| 1277 | 3300025297 | Ga0209758_1021428 | Ga0209758_10214283 | 161 |
| 1278 | 3300025297 | Ga0209758_1021657 | Ga0209758_10216573 | 161 |
| 1279 | 3300025297 | Ga0209758_1021673 | Ga0209758_10216731 | 161 |
| 1280 | 3300025297 | Ga0209758_1035760 | Ga0209758_10357602 | 161 |
| 1281 | 3300025297 | Ga0209758_1058408 | Ga0209758_10584082 | 161 |
| 1282 | 3300025298 | Ga0209050_1004183 | Ga0209050_10041833 | 161 |
| 1283 | 3300025298 | Ga0209050_1009264 | Ga0209050_10092644 | 161 |
| 1284 | 3300025299 | Ga0209256_1000361 | Ga0209256_100036177 | 161 |
| 1285 | 3300025299 | Ga0209256_1001149 | Ga0209256_100114913 | 161 |
| 1286 | 3300025299 | Ga0209256_1001517 | Ga0209256_100151713 | 161 |
| 1287 | 3300025299 | Ga0209256_1002615 | Ga0209256_100261515 | 161 |
| 1288 | 3300025299 | Ga0209256_1003137 | Ga0209256_10031373 | 161 |
| 1289 | 3300025299 | Ga0209256_1003810 | Ga0209256_100381011 | 161 |
| 1290 | 3300025299 | Ga0209256_1010847 | Ga0209256_10108472 | 161 |
| 1291 | 3300025299 | Ga0209256_1055479 | Ga0209256_10554792 | 161 |
| 1292 | 3300025299 | Ga0209256_1081405 | Ga0209256_10814051 | 161 |
| 1293 | 3300025302 | Ga0207426_1000041 | Ga0207426_100004147 | 161 |
| 1294 | 3300025302 | Ga0207426_1000072 | Ga0207426_1000072141 | 161 |
| 1295 | 3300025302 | Ga0207426_1000131 | Ga0207426_1000131102 | 161 |
| 1296 | 3300025302 | Ga0207426_1000214 | Ga0207426_1000214110 | 161 |
| 1297 | 3300025302 | Ga0207426_1002342 | Ga0207426_10023423 | 161 |
| 1298 | 3300025303 | Ga0209051_1000118 | Ga0209051_100011860 | 161 |
| 1299 | 3300025303 | Ga0209051_1001684 | Ga0209051_100168418 | 161 |
| 1300 | 3300025303 | Ga0209051_1002434 | Ga0209051_10024343 | 161 |
| 1301 | 3300025303 | Ga0209051_1006052 | Ga0209051_10060523 | 161 |
| 1302 | 3300025303 | Ga0209051_1075092 | Ga0209051_10750922 | 161 |
| 1303 | 3300025304 | Ga0209257_1001639 | Ga0209257_100163911 | 161 |
| 1304 | 3300025304 | Ga0209257_1001825 | Ga0209257_100182513 | 161 |
| 1305 | 3300025304 | Ga0209257_1003745 | Ga0209257_10037453 | 161 |
| 1306 | 3300025304 | Ga0209257_1032140 | Ga0209257_10321401 | 161 |
| 1307 | 3300025304 | Ga0209257_1039424 | Ga0209257_10394241 | 161 |
| 1308 | 3300025304 | Ga0209257_1094812 | Ga0209257_10948121 | 161 |
| 1309 | 3300025321 | Ga0207656_10194928 | Ga0207656_101949282 | 161 |
| 1310 | 3300025903 | Ga0207680_10795888 | Ga0207680_107958881 | 161 |
| 1311 | 3300025904 | Ga0207647_10007088 | Ga0207647_100070884 | 161 |
| 1312 | 3300025907 | Ga0207645_10089984 | Ga0207645_100899842 | 161 |
| 1313 | 3300025908 | Ga0207643_10358138 | Ga0207643_103581381 | 161 |
| 1314 | 3300025911 | Ga0207654_10029870 | Ga0207654_100298704 | 161 |
| 1315 | 3300025911 | Ga0207654_10080358 | Ga0207654_100803582 | 161 |
| 1316 | 3300025913 | Ga0207695_10000234 | Ga0207695_1000023435 | 161 |
| 1317 | 3300025913 | Ga0207695_10071983 | Ga0207695_100719833 | 161 |
| 1318 | 3300025913 | Ga0207695_10331756 | Ga0207695_103317563 | 161 |
| 1319 | 3300025913 | Ga0207695_10847244 | Ga0207695_108472442 | 161 |
| 1320 | 3300025913 | Ga0207695_11503466 | Ga0207695_115034661 | 161 |
| 1321 | 3300025914 | Ga0207671_10000043 | Ga0207671_1000004334 | 161 |
| 1322 | 3300025914 | Ga0207671_10023356 | Ga0207671_100233564 | 161 |
| 1323 | 3300025914 | Ga0207671_10671813 | Ga0207671_106718132 | 161 |
| 1324 | 3300025919 | Ga0207657_10057261 | Ga0207657_100572613 | 161 |
| 1325 | 3300025919 | Ga0207657_10452758 | Ga0207657_104527582 | 161 |
| 1326 | 3300025923 | Ga0207681_10175757 | Ga0207681_101757573 | 161 |
| 1327 | 3300025923 | Ga0207681_10256917 | Ga0207681_102569172 | 161 |
| 1328 | 3300025924 | Ga0207694_10353883 | Ga0207694_103538833 | 161 |
| 1329 | 3300025925 | Ga0207650_10000207 | Ga0207650_1000020747 | 161 |
| 1330 | 3300025927 | Ga0207687_10623780 | Ga0207687_106237802 | 161 |
| 1331 | 3300025927 | Ga0207687_10745828 | Ga0207687_107458281 | 161 |
| 1332 | 3300025933 | Ga0207706_10176921 | Ga0207706_101769212 | 161 |
| 1333 | 3300025934 | Ga0207686_10695319 | Ga0207686_106953192 | 161 |
| 1334 | 3300025935 | Ga0207709_10145508 | Ga0207709_101455083 | 161 |
| 1335 | 3300025935 | Ga0207709_10224098 | Ga0207709_102240982 | 161 |
| 1336 | 3300025938 | Ga0207704_10513584 | Ga0207704_105135842 | 161 |
| 1337 | 3300025940 | Ga0207691_10972252 | Ga0207691_109722522 | 161 |
| 1338 | 3300025941 | Ga0207711_10479700 | Ga0207711_104797002 | 161 |
| 1339 | 3300025942 | Ga0207689_10418819 | Ga0207689_104188193 | 161 |
| 1340 | 3300025945 | Ga0207679_10591490 | Ga0207679_105914902 | 161 |
| 1341 | 3300025949 | Ga0207667_10159711 | Ga0207667_101597113 | 161 |
| 1342 | 3300025949 | Ga0207667_10499075 | Ga0207667_104990752 | 161 |
| 1343 | 3300025949 | Ga0207667_10545953 | Ga0207667_105459531 | 161 |
| 1344 | 3300025961 | Ga0207712_10427121 | Ga0207712_104271212 | 161 |
| 1345 | 3300025972 | Ga0207668_10013360 | Ga0207668_100133604 | 161 |
| 1346 | 3300025972 | Ga0207668_10091320 | Ga0207668_100913203 | 161 |
| 1347 | 3300025972 | Ga0207668_10147887 | Ga0207668_101478873 | 161 |
| 1348 | 3300025972 | Ga0207668_10250865 | Ga0207668_102508652 | 161 |
| 1349 | 3300025972 | Ga0207668_10681340 | Ga0207668_106813402 | 161 |
| 1350 | 3300025981 | Ga0207640_10283277 | Ga0207640_102832772 | 161 |
| 1351 | 3300025981 | Ga0207640_10444323 | Ga0207640_104443232 | 161 |
| 1352 | 3300025981 | Ga0207640_11023872 | Ga0207640_110238721 | 161 |
| 1353 | 3300026041 | Ga0207639_10004025 | Ga0207639_100040254 | 161 |
| 1354 | 3300026041 | Ga0207639_10362850 | Ga0207639_103628502 | 161 |
| 1355 | 3300026041 | Ga0207639_10557684 | Ga0207639_105576843 | 161 |
| 1356 | 3300026067 | Ga0207678_10023129 | Ga0207678_100231296 | 161 |
| 1357 | 3300026067 | Ga0207678_10187876 | Ga0207678_101878764 | 161 |
| 1358 | 3300026067 | Ga0207678_10193094 | Ga0207678_101930942 | 161 |
| 1359 | 3300026067 | Ga0207678_10265126 | Ga0207678_102651263 | 161 |
| 1360 | 3300026067 | Ga0207678_10434387 | Ga0207678_104343873 | 161 |
| 1361 | 3300026078 | Ga0207702_10045234 | Ga0207702_100452344 | 161 |
| 1362 | 3300026078 | Ga0207702_10102227 | Ga0207702_101022271 | 161 |
| 1363 | 3300026078 | Ga0207702_10245482 | Ga0207702_102454822 | 161 |
| 1364 | 3300026089 | Ga0207648_10399153 | Ga0207648_103991532 | 161 |
| 1365 | 3300026116 | Ga0207674_10477297 | Ga0207674_104772973 | 161 |
| 1366 | 3300026116 | Ga0207674_11517631 | Ga0207674_115176311 | 161 |
| 1367 | 3300026118 | Ga0207675_101350440 | Ga0207675_1013504402 | 161 |
| 1368 | 3300026121 | Ga0207683_10255124 | Ga0207683_102551242 | 161 |
| 1369 | 3300027111 | Ga0209281_1000028 | Ga0209281_1000028298 | 161 |
| 1370 | 3300027111 | Ga0209281_1000030 | Ga0209281_1000030265 | 161 |
| 1371 | 3300027111 | Ga0209281_1000857 | Ga0209281_100085714 | 161 |
| 1372 | 3300027312 | Ga0209371_1000037 | Ga0209371_1000037212 | 161 |
| 1373 | 3300027312 | Ga0209371_1001614 | Ga0209371_100161410 | 161 |
| 1374 | 3300027312 | Ga0209371_1021804 | Ga0209371_10218043 | 161 |
| 1375 | 3300027665 | Ga0209983_1023367 | Ga0209983_10233673 | 161 |
| 1376 | 3300027666 | Ga0209282_1000004 | Ga0209282_1000004265 | 161 |
| 1377 | 3300027666 | Ga0209282_1010364 | Ga0209282_10103646 | 161 |
| 1378 | 3300027866 | Ga0209813_10014181 | Ga0209813_100141813 | 161 |
| 1379 | 3300027866 | Ga0209813_10025670 | Ga0209813_100256702 | 161 |
| 1380 | 3300027866 | Ga0209813_10037922 | Ga0209813_100379223 | 161 |
| 1381 | 3300027866 | Ga0209813_10286423 | Ga0209813_102864231 | 161 |
| 1382 | 3300028379 | Ga0268266_10009893 | Ga0268266_100098932 | 161 |
| 1383 | 3300028379 | Ga0268266_10027268 | Ga0268266_100272683 | 161 |
| 1384 | 3300028379 | Ga0268266_10036851 | Ga0268266_100368514 | 161 |
| 1385 | 3300028379 | Ga0268266_10056837 | Ga0268266_100568372 | 161 |
| 1386 | 3300028379 | Ga0268266_10112977 | Ga0268266_101129773 | 161 |
| 1387 | 3300028379 | Ga0268266_10289288 | Ga0268266_102892883 | 161 |
| 1388 | 3300028379 | Ga0268266_10827908 | Ga0268266_108279082 | 161 |
| 1389 | 3300028794 | Ga0307515_10000136 | Ga0307515_10000136163 | 161 |
| 1390 | 3300028794 | Ga0307515_10001840 | Ga0307515_1000184040 | 161 |
| 1391 | 3300028794 | Ga0307515_10003402 | Ga0307515_1000340215 | 161 |
| 1392 | 3300028794 | Ga0307515_10050525 | Ga0307515_100505251 | 161 |
| 1393 | 3300028794 | Ga0307515_10186903 | Ga0307515_101869033 | 161 |
| 1394 | 3300028794 | Ga0307515_10342304 | Ga0307515_103423043 | 161 |
| 1395 | 3300028794 | Ga0307515_10496673 | Ga0307515_104966731 | 161 |
| 1396 | 3300030500 | Ga0268256_1000039 | Ga0268256_100003996 | 161 |
| 1397 | 3300030500 | Ga0268256_1032238 | Ga0268256_10322382 | 161 |
| 1398 | 3300030500 | Ga0268256_1042016 | Ga0268256_10420162 | 161 |
| 1399 | 3300030744 | Ga0316181_1054311 | Ga0316181_10543111 | 161 |
| 1400 | 3300031456 | Ga0307513_10010967 | Ga0307513_100109672 | 161 |
| 1401 | 3300031456 | Ga0307513_10377852 | Ga0307513_103778522 | 161 |
| 1402 | 3300031548 | Ga0307408_100012911 | Ga0307408_1000129113 | 161 |
| 1403 | 3300031548 | Ga0307408_100230484 | Ga0307408_1002304842 | 161 |
| 1404 | 3300031548 | Ga0307408_100469156 | Ga0307408_1004691562 | 161 |
| 1405 | 3300031691 | Ga0316579_10374278 | Ga0316579_103742781 | 161 |
| 1406 | 3300031730 | Ga0307516_10060302 | Ga0307516_100603022 | 161 |
| 1407 | 3300031731 | Ga0307405_10000203 | Ga0307405_1000020320 | 161 |
| 1408 | 3300031731 | Ga0307405_10053789 | Ga0307405_100537893 | 161 |
| 1409 | 3300031731 | Ga0307405_10492615 | Ga0307405_104926151 | 161 |
| 1410 | 3300031731 | Ga0307405_10612896 | Ga0307405_106128962 | 161 |
| 1411 | 3300031731 | Ga0307405_10723009 | Ga0307405_107230091 | 161 |
| 1412 | 3300031824 | Ga0307413_10307820 | Ga0307413_103078203 | 161 |
| 1413 | 3300031824 | Ga0307413_10552463 | Ga0307413_105524632 | 161 |
| 1414 | 3300031852 | Ga0307410_10211898 | Ga0307410_102118981 | 161 |
| 1415 | 3300031852 | Ga0307410_10634021 | Ga0307410_106340212 | 161 |
| 1416 | 3300031901 | Ga0307406_10019753 | Ga0307406_100197533 | 161 |
| 1417 | 3300031901 | Ga0307406_10691522 | Ga0307406_106915221 | 161 |
| 1418 | 3300031901 | Ga0307406_10967503 | Ga0307406_109675031 | 161 |
| 1419 | 3300031903 | Ga0307407_10299958 | Ga0307407_102999583 | 161 |
| 1420 | 3300031903 | Ga0307407_11088364 | Ga0307407_110883642 | 161 |
| 1421 | 3300031911 | Ga0307412_10000671 | Ga0307412_100006719 | 161 |
| 1422 | 3300031911 | Ga0307412_10050105 | Ga0307412_100501052 | 161 |
| 1423 | 3300031911 | Ga0307412_10224860 | Ga0307412_102248602 | 161 |
| 1424 | 3300031911 | Ga0307412_10496624 | Ga0307412_104966242 | 161 |
| 1425 | 3300031911 | Ga0307412_10866104 | Ga0307412_108661041 | 161 |
| 1426 | 3300031967 | Ga0315914_1000001 | Ga0315914_1000001119 | 161 |
| 1427 | 3300031995 | Ga0307409_100122337 | Ga0307409_1001223371 | 161 |
| 1428 | 3300031995 | Ga0307409_100234209 | Ga0307409_1002342093 | 161 |
| 1429 | 3300031995 | Ga0307409_100811955 | Ga0307409_1008119552 | 161 |
| 1430 | 3300031995 | Ga0307409_101057072 | Ga0307409_1010570722 | 161 |
| 1431 | 3300031995 | Ga0307409_102230496 | Ga0307409_1022304961 | 161 |
| 1432 | 3300032002 | Ga0307416_100210294 | Ga0307416_1002102943 | 161 |
| 1433 | 3300032002 | Ga0307416_100314458 | Ga0307416_1003144583 | 161 |
| 1434 | 3300032002 | Ga0307416_100702315 | Ga0307416_1007023151 | 161 |
| 1435 | 3300032002 | Ga0307416_101145900 | Ga0307416_1011459002 | 161 |
| 1436 | 3300032002 | Ga0307416_101435017 | Ga0307416_1014350172 | 161 |
| 1437 | 3300032004 | Ga0307414_10054702 | Ga0307414_100547021 | 161 |
| 1438 | 3300032004 | Ga0307414_10294614 | Ga0307414_102946143 | 161 |
| 1439 | 3300032004 | Ga0307414_10364487 | Ga0307414_103644873 | 161 |
| 1440 | 3300032004 | Ga0307414_10452460 | Ga0307414_104524601 | 161 |
| 1441 | 3300032004 | Ga0307414_10822952 | Ga0307414_108229522 | 161 |
| 1442 | 3300032005 | Ga0307411_10574965 | Ga0307411_105749651 | 161 |
| 1443 | 3300033430 | Ga0315913_1000364 | Ga0315913_10003646 | 161 |
| 1444 | 3300033464 | Ga0315915_1000002 | Ga0315915_1000002266 | 161 |
| 1445 | 3300035692 | Ga0373935_0164347 | Ga0373935_0164347_756_1241 | 161 |
| 1446 | 3300035692 | Ga0373935_0284707 | Ga0373935_0284707_291_776 | 161 |
| 1447 | 3300035692 | Ga0373935_1466639 | Ga0373935_1466639_10_495 | 161 |
| 1448 | 3300035695 | Ga0373927_0000074 | Ga0373927_0000074_65694_66179 | 161 |
| 1449 | 3300037068 | Ga0373925_0008542 | Ga0373925_0008542_4217_4702 | 161 |
| 1450 | 3300037312 | Ga0395899_0000014 | Ga0395899_0000014_359348_359833 | 161 |
| 1451 | 3300037312 | Ga0395899_0578189 | Ga0395899_0578189_176_661 | 161 |
| 1452 | 3300037418 | Ga0395900_0000007 | Ga0395900_0000007_359367_359852 | 161 |
| 1453 | 3300037418 | Ga0395900_0256182 | Ga0395900_0256182_1061_1546 | 161 |
| 1454 | 3300037418 | Ga0395900_0287462 | Ga0395900_0287462_651_1136 | 161 |
| 1455 | 3300037418 | Ga0395900_0487374 | Ga0395900_0487374_73_561 | 161 |
| 1456 | 3300037418 | Ga0395900_0534583 | Ga0395900_0534583_536_1021 | 161 |
| 1457 | 3300037418 | Ga0395900_0656906 | Ga0395900_0656906_175_669 | 161 |
| 1458 | 3300037466 | Ga0395898_0000011 | Ga0395898_0000011_129009_129494 | 161 |
| 1459 | 3300037466 | Ga0395898_0066132 | Ga0395898_0066132_1705_2190 | 161 |
| 1460 | 3300037466 | Ga0395898_0170613 | Ga0395898_0170613_615_1100 | 161 |
| 1461 | 3300037466 | Ga0395898_0845855 | Ga0395898_0845855_131_619 | 161 |
| 1462 | 3300037471 | Ga0395905_0000008 | Ga0395905_0000008_359367_359852 | 161 |
| 1463 | 3300037471 | Ga0395905_0003609 | Ga0395905_0003609_15123_15740 | 161 |
| 1464 | 3300037471 | Ga0395905_0062829 | Ga0395905_0062829_2554_3048 | 161 |
| 1465 | 3300037471 | Ga0395905_0081757 | Ga0395905_0081757_859_1353 | 161 |
| 1466 | 3300037471 | Ga0395905_0087746 | Ga0395905_0087746_2260_2745 | 161 |
| 1467 | 3300037471 | Ga0395905_0184733 | Ga0395905_0184733_1026_1511 | 161 |
| 1468 | 3300037471 | Ga0395905_0198464 | Ga0395905_0198464_114_599 | 161 |
| 1469 | 3300038443 | Ga0395901_0000020 | Ga0395901_0000020_185425_185910 | 161 |
| 1470 | 3300038443 | Ga0395901_0203247 | Ga0395901_0203247_267_752 | 161 |
| 1471 | 3300038443 | Ga0395901_0418062 | Ga0395901_0418062_681_1166 | 161 |
| 1472 | 3300038443 | Ga0395901_0735369 | Ga0395901_0735369_305_793 | 161 |
| 1473 | 3300038443 | Ga0395901_1494359 | Ga0395901_1494359_56_541 | 161 |
| 1474 | 3300041413 | Ga0439465_0002198 | Ga0439465_0002198_3350_3859 | 161 |
| 1475 | 3300041413 | Ga0439465_0028181 | Ga0439465_0028181_396_881 | 161 |
| 1476 | 3300041413 | Ga0439465_0196135 | Ga0439465_0196135_17_526 | 161 |
| 1477 | 3300041413 | Ga0439465_0216688 | Ga0439465_0216688_180_665 | 161 |
| 1478 | 3300041413 | Ga0439465_0249916 | Ga0439465_0249916_131_643 | 161 |
| 1479 | 3300041441 | Ga0451787_031617 | Ga0451787_031617_2147_2656 | 161 |
| 1480 | 3300041443 | Ga0451789_0616123 | Ga0451789_0616123_126_611 | 161 |
| 1481 | 3300041444 | Ga0451790_41710 | Ga0451790_41710_53_538 | 161 |
| 1482 | 3300041451 | Ga0451791_0907373 | Ga0451791_0907373_341_826 | 161 |
| 1483 | 3300041451 | Ga0451791_1393878 | Ga0451791_1393878_195_692 | 161 |
| 1484 | 3300041453 | Ga0451797_1310432 | Ga0451797_1310432_73_558 | 161 |
| 1485 | 3300041491 | Ga0451833_1319809 | Ga0451833_1319809_15_500 | 161 |
| 1486 | 3300041492 | Ga0451835_0218371 | Ga0451835_0218371_44_553 | 161 |
| 1487 | 3300041493 | Ga0451836_13108 | Ga0451836_13108_150_659 | 161 |
| 1488 | 3300041494 | Ga0451837_0471602 | Ga0451837_0471602_384_893 | 161 |
| 1489 | 3300041494 | Ga0451837_0562295 | Ga0451837_0562295_282_791 | 161 |
| 1490 | 3300041496 | Ga0451839_0562329 | Ga0451839_0562329_38_547 | 161 |
| 1491 | 3300041497 | Ga0451840_28572 | Ga0451840_28572_281_790 | 161 |
| 1492 | 3300041498 | Ga0451841_0541929 | Ga0451841_0541929_339_824 | 161 |
| 1493 | 3300041498 | Ga0451841_0881634 | Ga0451841_0881634_791_1276 | 161 |
| 1494 | 3300041500 | Ga0451844_02159 | Ga0451844_02159_383_892 | 161 |
| 1495 | 3300041501 | Ga0451845_0753293 | Ga0451845_0753293_306_791 | 161 |
| 1496 | 3300041503 | Ga0451847_0228755 | Ga0451847_0228755_1270_1755 | 161 |
| 1497 | 3300041503 | Ga0451847_0469452 | Ga0451847_0469452_23_508 | 161 |
| 1498 | 3300041504 | Ga0451848_06670 | Ga0451848_06670_292_777 | 161 |
| 1499 | 3300041507 | Ga0451851_0283834 | Ga0451851_0283834_82_582 | 161 |
| 1500 | 3300041507 | Ga0451851_0517594 | Ga0451851_0517594_1213_1698 | 161 |
| 1501 | 3300041509 | Ga0451843_1214210 | Ga0451843_1214210_186_695 | 161 |
| 1502 | 3300041510 | Ga0451854_30503 | Ga0451854_30503_422_931 | 161 |
| 1503 | 3300041511 | Ga0451855_0216161 | Ga0451855_0216161_3013_3498 | 161 |
| 1504 | 3300041511 | Ga0451855_0278802 | Ga0451855_0278802_23_508 | 161 |
| 1505 | 3300041512 | Ga0451853_2686657 | Ga0451853_2686657_1496_2005 | 161 |
| 1506 | 3300041907 | Ga0452268_02506 | Ga0452268_02506_225_710 | 161 |
| 1507 | 3300041907 | Ga0452268_31546 | Ga0452268_31546_239_724 | 161 |
| 1508 | 3300042001 | Ga0439441_059889 | Ga0439441_059889_42_527 | 161 |
| 1509 | 3300042002 | Ga0439442_105887 | Ga0439442_105887_66_551 | 161 |
| 1510 | 3300042004 | Ga0439445_0044398 | Ga0439445_0044398_169_654 | 161 |
| 1511 | 3300042006 | Ga0439432_049090 | Ga0439432_049090_789_1286 | 161 |
| 1512 | 3300042007 | Ga0439449_0020537 | Ga0439449_0020537_1509_2018 | 161 |
| 1513 | 3300042136 | Ga0450900_023943 | Ga0450900_023943_359_850 | 161 |
| 1514 | 3300042157 | Ga0439458_0050942 | Ga0439458_0050942_85_570 | 161 |
| 1515 | 3300042435 | Ga0439434_0006200 | Ga0439434_0006200_1427_1936 | 161 |
| 1516 | 3300042531 | Ga0450918_000624 | Ga0450918_000624_122_631 | 161 |
| 1517 | 3300044658 | Ga0466972_0039301 | Ga0466972_0039301_613_1098 | 161 |
| 1518 | 3300044683 | Ga0466965_0155215 | Ga0466965_0155215_173_658 | 161 |
| 1519 | 3300044683 | Ga0466965_0174919 | Ga0466965_0174919_75_560 | 161 |
| 1520 | 3300044735 | Ga0466968_0156700 | Ga0466968_0156700_415_900 | 161 |
| 1521 | 3300044735 | Ga0466968_0514774 | Ga0466968_0514774_90_575 | 161 |
| 1522 | 3300044765 | Ga0466970_0640706 | Ga0466970_0640706_63_548 | 161 |
| 1523 | 3300044901 | Ga0466960_0112323 | Ga0466960_0112323_829_1314 | 161 |
| 1524 | 3300045049 | Ga0466959_0395808 | Ga0466959_0395808_39_548 | 161 |
| 1525 | 3300045051 | Ga0451576_1303413 | Ga0451576_1303413_143_697 | 161 |
| 1526 | 3300046459 | Ga0495629_0037852 | Ga0495629_0037852_198_707 | 161 |
| 1527 | 3300046460 | Ga0495638_0000110 | Ga0495638_0000110_15794_16279 | 161 |
| 1528 | 3300046460 | Ga0495638_0012945 | Ga0495638_0012945_4396_4881 | 161 |
| 1529 | 3300046460 | Ga0495638_0028199 | Ga0495638_0028199_2909_3394 | 161 |
| 1530 | 3300046460 | Ga0495638_0426201 | Ga0495638_0426201_45_611 | 161 |
| 1531 | 3300046460 | Ga0495638_0465294 | Ga0495638_0465294_104_589 | 161 |
| 1532 | 3300046471 | Ga0495650_0095593 | Ga0495650_0095593_345_854 | 161 |
| 1533 | 3300046476 | Ga0495662_0004122 | Ga0495662_0004122_1294_1803 | 161 |
| 1534 | 3300046492 | Ga0495585_0008442 | Ga0495585_0008442_457_966 | 161 |
| 1535 | 3300046492 | Ga0495585_0245939 | Ga0495585_0245939_91_576 | 161 |
| 1536 | 3300046500 | Ga0495596_0025403 | Ga0495596_0025403_1519_2028 | 161 |
| 1537 | 3300046501 | Ga0495607_0023917 | Ga0495607_0023917_800_1309 | 161 |
| 1538 | 3300046506 | Ga0495583_0025141 | Ga0495583_0025141_2461_2970 | 161 |
| 1539 | 3300046506 | Ga0495583_0141152 | Ga0495583_0141152_288_773 | 161 |
| 1540 | 3300046507 | Ga0495606_0001739 | Ga0495606_0001739_17679_18188 | 161 |
| 1541 | 3300046507 | Ga0495606_0015600 | Ga0495606_0015600_1715_2224 | 161 |
| 1542 | 3300046507 | Ga0495606_0234470 | Ga0495606_0234470_115_600 | 161 |
| 1543 | 3300046512 | Ga0495610_0001935 | Ga0495610_0001935_1858_2367 | 161 |
| 1544 | 3300046512 | Ga0495610_0066907 | Ga0495610_0066907_365_874 | 161 |
| 1545 | 3300046515 | Ga0495620_0178898 | Ga0495620_0178898_162_671 | 161 |
| 1546 | 3300046518 | Ga0495631_0173697 | Ga0495631_0173697_14_499 | 161 |
| 1547 | 3300046518 | Ga0495631_0205993 | Ga0495631_0205993_267_776 | 161 |
| 1548 | 3300046519 | Ga0495632_0000347 | Ga0495632_0000347_11278_11787 | 161 |
| 1549 | 3300046519 | Ga0495632_0019297 | Ga0495632_0019297_3144_3653 | 161 |
| 1550 | 3300046519 | Ga0495632_0062337 | Ga0495632_0062337_608_1093 | 161 |
| 1551 | 3300046520 | Ga0495637_0117180 | Ga0495637_0117180_115_600 | 161 |
| 1552 | 3300046522 | Ga0495643_0015286 | Ga0495643_0015286_1771_2280 | 161 |
| 1553 | 3300046522 | Ga0495643_0027853 | Ga0495643_0027853_818_1303 | 161 |
| 1554 | 3300046529 | Ga0495652_0429760 | Ga0495652_0429760_61_570 | 161 |
| 1555 | 3300046530 | Ga0495654_0000143 | Ga0495654_0000143_8584_9093 | 161 |
| 1556 | 3300046530 | Ga0495654_0034316 | Ga0495654_0034316_1134_1643 | 161 |
| 1557 | 3300046536 | Ga0495587_0140782 | Ga0495587_0140782_520_1029 | 161 |
| 1558 | 3300046538 | Ga0495609_0030102 | Ga0495609_0030102_1679_2164 | 161 |
| 1559 | 3300046538 | Ga0495609_0047745 | Ga0495609_0047745_128_637 | 161 |
| 1560 | 3300046557 | Ga0495622_0025118 | Ga0495622_0025118_84_593 | 161 |
| 1561 | 3300046557 | Ga0495622_0115690 | Ga0495622_0115690_703_1212 | 161 |
| 1562 | 3300046558 | Ga0495633_0067416 | Ga0495633_0067416_135_644 | 161 |
| 1563 | 3300046615 | Ga0495656_0122164 | Ga0495656_0122164_115_600 | 161 |
| 1564 | 3300046615 | Ga0495656_0486606 | Ga0495656_0486606_29_538 | 161 |
| 1565 | 3300046615 | Ga0495656_0618489 | Ga0495656_0618489_48_557 | 161 |
| 1566 | 3300046616 | Ga0495668_0035633 | Ga0495668_0035633_357_866 | 161 |
| 1567 | 3300046616 | Ga0495668_0094268 | Ga0495668_0094268_397_882 | 161 |
| 1568 | 3300046616 | Ga0495668_0138825 | Ga0495668_0138825_433_918 | 161 |
| 1569 | 3300046660 | Ga0495625_0032377 | Ga0495625_0032377_850_1335 | 161 |
| 1570 | 3300046660 | Ga0495625_0171839 | Ga0495625_0171839_727_1239 | 161 |
| 1571 | 3300046660 | Ga0495625_0267893 | Ga0495625_0267893_35_520 | 161 |
| 1572 | 3300046663 | Ga0495635_0124869 | Ga0495635_0124869_454_963 | 161 |
| 1573 | 3300046665 | Ga0495661_0032290 | Ga0495661_0032290_1277_1786 | 161 |
| 1574 | 3300046683 | Ga0495658_0115609 | Ga0495658_0115609_806_1315 | 161 |
| 1575 | 3300046691 | Ga0495670_0013105 | Ga0495670_0013105_2823_3308 | 161 |
| 1576 | 3300046692 | Ga0495671_0033323 | Ga0495671_0033323_1023_1532 | 161 |
| 1577 | 3300046810 | Ga0495660_0080875 | Ga0495660_0080875_401_910 | 161 |
| 1578 | 3300047317 | Ga0495604_0019395 | Ga0495604_0019395_2599_3108 | 161 |
| 1579 | 3300047318 | Ga0495636_0091956 | Ga0495636_0091956_534_1019 | 161 |
| 1580 | 3300047320 | Ga0495672_0110440 | Ga0495672_0110440_575_1060 | 161 |
| 1581 | 3300047321 | Ga0495676_0819074 | Ga0495676_0819074_93_578 | 161 |
| 1582 | 3300047443 | Ga0495687_070586 | Ga0495687_070586_213_698 | 161 |
| 1583 | 3300047445 | Ga0495677_0195012 | Ga0495677_0195012_219_704 | 161 |
| 1584 | 3300047470 | Ga0495681_0091967 | Ga0495681_0091967_782_1267 | 161 |
| 1585 | 3300047470 | Ga0495681_0117388 | Ga0495681_0117388_578_1087 | 161 |
| 1586 | 3300047472 | Ga0495686_0000922 | Ga0495686_0000922_33518_34027 | 161 |
| 1587 | 3300047472 | Ga0495686_0002075 | Ga0495686_0002075_7581_8090 | 161 |
| 1588 | 3300047472 | Ga0495686_0006491 | Ga0495686_0006491_5404_5913 | 161 |
| 1589 | 3300047472 | Ga0495686_0033990 | Ga0495686_0033990_167_652 | 161 |
| 1590 | 3300047472 | Ga0495686_0093608 | Ga0495686_0093608_642_1127 | 161 |
| 1591 | 3300048088 | Ga0495602_0304557 | Ga0495602_0304557_267_776 | 161 |
| 1592 | 3300048091 | Ga0495626_0147980 | Ga0495626_0147980_288_797 | 161 |
| 1593 | 3300048905 | Ga0496102_0352497 | Ga0496102_0352497_714_1199 | 161 |
| 1594 | 3300048905 | Ga0496102_1758046 | Ga0496102_1758046_32_517 | 161 |
| 1595 | 3300048906 | Ga0496103_0178336 | Ga0496103_0178336_333_818 | 161 |
| 1596 | 3300048907 | Ga0496104_0261376 | Ga0496104_0261376_599_1084 | 161 |
| 1597 | 3300048909 | Ga0496106_1270917 | Ga0496106_1270917_47_556 | 161 |
| 1598 | 3300048912 | Ga0496109_0513229 | Ga0496109_0513229_104_589 | 161 |
| 1599 | 3300048913 | Ga0496110_0533748 | Ga0496110_0533748_94_579 | 161 |
| 1600 | 3300048914 | Ga0496111_0000447 | Ga0496111_0000447_16999_17484 | 161 |
| 1601 | 3300048914 | Ga0496111_0853401 | Ga0496111_0853401_62_559 | 161 |
| 1602 | 3300048915 | Ga0496112_0042936 | Ga0496112_0042936_189_674 | 161 |
| 1603 | 3300048915 | Ga0496112_0218361 | Ga0496112_0218361_1111_1596 | 161 |
| 1604 | 3300048918 | Ga0496115_0051128 | Ga0496115_0051128_29_574 | 161 |
| 1605 | 3300048918 | Ga0496115_0333921 | Ga0496115_0333921_619_1104 | 161 |
| 1606 | 3300048919 | Ga0496116_0000057 | Ga0496116_0000057_148990_149505 | 161 |
| 1607 | 3300048919 | Ga0496116_0004102 | Ga0496116_0004102_8124_8633 | 161 |
| 1608 | 3300048919 | Ga0496116_0005154 | Ga0496116_0005154_9167_9652 | 161 |
| 1609 | 3300048919 | Ga0496116_0155737 | Ga0496116_0155737_51_560 | 161 |
| 1610 | 3300048920 | Ga0496117_0000031 | Ga0496117_0000031_259197_259706 | 161 |
| 1611 | 3300048920 | Ga0496117_0001716 | Ga0496117_0001716_2969_3478 | 161 |
| 1612 | 3300048920 | Ga0496117_0003198 | Ga0496117_0003198_3367_3876 | 161 |
| 1613 | 3300048920 | Ga0496117_0055346 | Ga0496117_0055346_2214_2723 | 161 |
| 1614 | 3300048920 | Ga0496117_0146975 | Ga0496117_0146975_116_601 | 161 |
| 1615 | 3300048920 | Ga0496117_0189855 | Ga0496117_0189855_614_1123 | 161 |
| 1616 | 3300048921 | Ga0496118_0000208 | Ga0496118_0000208_3598_4107 | 161 |
| 1617 | 3300048921 | Ga0496118_0014561 | Ga0496118_0014561_3569_4078 | 161 |
| 1618 | 3300048921 | Ga0496118_0026276 | Ga0496118_0026276_2732_3241 | 161 |
| 1619 | 3300048921 | Ga0496118_0039076 | Ga0496118_0039076_159_644 | 161 |
| 1620 | 3300048921 | Ga0496118_0043584 | Ga0496118_0043584_355_840 | 161 |
| 1621 | 3300048921 | Ga0496118_0053043 | Ga0496118_0053043_1198_1683 | 161 |
| 1622 | 3300048921 | Ga0496118_0101758 | Ga0496118_0101758_497_1006 | 161 |
| 1623 | 3300048921 | Ga0496118_0246096 | Ga0496118_0246096_16_501 | 161 |
| 1624 | 3300048921 | Ga0496118_0483954 | Ga0496118_0483954_77_562 | 161 |
| 1625 | 3300048921 | Ga0496118_0487981 | Ga0496118_0487981_74_589 | 161 |
| 1626 | 3300048922 | Ga0496119_0014917 | Ga0496119_0014917_4925_5410 | 161 |
| 1627 | 3300048922 | Ga0496119_0035101 | Ga0496119_0035101_15_524 | 161 |
| 1628 | 3300048922 | Ga0496119_0049554 | Ga0496119_0049554_1754_2263 | 161 |
| 1629 | 3300048922 | Ga0496119_0083457 | Ga0496119_0083457_710_1195 | 161 |
| 1630 | 3300048922 | Ga0496119_0088348 | Ga0496119_0088348_1253_1738 | 161 |
| 1631 | 3300048922 | Ga0496119_0118815 | Ga0496119_0118815_317_826 | 161 |
| 1632 | 3300048922 | Ga0496119_0232717 | Ga0496119_0232717_64_549 | 161 |
| 1633 | 3300048922 | Ga0496119_0468903 | Ga0496119_0468903_35_520 | 161 |
| 1634 | 3300048923 | Ga0496120_0001350 | Ga0496120_0001350_23689_24198 | 161 |
| 1635 | 3300048923 | Ga0496120_0001677 | Ga0496120_0001677_13941_14426 | 161 |
| 1636 | 3300048923 | Ga0496120_0114344 | Ga0496120_0114344_253_738 | 161 |
| 1637 | 3300048923 | Ga0496120_0130251 | Ga0496120_0130251_460_969 | 161 |
| 1638 | 3300048923 | Ga0496120_0139297 | Ga0496120_0139297_569_1078 | 161 |
| 1639 | 3300048923 | Ga0496120_0204615 | Ga0496120_0204615_109_594 | 161 |
| 1640 | 3300048923 | Ga0496120_0244623 | Ga0496120_0244623_193_702 | 161 |
| 1641 | 3300048924 | Ga0496121_0000034 | Ga0496121_0000034_200853_201362 | 161 |
| 1642 | 3300048924 | Ga0496121_0000888 | Ga0496121_0000888_50563_51048 | 161 |
| 1643 | 3300048924 | Ga0496121_0002668 | Ga0496121_0002668_26145_26654 | 161 |
| 1644 | 3300048924 | Ga0496121_0018567 | Ga0496121_0018567_4134_4619 | 161 |
| 1645 | 3300048924 | Ga0496121_0039767 | Ga0496121_0039767_2354_2869 | 161 |
| 1646 | 3300048924 | Ga0496121_0066030 | Ga0496121_0066030_163_672 | 161 |
| 1647 | 3300048924 | Ga0496121_0110599 | Ga0496121_0110599_233_742 | 161 |
| 1648 | 3300048924 | Ga0496121_0221325 | Ga0496121_0221325_157_651 | 161 |
| 1649 | 3300048924 | Ga0496121_0266623 | Ga0496121_0266623_150_659 | 161 |
| 1650 | 3300048924 | Ga0496121_0419085 | Ga0496121_0419085_310_795 | 161 |
| 1651 | 3300048924 | Ga0496121_0537548 | Ga0496121_0537548_13_501 | 161 |
| 1652 | 3300048924 | Ga0496121_0675887 | Ga0496121_0675887_74_583 | 161 |
| 1653 | 3300048925 | Ga0496122_0000023 | Ga0496122_0000023_259185_259694 | 161 |
| 1654 | 3300048925 | Ga0496122_0000082 | Ga0496122_0000082_98795_99280 | 161 |
| 1655 | 3300048925 | Ga0496122_0000286 | Ga0496122_0000286_108603_109112 | 161 |
| 1656 | 3300048925 | Ga0496122_0004894 | Ga0496122_0004894_2157_2672 | 161 |
| 1657 | 3300048925 | Ga0496122_0018350 | Ga0496122_0018350_1678_2163 | 161 |
| 1658 | 3300048925 | Ga0496122_0026286 | Ga0496122_0026286_1662_2171 | 161 |
| 1659 | 3300048925 | Ga0496122_0087471 | Ga0496122_0087471_889_1374 | 161 |
| 1660 | 3300048925 | Ga0496122_0095309 | Ga0496122_0095309_22_507 | 161 |
| 1661 | 3300048925 | Ga0496122_0170011 | Ga0496122_0170011_809_1300 | 161 |
| 1662 | 3300048926 | Ga0496123_0000027 | Ga0496123_0000027_121342_121851 | 161 |
| 1663 | 3300048926 | Ga0496123_0000066 | Ga0496123_0000066_111429_111938 | 161 |
| 1664 | 3300048926 | Ga0496123_0000067 | Ga0496123_0000067_109880_110365 | 161 |
| 1665 | 3300048926 | Ga0496123_0013117 | Ga0496123_0013117_1607_2116 | 161 |
| 1666 | 3300048926 | Ga0496123_0041094 | Ga0496123_0041094_1261_1746 | 161 |
| 1667 | 3300048926 | Ga0496123_0046501 | Ga0496123_0046501_1615_2130 | 161 |
| 1668 | 3300048926 | Ga0496123_0061041 | Ga0496123_0061041_1792_2343 | 161 |
| 1669 | 3300048926 | Ga0496123_0063420 | Ga0496123_0063420_504_989 | 161 |
| 1670 | 3300048926 | Ga0496123_0076632 | Ga0496123_0076632_1378_1887 | 161 |
| 1671 | 3300048926 | Ga0496123_0091216 | Ga0496123_0091216_333_848 | 161 |
| 1672 | 3300048926 | Ga0496123_0098893 | Ga0496123_0098893_578_1087 | 161 |
| 1673 | 3300048927 | Ga0496124_0000174 | Ga0496124_0000174_108184_108669 | 161 |
| 1674 | 3300048927 | Ga0496124_0003251 | Ga0496124_0003251_9305_9814 | 161 |
| 1675 | 3300048927 | Ga0496124_0006284 | Ga0496124_0006284_9194_9679 | 161 |
| 1676 | 3300048927 | Ga0496124_0009223 | Ga0496124_0009223_3187_3696 | 161 |
| 1677 | 3300048927 | Ga0496124_0015603 | Ga0496124_0015603_6688_7197 | 161 |
| 1678 | 3300048927 | Ga0496124_0022211 | Ga0496124_0022211_895_1380 | 161 |
| 1679 | 3300048927 | Ga0496124_0028978 | Ga0496124_0028978_3302_3787 | 161 |
| 1680 | 3300048927 | Ga0496124_0037583 | Ga0496124_0037583_10_519 | 161 |
| 1681 | 3300048927 | Ga0496124_0038925 | Ga0496124_0038925_1834_2343 | 161 |
| 1682 | 3300048927 | Ga0496124_0121559 | Ga0496124_0121559_1484_2029 | 161 |
| 1683 | 3300048927 | Ga0496124_0153605 | Ga0496124_0153605_363_848 | 161 |
| 1684 | 3300048927 | Ga0496124_0190362 | Ga0496124_0190362_733_1242 | 161 |
| 1685 | 3300048927 | Ga0496124_0218741 | Ga0496124_0218741_327_824 | 161 |
| 1686 | 3300048927 | Ga0496124_0307385 | Ga0496124_0307385_78_575 | 161 |
| 1687 | 3300048928 | Ga0496125_0000030 | Ga0496125_0000030_173145_173654 | 161 |
| 1688 | 3300048928 | Ga0496125_0000279 | Ga0496125_0000279_94287_94784 | 161 |
| 1689 | 3300048928 | Ga0496125_0000288 | Ga0496125_0000288_30688_31197 | 161 |
| 1690 | 3300048928 | Ga0496125_0006344 | Ga0496125_0006344_9529_10014 | 161 |
| 1691 | 3300048928 | Ga0496125_0061583 | Ga0496125_0061583_1869_2378 | 161 |
| 1692 | 3300048928 | Ga0496125_0077477 | Ga0496125_0077477_736_1245 | 161 |
| 1693 | 3300048928 | Ga0496125_0142884 | Ga0496125_0142884_335_820 | 161 |
| 1694 | 3300048928 | Ga0496125_0176690 | Ga0496125_0176690_248_733 | 161 |
| 1695 | 3300048928 | Ga0496125_0415216 | Ga0496125_0415216_53_550 | 161 |
| 1696 | 3300048929 | Ga0496126_0000115 | Ga0496126_0000115_149077_149592 | 161 |
| 1697 | 3300048929 | Ga0496126_0000258 | Ga0496126_0000258_110802_111311 | 161 |
| 1698 | 3300048929 | Ga0496126_0032272 | Ga0496126_0032272_2161_2658 | 161 |
| 1699 | 3300048929 | Ga0496126_0059518 | Ga0496126_0059518_1880_2389 | 161 |
| 1700 | 3300048929 | Ga0496126_0073711 | Ga0496126_0073711_1068_1553 | 161 |
| 1701 | 3300048929 | Ga0496126_0106372 | Ga0496126_0106372_1204_1713 | 161 |
| 1702 | 3300048929 | Ga0496126_0175746 | Ga0496126_0175746_1285_1794 | 161 |
| 1703 | 3300048929 | Ga0496126_0238009 | Ga0496126_0238009_500_985 | 161 |
| 1704 | 3300048929 | Ga0496126_0248570 | Ga0496126_0248570_515_1000 | 161 |
| 1705 | 3300048929 | Ga0496126_0297042 | Ga0496126_0297042_691_1176 | 161 |
| 1706 | 3300048929 | Ga0496126_0465308 | Ga0496126_0465308_472_981 | 161 |
| 1707 | 3300048929 | Ga0496126_1090073 | Ga0496126_1090073_33_518 | 161 |
| 1708 | 3300049523 | Ga0501300_019550 | Ga0501300_019550_25_510 | 161 |
| 1709 | 3300049568 | Ga0501031_0000831 | Ga0501031_0000831_5055_5552 | 161 |
| 1710 | 3300049568 | Ga0501031_0024325 | Ga0501031_0024325_1843_2346 | 161 |
| 1711 | 3300049568 | Ga0501031_0032259 | Ga0501031_0032259_1318_1827 | 161 |
| 1712 | 3300049568 | Ga0501031_0052719 | Ga0501031_0052719_292_777 | 161 |
| 1713 | 3300049568 | Ga0501031_0143196 | Ga0501031_0143196_1020_1505 | 161 |
| 1714 | 3300049569 | Ga0501032_0000019 | Ga0501032_0000019_68532_69029 | 161 |
| 1715 | 3300049569 | Ga0501032_0000102 | Ga0501032_0000102_48029_48526 | 161 |
| 1716 | 3300049569 | Ga0501032_0002196 | Ga0501032_0002196_5405_5890 | 161 |
| 1717 | 3300049569 | Ga0501032_0011699 | Ga0501032_0011699_5093_5596 | 161 |
| 1718 | 3300049569 | Ga0501032_0013398 | Ga0501032_0013398_5260_5766 | 161 |
| 1719 | 3300049569 | Ga0501032_0020932 | Ga0501032_0020932_1366_1851 | 161 |
| 1720 | 3300049569 | Ga0501032_0032000 | Ga0501032_0032000_1879_2364 | 161 |
| 1721 | 3300049569 | Ga0501032_0050455 | Ga0501032_0050455_334_819 | 161 |
| 1722 | 3300049569 | Ga0501032_0580689 | Ga0501032_0580689_89_574 | 161 |
| 1723 | 3300049569 | Ga0501032_0754517 | Ga0501032_0754517_72_575 | 161 |
| 1724 | 3300049570 | Ga0501033_0000133 | Ga0501033_0000133_48031_48528 | 161 |
| 1725 | 3300049570 | Ga0501033_0000185 | Ga0501033_0000185_36745_37230 | 161 |
| 1726 | 3300049570 | Ga0501033_0003165 | Ga0501033_0003165_181_678 | 161 |
| 1727 | 3300049570 | Ga0501033_0008082 | Ga0501033_0008082_1983_2468 | 161 |
| 1728 | 3300049570 | Ga0501033_0015786 | Ga0501033_0015786_1241_1744 | 161 |
| 1729 | 3300049570 | Ga0501033_0024075 | Ga0501033_0024075_2978_3463 | 161 |
| 1730 | 3300049570 | Ga0501033_0089980 | Ga0501033_0089980_1681_2184 | 161 |
| 1731 | 3300049570 | Ga0501033_0216610 | Ga0501033_0216610_377_862 | 161 |
| 1732 | 3300049570 | Ga0501033_0310137 | Ga0501033_0310137_121_630 | 161 |
| 1733 | 3300049570 | Ga0501033_0399009 | Ga0501033_0399009_149_655 | 161 |
| 1734 | 3300049570 | Ga0501033_0968875 | Ga0501033_0968875_18_503 | 161 |
| 1735 | 3300049571 | Ga0501034_0000130 | Ga0501034_0000130_52932_53429 | 161 |
| 1736 | 3300049571 | Ga0501034_0000296 | Ga0501034_0000296_48029_48526 | 161 |
| 1737 | 3300049571 | Ga0501034_0000611 | Ga0501034_0000611_771_1268 | 161 |
| 1738 | 3300049571 | Ga0501034_0011862 | Ga0501034_0011862_8445_8942 | 161 |
| 1739 | 3300049571 | Ga0501034_0013933 | Ga0501034_0013933_1015_1500 | 161 |
| 1740 | 3300049571 | Ga0501034_0033876 | Ga0501034_0033876_3981_4484 | 161 |
| 1741 | 3300049571 | Ga0501034_0056088 | Ga0501034_0056088_2703_3188 | 161 |
| 1742 | 3300049571 | Ga0501034_0089007 | Ga0501034_0089007_2266_2751 | 161 |
| 1743 | 3300049571 | Ga0501034_0111233 | Ga0501034_0111233_440_949 | 161 |
| 1744 | 3300049571 | Ga0501034_0125911 | Ga0501034_0125911_469_954 | 161 |
| 1745 | 3300049571 | Ga0501034_0168146 | Ga0501034_0168146_438_923 | 161 |
| 1746 | 3300049571 | Ga0501034_0207269 | Ga0501034_0207269_464_970 | 161 |
| 1747 | 3300049571 | Ga0501034_0392880 | Ga0501034_0392880_331_831 | 161 |
| 1748 | 3300049571 | Ga0501034_0395688 | Ga0501034_0395688_165_650 | 161 |
| 1749 | 3300049571 | Ga0501034_0406609 | Ga0501034_0406609_343_828 | 161 |
| 1750 | 3300049571 | Ga0501034_0618241 | Ga0501034_0618241_416_901 | 161 |
| 1751 | 3300049571 | Ga0501034_0738934 | Ga0501034_0738934_352_837 | 161 |
| 1752 | 3300049571 | Ga0501034_1208711 | Ga0501034_1208711_94_579 | 161 |
| 1753 | 3300049571 | Ga0501034_1458588 | Ga0501034_1458588_21_506 | 161 |
| 1754 | 3300049572 | Ga0501036_0000034 | Ga0501036_0000034_48029_48526 | 161 |
| 1755 | 3300049572 | Ga0501036_0020290 | Ga0501036_0020290_3263_3769 | 161 |
| 1756 | 3300049572 | Ga0501036_0024429 | Ga0501036_0024429_3323_3826 | 161 |
| 1757 | 3300049572 | Ga0501036_0030905 | Ga0501036_0030905_3881_4378 | 161 |
| 1758 | 3300049572 | Ga0501036_0061705 | Ga0501036_0061705_1393_1899 | 161 |
| 1759 | 3300049572 | Ga0501036_0115820 | Ga0501036_0115820_826_1311 | 161 |
| 1760 | 3300049572 | Ga0501036_0199776 | Ga0501036_0199776_395_880 | 161 |
| 1761 | 3300049572 | Ga0501036_0210707 | Ga0501036_0210707_642_1127 | 161 |
| 1762 | 3300049572 | Ga0501036_0945732 | Ga0501036_0945732_38_532 | 161 |
| 1763 | 3300049573 | Ga0501037_0000079 | Ga0501037_0000079_48029_48526 | 161 |
| 1764 | 3300049573 | Ga0501037_0000089 | Ga0501037_0000089_72180_72665 | 161 |
| 1765 | 3300049573 | Ga0501037_0023331 | Ga0501037_0023331_3958_4455 | 161 |
| 1766 | 3300049573 | Ga0501037_0039467 | Ga0501037_0039467_2278_2781 | 161 |
| 1767 | 3300049573 | Ga0501037_0082089 | Ga0501037_0082089_1379_1864 | 161 |
| 1768 | 3300049573 | Ga0501037_0216648 | Ga0501037_0216648_427_936 | 161 |
| 1769 | 3300049573 | Ga0501037_0444244 | Ga0501037_0444244_236_721 | 161 |
| 1770 | 3300049573 | Ga0501037_0602240 | Ga0501037_0602240_41_541 | 161 |
| 1771 | 3300049574 | Ga0501038_0000063 | Ga0501038_0000063_39830_40327 | 161 |
| 1772 | 3300049574 | Ga0501038_0000478 | Ga0501038_0000478_15677_16174 | 161 |
| 1773 | 3300049574 | Ga0501038_0008634 | Ga0501038_0008634_3173_3679 | 161 |
| 1774 | 3300049574 | Ga0501038_0028340 | Ga0501038_0028340_582_1067 | 161 |
| 1775 | 3300049574 | Ga0501038_0093901 | Ga0501038_0093901_221_727 | 161 |
| 1776 | 3300049574 | Ga0501038_0104265 | Ga0501038_0104265_1035_1520 | 161 |
| 1777 | 3300049574 | Ga0501038_0145772 | Ga0501038_0145772_74_559 | 161 |
| 1778 | 3300049574 | Ga0501038_0356263 | Ga0501038_0356263_145_654 | 161 |
| 1779 | 3300049574 | Ga0501038_0356932 | Ga0501038_0356932_88_594 | 161 |
| 1780 | 3300049575 | Ga0501039_0000028 | Ga0501039_0000028_86140_86637 | 161 |
| 1781 | 3300049575 | Ga0501039_0000058 | Ga0501039_0000058_39830_40327 | 161 |
| 1782 | 3300049575 | Ga0501039_0143657 | Ga0501039_0143657_189_674 | 161 |
| 1783 | 3300049575 | Ga0501039_0151499 | Ga0501039_0151499_714_1199 | 161 |
| 1784 | 3300049575 | Ga0501039_0477382 | Ga0501039_0477382_420_905 | 161 |
| 1785 | 3300049575 | Ga0501039_0520285 | Ga0501039_0520285_282_767 | 161 |
| 1786 | 3300049576 | Ga0501040_0336600 | Ga0501040_0336600_455_958 | 161 |
| 1787 | 3300049577 | Ga0501041_0529004 | Ga0501041_0529004_234_737 | 161 |
| 1788 | 3300049578 | Ga0501042_0675925 | Ga0501042_0675925_168_665 | 161 |
| 1789 | 3300049579 | Ga0501043_0000007 | Ga0501043_0000007_138597_139082 | 161 |
| 1790 | 3300049579 | Ga0501043_0000113 | Ga0501043_0000113_72794_73291 | 161 |
| 1791 | 3300049579 | Ga0501043_0000355 | Ga0501043_0000355_20891_21388 | 161 |
| 1792 | 3300049579 | Ga0501043_0023562 | Ga0501043_0023562_2047_2550 | 161 |
| 1793 | 3300049579 | Ga0501043_0107791 | Ga0501043_0107791_1581_2066 | 161 |
| 1794 | 3300049579 | Ga0501043_0150489 | Ga0501043_0150489_1172_1681 | 161 |
| 1795 | 3300049579 | Ga0501043_0377465 | Ga0501043_0377465_400_885 | 161 |
| 1796 | 3300049579 | Ga0501043_0422719 | Ga0501043_0422719_194_679 | 161 |
| 1797 | 3300049580 | Ga0501046_0074876 | Ga0501046_0074876_280_783 | 161 |
| 1798 | 3300049581 | Ga0501047_0000969 | Ga0501047_0000969_8148_8645 | 161 |
| 1799 | 3300049581 | Ga0501047_0005048 | Ga0501047_0005048_4985_5488 | 161 |
| 1800 | 3300049581 | Ga0501047_0009690 | Ga0501047_0009690_4302_4787 | 161 |
| 1801 | 3300049581 | Ga0501047_0014312 | Ga0501047_0014312_2053_2538 | 161 |
| 1802 | 3300049581 | Ga0501047_0022132 | Ga0501047_0022132_592_1077 | 161 |
| 1803 | 3300049581 | Ga0501047_0175568 | Ga0501047_0175568_166_651 | 161 |
| 1804 | 3300049581 | Ga0501047_0180407 | Ga0501047_0180407_385_870 | 161 |
| 1805 | 3300049581 | Ga0501047_0199065 | Ga0501047_0199065_1022_1507 | 161 |
| 1806 | 3300049581 | Ga0501047_0285388 | Ga0501047_0285388_37_585 | 161 |
| 1807 | 3300049581 | Ga0501047_0558421 | Ga0501047_0558421_118_603 | 161 |
| 1808 | 3300049581 | Ga0501047_0633710 | Ga0501047_0633710_110_607 | 161 |
| 1809 | 3300049582 | Ga0501048_0057912 | Ga0501048_0057912_1371_1874 | 161 |
| 1810 | 3300049582 | Ga0501048_0747413 | Ga0501048_0747413_150_656 | 161 |
| 1811 | 3300049583 | Ga0501067_0072755 | Ga0501067_0072755_1210_1695 | 161 |
| 1812 | 3300049584 | Ga0501068_0005603 | Ga0501068_0005603_5106_5609 | 161 |
| 1813 | 3300049584 | Ga0501068_0119051 | Ga0501068_0119051_1096_1602 | 161 |
| 1814 | 3300049585 | Ga0501069_0000001 | Ga0501069_0000001_256104_256589 | 161 |
| 1815 | 3300049585 | Ga0501069_0009230 | Ga0501069_0009230_3097_3582 | 161 |
| 1816 | 3300049585 | Ga0501069_0025263 | Ga0501069_0025263_1977_2462 | 161 |
| 1817 | 3300049585 | Ga0501069_0028526 | Ga0501069_0028526_1277_1783 | 161 |
| 1818 | 3300049585 | Ga0501069_0140327 | Ga0501069_0140327_66_551 | 161 |
| 1819 | 3300049585 | Ga0501069_0376150 | Ga0501069_0376150_225_728 | 161 |
| 1820 | 3300049586 | Ga0501070_0000789 | Ga0501070_0000789_11362_11847 | 161 |
| 1821 | 3300049586 | Ga0501070_0001012 | Ga0501070_0001012_2837_3322 | 161 |
| 1822 | 3300049586 | Ga0501070_0003595 | Ga0501070_0003595_342_827 | 161 |
| 1823 | 3300049586 | Ga0501070_0033843 | Ga0501070_0033843_1496_1999 | 161 |
| 1824 | 3300049586 | Ga0501070_0046330 | Ga0501070_0046330_818_1303 | 161 |
| 1825 | 3300049586 | Ga0501070_0061369 | Ga0501070_0061369_1747_2232 | 161 |
| 1826 | 3300049586 | Ga0501070_0076869 | Ga0501070_0076869_1788_2273 | 161 |
| 1827 | 3300049586 | Ga0501070_0102806 | Ga0501070_0102806_115_621 | 161 |
| 1828 | 3300049586 | Ga0501070_0133106 | Ga0501070_0133106_1417_1914 | 161 |
| 1829 | 3300049586 | Ga0501070_0252646 | Ga0501070_0252646_289_777 | 161 |
| 1830 | 3300049586 | Ga0501070_0833925 | Ga0501070_0833925_185_670 | 161 |
| 1831 | 3300049586 | Ga0501070_0847477 | Ga0501070_0847477_124_630 | 161 |
| 1832 | 3300049587 | Ga0501071_0047076 | Ga0501071_0047076_2594_3079 | 161 |
| 1833 | 3300049587 | Ga0501071_0803087 | Ga0501071_0803087_30_515 | 161 |
| 1834 | 3300049588 | Ga0501072_0544756 | Ga0501072_0544756_32_517 | 161 |
| 1835 | 3300049588 | Ga0501072_0851653 | Ga0501072_0851653_184_681 | 161 |
| 1836 | 3300049589 | Ga0501073_0011583 | Ga0501073_0011583_5769_6254 | 161 |
| 1837 | 3300049589 | Ga0501073_0034527 | Ga0501073_0034527_1715_2206 | 161 |
| 1838 | 3300049589 | Ga0501073_0164719 | Ga0501073_0164719_11_517 | 161 |
| 1839 | 3300049589 | Ga0501073_0264810 | Ga0501073_0264810_231_716 | 161 |
| 1840 | 3300049590 | Ga0501074_0000003 | Ga0501074_0000003_13463_13948 | 161 |
| 1841 | 3300049590 | Ga0501074_0012185 | Ga0501074_0012185_2925_3410 | 161 |
| 1842 | 3300049590 | Ga0501074_0032625 | Ga0501074_0032625_650_1156 | 161 |
| 1843 | 3300049590 | Ga0501074_0068543 | Ga0501074_0068543_218_703 | 161 |
| 1844 | 3300049590 | Ga0501074_0494006 | Ga0501074_0494006_242_727 | 161 |
| 1845 | 3300049671 | Ga0501238_046359 | Ga0501238_046359_90_599 | 161 |
| 1846 | 3300049741 | Ga0501079_1076655 | Ga0501079_1076655_102_605 | 161 |
| 1847 | 3300049742 | Ga0501080_0000090 | Ga0501080_0000090_57026_57511 | 161 |
| 1848 | 3300049742 | Ga0501080_0002221 | Ga0501080_0002221_4379_4864 | 161 |
| 1849 | 3300049742 | Ga0501080_0017506 | Ga0501080_0017506_4937_5440 | 161 |
| 1850 | 3300049742 | Ga0501080_0021242 | Ga0501080_0021242_1327_1812 | 161 |
| 1851 | 3300049742 | Ga0501080_0028515 | Ga0501080_0028515_4081_4566 | 161 |
| 1852 | 3300049742 | Ga0501080_0081908 | Ga0501080_0081908_291_776 | 161 |
| 1853 | 3300049742 | Ga0501080_0258070 | Ga0501080_0258070_167_673 | 161 |
| 1854 | 3300049744 | Ga0501083_0000012 | Ga0501083_0000012_39430_39915 | 161 |
| 1855 | 3300049744 | Ga0501083_0092675 | Ga0501083_0092675_1383_1898 | 161 |
| 1856 | 3300049763 | Ga0501266_014742 | Ga0501266_014742_377_862 | 161 |
| 1857 | 3300049776 | Ga0501280_001648 | Ga0501280_001648_2455_2940 | 161 |
| 1858 | 3300049776 | Ga0501280_001986 | Ga0501280_001986_2375_2860 | 161 |
| 1859 | 3300049822 | Ga0501035_0000037 | Ga0501035_0000037_42841_43326 | 161 |
| 1860 | 3300049822 | Ga0501035_0000143 | Ga0501035_0000143_86124_86621 | 161 |
| 1861 | 3300049822 | Ga0501035_0000203 | Ga0501035_0000203_48031_48528 | 161 |
| 1862 | 3300049822 | Ga0501035_0000529 | Ga0501035_0000529_30727_31212 | 161 |
| 1863 | 3300049822 | Ga0501035_0001061 | Ga0501035_0001061_66_551 | 161 |
| 1864 | 3300049822 | Ga0501035_0001616 | Ga0501035_0001616_9459_9944 | 161 |
| 1865 | 3300049822 | Ga0501035_0006787 | Ga0501035_0006787_6898_7383 | 161 |
| 1866 | 3300049822 | Ga0501035_0022057 | Ga0501035_0022057_14_514 | 161 |
| 1867 | 3300049822 | Ga0501035_0022420 | Ga0501035_0022420_695_1198 | 161 |
| 1868 | 3300049822 | Ga0501035_0073893 | Ga0501035_0073893_899_1408 | 161 |
| 1869 | 3300049822 | Ga0501035_0094304 | Ga0501035_0094304_1061_1546 | 161 |
| 1870 | 3300049822 | Ga0501035_0493833 | Ga0501035_0493833_429_923 | 161 |
| 1871 | 3300049822 | Ga0501035_0589024 | Ga0501035_0589024_156_641 | 161 |
| 1872 | 3300049822 | Ga0501035_0830144 | Ga0501035_0830144_210_710 | 161 |
| 1873 | 3300049823 | Ga0501044_0000018 | Ga0501044_0000018_181867_182352 | 161 |
| 1874 | 3300049823 | Ga0501044_0000142 | Ga0501044_0000142_48029_48526 | 161 |
| 1875 | 3300049823 | Ga0501044_0008899 | Ga0501044_0008899_10330_10827 | 161 |
| 1876 | 3300049823 | Ga0501044_0034593 | Ga0501044_0034593_721_1227 | 161 |
| 1877 | 3300049823 | Ga0501044_0038672 | Ga0501044_0038672_4286_4771 | 161 |
| 1878 | 3300049823 | Ga0501044_0050480 | Ga0501044_0050480_3527_4012 | 161 |
| 1879 | 3300049823 | Ga0501044_0094578 | Ga0501044_0094578_1269_1772 | 161 |
| 1880 | 3300049823 | Ga0501044_0188088 | Ga0501044_0188088_1240_1743 | 161 |
| 1881 | 3300049823 | Ga0501044_0307646 | Ga0501044_0307646_299_796 | 161 |
| 1882 | 3300049823 | Ga0501044_0314997 | Ga0501044_0314997_351_836 | 161 |
| 1883 | 3300049823 | Ga0501044_0316730 | Ga0501044_0316730_104_613 | 161 |
| 1884 | 3300049823 | Ga0501044_0316810 | Ga0501044_0316810_608_1108 | 161 |
| 1885 | 3300049823 | Ga0501044_0330106 | Ga0501044_0330106_781_1266 | 161 |
| 1886 | 3300049823 | Ga0501044_0405368 | Ga0501044_0405368_107_610 | 161 |
| 1887 | 3300049823 | Ga0501044_0465105 | Ga0501044_0465105_219_704 | 161 |
| 1888 | 3300049823 | Ga0501044_0660312 | Ga0501044_0660312_283_768 | 161 |
| 1889 | 3300049823 | Ga0501044_1002814 | Ga0501044_1002814_124_609 | 161 |
| 1890 | 3300049824 | Ga0501045_0001774 | Ga0501045_0001774_4945_5448 | 161 |
| 1891 | 3300049824 | Ga0501045_0317041 | Ga0501045_0317041_205_702 | 161 |
| 1892 | 3300049824 | Ga0501045_0745925 | Ga0501045_0745925_148_633 | 161 |
| 1893 | 3300050489 | nmdc:mga03683_201857_c1 | nmdc:mga03683_201857_c1_108_593 | 161 |
| 1894 | 3300050489 | nmdc:mga03683_208704_c1 | nmdc:mga03683_208704_c1_56_541 | 161 |
| 1895 | 3300050489 | nmdc:mga03683_3182_c1 | nmdc:mga03683_3182_c1_363_848 | 161 |
| 1896 | 3300050489 | nmdc:mga03683_328154_c1 | nmdc:mga03683_328154_c1_187_672 | 161 |
| 1897 | 3300050489 | nmdc:mga03683_6840_c1 | nmdc:mga03683_6840_c1_1954_2463 | 161 |
| 1898 | 3300050489 | nmdc:mga03683_811_c1 | nmdc:mga03683_811_c1_7071_7580 | 161 |
| 1899 | 3300050490 | nmdc:mga03n38_188260_c1 | nmdc:mga03n38_188260_c1_496_981 | 161 |
| 1900 | 3300050490 | nmdc:mga03n38_378752_c1 | nmdc:mga03n38_378752_c1_229_714 | 161 |
| 1901 | 3300050490 | nmdc:mga03n38_71982_c1 | nmdc:mga03n38_71982_c1_506_991 | 161 |
| 1902 | 3300050490 | nmdc:mga03n38_83643_c1 | nmdc:mga03n38_83643_c1_387_896 | 161 |
| 1903 | 3300050491 | nmdc:mga00v17_102223_c1 | nmdc:mga00v17_102223_c1_1164_1673 | 161 |
| 1904 | 3300050491 | nmdc:mga00v17_15_c1 | nmdc:mga00v17_15_c1_7250_7759 | 161 |
| 1905 | 3300050491 | nmdc:mga00v17_26228_c1 | nmdc:mga00v17_26228_c1_2400_2909 | 161 |
| 1906 | 3300050491 | nmdc:mga00v17_584912_c1 | nmdc:mga00v17_584912_c1_123_677 | 161 |
| 1907 | 3300050491 | nmdc:mga00v17_8647_c1 | nmdc:mga00v17_8647_c1_3674_4159 | 161 |
| 1908 | 3300050491 | nmdc:mga00v17_89_c1 | nmdc:mga00v17_89_c1_42251_42736 | 161 |
| 1909 | 3300050492 | nmdc:mga0yw44_140008_c1 | nmdc:mga0yw44_140008_c1_1033_1518 | 161 |
| 1910 | 3300050492 | nmdc:mga0yw44_183296_c1 | nmdc:mga0yw44_183296_c1_209_694 | 161 |
| 1911 | 3300050492 | nmdc:mga0yw44_23657_c1 | nmdc:mga0yw44_23657_c1_1534_2043 | 161 |
| 1912 | 3300050492 | nmdc:mga0yw44_401659_c1 | nmdc:mga0yw44_401659_c1_377_862 | 161 |
| 1913 | 3300050492 | nmdc:mga0yw44_5630_c1 | nmdc:mga0yw44_5630_c1_525_1010 | 161 |
| 1914 | 3300050493 | nmdc:mga0k408_308704_c1 | nmdc:mga0k408_308704_c1_63_572 | 161 |
| 1915 | 3300050493 | nmdc:mga0k408_375785_c1 | nmdc:mga0k408_375785_c1_258_743 | 161 |
| 1916 | 3300050493 | nmdc:mga0k408_588902_c1 | nmdc:mga0k408_588902_c1_76_561 | 161 |
| 1917 | 3300050493 | nmdc:mga0k408_6366_c1 | nmdc:mga0k408_6366_c1_3577_4086 | 161 |
| 1918 | 3300050493 | nmdc:mga0k408_77366_c1 | nmdc:mga0k408_77366_c1_298_807 | 161 |
| 1919 | 3300050494 | nmdc:mga06z11_126586_c1 | nmdc:mga06z11_126586_c1_856_1341 | 161 |
| 1920 | 3300050494 | nmdc:mga06z11_176227_c1 | nmdc:mga06z11_176227_c1_310_825 | 161 |
| 1921 | 3300050494 | nmdc:mga06z11_22195_c1 | nmdc:mga06z11_22195_c1_1627_2136 | 161 |
| 1922 | 3300050494 | nmdc:mga06z11_38443_c1 | nmdc:mga06z11_38443_c1_800_1285 | 161 |
| 1923 | 3300050494 | nmdc:mga06z11_48863_c1 | nmdc:mga06z11_48863_c1_172_657 | 161 |
| 1924 | 3300050494 | nmdc:mga06z11_48902_c1 | nmdc:mga06z11_48902_c1_568_1053 | 161 |
| 1925 | 3300050494 | nmdc:mga06z11_95147_c1 | nmdc:mga06z11_95147_c1_419_928 | 161 |
| 1926 | 3300050495 | nmdc:mga04h51_113833_c1 | nmdc:mga04h51_113833_c1_429_914 | 161 |
| 1927 | 3300050495 | nmdc:mga04h51_126921_c1 | nmdc:mga04h51_126921_c1_103_612 | 161 |
| 1928 | 3300050495 | nmdc:mga04h51_73206_c1 | nmdc:mga04h51_73206_c1_421_906 | 161 |
| 1929 | 3300050495 | nmdc:mga04h51_74946_c1 | nmdc:mga04h51_74946_c1_11_496 | 161 |
| 1930 | 3300050496 | nmdc:mga07m45_292368_c1 | nmdc:mga07m45_292368_c1_432_917 | 161 |
| 1931 | 3300050496 | nmdc:mga07m45_338145_c1 | nmdc:mga07m45_338145_c1_370_855 | 161 |
| 1932 | 3300050496 | nmdc:mga07m45_4831_c1 | nmdc:mga07m45_4831_c1_1515_2000 | 161 |
| 1933 | 3300050496 | nmdc:mga07m45_6173_c1 | nmdc:mga07m45_6173_c1_2736_3245 | 161 |
| 1934 | 3300050516 | nmdc:mga0sz30_2214_c2 | nmdc:mga0sz30_2214_c2_1645_2154 | 161 |
| 1935 | 3300050516 | nmdc:mga0sz30_2494_c1 | nmdc:mga0sz30_2494_c1_359_868 | 161 |
| 1936 | 3300050516 | nmdc:mga0sz30_4223_c1 | nmdc:mga0sz30_4223_c1_1280_1789 | 161 |
| 1937 | 3300050516 | nmdc:mga0sz30_65238_c1 | nmdc:mga0sz30_65238_c1_377_862 | 161 |
| 1938 | 3300050516 | nmdc:mga0sz30_74182_c1 | nmdc:mga0sz30_74182_c1_362_847 | 161 |
| 1939 | 3300053077 | Ga0495601_0143683 | Ga0495601_0143683_903_1412 | 161 |
| 1940 | 3300053079 | Ga0500610_0044800 | Ga0500610_0044800_293_778 | 161 |
| 1941 | 3300053079 | Ga0500610_0110793 | Ga0500610_0110793_31_516 | 161 |
| 1942 | 3300053083 | Ga0495655_0112419 | Ga0495655_0112419_190_675 | 161 |
| 1943 | 3300053086 | Ga0500578_0099734 | Ga0500578_0099734_1133_1642 | 161 |
| 1944 | 3300053087 | Ga0500643_025102 | Ga0500643_025102_552_1064 | 161 |
| 1945 | 3300053108 | Ga0500562_046931 | Ga0500562_046931_322_807 | 161 |
| 1946 | 3300053109 | Ga0500569_045348 | Ga0500569_045348_196_705 | 161 |
| 1947 | 3300053116 | Ga0500592_054822 | Ga0500592_054822_67_552 | 161 |
| 1948 | 3300053119 | Ga0500595_020626 | Ga0500595_020626_1058_1543 | 161 |
| 1949 | 3300053122 | Ga0500608_018114 | Ga0500608_018114_1901_2386 | 161 |
| 1950 | 3300053125 | Ga0500618_000528 | Ga0500618_000528_8869_9378 | 161 |
| 1951 | 3300053125 | Ga0500618_000573 | Ga0500618_000573_14033_14542 | 161 |
| 1952 | 3300053125 | Ga0500618_006786 | Ga0500618_006786_1201_1710 | 161 |
| 1953 | 3300053125 | Ga0500618_038091 | Ga0500618_038091_205_714 | 161 |
| 1954 | 3300053134 | Ga0500658_0002828 | Ga0500658_0002828_6130_6639 | 161 |
| 1955 | 3300053134 | Ga0500658_0100561 | Ga0500658_0100561_445_930 | 161 |
| 1956 | 3300053136 | Ga0500559_0012657 | Ga0500559_0012657_199_693 | 161 |
| 1957 | 3300053137 | Ga0500561_0000030 | Ga0500561_0000030_3386_3895 | 161 |
| 1958 | 3300053139 | Ga0500568_0000421 | Ga0500568_0000421_15797_16282 | 161 |
| 1959 | 3300053139 | Ga0500568_0000607 | Ga0500568_0000607_11788_12273 | 161 |
| 1960 | 3300053139 | Ga0500568_0000640 | Ga0500568_0000640_6134_6619 | 161 |
| 1961 | 3300053140 | Ga0500573_0013675 | Ga0500573_0013675_3205_3714 | 161 |
| 1962 | 3300053140 | Ga0500573_0024212 | Ga0500573_0024212_470_979 | 161 |
| 1963 | 3300053148 | Ga0500590_000839 | Ga0500590_000839_1067_1576 | 161 |
| 1964 | 3300053151 | Ga0500604_0000684 | Ga0500604_0000684_8522_9019 | 161 |
| 1965 | 3300053151 | Ga0500604_0015547 | Ga0500604_0015547_449_934 | 161 |
| 1966 | 3300053151 | Ga0500604_0050226 | Ga0500604_0050226_18_503 | 161 |
| 1967 | 3300053153 | Ga0500616_0000583 | Ga0500616_0000583_29424_29933 | 161 |
| 1968 | 3300053153 | Ga0500616_0001279 | Ga0500616_0001279_7762_8247 | 161 |
| 1969 | 3300053153 | Ga0500616_0027523 | Ga0500616_0027523_327_812 | 161 |
| 1970 | 3300053153 | Ga0500616_0048098 | Ga0500616_0048098_641_1126 | 161 |
| 1971 | 3300053153 | Ga0500616_0104269 | Ga0500616_0104269_211_696 | 161 |
| 1972 | 3300053153 | Ga0500616_0189142 | Ga0500616_0189142_365_874 | 161 |
| 1973 | 3300053156 | Ga0500622_0000541 | Ga0500622_0000541_12554_13048 | 161 |
| 1974 | 3300053156 | Ga0500622_0000962 | Ga0500622_0000962_11832_12317 | 161 |
| 1975 | 3300053157 | Ga0500624_001087 | Ga0500624_001087_3963_4472 | 161 |
| 1976 | 3300053158 | Ga0500627_0031040 | Ga0500627_0031040_910_1395 | 161 |
| 1977 | 3300053161 | Ga0500634_0062389 | Ga0500634_0062389_315_824 | 161 |
| 1978 | 3300053177 | Ga0500636_0000025 | Ga0500636_0000025_51417_51932 | 161 |
| 1979 | 3300053727 | Ga0500611_011078 | Ga0500611_011078_609_1094 | 161 |
| 1980 | 3300059477 | Ga0587084_012437 | Ga0587084_012437_272_781 | 161 |
| 1981 | 3300059490 | Ga0587066_012837 | Ga0587066_012837_628_1137 | 161 |
| 1982 | 3300059490 | Ga0587066_041647 | Ga0587066_041647_85_594 | 161 |
| 1983 | 3300059491 | Ga0587070_045005 | Ga0587070_045005_267_776 | 161 |
| 1984 | 3300059492 | Ga0587073_0020523 | Ga0587073_0020523_275_784 | 161 |
| 1985 | 3300059492 | Ga0587073_0210759 | Ga0587073_0210759_12_521 | 161 |
| 1986 | 3300059493 | Ga0587077_023247 | Ga0587077_023247_338_847 | 161 |
| 1987 | 3300059493 | Ga0587077_048248 | Ga0587077_048248_383_868 | 161 |
| 1988 | 3300059493 | Ga0587077_068672 | Ga0587077_068672_266_775 | 161 |
| 1989 | 3300059493 | Ga0587077_076300 | Ga0587077_076300_264_749 | 161 |
| 1990 | 3300059503 | Ga0587080_036364 | Ga0587080_036364_97_606 | 161 |
| 1991 | 3300059503 | Ga0587080_125430 | Ga0587080_125430_27_512 | 161 |
| 1992 | 3300059504 | Ga0587082_019304 | Ga0587082_019304_310_819 | 161 |
| 1993 | 3300059504 | Ga0587082_025181 | Ga0587082_025181_182_727 | 161 |
| 1994 | 3300059505 | Ga0587083_0031082 | Ga0587083_0031082_271_780 | 161 |
| 1995 | 3300059507 | Ga0587086_026272 | Ga0587086_026272_86_595 | 161 |
| 1996 | 3300059508 | Ga0587088_026264 | Ga0587088_026264_278_787 | 161 |
| 1997 | 3300059508 | Ga0587088_031222 | Ga0587088_031222_373_882 | 161 |
| 1998 | 3300059510 | Ga0587090_008592 | Ga0587090_008592_591_1100 | 161 |
| 1999 | 3300059510 | Ga0587090_020816 | Ga0587090_020816_75_584 | 161 |
| 2000 | 3300059511 | Ga0587091_047505 | Ga0587091_047505_278_787 | 161 |
| 2001 | 3300059511 | Ga0587091_127142 | Ga0587091_127142_123_608 | 161 |
| 2002 | 3300059513 | Ga0587094_027488 | Ga0587094_027488_272_781 | 161 |
| 2003 | 3300059604 | Ga0587098_019801 | Ga0587098_019801_85_594 | 161 |
| 2004 | 3300059605 | Ga0587106_029697 | Ga0587106_029697_101_610 | 161 |
| 2005 | 3300059623 | Ga0587101_017071 | Ga0587101_017071_275_784 | 161 |
| 2006 | 3300059624 | Ga0587109_050145 | Ga0587109_050145_85_594 | 161 |
| 2007 | 3300059624 | Ga0587109_142633 | Ga0587109_142633_25_510 | 161 |
| 2008 | 3300059626 | Ga0587115_015762 | Ga0587115_015762_353_862 | 161 |
| 2009 | 3300059628 | Ga0587122_009880 | Ga0587122_009880_111_620 | 161 |
| 2010 | 3300059630 | Ga0587128_013341 | Ga0587128_013341_638_1147 | 161 |
| 2011 | 3300059630 | Ga0587128_032618 | Ga0587128_032618_275_784 | 161 |
| 2012 | 3300059639 | Ga0587062_007581 | Ga0587062_007581_680_1189 | 161 |
| 2013 | 3300059639 | Ga0587062_031311 | Ga0587062_031311_226_735 | 161 |
| 2014 | 3300059640 | Ga0587067_033485 | Ga0587067_033485_330_839 | 161 |
| 2015 | 3300059640 | Ga0587067_038145 | Ga0587067_038145_12_521 | 161 |
| 2016 | 3300059641 | Ga0587068_012550 | Ga0587068_012550_511_1020 | 161 |
| 2017 | 3300059643 | Ga0587072_016120 | Ga0587072_016120_50_559 | 161 |
| 2018 | 3300059643 | Ga0587072_044876 | Ga0587072_044876_86_595 | 161 |
| 2019 | 3300059643 | Ga0587072_048542 | Ga0587072_048542_271_780 | 161 |
| 2020 | 3300059643 | Ga0587072_052449 | Ga0587072_052449_254_739 | 161 |
| 2021 | 3300059644 | Ga0587075_027659 | Ga0587075_027659_275_784 | 161 |
| 2022 | 3300059644 | Ga0587075_049075 | Ga0587075_049075_100_585 | 161 |
| 2023 | 3300059645 | Ga0587076_012829 | Ga0587076_012829_476_985 | 161 |
| 2024 | 3300059647 | Ga0587079_087446 | Ga0587079_087446_198_683 | 161 |
| 2025 | 3300059649 | Ga0587102_016744 | Ga0587102_016744_12_521 | 161 |
| 2026 | 3300059652 | Ga0587107_017107 | Ga0587107_017107_86_595 | 161 |
| 2027 | 3300059652 | Ga0587107_034344 | Ga0587107_034344_12_497 | 161 |
| 2028 | 3300059653 | Ga0587108_011115 | Ga0587108_011115_12_521 | 161 |
| 2029 | 3300059655 | Ga0587114_025361 | Ga0587114_025361_86_595 | 161 |
| 2030 | 3300060346 | Ga0587111_0052522 | Ga0587111_0052522_330_815 | 161 |
| 2031 | 3300060353 | Ga0501082_0034353 | Ga0501082_0034353_381_896 | 161 |
| 2032 | 3300060353 | Ga0501082_0088000 | Ga0501082_0088000_1419_1904 | 161 |
| 2033 | 3300060353 | Ga0501082_0786025 | Ga0501082_0786025_24_509 | 161 |
| 2034 | 3300060353 | Ga0501082_0896214 | Ga0501082_0896214_268_753 | 161 |
| 2035 | iso_pu_bacteria | 2512047086 | 2512534537 | 161 |
| 2036 | iso_pu_bacteria | 2838675328 | 2838678599 | 161 |
| 2037 | iso_pu_bacteria | 2838724970 | 2838728379 | 161 |
| 2038 | iso_pu_bacteria | 2842298080 | 2842302590 | 161 |
| 2039 | iso_pu_bacteria | 2842357229 | 2842358908 | 161 |
| 2040 | iso_pu_bacteria | 2842502639 | 2842507558 | 161 |
| 2041 | iso_pu_bacteria | 2842509118 | 2842514728 | 161 |
| 2042 | iso_pu_bacteria | 2850079185 | 2850082587 | 161 |
| 2043 | iso_pu_bacteria | 2899845264 | 2899849371 | 161 |
| 2044 | iso_pu_bacteria | 2919166419 | 2919170517 | 161 |
| 2045 | iso_pu_bacteria | 2929138655 | 2929141885 | 161 |
| 2046 | iso_pu_bacteria | 2937078374 | 2937081991 | 161 |
| 2047 | iso_pu_bacteria | 2958064165 | 2958066714 | 161 |
| 2048 | iso_pu_bacteria | 2977530762 | 2977535138 | 161 |
| 2049 | iso_pu_bacteria | 2978969890 | 2978972680 | 161 |
| 2050 | iso_pu_bacteria | 2979089926 | 2979092606 | 161 |
| 2051 | iso_pu_bacteria | 2979095461 | 2979100003 | 161 |
| 2052 | iso_pu_bacteria | 2984587000 | 2984590932 | 161 |
| 2053 | iso_pu_bacteria | 3005445848 | 3005449808 | 161 |
| 2054 | iso_pu_bacteria | 8005645114 | 8005645158 | 161 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3fvb-assembly1.cif.gz_A | crystal structure of ferritin (bacterioferritin) from brucella melitensis | 0.9916 | 2 | 159 |
| 5zur-assembly1.cif.gz_B | achromobacter dh1f bacterioferritin | 0.9912 | 1 | 155 |
| 8sqq-assembly1.cif.gz_A | crystal structure of bacterioferritin (bfr) from brucella abortus (apo cubic form 2, f16l mutant) | 0.991 | 2 | 159 |
| 3bkn-assembly1.cif.gz_A | the structure of mycobacterial bacterioferritin | 0.9898 | 1 | 155 |
| 2wtl-assembly1.cif.gz_A | crystal structure of bfra from m. tuberculosis | 0.9884 | 2 | 155 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3fvbA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9916 | 2 | 159 | 1.20.1260.10 |
| 5zurA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9912 | 1 | 153 | 1.20.1260.10 |
| 3gvyA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9883 | 1 | 157 | 1.20.1260.10 |
| 5xx9B00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9872 | 1 | 157 | 1.20.1260.10 |
| 3uoix00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9867 | 1 | 155 | 1.20.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1M3AFY0-F1-model_v4 | deleted | 1 | 1 | 141 |
|
| AF-A0A167GY78-F1-model_v4 | deleted | 0.9985 | 1 | 139 |
|
| AF-A0A258LLL3-F1-model_v4 | Bacterioferritin | 0.9979 | 1 | 133 |
GO:0004322
GO:0005829 GO:0006826 GO:0006880 GO:0008199 GO:0020037 |
| AF-A0A4R2CUK1-F1-model_v4 | Bacterioferritin (EC 1.16.3.1) | 0.996 | 1 | 156 |
GO:0004322
GO:0005829 GO:0006880 GO:0008199 GO:0015093 GO:0020037 |
| AF-A0A258DYD7-F1-model_v4 | Bacterioferritin | 0.9956 | 1 | 118 |
GO:0004322
GO:0005829 GO:0006826 GO:0006880 GO:0008199 GO:0020037 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar