F496159
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1965 | 484 | 3930 | 122 |
Family's Representative Sequence
| Representative Sequence | 3300041503|Ga0451847_0567380|Ga0451847_0567380_137_571 |
| Length | 144 |
| Sequence | VAAEMPGHSAVLDEEPDEPGSHGGVGVDLIEIARIRRALERYPAFRERCFTEAERAYCESRPNPAQHYAARFAGKEAVGKALGFGVARAFAWRDIEIAGRPKPSVRLSGRVAGWAERVGAGAIDLSMTHSRELANAVAVVDEER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 7 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 85 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 86 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 94 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 95 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 141 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 142 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 207 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 211 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 212 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 213 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 214 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 215 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 216 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 217 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 220 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 223 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 224 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 225 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 226 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 227 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 228 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 229 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 230 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 231 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 232 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 233 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 234 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 235 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 236 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 237 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 238 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 239 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 240 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 241 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 242 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 243 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 244 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 245 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 246 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 247 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 248 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 249 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 250 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 251 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 252 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 253 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 254 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 255 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 256 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 257 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 259 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 260 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 261 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 262 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 263 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 264 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 266 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 267 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 268 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 269 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 270 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 272 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 273 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 274 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 275 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 276 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 277 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 278 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 279 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 280 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 281 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 282 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 283 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 284 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 285 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 286 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 287 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 288 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 289 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 290 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 291 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 292 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 293 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 294 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 295 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 296 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 297 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 298 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 299 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 300 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 301 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 302 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 303 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 304 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 305 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 306 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 307 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 308 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 309 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 310 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 311 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 312 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 313 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 314 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 315 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 316 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 317 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 318 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 319 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 320 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 321 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 322 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 323 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 324 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 325 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 326 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 327 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 328 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 329 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 330 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 331 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 332 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 333 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 334 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 410 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 411 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 412 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 413 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 414 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 415 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 416 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 417 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 418 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 419 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 420 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 421 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 422 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 423 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 424 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 425 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 426 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 453 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 454 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 459 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 463 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 464 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 465 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 466 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 481 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 482 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 484 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.64 |
| Metatranscriptomes | 0.36 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.41 |
| Nodule | 0 |
| Rhizoplane | 10.03 |
| Rhizosphere | 89.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451847_0567380 | 3300041503 | Bacteria | 732 |
| 2 | JGI24737J22298_10226770 | 3300001990 | Bacteria | 551 |
| 3 | JGI24744J21845_10006394 | 3300002077 | Unclassified | 2445 |
| 4 | JGI24742J22300_10032619 | 3300002244 | Archaea | 913 |
| 5 | JGI25406J46586_10075207 | 3300003203 | Bacteria | 1048 |
| 6 | JGI25407J50210_10004039 | 3300003373 | Bacteria | 3561 |
| 7 | JGI25407J50210_10008409 | 3300003373 | Bacteria | 2601 |
| 8 | Ga0058862_12097182 | 3300004803 | Bacteria | 505 |
| 9 | Ga0070658_10017458 | 3300005327 | Bacteria | 5741 |
| 10 | Ga0070658_10599467 | 3300005327 | Unclassified | 955 |
| 11 | Ga0070676_10123021 | 3300005328 | Bacteria | 1631 |
| 12 | Ga0070676_11296682 | 3300005328 | Bacteria | 556 |
| 13 | Ga0070683_100097361 | 3300005329 | Bacteria | 2768 |
| 14 | Ga0070683_100142815 | 3300005329 | Bacteria | 2268 |
| 15 | Ga0070683_100559210 | 3300005329 | Unclassified | 1094 |
| 16 | Ga0070683_101235695 | 3300005329 | Unclassified | 718 |
| 17 | Ga0070690_100968183 | 3300005330 | Bacteria | 669 |
| 18 | Ga0070670_100233967 | 3300005331 | Bacteria | 1599 |
| 19 | Ga0068869_100066126 | 3300005334 | Bacteria | 2663 |
| 20 | Ga0068869_100088433 | 3300005334 | Bacteria | 2325 |
| 21 | Ga0068869_101174937 | 3300005334 | Bacteria | 674 |
| 22 | Ga0070666_10071585 | 3300005335 | Bacteria | 2360 |
| 23 | Ga0070680_100099227 | 3300005336 | Bacteria | 2416 |
| 24 | Ga0070680_100158195 | 3300005336 | Unclassified | 1903 |
| 25 | Ga0070680_100261476 | 3300005336 | Archaea | 1464 |
| 26 | Ga0070680_101160004 | 3300005336 | Bacteria | 668 |
| 27 | Ga0070682_100000724 | 3300005337 | Bacteria | 19777 |
| 28 | Ga0070682_100353853 | 3300005337 | Bacteria | 1096 |
| 29 | Ga0070682_100492699 | 3300005337 | Unclassified | 948 |
| 30 | Ga0070682_101793144 | 3300005337 | Bacteria | 535 |
| 31 | Ga0068868_100021473 | 3300005338 | Bacteria | 4861 |
| 32 | Ga0068868_100031465 | 3300005338 | Bacteria | 4076 |
| 33 | Ga0068868_100037051 | 3300005338 | Bacteria | 3779 |
| 34 | Ga0068868_100412417 | 3300005338 | Bacteria | 1168 |
| 35 | Ga0070660_100004795 | 3300005339 | Bacteria | 9351 |
| 36 | Ga0070660_100012584 | 3300005339 | Bacteria | 6043 |
| 37 | Ga0070660_100035695 | 3300005339 | Bacteria | 3764 |
| 38 | Ga0070660_100080555 | 3300005339 | Bacteria | 2555 |
| 39 | Ga0070660_100620462 | 3300005339 | Bacteria | 905 |
| 40 | Ga0070660_101032960 | 3300005339 | Bacteria | 695 |
| 41 | Ga0070689_100001164 | 3300005340 | Bacteria | 16615 |
| 42 | Ga0070691_10274266 | 3300005341 | Bacteria | 913 |
| 43 | Ga0070691_10841359 | 3300005341 | Unclassified | 562 |
| 44 | Ga0070687_100117055 | 3300005343 | Bacteria | 1518 |
| 45 | Ga0070692_10062692 | 3300005345 | Bacteria | 1962 |
| 46 | Ga0070692_10243144 | 3300005345 | Bacteria | 1074 |
| 47 | Ga0070692_10531806 | 3300005345 | Unclassified | 767 |
| 48 | Ga0070692_10569908 | 3300005345 | Bacteria | 745 |
| 49 | Ga0070668_100194587 | 3300005347 | Bacteria | 1662 |
| 50 | Ga0070668_100328762 | 3300005347 | Archaea | 1289 |
| 51 | Ga0070669_100592106 | 3300005353 | Unclassified | 928 |
| 52 | Ga0070675_100093736 | 3300005354 | Bacteria | 2518 |
| 53 | Ga0070675_100138855 | 3300005354 | Bacteria | 2076 |
| 54 | Ga0070675_100440446 | 3300005354 | Bacteria | 1167 |
| 55 | Ga0070671_100106400 | 3300005355 | Unclassified | 2355 |
| 56 | Ga0070674_100070769 | 3300005356 | Bacteria | 2465 |
| 57 | Ga0070674_100088494 | 3300005356 | Bacteria | 2229 |
| 58 | Ga0070674_100171053 | 3300005356 | Bacteria | 1656 |
| 59 | Ga0070674_100337666 | 3300005356 | Unclassified | 1213 |
| 60 | Ga0070674_100449858 | 3300005356 | Bacteria | 1063 |
| 61 | Ga0070674_100573692 | 3300005356 | Unclassified | 950 |
| 62 | Ga0070674_100645764 | 3300005356 | Bacteria | 899 |
| 63 | Ga0070673_100144366 | 3300005364 | Bacteria | 2011 |
| 64 | Ga0070688_100031102 | 3300005365 | Bacteria | 3209 |
| 65 | Ga0070688_100307199 | 3300005365 | Bacteria | 1148 |
| 66 | Ga0070688_100668004 | 3300005365 | Bacteria | 802 |
| 67 | Ga0070659_100003178 | 3300005366 | Bacteria | 11692 |
| 68 | Ga0070659_100402607 | 3300005366 | Archaea | 1155 |
| 69 | Ga0070659_100415626 | 3300005366 | Unclassified | 1137 |
| 70 | Ga0070659_101035686 | 3300005366 | Bacteria | 721 |
| 71 | Ga0070667_100094285 | 3300005367 | Unclassified | 2579 |
| 72 | Ga0070667_100458895 | 3300005367 | Bacteria | 1165 |
| 73 | Ga0070703_10016513 | 3300005406 | Bacteria | 2119 |
| 74 | Ga0070703_10108310 | 3300005406 | Archaea | 990 |
| 75 | Ga0070709_10063361 | 3300005434 | Bacteria | 2361 |
| 76 | Ga0070709_10235018 | 3300005434 | Bacteria | 1313 |
| 77 | Ga0070709_10335885 | 3300005434 | Bacteria | 1113 |
| 78 | Ga0070709_11099465 | 3300005434 | Bacteria | 636 |
| 79 | Ga0070709_11286633 | 3300005434 | Bacteria | 589 |
| 80 | Ga0070709_11583593 | 3300005434 | Bacteria | 533 |
| 81 | Ga0070714_100004641 | 3300005435 | Bacteria | 10368 |
| 82 | Ga0070714_100009404 | 3300005435 | Bacteria | 7685 |
| 83 | Ga0070714_100021468 | 3300005435 | Bacteria | 5283 |
| 84 | Ga0070714_100054262 | 3300005435 | Bacteria | 3423 |
| 85 | Ga0070714_100072186 | 3300005435 | Bacteria | 2987 |
| 86 | Ga0070714_100177175 | 3300005435 | Bacteria | 1938 |
| 87 | Ga0070714_100279502 | 3300005435 | Bacteria | 1550 |
| 88 | Ga0070714_100302028 | 3300005435 | Bacteria | 1492 |
| 89 | Ga0070714_100491228 | 3300005435 | Unclassified | 1170 |
| 90 | Ga0070714_101240172 | 3300005435 | Bacteria | 728 |
| 91 | Ga0070713_100112608 | 3300005436 | Bacteria | 2374 |
| 92 | Ga0070713_100175288 | 3300005436 | Bacteria | 1924 |
| 93 | Ga0070713_100674034 | 3300005436 | Bacteria | 986 |
| 94 | Ga0070713_100962494 | 3300005436 | Bacteria | 823 |
| 95 | Ga0070713_101057460 | 3300005436 | Bacteria | 784 |
| 96 | Ga0070713_101989177 | 3300005436 | Bacteria | 564 |
| 97 | Ga0070710_10077042 | 3300005437 | Bacteria | 1937 |
| 98 | Ga0070710_10097550 | 3300005437 | Unclassified | 1744 |
| 99 | Ga0070710_10314580 | 3300005437 | Bacteria | 1026 |
| 100 | Ga0070710_10506106 | 3300005437 | Unclassified | 827 |
| 101 | Ga0070701_10029400 | 3300005438 | Unclassified | 2710 |
| 102 | Ga0070701_10974226 | 3300005438 | Bacteria | 590 |
| 103 | Ga0070711_100005292 | 3300005439 | Bacteria | 7705 |
| 104 | Ga0070711_100335146 | 3300005439 | Bacteria | 1212 |
| 105 | Ga0070711_100347812 | 3300005439 | Unclassified | 1191 |
| 106 | Ga0070711_100479998 | 3300005439 | Bacteria | 1022 |
| 107 | Ga0070711_101344084 | 3300005439 | Bacteria | 621 |
| 108 | Ga0070705_100032809 | 3300005440 | Unclassified | 2888 |
| 109 | Ga0070705_100142209 | 3300005440 | Unclassified | 1580 |
| 110 | Ga0070705_100161336 | 3300005440 | Unclassified | 1499 |
| 111 | Ga0070705_100197641 | 3300005440 | Bacteria | 1376 |
| 112 | Ga0070705_100286981 | 3300005440 | Bacteria | 1173 |
| 113 | Ga0070705_100479506 | 3300005440 | Unclassified | 939 |
| 114 | Ga0070705_101675539 | 3300005440 | Bacteria | 537 |
| 115 | Ga0070700_100017962 | 3300005441 | Bacteria | 4057 |
| 116 | Ga0070700_100705534 | 3300005441 | Unclassified | 803 |
| 117 | Ga0070700_100856377 | 3300005441 | Bacteria | 736 |
| 118 | Ga0070694_100002541 | 3300005444 | Bacteria | 10773 |
| 119 | Ga0070694_100224112 | 3300005444 | Bacteria | 1411 |
| 120 | Ga0070694_100956813 | 3300005444 | Bacteria | 709 |
| 121 | Ga0070708_100059650 | 3300005445 | Bacteria | 3403 |
| 122 | Ga0070708_100144183 | 3300005445 | Bacteria | 2211 |
| 123 | Ga0070708_100514941 | 3300005445 | Bacteria | 1128 |
| 124 | Ga0070708_100854210 | 3300005445 | Bacteria | 855 |
| 125 | Ga0070663_100104925 | 3300005455 | Unclassified | 2115 |
| 126 | Ga0070663_100616716 | 3300005455 | Unclassified | 914 |
| 127 | Ga0070663_100816012 | 3300005455 | Bacteria | 801 |
| 128 | Ga0070663_101460446 | 3300005455 | Unclassified | 607 |
| 129 | Ga0070678_100016378 | 3300005456 | Bacteria | 4742 |
| 130 | Ga0070678_100098940 | 3300005456 | Bacteria | 2256 |
| 131 | Ga0070678_100225644 | 3300005456 | Bacteria | 1559 |
| 132 | Ga0070678_100299146 | 3300005456 | Bacteria | 1367 |
| 133 | Ga0070678_100323794 | 3300005456 | Bacteria | 1317 |
| 134 | Ga0070678_100401937 | 3300005456 | Bacteria | 1190 |
| 135 | Ga0070678_100853536 | 3300005456 | Bacteria | 830 |
| 136 | Ga0070678_101315656 | 3300005456 | Bacteria | 673 |
| 137 | Ga0070662_100120899 | 3300005457 | Bacteria | 2007 |
| 138 | Ga0070662_100417504 | 3300005457 | Bacteria | 1109 |
| 139 | Ga0070662_100453067 | 3300005457 | Bacteria | 1065 |
| 140 | Ga0070662_101276775 | 3300005457 | Bacteria | 632 |
| 141 | Ga0070681_10008425 | 3300005458 | Bacteria | 10099 |
| 142 | Ga0070681_10024213 | 3300005458 | Bacteria | 6112 |
| 143 | Ga0070681_10181531 | 3300005458 | Bacteria | 2026 |
| 144 | Ga0070681_11307142 | 3300005458 | Bacteria | 648 |
| 145 | Ga0070681_11950120 | 3300005458 | Bacteria | 515 |
| 146 | Ga0068867_100005114 | 3300005459 | Bacteria | 9268 |
| 147 | Ga0068867_100251077 | 3300005459 | Bacteria | 1438 |
| 148 | Ga0068867_100264654 | 3300005459 | Bacteria | 1403 |
| 149 | Ga0070685_10780219 | 3300005466 | Bacteria | 703 |
| 150 | Ga0070706_100019334 | 3300005467 | Bacteria | 6283 |
| 151 | Ga0070706_100039954 | 3300005467 | Bacteria | 4331 |
| 152 | Ga0070706_100063962 | 3300005467 | Bacteria | 3400 |
| 153 | Ga0070706_100245793 | 3300005467 | Bacteria | 1671 |
| 154 | Ga0070706_100644267 | 3300005467 | Bacteria | 984 |
| 155 | Ga0070706_100697149 | 3300005467 | Bacteria | 942 |
| 156 | Ga0070706_101014677 | 3300005467 | Bacteria | 765 |
| 157 | Ga0070707_100000876 | 3300005468 | Bacteria | 29832 |
| 158 | Ga0070707_100014709 | 3300005468 | Bacteria | 7335 |
| 159 | Ga0070707_100142740 | 3300005468 | Unclassified | 2330 |
| 160 | Ga0070707_100223602 | 3300005468 | Bacteria | 1833 |
| 161 | Ga0070707_100254843 | 3300005468 | Bacteria | 1708 |
| 162 | Ga0070707_100503632 | 3300005468 | Bacteria | 1173 |
| 163 | Ga0070707_100535984 | 3300005468 | Bacteria | 1133 |
| 164 | Ga0070707_101404098 | 3300005468 | Unclassified | 665 |
| 165 | Ga0070707_102170021 | 3300005468 | Bacteria | 523 |
| 166 | Ga0070698_100010606 | 3300005471 | Bacteria | 9816 |
| 167 | Ga0070698_100013685 | 3300005471 | Bacteria | 8589 |
| 168 | Ga0070698_100051873 | 3300005471 | Bacteria | 4176 |
| 169 | Ga0070698_100072239 | 3300005471 | Bacteria | 3459 |
| 170 | Ga0070698_100229314 | 3300005471 | Bacteria | 1790 |
| 171 | Ga0070698_100284728 | 3300005471 | Bacteria | 1584 |
| 172 | Ga0070698_100566529 | 3300005471 | Bacteria | 1076 |
| 173 | Ga0070698_100931958 | 3300005471 | Bacteria | 815 |
| 174 | Ga0070698_100990651 | 3300005471 | Bacteria | 788 |
| 175 | Ga0070698_100990800 | 3300005471 | Bacteria | 787 |
| 176 | Ga0070698_101419543 | 3300005471 | Unclassified | 645 |
| 177 | Ga0070698_102118226 | 3300005471 | Bacteria | 516 |
| 178 | Ga0070699_100010261 | 3300005518 | Bacteria | 8101 |
| 179 | Ga0070699_100047910 | 3300005518 | Bacteria | 3698 |
| 180 | Ga0070699_100158488 | 3300005518 | Bacteria | 2003 |
| 181 | Ga0070699_100265330 | 3300005518 | Bacteria | 1536 |
| 182 | Ga0070699_100363138 | 3300005518 | Bacteria | 1306 |
| 183 | Ga0070699_100598294 | 3300005518 | Bacteria | 1005 |
| 184 | Ga0070699_100823004 | 3300005518 | Bacteria | 850 |
| 185 | Ga0070699_101013289 | 3300005518 | Unclassified | 761 |
| 186 | Ga0070699_101723486 | 3300005518 | Unclassified | 574 |
| 187 | Ga0070679_100156727 | 3300005530 | Bacteria | 2252 |
| 188 | Ga0070679_100158088 | 3300005530 | Bacteria | 2241 |
| 189 | Ga0070679_100273022 | 3300005530 | Bacteria | 1644 |
| 190 | Ga0070679_100301997 | 3300005530 | Bacteria | 1551 |
| 191 | Ga0070679_100545873 | 3300005530 | Bacteria | 1103 |
| 192 | Ga0070684_100042465 | 3300005535 | Bacteria | 3925 |
| 193 | Ga0070697_100200450 | 3300005536 | Bacteria | 1696 |
| 194 | Ga0070697_101105278 | 3300005536 | Unclassified | 706 |
| 195 | Ga0070697_101636157 | 3300005536 | Unclassified | 576 |
| 196 | Ga0068853_102099934 | 3300005539 | Bacteria | 548 |
| 197 | Ga0070672_100051152 | 3300005543 | Bacteria | 3220 |
| 198 | Ga0070672_100110878 | 3300005543 | Bacteria | 2236 |
| 199 | Ga0070672_100297156 | 3300005543 | Bacteria | 1368 |
| 200 | Ga0070672_100455698 | 3300005543 | Unclassified | 1102 |
| 201 | Ga0070672_100772991 | 3300005543 | Bacteria | 844 |
| 202 | Ga0070686_100123364 | 3300005544 | Bacteria | 1782 |
| 203 | Ga0070686_100642333 | 3300005544 | Unclassified | 841 |
| 204 | Ga0070686_101179751 | 3300005544 | Unclassified | 635 |
| 205 | Ga0070695_100034587 | 3300005545 | Bacteria | 3169 |
| 206 | Ga0070695_100097243 | 3300005545 | Bacteria | 1977 |
| 207 | Ga0070695_100103679 | 3300005545 | Bacteria | 1919 |
| 208 | Ga0070695_100278029 | 3300005545 | Bacteria | 1229 |
| 209 | Ga0070695_100574641 | 3300005545 | Bacteria | 882 |
| 210 | Ga0070696_100008682 | 3300005546 | Bacteria | 6800 |
| 211 | Ga0070696_100012464 | 3300005546 | Bacteria | 5705 |
| 212 | Ga0070696_100450255 | 3300005546 | Bacteria | 1016 |
| 213 | Ga0070696_101026665 | 3300005546 | Bacteria | 690 |
| 214 | Ga0070696_101196695 | 3300005546 | Bacteria | 642 |
| 215 | Ga0070696_101765274 | 3300005546 | Unclassified | 534 |
| 216 | Ga0070693_100036720 | 3300005547 | Bacteria | 2726 |
| 217 | Ga0070693_100073851 | 3300005547 | Bacteria | 2016 |
| 218 | Ga0070693_100102540 | 3300005547 | Unclassified | 1745 |
| 219 | Ga0070693_100124315 | 3300005547 | Bacteria | 1604 |
| 220 | Ga0070693_100264590 | 3300005547 | Unclassified | 1145 |
| 221 | Ga0070693_100656928 | 3300005547 | Unclassified | 763 |
| 222 | Ga0070665_100211979 | 3300005548 | Bacteria | 1938 |
| 223 | Ga0070665_100527452 | 3300005548 | Bacteria | 1193 |
| 224 | Ga0070704_100007778 | 3300005549 | Bacteria | 6390 |
| 225 | Ga0070704_100286559 | 3300005549 | Bacteria | 1367 |
| 226 | Ga0070704_100384330 | 3300005549 | Bacteria | 1194 |
| 227 | Ga0070704_100490434 | 3300005549 | Bacteria | 1064 |
| 228 | Ga0070704_100618264 | 3300005549 | Bacteria | 954 |
| 229 | Ga0070704_101000668 | 3300005549 | Bacteria | 756 |
| 230 | Ga0068855_100011694 | 3300005563 | Bacteria | 10606 |
| 231 | Ga0068855_100026071 | 3300005563 | Bacteria | 6992 |
| 232 | Ga0068855_100054074 | 3300005563 | Bacteria | 4721 |
| 233 | Ga0068855_100076167 | 3300005563 | Bacteria | 3894 |
| 234 | Ga0068855_100095580 | 3300005563 | Bacteria | 3425 |
| 235 | Ga0068855_100745323 | 3300005563 | Bacteria | 1045 |
| 236 | Ga0070664_100999464 | 3300005564 | Unclassified | 786 |
| 237 | Ga0070664_101868090 | 3300005564 | Bacteria | 570 |
| 238 | Ga0068857_100012071 | 3300005577 | Bacteria | 7511 |
| 239 | Ga0068854_100263133 | 3300005578 | Unclassified | 1382 |
| 240 | Ga0068856_100002288 | 3300005614 | Bacteria | 19758 |
| 241 | Ga0068856_100006131 | 3300005614 | Bacteria | 11801 |
| 242 | Ga0068856_100213729 | 3300005614 | Unclassified | 1944 |
| 243 | Ga0068856_100724824 | 3300005614 | Unclassified | 1015 |
| 244 | Ga0068856_100990614 | 3300005614 | Bacteria | 859 |
| 245 | Ga0068856_101292017 | 3300005614 | Unclassified | 745 |
| 246 | Ga0070702_100045252 | 3300005615 | Bacteria | 2489 |
| 247 | Ga0070702_100047635 | 3300005615 | Unclassified | 2436 |
| 248 | Ga0070702_100051895 | 3300005615 | Bacteria | 2350 |
| 249 | Ga0070702_100569966 | 3300005615 | Unclassified | 844 |
| 250 | Ga0070702_100619599 | 3300005615 | Bacteria | 814 |
| 251 | Ga0068852_100186519 | 3300005616 | Unclassified | 1954 |
| 252 | Ga0068852_100398170 | 3300005616 | Unclassified | 1354 |
| 253 | Ga0068852_102326828 | 3300005616 | Bacteria | 557 |
| 254 | Ga0068859_100066787 | 3300005617 | Bacteria | 3632 |
| 255 | Ga0068859_100068771 | 3300005617 | Bacteria | 3576 |
| 256 | Ga0068859_101253902 | 3300005617 | Unclassified | 817 |
| 257 | Ga0068864_100281527 | 3300005618 | Bacteria | 1552 |
| 258 | Ga0068866_10296046 | 3300005718 | Bacteria | 1009 |
| 259 | Ga0068866_10355344 | 3300005718 | Unclassified | 932 |
| 260 | Ga0068861_100061062 | 3300005719 | Bacteria | 2891 |
| 261 | Ga0068861_100548529 | 3300005719 | Bacteria | 1053 |
| 262 | Ga0068861_101810463 | 3300005719 | Bacteria | 606 |
| 263 | Ga0068870_10036532 | 3300005840 | Bacteria | 2528 |
| 264 | Ga0068870_10930004 | 3300005840 | Bacteria | 616 |
| 265 | Ga0068863_102165100 | 3300005841 | Unclassified | 566 |
| 266 | Ga0068858_100167631 | 3300005842 | Bacteria | 2070 |
| 267 | Ga0068858_100216107 | 3300005842 | Unclassified | 1815 |
| 268 | Ga0068860_100054202 | 3300005843 | Bacteria | 3812 |
| 269 | Ga0068860_100892634 | 3300005843 | Bacteria | 905 |
| 270 | Ga0068862_100146178 | 3300005844 | Bacteria | 2101 |
| 271 | Ga0068862_101082901 | 3300005844 | Bacteria | 796 |
| 272 | Ga0068862_101156284 | 3300005844 | Bacteria | 771 |
| 273 | Ga0081455_10028173 | 3300005937 | Bacteria | 5135 |
| 274 | Ga0081455_10087699 | 3300005937 | Bacteria | 2531 |
| 275 | Ga0081455_10115946 | 3300005937 | Bacteria | 2119 |
| 276 | Ga0081455_10192003 | 3300005937 | Archaea | 1537 |
| 277 | Ga0081455_10243433 | 3300005937 | Bacteria | 1320 |
| 278 | Ga0081538_10000562 | 3300005981 | Bacteria | 41236 |
| 279 | Ga0081538_10000853 | 3300005981 | Bacteria | 32893 |
| 280 | Ga0081538_10001225 | 3300005981 | Bacteria | 26911 |
| 281 | Ga0081538_10007406 | 3300005981 | Bacteria | 9503 |
| 282 | Ga0081538_10010402 | 3300005981 | Bacteria | 7627 |
| 283 | Ga0081538_10019642 | 3300005981 | Bacteria | 5008 |
| 284 | Ga0081538_10054341 | 3300005981 | Bacteria | 2369 |
| 285 | Ga0081538_10083202 | 3300005981 | Bacteria | 1692 |
| 286 | Ga0081538_10234738 | 3300005981 | Archaea | 713 |
| 287 | Ga0081539_10003901 | 3300005985 | Bacteria | 17357 |
| 288 | Ga0081539_10015861 | 3300005985 | Bacteria | 5435 |
| 289 | Ga0081539_10051470 | 3300005985 | Unclassified | 2320 |
| 290 | Ga0081539_10086606 | 3300005985 | Bacteria | 1629 |
| 291 | Ga0070717_10025852 | 3300006028 | Bacteria | 4677 |
| 292 | Ga0070717_10202222 | 3300006028 | Bacteria | 1740 |
| 293 | Ga0070717_10626624 | 3300006028 | Bacteria | 976 |
| 294 | Ga0075365_10034867 | 3300006038 | Bacteria | 3253 |
| 295 | Ga0075365_10160485 | 3300006038 | Bacteria | 1566 |
| 296 | Ga0075432_10005707 | 3300006058 | Bacteria | 4237 |
| 297 | Ga0075432_10066592 | 3300006058 | Bacteria | 1289 |
| 298 | Ga0075432_10100204 | 3300006058 | Bacteria | 1070 |
| 299 | Ga0070715_10028985 | 3300006163 | Bacteria | 2226 |
| 300 | Ga0070716_100020975 | 3300006173 | Bacteria | 3437 |
| 301 | Ga0070716_100146645 | 3300006173 | Bacteria | 1512 |
| 302 | Ga0070716_100191536 | 3300006173 | Unclassified | 1352 |
| 303 | Ga0070716_100430722 | 3300006173 | Unclassified | 956 |
| 304 | Ga0070716_101147048 | 3300006173 | Bacteria | 622 |
| 305 | Ga0070712_100009723 | 3300006175 | Bacteria | 6061 |
| 306 | Ga0070712_100075379 | 3300006175 | Bacteria | 2426 |
| 307 | Ga0070712_100080069 | 3300006175 | Unclassified | 2363 |
| 308 | Ga0070712_100306712 | 3300006175 | Unclassified | 1286 |
| 309 | Ga0070712_100345656 | 3300006175 | Bacteria | 1216 |
| 310 | Ga0070712_100435608 | 3300006175 | Unclassified | 1089 |
| 311 | Ga0070712_101419925 | 3300006175 | Bacteria | 606 |
| 312 | Ga0075367_10832747 | 3300006178 | Unclassified | 588 |
| 313 | Ga0097621_100011800 | 3300006237 | Bacteria | 6453 |
| 314 | Ga0097621_100174180 | 3300006237 | Bacteria | 1856 |
| 315 | Ga0097621_100213561 | 3300006237 | Bacteria | 1679 |
| 316 | Ga0068871_100134410 | 3300006358 | Unclassified | 2100 |
| 317 | Ga0068871_100214794 | 3300006358 | Bacteria | 1665 |
| 318 | Ga0068871_100376888 | 3300006358 | Unclassified | 1260 |
| 319 | Ga0075428_100050603 | 3300006844 | Bacteria | 4556 |
| 320 | Ga0075428_100268792 | 3300006844 | Bacteria | 1835 |
| 321 | Ga0075428_100573004 | 3300006844 | Unclassified | 1206 |
| 322 | Ga0075428_101203178 | 3300006844 | Bacteria | 799 |
| 323 | Ga0075428_101983677 | 3300006844 | Bacteria | 603 |
| 324 | Ga0075430_100222135 | 3300006846 | Bacteria | 1567 |
| 325 | Ga0075430_100261228 | 3300006846 | Bacteria | 1434 |
| 326 | Ga0075430_101109700 | 3300006846 | Archaea | 651 |
| 327 | Ga0075431_100009745 | 3300006847 | Bacteria | 9647 |
| 328 | Ga0075431_100076028 | 3300006847 | Bacteria | 3465 |
| 329 | Ga0075431_100186447 | 3300006847 | Unclassified | 2127 |
| 330 | Ga0075433_10184272 | 3300006852 | Unclassified | 1857 |
| 331 | Ga0075433_10186541 | 3300006852 | Bacteria | 1845 |
| 332 | Ga0075433_10197241 | 3300006852 | Unclassified | 1790 |
| 333 | Ga0075433_10291887 | 3300006852 | Bacteria | 1444 |
| 334 | Ga0075433_10736973 | 3300006852 | Unclassified | 862 |
| 335 | Ga0075434_100052068 | 3300006871 | Bacteria | 4068 |
| 336 | Ga0075434_100052483 | 3300006871 | Bacteria | 4051 |
| 337 | Ga0075434_100094216 | 3300006871 | Bacteria | 2999 |
| 338 | Ga0075434_100160015 | 3300006871 | Bacteria | 2271 |
| 339 | Ga0075434_100207228 | 3300006871 | Bacteria | 1981 |
| 340 | Ga0075434_100231680 | 3300006871 | Bacteria | 1866 |
| 341 | Ga0075434_100280016 | 3300006871 | Unclassified | 1687 |
| 342 | Ga0075434_101509570 | 3300006871 | Unclassified | 681 |
| 343 | Ga0075434_101666872 | 3300006871 | Bacteria | 646 |
| 344 | Ga0075429_100006033 | 3300006880 | Bacteria | 10478 |
| 345 | Ga0075429_100194385 | 3300006880 | Unclassified | 1777 |
| 346 | Ga0075429_100407100 | 3300006880 | Unclassified | 1191 |
| 347 | Ga0068865_100001518 | 3300006881 | Bacteria | 13527 |
| 348 | Ga0068865_100149598 | 3300006881 | Bacteria | 1770 |
| 349 | Ga0068865_100364237 | 3300006881 | Bacteria | 1175 |
| 350 | Ga0068865_100513771 | 3300006881 | Bacteria | 1001 |
| 351 | Ga0068865_100754853 | 3300006881 | Bacteria | 836 |
| 352 | Ga0068865_101100865 | 3300006881 | Bacteria | 700 |
| 353 | Ga0068865_101586257 | 3300006881 | Bacteria | 588 |
| 354 | Ga0075436_100008310 | 3300006914 | Bacteria | 7100 |
| 355 | Ga0075436_100048885 | 3300006914 | Bacteria | 2918 |
| 356 | Ga0075436_100077952 | 3300006914 | Bacteria | 2295 |
| 357 | Ga0075436_100307289 | 3300006914 | Bacteria | 1137 |
| 358 | Ga0075436_100403334 | 3300006914 | Bacteria | 991 |
| 359 | Ga0075436_100734759 | 3300006914 | Unclassified | 732 |
| 360 | Ga0075436_101089983 | 3300006914 | Bacteria | 601 |
| 361 | Ga0097620_100066788 | 3300006931 | Bacteria | 3632 |
| 362 | Ga0097620_100068770 | 3300006931 | Bacteria | 3576 |
| 363 | Ga0097620_101253855 | 3300006931 | Unclassified | 817 |
| 364 | Ga0075435_100002001 | 3300007076 | Bacteria | 13341 |
| 365 | Ga0075435_100009053 | 3300007076 | Bacteria | 7182 |
| 366 | Ga0075435_100013824 | 3300007076 | Bacteria | 6018 |
| 367 | Ga0075435_100040550 | 3300007076 | Bacteria | 3719 |
| 368 | Ga0075435_100221331 | 3300007076 | Bacteria | 1607 |
| 369 | Ga0105250_10360533 | 3300009092 | Bacteria | 638 |
| 370 | Ga0105240_10013310 | 3300009093 | Bacteria | 11307 |
| 371 | Ga0105240_10432243 | 3300009093 | Bacteria | 1477 |
| 372 | Ga0105240_11971471 | 3300009093 | Unclassified | 607 |
| 373 | Ga0105240_12231899 | 3300009093 | Bacteria | 567 |
| 374 | Ga0111539_10029604 | 3300009094 | Bacteria | 6666 |
| 375 | Ga0111539_10228515 | 3300009094 | Unclassified | 2167 |
| 376 | Ga0111539_10374009 | 3300009094 | Bacteria | 1658 |
| 377 | Ga0111539_10758251 | 3300009094 | Unclassified | 1129 |
| 378 | Ga0111539_11043617 | 3300009094 | Unclassified | 950 |
| 379 | Ga0111539_11419980 | 3300009094 | Bacteria | 805 |
| 380 | Ga0111539_12335322 | 3300009094 | Unclassified | 620 |
| 381 | Ga0105245_10002378 | 3300009098 | Bacteria | 17012 |
| 382 | Ga0105245_10010538 | 3300009098 | Bacteria | 8043 |
| 383 | Ga0105245_10016039 | 3300009098 | Bacteria | 6527 |
| 384 | Ga0105245_10026837 | 3300009098 | Bacteria | 5071 |
| 385 | Ga0105245_10027993 | 3300009098 | Bacteria | 4968 |
| 386 | Ga0105245_10177381 | 3300009098 | Bacteria | 2033 |
| 387 | Ga0105245_10768795 | 3300009098 | Unclassified | 1000 |
| 388 | Ga0105245_11497091 | 3300009098 | Unclassified | 726 |
| 389 | Ga0105245_11984730 | 3300009098 | Bacteria | 635 |
| 390 | Ga0105245_12838075 | 3300009098 | Bacteria | 537 |
| 391 | Ga0105245_12933283 | 3300009098 | Bacteria | 529 |
| 392 | Ga0105247_10022659 | 3300009101 | Bacteria | 3783 |
| 393 | Ga0105247_10839932 | 3300009101 | Bacteria | 704 |
| 394 | Ga0105247_11229638 | 3300009101 | Bacteria | 598 |
| 395 | Ga0114129_10005388 | 3300009147 | Bacteria | 18059 |
| 396 | Ga0114129_10008675 | 3300009147 | Bacteria | 14490 |
| 397 | Ga0114129_10040341 | 3300009147 | Bacteria | 6581 |
| 398 | Ga0114129_10047239 | 3300009147 | Bacteria | 6050 |
| 399 | Ga0114129_10173819 | 3300009147 | Unclassified | 2935 |
| 400 | Ga0114129_10221020 | 3300009147 | Unclassified | 2555 |
| 401 | Ga0114129_10245304 | 3300009147 | Bacteria | 2407 |
| 402 | Ga0114129_10471642 | 3300009147 | Bacteria | 1643 |
| 403 | Ga0114129_11190216 | 3300009147 | Bacteria | 950 |
| 404 | Ga0114129_12997658 | 3300009147 | Unclassified | 555 |
| 405 | Ga0114129_13125366 | 3300009147 | Bacteria | 541 |
| 406 | Ga0105243_10027910 | 3300009148 | Bacteria | 4330 |
| 407 | Ga0105243_10052582 | 3300009148 | Bacteria | 3227 |
| 408 | Ga0105243_10106557 | 3300009148 | Bacteria | 2337 |
| 409 | Ga0105243_10240380 | 3300009148 | Bacteria | 1611 |
| 410 | Ga0105243_12753586 | 3300009148 | Unclassified | 532 |
| 411 | Ga0105241_10198782 | 3300009174 | Bacteria | 1673 |
| 412 | Ga0105241_10981413 | 3300009174 | Unclassified | 789 |
| 413 | Ga0105241_11458632 | 3300009174 | Bacteria | 657 |
| 414 | Ga0105242_10008443 | 3300009176 | Bacteria | 7914 |
| 415 | Ga0105242_10024840 | 3300009176 | Bacteria | 4736 |
| 416 | Ga0105242_10120030 | 3300009176 | Bacteria | 2254 |
| 417 | Ga0105242_10245765 | 3300009176 | Bacteria | 1610 |
| 418 | Ga0105242_10376029 | 3300009176 | Bacteria | 1319 |
| 419 | Ga0105242_10448917 | 3300009176 | Bacteria | 1215 |
| 420 | Ga0105242_12143359 | 3300009176 | Bacteria | 603 |
| 421 | Ga0105248_10008379 | 3300009177 | Bacteria | 11351 |
| 422 | Ga0105248_11017689 | 3300009177 | Bacteria | 936 |
| 423 | Ga0105248_12259279 | 3300009177 | Bacteria | 619 |
| 424 | Ga0105237_10520886 | 3300009545 | Unclassified | 1195 |
| 425 | Ga0105238_10006132 | 3300009551 | Bacteria | 11932 |
| 426 | Ga0105238_10392678 | 3300009551 | Unclassified | 1380 |
| 427 | Ga0105238_10716228 | 3300009551 | Bacteria | 1013 |
| 428 | Ga0105238_12575289 | 3300009551 | Bacteria | 545 |
| 429 | Ga0105249_10001066 | 3300009553 | Bacteria | 24325 |
| 430 | Ga0105249_10386296 | 3300009553 | Bacteria | 1427 |
| 431 | Ga0105249_10685121 | 3300009553 | Unclassified | 1084 |
| 432 | Ga0105249_12251100 | 3300009553 | Bacteria | 618 |
| 433 | Ga0105249_12326922 | 3300009553 | Unclassified | 608 |
| 434 | Ga0105249_12970872 | 3300009553 | Bacteria | 544 |
| 435 | Ga0105239_10006889 | 3300010375 | Bacteria | 13111 |
| 436 | Ga0105239_10022722 | 3300010375 | Bacteria | 6914 |
| 437 | Ga0105239_10234932 | 3300010375 | Bacteria | 2057 |
| 438 | Ga0105239_10453373 | 3300010375 | Unclassified | 1455 |
| 439 | Ga0105239_10651874 | 3300010375 | Unclassified | 1203 |
| 440 | Ga0105239_13027409 | 3300010375 | Bacteria | 548 |
| 441 | Ga0105246_10090198 | 3300011119 | Bacteria | 2207 |
| 442 | Ga0105246_10133644 | 3300011119 | Bacteria | 1856 |
| 443 | Ga0105246_10611534 | 3300011119 | Bacteria | 943 |
| 444 | Ga0157321_1022019 | 3300012487 | Unclassified | 592 |
| 445 | Ga0157373_10571147 | 3300013100 | Bacteria | 821 |
| 446 | Ga0157373_10790347 | 3300013100 | Bacteria | 699 |
| 447 | Ga0157371_10876157 | 3300013102 | Bacteria | 680 |
| 448 | Ga0157370_10008957 | 3300013104 | Bacteria | 10747 |
| 449 | Ga0157370_10011605 | 3300013104 | Bacteria | 9198 |
| 450 | Ga0157370_10021485 | 3300013104 | Bacteria | 6431 |
| 451 | Ga0157370_10581521 | 3300013104 | Unclassified | 1026 |
| 452 | Ga0157369_10002298 | 3300013105 | Bacteria | 22996 |
| 453 | Ga0157369_10018218 | 3300013105 | Bacteria | 7875 |
| 454 | Ga0157369_10369578 | 3300013105 | Bacteria | 1489 |
| 455 | Ga0157369_10664886 | 3300013105 | Bacteria | 1074 |
| 456 | Ga0157369_10732624 | 3300013105 | Bacteria | 1017 |
| 457 | Ga0157369_12050789 | 3300013105 | Bacteria | 580 |
| 458 | Ga0157374_10006816 | 3300013296 | Bacteria | 9718 |
| 459 | Ga0157374_11027978 | 3300013296 | Unclassified | 843 |
| 460 | Ga0157374_11366903 | 3300013296 | Bacteria | 731 |
| 461 | Ga0157378_10363346 | 3300013297 | Bacteria | 1417 |
| 462 | Ga0157378_10571851 | 3300013297 | Bacteria | 1138 |
| 463 | Ga0157378_11312841 | 3300013297 | Bacteria | 765 |
| 464 | Ga0163162_10007126 | 3300013306 | Bacteria | 10851 |
| 465 | Ga0163162_10068726 | 3300013306 | Bacteria | 3594 |
| 466 | Ga0157372_10062694 | 3300013307 | Bacteria | 4166 |
| 467 | Ga0157372_10511293 | 3300013307 | Bacteria | 1400 |
| 468 | Ga0157372_10895525 | 3300013307 | Bacteria | 1030 |
| 469 | Ga0157372_11627991 | 3300013307 | Bacteria | 743 |
| 470 | Ga0157372_11848106 | 3300013307 | Unclassified | 694 |
| 471 | Ga0157372_12543911 | 3300013307 | Bacteria | 588 |
| 472 | Ga0157375_10124007 | 3300013308 | Bacteria | 2696 |
| 473 | Ga0157375_10233570 | 3300013308 | Unclassified | 1998 |
| 474 | Ga0157375_10313664 | 3300013308 | Bacteria | 1732 |
| 475 | Ga0157375_10840723 | 3300013308 | Unclassified | 1065 |
| 476 | Ga0157375_10928123 | 3300013308 | Bacteria | 1013 |
| 477 | Ga0163163_10090122 | 3300014325 | Bacteria | 3080 |
| 478 | Ga0163163_10747369 | 3300014325 | Bacteria | 1041 |
| 479 | Ga0163163_11012849 | 3300014325 | Unclassified | 894 |
| 480 | Ga0163163_11037752 | 3300014325 | Bacteria | 883 |
| 481 | Ga0163163_11503159 | 3300014325 | Unclassified | 735 |
| 482 | Ga0157380_10064114 | 3300014326 | Bacteria | 2948 |
| 483 | Ga0157380_10240371 | 3300014326 | Bacteria | 1632 |
| 484 | Ga0157380_11036642 | 3300014326 | Bacteria | 856 |
| 485 | Ga0182008_10150105 | 3300014497 | Bacteria | 1169 |
| 486 | Ga0182008_10881057 | 3300014497 | Bacteria | 525 |
| 487 | Ga0157377_10008690 | 3300014745 | Bacteria | 4961 |
| 488 | Ga0157377_10025409 | 3300014745 | Bacteria | 3159 |
| 489 | Ga0157377_11084471 | 3300014745 | Bacteria | 612 |
| 490 | Ga0157379_10245504 | 3300014968 | Bacteria | 1624 |
| 491 | Ga0157379_10749500 | 3300014968 | Bacteria | 919 |
| 492 | Ga0157379_10812705 | 3300014968 | Bacteria | 883 |
| 493 | Ga0157379_10889147 | 3300014968 | Unclassified | 844 |
| 494 | Ga0157376_10025044 | 3300014969 | Bacteria | 4695 |
| 495 | Ga0157376_10097436 | 3300014969 | Unclassified | 2562 |
| 496 | Ga0157376_10408014 | 3300014969 | Bacteria | 1315 |
| 497 | Ga0157376_10882916 | 3300014969 | Bacteria | 911 |
| 498 | Ga0157376_10911999 | 3300014969 | Bacteria | 897 |
| 499 | Ga0157376_12012877 | 3300014969 | Unclassified | 615 |
| 500 | Ga0182007_10351269 | 3300015262 | Bacteria | 554 |
| 501 | Ga0182005_1307918 | 3300015265 | Unclassified | 501 |
| 502 | Ga0163161_10485117 | 3300017792 | Bacteria | 1004 |
| 503 | Ga0163161_11300143 | 3300017792 | Bacteria | 632 |
| 504 | Ga0197907_10065360 | 3300020069 | Bacteria | 1884 |
| 505 | Ga0206356_11236435 | 3300020070 | Bacteria | 2417 |
| 506 | Ga0206354_11509267 | 3300020081 | Bacteria | 5110 |
| 507 | Ga0206353_10968799 | 3300020082 | Bacteria | 1059 |
| 508 | Ga0206353_11480980 | 3300020082 | Bacteria | 637 |
| 509 | Ga0206353_12016091 | 3300020082 | Bacteria | 3625 |
| 510 | Ga0213873_10195572 | 3300021358 | Bacteria | 626 |
| 511 | Ga0213871_10015656 | 3300021441 | Bacteria | 1816 |
| 512 | Ga0207653_10001347 | 3300025885 | Bacteria | 7986 |
| 513 | Ga0207692_10186608 | 3300025898 | Unclassified | 1211 |
| 514 | Ga0207692_10237492 | 3300025898 | Bacteria | 1087 |
| 515 | Ga0207692_10292174 | 3300025898 | Unclassified | 989 |
| 516 | Ga0207692_10307069 | 3300025898 | Bacteria | 967 |
| 517 | Ga0207642_10003349 | 3300025899 | Bacteria | 5047 |
| 518 | Ga0207688_10210317 | 3300025901 | Unclassified | 1168 |
| 519 | Ga0207688_10212351 | 3300025901 | Bacteria | 1163 |
| 520 | Ga0207688_10401861 | 3300025901 | Bacteria | 850 |
| 521 | Ga0207647_10075870 | 3300025904 | Unclassified | 2023 |
| 522 | Ga0207685_10007078 | 3300025905 | Bacteria | 3103 |
| 523 | Ga0207685_10438335 | 3300025905 | Unclassified | 677 |
| 524 | Ga0207699_10040087 | 3300025906 | Unclassified | 2696 |
| 525 | Ga0207699_10065044 | 3300025906 | Bacteria | 2209 |
| 526 | Ga0207699_10074517 | 3300025906 | Bacteria | 2085 |
| 527 | Ga0207699_10486038 | 3300025906 | Archaea | 890 |
| 528 | Ga0207699_10530288 | 3300025906 | Bacteria | 852 |
| 529 | Ga0207699_10750668 | 3300025906 | Bacteria | 716 |
| 530 | Ga0207699_10863588 | 3300025906 | Bacteria | 667 |
| 531 | Ga0207645_10219858 | 3300025907 | Unclassified | 1252 |
| 532 | Ga0207645_10698301 | 3300025907 | Bacteria | 690 |
| 533 | Ga0207643_10416065 | 3300025908 | Bacteria | 852 |
| 534 | Ga0207643_10756380 | 3300025908 | Bacteria | 629 |
| 535 | Ga0207705_10085132 | 3300025909 | Unclassified | 2309 |
| 536 | Ga0207705_10177943 | 3300025909 | Bacteria | 1604 |
| 537 | Ga0207705_10248385 | 3300025909 | Bacteria | 1357 |
| 538 | Ga0207684_10050496 | 3300025910 | Bacteria | 3528 |
| 539 | Ga0207684_10140613 | 3300025910 | Bacteria | 2075 |
| 540 | Ga0207684_10357755 | 3300025910 | Bacteria | 1256 |
| 541 | Ga0207684_10415672 | 3300025910 | Bacteria | 1156 |
| 542 | Ga0207684_10551359 | 3300025910 | Bacteria | 986 |
| 543 | Ga0207654_10331074 | 3300025911 | Bacteria | 1044 |
| 544 | Ga0207654_10385247 | 3300025911 | Bacteria | 972 |
| 545 | Ga0207707_10001299 | 3300025912 | Bacteria | 23250 |
| 546 | Ga0207707_10079600 | 3300025912 | Bacteria | 2861 |
| 547 | Ga0207707_10341760 | 3300025912 | Unclassified | 1290 |
| 548 | Ga0207707_10861068 | 3300025912 | Bacteria | 751 |
| 549 | Ga0207695_10114961 | 3300025913 | Unclassified | 2666 |
| 550 | Ga0207695_10931034 | 3300025913 | Bacteria | 748 |
| 551 | Ga0207695_11476554 | 3300025913 | Bacteria | 560 |
| 552 | Ga0207671_10356252 | 3300025914 | Unclassified | 1161 |
| 553 | Ga0207693_10000183 | 3300025915 | Bacteria | 57157 |
| 554 | Ga0207693_10000543 | 3300025915 | Bacteria | 34121 |
| 555 | Ga0207693_10004718 | 3300025915 | Bacteria | 11466 |
| 556 | Ga0207693_10118547 | 3300025915 | Bacteria | 2078 |
| 557 | Ga0207693_10263454 | 3300025915 | Bacteria | 1351 |
| 558 | Ga0207693_10389104 | 3300025915 | Unclassified | 1090 |
| 559 | Ga0207693_11031568 | 3300025915 | Bacteria | 627 |
| 560 | Ga0207693_11031591 | 3300025915 | Bacteria | 627 |
| 561 | Ga0207663_10022230 | 3300025916 | Bacteria | 3623 |
| 562 | Ga0207663_10439320 | 3300025916 | Bacteria | 1005 |
| 563 | Ga0207663_10495530 | 3300025916 | Bacteria | 948 |
| 564 | Ga0207663_10774029 | 3300025916 | Unclassified | 763 |
| 565 | Ga0207663_11461776 | 3300025916 | Bacteria | 550 |
| 566 | Ga0207663_11611665 | 3300025916 | Bacteria | 522 |
| 567 | Ga0207660_10201701 | 3300025917 | Archaea | 1554 |
| 568 | Ga0207660_10554816 | 3300025917 | Bacteria | 934 |
| 569 | Ga0207660_11255522 | 3300025917 | Bacteria | 602 |
| 570 | Ga0207662_10382893 | 3300025918 | Bacteria | 951 |
| 571 | Ga0207657_10003624 | 3300025919 | Bacteria | 16448 |
| 572 | Ga0207657_10012052 | 3300025919 | Bacteria | 8551 |
| 573 | Ga0207657_10012634 | 3300025919 | Bacteria | 8323 |
| 574 | Ga0207657_10071676 | 3300025919 | Unclassified | 2933 |
| 575 | Ga0207657_10385561 | 3300025919 | Bacteria | 1103 |
| 576 | Ga0207657_10542382 | 3300025919 | Bacteria | 910 |
| 577 | Ga0207657_10755239 | 3300025919 | Bacteria | 753 |
| 578 | Ga0207649_10545013 | 3300025920 | Bacteria | 887 |
| 579 | Ga0207652_10021367 | 3300025921 | Bacteria | 5343 |
| 580 | Ga0207652_10185066 | 3300025921 | Bacteria | 1873 |
| 581 | Ga0207652_10303651 | 3300025921 | Bacteria | 1441 |
| 582 | Ga0207652_10437217 | 3300025921 | Bacteria | 1180 |
| 583 | Ga0207652_10530816 | 3300025921 | Bacteria | 1058 |
| 584 | Ga0207646_10025319 | 3300025922 | Bacteria | 5429 |
| 585 | Ga0207646_10052541 | 3300025922 | Bacteria | 3646 |
| 586 | Ga0207646_10390990 | 3300025922 | Bacteria | 1256 |
| 587 | Ga0207646_10507311 | 3300025922 | Bacteria | 1086 |
| 588 | Ga0207646_11326255 | 3300025922 | Bacteria | 628 |
| 589 | Ga0207646_11442757 | 3300025922 | Bacteria | 597 |
| 590 | Ga0207681_10423505 | 3300025923 | Unclassified | 1079 |
| 591 | Ga0207694_10499456 | 3300025924 | Unclassified | 1018 |
| 592 | Ga0207659_10092558 | 3300025926 | Bacteria | 2261 |
| 593 | Ga0207659_10186154 | 3300025926 | Unclassified | 1649 |
| 594 | Ga0207659_10868070 | 3300025926 | Bacteria | 776 |
| 595 | Ga0207687_10008291 | 3300025927 | Bacteria | 6797 |
| 596 | Ga0207687_10010129 | 3300025927 | Bacteria | 6164 |
| 597 | Ga0207687_10020256 | 3300025927 | Bacteria | 4412 |
| 598 | Ga0207687_10026619 | 3300025927 | Bacteria | 3873 |
| 599 | Ga0207687_10048987 | 3300025927 | Bacteria | 2936 |
| 600 | Ga0207687_10146343 | 3300025927 | Unclassified | 1798 |
| 601 | Ga0207687_10462302 | 3300025927 | Bacteria | 1054 |
| 602 | Ga0207687_10930344 | 3300025927 | Unclassified | 744 |
| 603 | Ga0207700_10040505 | 3300025928 | Bacteria | 3401 |
| 604 | Ga0207700_10159450 | 3300025928 | Bacteria | 1872 |
| 605 | Ga0207700_10403419 | 3300025928 | Bacteria | 1198 |
| 606 | Ga0207700_10409502 | 3300025928 | Archaea | 1189 |
| 607 | Ga0207700_10475041 | 3300025928 | Bacteria | 1104 |
| 608 | Ga0207700_10857433 | 3300025928 | Unclassified | 813 |
| 609 | Ga0207700_10943279 | 3300025928 | Unclassified | 772 |
| 610 | Ga0207700_11153775 | 3300025928 | Bacteria | 692 |
| 611 | Ga0207700_11156866 | 3300025928 | Bacteria | 691 |
| 612 | Ga0207664_10055197 | 3300025929 | Bacteria | 3152 |
| 613 | Ga0207664_10072260 | 3300025929 | Bacteria | 2781 |
| 614 | Ga0207664_10073052 | 3300025929 | Bacteria | 2767 |
| 615 | Ga0207664_10074962 | 3300025929 | Bacteria | 2735 |
| 616 | Ga0207664_10111135 | 3300025929 | Bacteria | 2280 |
| 617 | Ga0207664_10115264 | 3300025929 | Bacteria | 2240 |
| 618 | Ga0207664_10121549 | 3300025929 | Bacteria | 2186 |
| 619 | Ga0207664_10269823 | 3300025929 | Bacteria | 1490 |
| 620 | Ga0207664_11004510 | 3300025929 | Bacteria | 748 |
| 621 | Ga0207644_10168324 | 3300025931 | Unclassified | 1709 |
| 622 | Ga0207644_10994542 | 3300025931 | Unclassified | 704 |
| 623 | Ga0207690_10014593 | 3300025932 | Bacteria | 4745 |
| 624 | Ga0207690_10038686 | 3300025932 | Bacteria | 3106 |
| 625 | Ga0207690_10144533 | 3300025932 | Bacteria | 1757 |
| 626 | Ga0207706_10094006 | 3300025933 | Bacteria | 2637 |
| 627 | Ga0207706_10171296 | 3300025933 | Unclassified | 1907 |
| 628 | Ga0207706_10222488 | 3300025933 | Bacteria | 1652 |
| 629 | Ga0207706_10439565 | 3300025933 | Bacteria | 1129 |
| 630 | Ga0207706_10578108 | 3300025933 | Bacteria | 966 |
| 631 | Ga0207706_10751561 | 3300025933 | Bacteria | 831 |
| 632 | Ga0207706_11424707 | 3300025933 | Unclassified | 568 |
| 633 | Ga0207686_10006015 | 3300025934 | Bacteria | 6513 |
| 634 | Ga0207686_10326493 | 3300025934 | Bacteria | 1148 |
| 635 | Ga0207686_10394458 | 3300025934 | Bacteria | 1052 |
| 636 | Ga0207686_10572299 | 3300025934 | Bacteria | 886 |
| 637 | Ga0207686_10977724 | 3300025934 | Bacteria | 686 |
| 638 | Ga0207686_11635864 | 3300025934 | Bacteria | 532 |
| 639 | Ga0207709_10027389 | 3300025935 | Bacteria | 3283 |
| 640 | Ga0207709_10074810 | 3300025935 | Bacteria | 2163 |
| 641 | Ga0207709_10967028 | 3300025935 | Unclassified | 695 |
| 642 | Ga0207709_11831278 | 3300025935 | Unclassified | 505 |
| 643 | Ga0207669_10017540 | 3300025937 | Bacteria | 3676 |
| 644 | Ga0207669_10113132 | 3300025937 | Unclassified | 1824 |
| 645 | Ga0207669_10159444 | 3300025937 | Bacteria | 1591 |
| 646 | Ga0207669_10559199 | 3300025937 | Bacteria | 924 |
| 647 | Ga0207669_10865386 | 3300025937 | Bacteria | 753 |
| 648 | Ga0207669_11575028 | 3300025937 | Bacteria | 561 |
| 649 | Ga0207704_10006979 | 3300025938 | Bacteria | 5303 |
| 650 | Ga0207704_10399170 | 3300025938 | Bacteria | 1084 |
| 651 | Ga0207704_10493587 | 3300025938 | Bacteria | 985 |
| 652 | Ga0207704_11004425 | 3300025938 | Bacteria | 706 |
| 653 | Ga0207704_11235625 | 3300025938 | Bacteria | 638 |
| 654 | Ga0207665_10024756 | 3300025939 | Bacteria | 3959 |
| 655 | Ga0207665_10128324 | 3300025939 | Bacteria | 1797 |
| 656 | Ga0207665_10237511 | 3300025939 | Unclassified | 1342 |
| 657 | Ga0207665_10377125 | 3300025939 | Bacteria | 1076 |
| 658 | Ga0207665_10542206 | 3300025939 | Bacteria | 903 |
| 659 | Ga0207665_10708851 | 3300025939 | Bacteria | 791 |
| 660 | Ga0207691_10002533 | 3300025940 | Bacteria | 17854 |
| 661 | Ga0207691_10085597 | 3300025940 | Bacteria | 2829 |
| 662 | Ga0207691_10505621 | 3300025940 | Unclassified | 1026 |
| 663 | Ga0207691_10784277 | 3300025940 | Bacteria | 801 |
| 664 | Ga0207711_10543310 | 3300025941 | Bacteria | 1084 |
| 665 | Ga0207711_10578692 | 3300025941 | Archaea | 1047 |
| 666 | Ga0207689_10062101 | 3300025942 | Bacteria | 3072 |
| 667 | Ga0207689_10068349 | 3300025942 | Bacteria | 2920 |
| 668 | Ga0207689_11686307 | 3300025942 | Unclassified | 525 |
| 669 | Ga0207661_10373742 | 3300025944 | Bacteria | 1289 |
| 670 | Ga0207661_10406482 | 3300025944 | Bacteria | 1235 |
| 671 | Ga0207661_10857491 | 3300025944 | Bacteria | 836 |
| 672 | Ga0207661_11506895 | 3300025944 | Bacteria | 616 |
| 673 | Ga0207679_11658692 | 3300025945 | Bacteria | 585 |
| 674 | Ga0207667_10010035 | 3300025949 | Bacteria | 11102 |
| 675 | Ga0207667_10035781 | 3300025949 | Bacteria | 5326 |
| 676 | Ga0207667_10081555 | 3300025949 | Bacteria | 3351 |
| 677 | Ga0207667_10089933 | 3300025949 | Bacteria | 3172 |
| 678 | Ga0207667_10237570 | 3300025949 | Unclassified | 1865 |
| 679 | Ga0207667_10261152 | 3300025949 | Unclassified | 1771 |
| 680 | Ga0207667_10350547 | 3300025949 | Bacteria | 1505 |
| 681 | Ga0207667_10485782 | 3300025949 | Unclassified | 1253 |
| 682 | Ga0207667_10987400 | 3300025949 | Unclassified | 830 |
| 683 | Ga0207667_11244043 | 3300025949 | Bacteria | 722 |
| 684 | Ga0207651_10279360 | 3300025960 | Bacteria | 1379 |
| 685 | Ga0207651_10918973 | 3300025960 | Bacteria | 780 |
| 686 | Ga0207651_11699104 | 3300025960 | Bacteria | 568 |
| 687 | Ga0207712_10046737 | 3300025961 | Bacteria | 3002 |
| 688 | Ga0207712_10084523 | 3300025961 | Bacteria | 2319 |
| 689 | Ga0207712_10169992 | 3300025961 | Unclassified | 1703 |
| 690 | Ga0207712_11491705 | 3300025961 | Bacteria | 606 |
| 691 | Ga0207668_10078854 | 3300025972 | Bacteria | 2380 |
| 692 | Ga0207668_10393280 | 3300025972 | Unclassified | 1170 |
| 693 | Ga0207668_10501072 | 3300025972 | Bacteria | 1045 |
| 694 | Ga0207668_11460826 | 3300025972 | Bacteria | 617 |
| 695 | Ga0207640_10170221 | 3300025981 | Unclassified | 1622 |
| 696 | Ga0207640_10208501 | 3300025981 | Bacteria | 1487 |
| 697 | Ga0207640_10219622 | 3300025981 | Bacteria | 1454 |
| 698 | Ga0207640_10517574 | 3300025981 | Bacteria | 996 |
| 699 | Ga0207658_10195007 | 3300025986 | Bacteria | 1687 |
| 700 | Ga0207677_10009894 | 3300026023 | Bacteria | 5376 |
| 701 | Ga0207677_10089729 | 3300026023 | Bacteria | 2232 |
| 702 | Ga0207677_10096958 | 3300026023 | Bacteria | 2159 |
| 703 | Ga0207703_10047912 | 3300026035 | Bacteria | 3447 |
| 704 | Ga0207639_11015348 | 3300026041 | Bacteria | 777 |
| 705 | Ga0207678_10025112 | 3300026067 | Bacteria | 5203 |
| 706 | Ga0207678_10069443 | 3300026067 | Bacteria | 3021 |
| 707 | Ga0207708_10000064 | 3300026075 | Bacteria | 85366 |
| 708 | Ga0207708_10017082 | 3300026075 | Bacteria | 5461 |
| 709 | Ga0207708_10077448 | 3300026075 | Bacteria | 2552 |
| 710 | Ga0207708_10436636 | 3300026075 | Unclassified | 1088 |
| 711 | Ga0207708_10701388 | 3300026075 | Bacteria | 865 |
| 712 | Ga0207708_10729420 | 3300026075 | Bacteria | 849 |
| 713 | Ga0207708_10875708 | 3300026075 | Bacteria | 776 |
| 714 | Ga0207702_10006561 | 3300026078 | Bacteria | 10009 |
| 715 | Ga0207702_10058251 | 3300026078 | Bacteria | 3287 |
| 716 | Ga0207702_10374513 | 3300026078 | Bacteria | 1368 |
| 717 | Ga0207702_10773139 | 3300026078 | Bacteria | 949 |
| 718 | Ga0207702_11145600 | 3300026078 | Unclassified | 772 |
| 719 | Ga0207702_11215883 | 3300026078 | Bacteria | 748 |
| 720 | Ga0207641_11092359 | 3300026088 | Bacteria | 796 |
| 721 | Ga0207641_11819067 | 3300026088 | Unclassified | 611 |
| 722 | Ga0207648_10005420 | 3300026089 | Bacteria | 12856 |
| 723 | Ga0207648_10024380 | 3300026089 | Bacteria | 5400 |
| 724 | Ga0207648_10105969 | 3300026089 | Bacteria | 2466 |
| 725 | Ga0207648_10180099 | 3300026089 | Bacteria | 1870 |
| 726 | Ga0207676_11403462 | 3300026095 | Bacteria | 694 |
| 727 | Ga0207674_10001429 | 3300026116 | Bacteria | 30846 |
| 728 | Ga0207675_100020980 | 3300026118 | Bacteria | 6091 |
| 729 | Ga0207675_100579607 | 3300026118 | Bacteria | 1123 |
| 730 | Ga0207675_100700350 | 3300026118 | Bacteria | 1022 |
| 731 | Ga0207675_100712749 | 3300026118 | Bacteria | 1013 |
| 732 | Ga0207683_10017237 | 3300026121 | Bacteria | 6151 |
| 733 | Ga0207683_10028633 | 3300026121 | Bacteria | 4818 |
| 734 | Ga0207683_10069241 | 3300026121 | Bacteria | 3116 |
| 735 | Ga0207683_10085967 | 3300026121 | Bacteria | 2796 |
| 736 | Ga0207683_10253638 | 3300026121 | Bacteria | 1606 |
| 737 | Ga0207683_10422387 | 3300026121 | Bacteria | 1228 |
| 738 | Ga0207683_10684889 | 3300026121 | Bacteria | 950 |
| 739 | Ga0207683_10685419 | 3300026121 | Bacteria | 950 |
| 740 | Ga0207683_11447543 | 3300026121 | Bacteria | 635 |
| 741 | Ga0207698_10097584 | 3300026142 | Bacteria | 2425 |
| 742 | Ga0207698_10362749 | 3300026142 | Unclassified | 1373 |
| 743 | Ga0207698_11217106 | 3300026142 | Bacteria | 767 |
| 744 | Ga0207698_11298181 | 3300026142 | Bacteria | 742 |
| 745 | Ga0209966_1020796 | 3300027695 | Bacteria | 1274 |
| 746 | Ga0209966_1025320 | 3300027695 | Bacteria | 1177 |
| 747 | Ga0209998_10048638 | 3300027717 | Bacteria | 977 |
| 748 | Ga0209974_10131539 | 3300027876 | Bacteria | 893 |
| 749 | Ga0207428_10033357 | 3300027907 | Bacteria | 4229 |
| 750 | Ga0207428_10186739 | 3300027907 | Bacteria | 1564 |
| 751 | Ga0207428_10837891 | 3300027907 | Bacteria | 652 |
| 752 | Ga0207428_10839898 | 3300027907 | Unclassified | 651 |
| 753 | Ga0207428_11143834 | 3300027907 | Bacteria | 543 |
| 754 | Ga0268266_10171787 | 3300028379 | Bacteria | 1968 |
| 755 | Ga0268265_10053613 | 3300028380 | Bacteria | 3056 |
| 756 | Ga0268265_10643562 | 3300028380 | Bacteria | 1018 |
| 757 | Ga0268265_12615626 | 3300028380 | Bacteria | 510 |
| 758 | Ga0268264_10087916 | 3300028381 | Bacteria | 2673 |
| 759 | Ga0268264_11740478 | 3300028381 | Bacteria | 634 |
| 760 | Ga0265337_1032915 | 3300028556 | Bacteria | 1532 |
| 761 | Ga0265337_1034853 | 3300028556 | Bacteria | 1477 |
| 762 | Ga0265337_1056877 | 3300028556 | Bacteria | 1090 |
| 763 | Ga0265326_10018324 | 3300028558 | Unclassified | 2016 |
| 764 | Ga0265326_10049685 | 3300028558 | Bacteria | 1188 |
| 765 | Ga0265319_1004602 | 3300028563 | Bacteria | 6787 |
| 766 | Ga0265319_1015323 | 3300028563 | Bacteria | 2977 |
| 767 | Ga0265319_1020214 | 3300028563 | Bacteria | 2473 |
| 768 | Ga0265334_10035955 | 3300028573 | Bacteria | 1957 |
| 769 | Ga0265334_10110953 | 3300028573 | Bacteria | 986 |
| 770 | Ga0265318_10010540 | 3300028577 | Bacteria | 4019 |
| 771 | Ga0265318_10016917 | 3300028577 | Bacteria | 3003 |
| 772 | Ga0265318_10023732 | 3300028577 | Unclassified | 2441 |
| 773 | Ga0265318_10046336 | 3300028577 | Unclassified | 1641 |
| 774 | Ga0265323_10086001 | 3300028653 | Unclassified | 1057 |
| 775 | Ga0265323_10278201 | 3300028653 | Bacteria | 519 |
| 776 | Ga0265322_10034519 | 3300028654 | Bacteria | 1441 |
| 777 | Ga0265322_10121619 | 3300028654 | Unclassified | 743 |
| 778 | Ga0265336_10025979 | 3300028666 | Bacteria | 1842 |
| 779 | Ga0265336_10177978 | 3300028666 | Bacteria | 633 |
| 780 | Ga0265338_10002399 | 3300028800 | Bacteria | 28183 |
| 781 | Ga0265338_10017798 | 3300028800 | Bacteria | 7640 |
| 782 | Ga0265338_10053386 | 3300028800 | Bacteria | 3616 |
| 783 | Ga0265338_10067363 | 3300028800 | Bacteria | 3092 |
| 784 | Ga0265338_10072949 | 3300028800 | Bacteria | 2928 |
| 785 | Ga0265338_10389296 | 3300028800 | Unclassified | 995 |
| 786 | Ga0265338_10391792 | 3300028800 | Bacteria | 992 |
| 787 | Ga0265338_10686886 | 3300028800 | Bacteria | 707 |
| 788 | Ga0265324_10077670 | 3300029957 | Bacteria | 1129 |
| 789 | Ga0265330_10026164 | 3300031235 | Bacteria | 2641 |
| 790 | Ga0265330_10284256 | 3300031235 | Bacteria | 697 |
| 791 | Ga0265330_10385019 | 3300031235 | Unclassified | 593 |
| 792 | Ga0265332_10085953 | 3300031238 | Bacteria | 1332 |
| 793 | Ga0265328_10002801 | 3300031239 | Bacteria | 7804 |
| 794 | Ga0265320_10073146 | 3300031240 | Bacteria | 1611 |
| 795 | Ga0265320_10134358 | 3300031240 | Bacteria | 1123 |
| 796 | Ga0265320_10277542 | 3300031240 | Bacteria | 742 |
| 797 | Ga0265325_10044376 | 3300031241 | Bacteria | 2315 |
| 798 | Ga0265325_10048042 | 3300031241 | Bacteria | 2207 |
| 799 | Ga0265329_10024571 | 3300031242 | Bacteria | 1999 |
| 800 | Ga0265340_10014348 | 3300031247 | Bacteria | 4142 |
| 801 | Ga0265340_10020600 | 3300031247 | Bacteria | 3386 |
| 802 | Ga0265340_10041231 | 3300031247 | Bacteria | 2270 |
| 803 | Ga0265339_10001458 | 3300031249 | Bacteria | 17517 |
| 804 | Ga0265339_10140375 | 3300031249 | Bacteria | 1229 |
| 805 | Ga0265339_10162764 | 3300031249 | Bacteria | 1122 |
| 806 | Ga0265339_10232554 | 3300031249 | Unclassified | 898 |
| 807 | Ga0265331_10020805 | 3300031250 | Bacteria | 3362 |
| 808 | Ga0265331_10102087 | 3300031250 | Bacteria | 1319 |
| 809 | Ga0265331_10501725 | 3300031250 | Bacteria | 546 |
| 810 | Ga0265327_10022468 | 3300031251 | Bacteria | 3770 |
| 811 | Ga0265327_10032775 | 3300031251 | Bacteria | 2904 |
| 812 | Ga0265327_10082280 | 3300031251 | Bacteria | 1587 |
| 813 | Ga0265327_10135973 | 3300031251 | Bacteria | 1152 |
| 814 | Ga0265327_10401038 | 3300031251 | Bacteria | 595 |
| 815 | Ga0265316_10111601 | 3300031344 | Bacteria | 2070 |
| 816 | Ga0265316_10253868 | 3300031344 | Unclassified | 1291 |
| 817 | Ga0265316_10287909 | 3300031344 | Bacteria | 1199 |
| 818 | Ga0265316_10346252 | 3300031344 | Bacteria | 1076 |
| 819 | Ga0265316_10490129 | 3300031344 | Bacteria | 879 |
| 820 | Ga0307408_100572705 | 3300031548 | Bacteria | 999 |
| 821 | Ga0307408_101418174 | 3300031548 | Bacteria | 654 |
| 822 | Ga0265313_10051943 | 3300031595 | Bacteria | 1958 |
| 823 | Ga0265313_10085378 | 3300031595 | Bacteria | 1426 |
| 824 | Ga0265314_10009344 | 3300031711 | Bacteria | 8295 |
| 825 | Ga0265314_10051195 | 3300031711 | Bacteria | 2877 |
| 826 | Ga0265314_10188459 | 3300031711 | Bacteria | 1229 |
| 827 | Ga0265342_10038976 | 3300031712 | Bacteria | 2890 |
| 828 | Ga0265342_10053412 | 3300031712 | Bacteria | 2404 |
| 829 | Ga0265342_10093305 | 3300031712 | Bacteria | 1723 |
| 830 | Ga0307405_10031541 | 3300031731 | Bacteria | 3122 |
| 831 | Ga0307405_10218643 | 3300031731 | Bacteria | 1396 |
| 832 | Ga0307405_10581213 | 3300031731 | Bacteria | 911 |
| 833 | Ga0307405_11360502 | 3300031731 | Unclassified | 619 |
| 834 | Ga0307413_10173135 | 3300031824 | Bacteria | 1530 |
| 835 | Ga0307413_10344472 | 3300031824 | Bacteria | 1147 |
| 836 | Ga0307413_10349947 | 3300031824 | Bacteria | 1140 |
| 837 | Ga0307410_10304766 | 3300031852 | Bacteria | 1258 |
| 838 | Ga0307406_11100863 | 3300031901 | Unclassified | 686 |
| 839 | Ga0307406_11322785 | 3300031901 | Bacteria | 629 |
| 840 | Ga0307406_11858598 | 3300031901 | Bacteria | 536 |
| 841 | Ga0307407_10073999 | 3300031903 | Bacteria | 2037 |
| 842 | Ga0307407_10754469 | 3300031903 | Bacteria | 737 |
| 843 | Ga0307407_11690675 | 3300031903 | Unclassified | 504 |
| 844 | Ga0307412_10326431 | 3300031911 | Bacteria | 1223 |
| 845 | Ga0307412_10635561 | 3300031911 | Bacteria | 908 |
| 846 | Ga0307412_11016305 | 3300031911 | Bacteria | 733 |
| 847 | Ga0307412_11904862 | 3300031911 | Bacteria | 549 |
| 848 | Ga0307409_100009147 | 3300031995 | Bacteria | 6071 |
| 849 | Ga0307409_100174426 | 3300031995 | Bacteria | 1896 |
| 850 | Ga0307409_100285406 | 3300031995 | Bacteria | 1528 |
| 851 | Ga0307409_100296371 | 3300031995 | Bacteria | 1502 |
| 852 | Ga0307409_100816969 | 3300031995 | Bacteria | 941 |
| 853 | Ga0307409_100948282 | 3300031995 | Bacteria | 876 |
| 854 | Ga0307409_101117060 | 3300031995 | Bacteria | 810 |
| 855 | Ga0307416_100062659 | 3300032002 | Bacteria | 3042 |
| 856 | Ga0307416_100251858 | 3300032002 | Bacteria | 1719 |
| 857 | Ga0307416_100267610 | 3300032002 | Bacteria | 1675 |
| 858 | Ga0307416_100303129 | 3300032002 | Unclassified | 1589 |
| 859 | Ga0307416_100379253 | 3300032002 | Bacteria | 1443 |
| 860 | Ga0307416_100539468 | 3300032002 | Bacteria | 1238 |
| 861 | Ga0307416_100553267 | 3300032002 | Bacteria | 1224 |
| 862 | Ga0307411_10234904 | 3300032005 | Bacteria | 1431 |
| 863 | Ga0307411_10327579 | 3300032005 | Bacteria | 1240 |
| 864 | Ga0307411_10967596 | 3300032005 | Unclassified | 760 |
| 865 | Ga0307415_100124797 | 3300032126 | Bacteria | 1938 |
| 866 | Ga0307415_100153264 | 3300032126 | Bacteria | 1776 |
| 867 | Ga0307415_100157345 | 3300032126 | Unclassified | 1756 |
| 868 | Ga0307415_100427408 | 3300032126 | Unclassified | 1139 |
| 869 | Ga0307415_102480776 | 3300032126 | Bacteria | 510 |
| 870 | Ga0373930_0004430 | 3300034816 | Bacteria | 2286 |
| 871 | Ga0373948_0003274 | 3300034817 | Bacteria | 2479 |
| 872 | Ga0373958_0061717 | 3300034819 | Unclassified | 813 |
| 873 | Ga0373959_0007931 | 3300034820 | Unclassified | 1794 |
| 874 | Ga0373938_0021207 | 3300034957 | Unclassified | 1315 |
| 875 | Ga0373926_0014653 | 3300035083 | Bacteria | 2667 |
| 876 | Ga0373928_0006626 | 3300035084 | Bacteria | 2228 |
| 877 | Ga0373944_0004151 | 3300035089 | Bacteria | 3763 |
| 878 | Ga0373944_0042736 | 3300035089 | Bacteria | 1406 |
| 879 | Ga0373949_0021547 | 3300035090 | Bacteria | 1480 |
| 880 | Ga0373951_0071532 | 3300035091 | Unclassified | 884 |
| 881 | Ga0373952_0006581 | 3300035092 | Bacteria | 2152 |
| 882 | Ga0373952_0276349 | 3300035092 | Unclassified | 516 |
| 883 | Ga0373923_0119327 | 3300035111 | Bacteria | 1177 |
| 884 | Ga0373932_0004244 | 3300035112 | Bacteria | 3403 |
| 885 | Ga0373936_0039974 | 3300035113 | Bacteria | 1878 |
| 886 | Ga0373939_0020387 | 3300035114 | Bacteria | 1800 |
| 887 | Ga0373939_0077596 | 3300035114 | Bacteria | 1096 |
| 888 | Ga0373941_0026995 | 3300035115 | Bacteria | 1672 |
| 889 | Ga0373945_0003225 | 3300035116 | Bacteria | 5120 |
| 890 | Ga0373945_0268313 | 3300035116 | Bacteria | 725 |
| 891 | Ga0373953_0027035 | 3300035117 | Bacteria | 2202 |
| 892 | Ga0373953_0184037 | 3300035117 | Bacteria | 902 |
| 893 | Ga0373954_0016832 | 3300035118 | Bacteria | 3279 |
| 894 | Ga0373954_0120414 | 3300035118 | Bacteria | 1274 |
| 895 | Ga0373956_0078972 | 3300035119 | Bacteria | 1508 |
| 896 | Ga0373956_0210625 | 3300035119 | Bacteria | 922 |
| 897 | Ga0373957_0042468 | 3300035120 | Bacteria | 1716 |
| 898 | Ga0373957_0095228 | 3300035120 | Bacteria | 1187 |
| 899 | Ga0373960_0007094 | 3300035121 | Bacteria | 2645 |
| 900 | Ga0373943_0004177 | 3300035170 | Bacteria | 6552 |
| 901 | Ga0373943_0012814 | 3300035170 | Bacteria | 3779 |
| 902 | Ga0373943_0050429 | 3300035170 | Bacteria | 2045 |
| 903 | Ga0373943_0956838 | 3300035170 | Unclassified | 513 |
| 904 | Ga0373946_0004366 | 3300035171 | Bacteria | 5064 |
| 905 | Ga0373946_0039458 | 3300035171 | Bacteria | 1928 |
| 906 | Ga0373946_0545260 | 3300035171 | Unclassified | 598 |
| 907 | Ga0373955_0029377 | 3300035172 | Bacteria | 2858 |
| 908 | Ga0373955_0251613 | 3300035172 | Bacteria | 1059 |
| 909 | Ga0373955_0820082 | 3300035172 | Unclassified | 572 |
| 910 | Ga0373942_0037964 | 3300035207 | Unclassified | 1304 |
| 911 | Ga0373961_0036653 | 3300035241 | Unclassified | 1398 |
| 912 | Ga0373961_0094780 | 3300035241 | Bacteria | 959 |
| 913 | Ga0373962_0004892 | 3300035242 | Bacteria | 3238 |
| 914 | Ga0373924_0007579 | 3300035410 | Bacteria | 3921 |
| 915 | Ga0373931_0022247 | 3300035691 | Bacteria | 3189 |
| 916 | Ga0373931_0339168 | 3300035691 | Bacteria | 938 |
| 917 | Ga0373931_0740670 | 3300035691 | Bacteria | 652 |
| 918 | Ga0373935_0002406 | 3300035692 | Bacteria | 10709 |
| 919 | Ga0373935_0061654 | 3300035692 | Bacteria | 2401 |
| 920 | Ga0373935_0174469 | 3300035692 | Bacteria | 1472 |
| 921 | Ga0373927_0052812 | 3300035695 | Bacteria | 2628 |
| 922 | Ga0373933_0059558 | 3300035724 | Bacteria | 2300 |
| 923 | Ga0373933_0291521 | 3300035724 | Bacteria | 1055 |
| 924 | Ga0373933_0442261 | 3300035724 | Bacteria | 850 |
| 925 | Ga0373933_1118709 | 3300035724 | Bacteria | 519 |
| 926 | Ga0373947_0004917 | 3300035725 | Bacteria | 7814 |
| 927 | Ga0373947_0020348 | 3300035725 | Bacteria | 3831 |
| 928 | Ga0373947_0072008 | 3300035725 | Bacteria | 2121 |
| 929 | Ga0373947_0091353 | 3300035725 | Bacteria | 1899 |
| 930 | Ga0373947_0146209 | 3300035725 | Unclassified | 1520 |
| 931 | Ga0373947_0413025 | 3300035725 | Unclassified | 911 |
| 932 | Ga0373937_0021717 | 3300036401 | Bacteria | 5762 |
| 933 | Ga0373937_0283198 | 3300036401 | Bacteria | 1565 |
| 934 | Ga0373937_2164911 | 3300036401 | Bacteria | 502 |
| 935 | Ga0373925_0005095 | 3300037068 | Bacteria | 9839 |
| 936 | Ga0373925_0188309 | 3300037068 | Bacteria | 1636 |
| 937 | Ga0373925_0223285 | 3300037068 | Bacteria | 1504 |
| 938 | Ga0373925_0306801 | 3300037068 | Bacteria | 1282 |
| 939 | Ga0373925_0621532 | 3300037068 | Unclassified | 890 |
| 940 | Ga0373925_1018832 | 3300037068 | Bacteria | 682 |
| 941 | Ga0373925_1255480 | 3300037068 | Unclassified | 608 |
| 942 | Ga0395899_0002854 | 3300037312 | Bacteria | 13911 |
| 943 | Ga0395899_0005973 | 3300037312 | Bacteria | 9455 |
| 944 | Ga0395899_0008716 | 3300037312 | Bacteria | 7808 |
| 945 | Ga0395899_0009725 | 3300037312 | Bacteria | 7380 |
| 946 | Ga0395899_0010577 | 3300037312 | Bacteria | 7070 |
| 947 | Ga0395899_0016967 | 3300037312 | Bacteria | 5550 |
| 948 | Ga0395899_0032880 | 3300037312 | Unclassified | 3897 |
| 949 | Ga0395899_0048050 | 3300037312 | Bacteria | 3176 |
| 950 | Ga0395899_0050955 | 3300037312 | Bacteria | 3073 |
| 951 | Ga0395899_0064701 | 3300037312 | Unclassified | 2688 |
| 952 | Ga0395899_0083770 | 3300037312 | Bacteria | 2319 |
| 953 | Ga0395899_0101194 | 3300037312 | Bacteria | 2080 |
| 954 | Ga0395899_0139195 | 3300037312 | Bacteria | 1728 |
| 955 | Ga0395899_0208298 | 3300037312 | Bacteria | 1360 |
| 956 | Ga0395899_0305632 | 3300037312 | Bacteria | 1075 |
| 957 | Ga0395899_0351280 | 3300037312 | Bacteria | 986 |
| 958 | Ga0395899_0720510 | 3300037312 | Bacteria | 624 |
| 959 | Ga0395899_0958102 | 3300037312 | Unclassified | 518 |
| 960 | Ga0395899_0976239 | 3300037312 | Bacteria | 512 |
| 961 | Ga0395900_0008078 | 3300037418 | Bacteria | 10831 |
| 962 | Ga0395900_0008413 | 3300037418 | Bacteria | 10614 |
| 963 | Ga0395900_0009665 | 3300037418 | Bacteria | 9887 |
| 964 | Ga0395900_0015917 | 3300037418 | Bacteria | 7662 |
| 965 | Ga0395900_0026666 | 3300037418 | Bacteria | 5916 |
| 966 | Ga0395900_0030328 | 3300037418 | Bacteria | 5552 |
| 967 | Ga0395900_0032967 | 3300037418 | Bacteria | 5330 |
| 968 | Ga0395900_0039951 | 3300037418 | Bacteria | 4835 |
| 969 | Ga0395900_0040112 | 3300037418 | Bacteria | 4825 |
| 970 | Ga0395900_0069741 | 3300037418 | Bacteria | 3613 |
| 971 | Ga0395900_0086330 | 3300037418 | Bacteria | 3225 |
| 972 | Ga0395900_0093684 | 3300037418 | Bacteria | 3085 |
| 973 | Ga0395900_0127274 | 3300037418 | Bacteria | 2612 |
| 974 | Ga0395900_0146797 | 3300037418 | Bacteria | 2412 |
| 975 | Ga0395900_0203228 | 3300037418 | Bacteria | 2003 |
| 976 | Ga0395900_0205324 | 3300037418 | Bacteria | 1991 |
| 977 | Ga0395900_0342635 | 3300037418 | Bacteria | 1470 |
| 978 | Ga0395900_0504119 | 3300037418 | Bacteria | 1160 |
| 979 | Ga0395900_0564400 | 3300037418 | Bacteria | 1081 |
| 980 | Ga0395900_0625422 | 3300037418 | Bacteria | 1015 |
| 981 | Ga0395900_0659422 | 3300037418 | Bacteria | 982 |
| 982 | Ga0395900_0781776 | 3300037418 | Bacteria | 883 |
| 983 | Ga0395900_0894232 | 3300037418 | Bacteria | 812 |
| 984 | Ga0395900_0977138 | 3300037418 | Bacteria | 767 |
| 985 | Ga0395900_1261977 | 3300037418 | Unclassified | 653 |
| 986 | Ga0395898_0004818 | 3300037466 | Bacteria | 14678 |
| 987 | Ga0395898_0005838 | 3300037466 | Bacteria | 13245 |
| 988 | Ga0395898_0009573 | 3300037466 | Bacteria | 10174 |
| 989 | Ga0395898_0014829 | 3300037466 | Bacteria | 8001 |
| 990 | Ga0395898_0023975 | 3300037466 | Bacteria | 6157 |
| 991 | Ga0395898_0025913 | 3300037466 | Bacteria | 5904 |
| 992 | Ga0395898_0026252 | 3300037466 | Bacteria | 5863 |
| 993 | Ga0395898_0031174 | 3300037466 | Bacteria | 5330 |
| 994 | Ga0395898_0031424 | 3300037466 | Bacteria | 5305 |
| 995 | Ga0395898_0044970 | 3300037466 | Bacteria | 4341 |
| 996 | Ga0395898_0055709 | 3300037466 | Bacteria | 3856 |
| 997 | Ga0395898_0065774 | 3300037466 | Bacteria | 3514 |
| 998 | Ga0395898_0076622 | 3300037466 | Bacteria | 3229 |
| 999 | Ga0395898_0094649 | 3300037466 | Bacteria | 2871 |
| 1000 | Ga0395898_0129251 | 3300037466 | Bacteria | 2420 |
| 1001 | Ga0395898_0146920 | 3300037466 | Bacteria | 2256 |
| 1002 | Ga0395898_0146990 | 3300037466 | Bacteria | 2256 |
| 1003 | Ga0395898_0151251 | 3300037466 | Bacteria | 2220 |
| 1004 | Ga0395898_0151360 | 3300037466 | Bacteria | 2220 |
| 1005 | Ga0395898_0341458 | 3300037466 | Bacteria | 1428 |
| 1006 | Ga0395898_0393459 | 3300037466 | Bacteria | 1321 |
| 1007 | Ga0395898_0460543 | 3300037466 | Unclassified | 1211 |
| 1008 | Ga0395898_0504946 | 3300037466 | Unclassified | 1150 |
| 1009 | Ga0395898_0613941 | 3300037466 | Unclassified | 1030 |
| 1010 | Ga0395898_0784324 | 3300037466 | Unclassified | 893 |
| 1011 | Ga0395898_1062438 | 3300037466 | Bacteria | 744 |
| 1012 | Ga0395898_1236522 | 3300037466 | Unclassified | 677 |
| 1013 | Ga0395905_0006664 | 3300037471 | Bacteria | 11579 |
| 1014 | Ga0395905_0008040 | 3300037471 | Bacteria | 10420 |
| 1015 | Ga0395905_0010274 | 3300037471 | Bacteria | 9113 |
| 1016 | Ga0395905_0013469 | 3300037471 | Bacteria | 7837 |
| 1017 | Ga0395905_0036864 | 3300037471 | Bacteria | 4592 |
| 1018 | Ga0395905_0037343 | 3300037471 | Bacteria | 4561 |
| 1019 | Ga0395905_0064361 | 3300037471 | Bacteria | 3431 |
| 1020 | Ga0395905_0072421 | 3300037471 | Bacteria | 3230 |
| 1021 | Ga0395905_0077520 | 3300037471 | Bacteria | 3114 |
| 1022 | Ga0395905_0083118 | 3300037471 | Bacteria | 3000 |
| 1023 | Ga0395905_0104634 | 3300037471 | Bacteria | 2657 |
| 1024 | Ga0395905_0189416 | 3300037471 | Bacteria | 1930 |
| 1025 | Ga0395905_0273039 | 3300037471 | Bacteria | 1577 |
| 1026 | Ga0395905_0285434 | 3300037471 | Bacteria | 1537 |
| 1027 | Ga0395905_0300869 | 3300037471 | Bacteria | 1491 |
| 1028 | Ga0395905_0324709 | 3300037471 | Unclassified | 1429 |
| 1029 | Ga0395905_0659004 | 3300037471 | Bacteria | 949 |
| 1030 | Ga0395905_1018030 | 3300037471 | Bacteria | 731 |
| 1031 | Ga0395905_1085159 | 3300037471 | Unclassified | 704 |
| 1032 | Ga0395905_1126279 | 3300037471 | Bacteria | 688 |
| 1033 | Ga0395901_0000731 | 3300038443 | Bacteria | 37223 |
| 1034 | Ga0395901_0002352 | 3300038443 | Bacteria | 19227 |
| 1035 | Ga0395901_0003039 | 3300038443 | Bacteria | 16910 |
| 1036 | Ga0395901_0009320 | 3300038443 | Bacteria | 9951 |
| 1037 | Ga0395901_0009671 | 3300038443 | Bacteria | 9776 |
| 1038 | Ga0395901_0011114 | 3300038443 | Bacteria | 9124 |
| 1039 | Ga0395901_0015241 | 3300038443 | Bacteria | 7822 |
| 1040 | Ga0395901_0027918 | 3300038443 | Bacteria | 5803 |
| 1041 | Ga0395901_0035405 | 3300038443 | Bacteria | 5157 |
| 1042 | Ga0395901_0037870 | 3300038443 | Bacteria | 4987 |
| 1043 | Ga0395901_0060611 | 3300038443 | Bacteria | 3937 |
| 1044 | Ga0395901_0064308 | 3300038443 | Bacteria | 3818 |
| 1045 | Ga0395901_0071864 | 3300038443 | Bacteria | 3606 |
| 1046 | Ga0395901_0074680 | 3300038443 | Bacteria | 3536 |
| 1047 | Ga0395901_0111538 | 3300038443 | Unclassified | 2872 |
| 1048 | Ga0395901_0119478 | 3300038443 | Bacteria | 2770 |
| 1049 | Ga0395901_0128562 | 3300038443 | Bacteria | 2663 |
| 1050 | Ga0395901_0142756 | 3300038443 | Bacteria | 2517 |
| 1051 | Ga0395901_0158514 | 3300038443 | Bacteria | 2377 |
| 1052 | Ga0395901_0163307 | 3300038443 | Bacteria | 2339 |
| 1053 | Ga0395901_0238164 | 3300038443 | Bacteria | 1898 |
| 1054 | Ga0395901_0243505 | 3300038443 | Bacteria | 1875 |
| 1055 | Ga0395901_0303240 | 3300038443 | Bacteria | 1656 |
| 1056 | Ga0395901_0323259 | 3300038443 | Bacteria | 1596 |
| 1057 | Ga0395901_0330304 | 3300038443 | Bacteria | 1576 |
| 1058 | Ga0395901_0340022 | 3300038443 | Bacteria | 1551 |
| 1059 | Ga0395901_0403287 | 3300038443 | Bacteria | 1404 |
| 1060 | Ga0395901_0465851 | 3300038443 | Bacteria | 1290 |
| 1061 | Ga0395901_0551056 | 3300038443 | Bacteria | 1169 |
| 1062 | Ga0395901_0580790 | 3300038443 | Bacteria | 1132 |
| 1063 | Ga0395901_0745638 | 3300038443 | Bacteria | 973 |
| 1064 | Ga0395901_0769497 | 3300038443 | Bacteria | 954 |
| 1065 | Ga0395901_0895255 | 3300038443 | Unclassified | 870 |
| 1066 | Ga0395901_1158586 | 3300038443 | Bacteria | 741 |
| 1067 | Ga0395901_1200750 | 3300038443 | Unclassified | 724 |
| 1068 | Ga0395901_1413672 | 3300038443 | Bacteria | 654 |
| 1069 | Ga0395901_1832786 | 3300038443 | Bacteria | 555 |
| 1070 | Ga0395901_1980533 | 3300038443 | Unclassified | 529 |
| 1071 | Ga0242420_072882 | 3300038996 | Bacteria | 700 |
| 1072 | Ga0436360_0109394 | 3300039438 | Bacteria | 6992 |
| 1073 | Ga0436363_0834990 | 3300039450 | Unclassified | 635 |
| 1074 | Ga0436363_1509554 | 3300039450 | Unclassified | 575 |
| 1075 | Ga0436362_0876451 | 3300039453 | Bacteria | 552 |
| 1076 | Ga0436362_0950133 | 3300039453 | Unclassified | 885 |
| 1077 | Ga0439438_041642 | 3300041405 | Bacteria | 1190 |
| 1078 | Ga0439461_0002121 | 3300041410 | Bacteria | 3137 |
| 1079 | Ga0439461_0011001 | 3300041410 | Bacteria | 1672 |
| 1080 | Ga0439466_0029918 | 3300041411 | Bacteria | 1871 |
| 1081 | Ga0439466_0110845 | 3300041411 | Unclassified | 851 |
| 1082 | Ga0439465_0260355 | 3300041413 | Unclassified | 643 |
| 1083 | Ga0451802_2055700 | 3300041460 | Unclassified | 910 |
| 1084 | Ga0451807_0430671 | 3300041486 | Bacteria | 579 |
| 1085 | Ga0451845_0039632 | 3300041501 | Bacteria | 696 |
| 1086 | Ga0451853_0221711 | 3300041512 | Unclassified | 700 |
| 1087 | Ga0451853_2921298 | 3300041512 | Unclassified | 1021 |
| 1088 | Ga0451853_3912091 | 3300041512 | Bacteria | 535 |
| 1089 | Ga0439437_035967 | 3300042000 | Bacteria | 633 |
| 1090 | Ga0439441_021194 | 3300042001 | Bacteria | 1197 |
| 1091 | Ga0439456_091856 | 3300042013 | Bacteria | 683 |
| 1092 | Ga0450912_003398 | 3300042116 | Unclassified | 1131 |
| 1093 | Ga0450913_029854 | 3300042117 | Bacteria | 534 |
| 1094 | Ga0450914_003882 | 3300042118 | Bacteria | 1180 |
| 1095 | Ga0450915_012003 | 3300042119 | Unclassified | 621 |
| 1096 | Ga0450920_023652 | 3300042122 | Bacteria | 1191 |
| 1097 | Ga0450905_017857 | 3300042142 | Bacteria | 1031 |
| 1098 | Ga0450907_071417 | 3300042146 | Bacteria | 601 |
| 1099 | Ga0450910_022011 | 3300042147 | Bacteria | 968 |
| 1100 | Ga0439446_0001277 | 3300042156 | Bacteria | 5653 |
| 1101 | Ga0439458_0029379 | 3300042157 | Bacteria | 1304 |
| 1102 | Ga0439458_0093884 | 3300042157 | Bacteria | 774 |
| 1103 | Ga0450908_087066 | 3300042184 | Bacteria | 564 |
| 1104 | Ga0439434_0165211 | 3300042435 | Bacteria | 737 |
| 1105 | Ga0439459_0017868 | 3300042438 | Bacteria | 1327 |
| 1106 | Ga0439459_0076260 | 3300042438 | Bacteria | 784 |
| 1107 | Ga0439460_0308629 | 3300042461 | Bacteria | 554 |
| 1108 | Ga0450916_032177 | 3300042530 | Bacteria | 768 |
| 1109 | Ga0450918_048381 | 3300042531 | Bacteria | 772 |
| 1110 | Ga0451577_1811052 | 3300042876 | Bacteria | 536 |
| 1111 | Ga0466969_0072078 | 3300044656 | Bacteria | 1660 |
| 1112 | Ga0466972_0103354 | 3300044658 | Bacteria | 1348 |
| 1113 | Ga0466965_0317508 | 3300044683 | Bacteria | 848 |
| 1114 | Ga0466966_0020014 | 3300044684 | Bacteria | 4403 |
| 1115 | Ga0466966_0040366 | 3300044684 | Bacteria | 3004 |
| 1116 | Ga0466966_0262271 | 3300044684 | Bacteria | 1040 |
| 1117 | Ga0466961_0001959 | 3300044693 | Bacteria | 12830 |
| 1118 | Ga0466961_0048623 | 3300044693 | Unclassified | 2711 |
| 1119 | Ga0466961_0237862 | 3300044693 | Unclassified | 1120 |
| 1120 | Ga0466961_0425221 | 3300044693 | Bacteria | 805 |
| 1121 | Ga0466963_0001943 | 3300044694 | Bacteria | 11331 |
| 1122 | Ga0466963_0003712 | 3300044694 | Bacteria | 8780 |
| 1123 | Ga0466963_0030304 | 3300044694 | Bacteria | 3490 |
| 1124 | Ga0466963_0229897 | 3300044694 | Unclassified | 1299 |
| 1125 | Ga0466963_0280817 | 3300044694 | Unclassified | 1170 |
| 1126 | Ga0466963_0328288 | 3300044694 | Bacteria | 1077 |
| 1127 | Ga0466963_0381020 | 3300044694 | Bacteria | 994 |
| 1128 | Ga0466963_0722076 | 3300044694 | Unclassified | 703 |
| 1129 | Ga0466964_0008287 | 3300044706 | Bacteria | 3901 |
| 1130 | Ga0466964_0069408 | 3300044706 | Unclassified | 1486 |
| 1131 | Ga0466964_0141382 | 3300044706 | Bacteria | 1106 |
| 1132 | Ga0466964_0206258 | 3300044706 | Bacteria | 947 |
| 1133 | Ga0466964_0232954 | 3300044706 | Bacteria | 900 |
| 1134 | Ga0466971_0036954 | 3300044719 | Bacteria | 2190 |
| 1135 | Ga0466971_0674651 | 3300044719 | Bacteria | 519 |
| 1136 | Ga0466968_0276298 | 3300044735 | Unclassified | 803 |
| 1137 | Ga0466968_0404405 | 3300044735 | Bacteria | 670 |
| 1138 | Ga0466970_0288062 | 3300044765 | Bacteria | 924 |
| 1139 | Ga0466957_0070751 | 3300044842 | Bacteria | 2156 |
| 1140 | Ga0466957_0071289 | 3300044842 | Bacteria | 2149 |
| 1141 | Ga0466957_0425722 | 3300044842 | Bacteria | 911 |
| 1142 | Ga0466960_0028065 | 3300044901 | Bacteria | 2574 |
| 1143 | Ga0466960_0133700 | 3300044901 | Bacteria | 1312 |
| 1144 | Ga0466960_0142471 | 3300044901 | Bacteria | 1274 |
| 1145 | Ga0466960_0292868 | 3300044901 | Bacteria | 915 |
| 1146 | Ga0466960_0423780 | 3300044901 | Bacteria | 770 |
| 1147 | Ga0466960_0951788 | 3300044901 | Bacteria | 526 |
| 1148 | Ga0466959_0041892 | 3300045049 | Bacteria | 3379 |
| 1149 | Ga0451576_0619700 | 3300045051 | Bacteria | 1137 |
| 1150 | Ga0451576_1382027 | 3300045051 | Bacteria | 733 |
| 1151 | Ga0466958_0010663 | 3300045836 | Bacteria | 5154 |
| 1152 | Ga0466958_0020060 | 3300045836 | Bacteria | 3896 |
| 1153 | Ga0466958_0029162 | 3300045836 | Bacteria | 3273 |
| 1154 | Ga0466958_0057741 | 3300045836 | Bacteria | 2359 |
| 1155 | Ga0466958_0303385 | 3300045836 | Bacteria | 1025 |
| 1156 | Ga0466958_0586667 | 3300045836 | Bacteria | 725 |
| 1157 | Ga0466967_0048200 | 3300045976 | Bacteria | 3719 |
| 1158 | Ga0466967_0057421 | 3300045976 | Bacteria | 3436 |
| 1159 | Ga0466967_0067626 | 3300045976 | Bacteria | 3187 |
| 1160 | Ga0466967_0088768 | 3300045976 | Bacteria | 2806 |
| 1161 | Ga0466967_0140751 | 3300045976 | Bacteria | 2247 |
| 1162 | Ga0466967_0147375 | 3300045976 | Unclassified | 2196 |
| 1163 | Ga0466967_0219133 | 3300045976 | Bacteria | 1807 |
| 1164 | Ga0466967_0331894 | 3300045976 | Bacteria | 1469 |
| 1165 | Ga0466967_0350144 | 3300045976 | Bacteria | 1429 |
| 1166 | Ga0466967_0472538 | 3300045976 | Bacteria | 1227 |
| 1167 | Ga0466967_0685596 | 3300045976 | Bacteria | 1014 |
| 1168 | Ga0466967_1022804 | 3300045976 | Bacteria | 823 |
| 1169 | Ga0466967_1231651 | 3300045976 | Bacteria | 745 |
| 1170 | Ga0466967_1567611 | 3300045976 | Bacteria | 656 |
| 1171 | Ga0466967_1998216 | 3300045976 | Unclassified | 576 |
| 1172 | Ga0495627_183681 | 3300046453 | Bacteria | 579 |
| 1173 | Ga0495592_0124239 | 3300046454 | Bacteria | 1812 |
| 1174 | Ga0495592_0338318 | 3300046454 | Bacteria | 968 |
| 1175 | Ga0495592_0551373 | 3300046454 | Bacteria | 709 |
| 1176 | Ga0495603_0016929 | 3300046455 | Bacteria | 4411 |
| 1177 | Ga0495603_0024832 | 3300046455 | Bacteria | 3626 |
| 1178 | Ga0495603_0031659 | 3300046455 | Bacteria | 3184 |
| 1179 | Ga0495603_0109821 | 3300046455 | Bacteria | 1609 |
| 1180 | Ga0495603_0153831 | 3300046455 | Unclassified | 1335 |
| 1181 | Ga0495603_0272775 | 3300046455 | Bacteria | 973 |
| 1182 | Ga0495603_0859238 | 3300046455 | Unclassified | 516 |
| 1183 | Ga0495591_074442 | 3300046458 | Unclassified | 876 |
| 1184 | Ga0495629_0018401 | 3300046459 | Bacteria | 5001 |
| 1185 | Ga0495629_0021356 | 3300046459 | Bacteria | 4620 |
| 1186 | Ga0495629_0051575 | 3300046459 | Bacteria | 2879 |
| 1187 | Ga0495629_0117540 | 3300046459 | Bacteria | 1853 |
| 1188 | Ga0495629_0128519 | 3300046459 | Bacteria | 1765 |
| 1189 | Ga0495629_0162190 | 3300046459 | Unclassified | 1553 |
| 1190 | Ga0495629_0180342 | 3300046459 | Bacteria | 1464 |
| 1191 | Ga0495629_0239086 | 3300046459 | Bacteria | 1251 |
| 1192 | Ga0495641_0022352 | 3300046461 | Bacteria | 3166 |
| 1193 | Ga0495641_0105834 | 3300046461 | Bacteria | 1255 |
| 1194 | Ga0495641_0135112 | 3300046461 | Bacteria | 1101 |
| 1195 | Ga0495641_0139027 | 3300046461 | Unclassified | 1085 |
| 1196 | Ga0495651_0033546 | 3300046462 | Bacteria | 4004 |
| 1197 | Ga0495651_0161083 | 3300046462 | Bacteria | 1607 |
| 1198 | Ga0495651_0260480 | 3300046462 | Bacteria | 1180 |
| 1199 | Ga0495651_0280540 | 3300046462 | Unclassified | 1126 |
| 1200 | Ga0495653_0002135 | 3300046463 | Bacteria | 15594 |
| 1201 | Ga0495653_0048424 | 3300046463 | Bacteria | 3281 |
| 1202 | Ga0495653_0060322 | 3300046463 | Bacteria | 2874 |
| 1203 | Ga0495653_0297898 | 3300046463 | Unclassified | 1053 |
| 1204 | Ga0495653_0352827 | 3300046463 | Bacteria | 945 |
| 1205 | Ga0495580_0382500 | 3300046472 | Bacteria | 950 |
| 1206 | Ga0495580_0435600 | 3300046472 | Bacteria | 881 |
| 1207 | Ga0495582_0009920 | 3300046473 | Bacteria | 5240 |
| 1208 | Ga0495582_0019313 | 3300046473 | Bacteria | 3726 |
| 1209 | Ga0495582_0043094 | 3300046473 | Bacteria | 2485 |
| 1210 | Ga0495582_0270330 | 3300046473 | Bacteria | 975 |
| 1211 | Ga0495582_0477323 | 3300046473 | Bacteria | 720 |
| 1212 | Ga0495582_0569907 | 3300046473 | Bacteria | 655 |
| 1213 | Ga0495582_0908820 | 3300046473 | Bacteria | 509 |
| 1214 | Ga0495605_0019864 | 3300046474 | Bacteria | 3578 |
| 1215 | Ga0495605_0123957 | 3300046474 | Unclassified | 1170 |
| 1216 | Ga0495605_0297710 | 3300046474 | Bacteria | 683 |
| 1217 | Ga0495639_0022510 | 3300046475 | Bacteria | 2765 |
| 1218 | Ga0495639_0189944 | 3300046475 | Bacteria | 1002 |
| 1219 | Ga0495639_0253705 | 3300046475 | Bacteria | 870 |
| 1220 | Ga0495662_0171984 | 3300046476 | Bacteria | 1067 |
| 1221 | Ga0495584_0085645 | 3300046491 | Unclassified | 1588 |
| 1222 | Ga0495584_0138004 | 3300046491 | Unclassified | 1238 |
| 1223 | Ga0495584_0376732 | 3300046491 | Unclassified | 721 |
| 1224 | Ga0495584_0509945 | 3300046491 | Unclassified | 613 |
| 1225 | Ga0495585_0261894 | 3300046492 | Unclassified | 860 |
| 1226 | Ga0495594_0042427 | 3300046499 | Bacteria | 2491 |
| 1227 | Ga0495594_0088064 | 3300046499 | Bacteria | 1738 |
| 1228 | Ga0495594_0265545 | 3300046499 | Bacteria | 977 |
| 1229 | Ga0495594_0344430 | 3300046499 | Bacteria | 849 |
| 1230 | Ga0495594_0434930 | 3300046499 | Bacteria | 746 |
| 1231 | Ga0495594_0846771 | 3300046499 | Bacteria | 515 |
| 1232 | Ga0495596_0338128 | 3300046500 | Unclassified | 586 |
| 1233 | Ga0495607_0142132 | 3300046501 | Bacteria | 1237 |
| 1234 | Ga0495607_0176188 | 3300046501 | Bacteria | 1076 |
| 1235 | Ga0495607_0256639 | 3300046501 | Unclassified | 839 |
| 1236 | Ga0495608_0003222 | 3300046511 | Bacteria | 11685 |
| 1237 | Ga0495608_0012504 | 3300046511 | Bacteria | 5890 |
| 1238 | Ga0495608_0027502 | 3300046511 | Bacteria | 3869 |
| 1239 | Ga0495608_0354443 | 3300046511 | Bacteria | 903 |
| 1240 | Ga0495618_0053359 | 3300046514 | Bacteria | 2556 |
| 1241 | Ga0495618_0617144 | 3300046514 | Bacteria | 644 |
| 1242 | Ga0495618_0735679 | 3300046514 | Bacteria | 578 |
| 1243 | Ga0495620_0079227 | 3300046515 | Unclassified | 1331 |
| 1244 | Ga0495628_0029204 | 3300046516 | Bacteria | 4474 |
| 1245 | Ga0495628_0242493 | 3300046516 | Bacteria | 1348 |
| 1246 | Ga0495628_0288182 | 3300046516 | Bacteria | 1218 |
| 1247 | Ga0495630_0005488 | 3300046517 | Bacteria | 8950 |
| 1248 | Ga0495630_0012217 | 3300046517 | Bacteria | 6229 |
| 1249 | Ga0495630_0014654 | 3300046517 | Bacteria | 5715 |
| 1250 | Ga0495630_0049662 | 3300046517 | Bacteria | 3139 |
| 1251 | Ga0495630_0300427 | 3300046517 | Bacteria | 1227 |
| 1252 | Ga0495630_0377004 | 3300046517 | Bacteria | 1086 |
| 1253 | Ga0495630_0664051 | 3300046517 | Bacteria | 798 |
| 1254 | Ga0495630_0763889 | 3300046517 | Unclassified | 738 |
| 1255 | Ga0495630_0895376 | 3300046517 | Bacteria | 676 |
| 1256 | Ga0495631_0074822 | 3300046518 | Bacteria | 1462 |
| 1257 | Ga0495631_0128341 | 3300046518 | Bacteria | 1090 |
| 1258 | Ga0495644_0041791 | 3300046523 | Bacteria | 1727 |
| 1259 | Ga0495644_0150987 | 3300046523 | Bacteria | 889 |
| 1260 | Ga0495644_0216083 | 3300046523 | Unclassified | 741 |
| 1261 | Ga0495644_0348068 | 3300046523 | Unclassified | 583 |
| 1262 | Ga0495663_0060997 | 3300046525 | Bacteria | 1186 |
| 1263 | Ga0495666_0004926 | 3300046526 | Bacteria | 6759 |
| 1264 | Ga0495666_0114106 | 3300046526 | Bacteria | 1268 |
| 1265 | Ga0495642_0215819 | 3300046528 | Bacteria | 837 |
| 1266 | Ga0495652_0056986 | 3300046529 | Bacteria | 3316 |
| 1267 | Ga0495652_0186191 | 3300046529 | Unclassified | 1588 |
| 1268 | Ga0495652_0359291 | 3300046529 | Bacteria | 1041 |
| 1269 | Ga0495652_0486924 | 3300046529 | Bacteria | 857 |
| 1270 | Ga0495654_0155520 | 3300046530 | Bacteria | 1008 |
| 1271 | Ga0495665_0003066 | 3300046531 | Bacteria | 9037 |
| 1272 | Ga0495640_0005710 | 3300046533 | Bacteria | 9891 |
| 1273 | Ga0495640_0059272 | 3300046533 | Bacteria | 2608 |
| 1274 | Ga0495640_0203888 | 3300046533 | Bacteria | 1252 |
| 1275 | Ga0495640_0268404 | 3300046533 | Bacteria | 1065 |
| 1276 | Ga0495586_0010275 | 3300046535 | Bacteria | 4979 |
| 1277 | Ga0495586_0237032 | 3300046535 | Archaea | 1039 |
| 1278 | Ga0495586_0418289 | 3300046535 | Bacteria | 772 |
| 1279 | Ga0495587_0018904 | 3300046536 | Bacteria | 4271 |
| 1280 | Ga0495587_0276083 | 3300046536 | Bacteria | 942 |
| 1281 | Ga0495587_0458999 | 3300046536 | Bacteria | 705 |
| 1282 | Ga0495598_0217895 | 3300046537 | Unclassified | 696 |
| 1283 | Ga0495598_0248517 | 3300046537 | Bacteria | 658 |
| 1284 | Ga0495609_0058397 | 3300046538 | Bacteria | 1706 |
| 1285 | Ga0495609_0160602 | 3300046538 | Bacteria | 953 |
| 1286 | Ga0495609_0278146 | 3300046538 | Unclassified | 685 |
| 1287 | Ga0495597_0044856 | 3300046542 | Bacteria | 1965 |
| 1288 | Ga0495645_0075828 | 3300046543 | Bacteria | 2421 |
| 1289 | Ga0495645_0247901 | 3300046543 | Bacteria | 1185 |
| 1290 | Ga0495667_0002394 | 3300046559 | Bacteria | 12542 |
| 1291 | Ga0495667_0011408 | 3300046559 | Bacteria | 6014 |
| 1292 | Ga0495667_0059259 | 3300046559 | Bacteria | 2513 |
| 1293 | Ga0495667_0384780 | 3300046559 | Bacteria | 884 |
| 1294 | Ga0495667_0824746 | 3300046559 | Bacteria | 571 |
| 1295 | Ga0495656_0034484 | 3300046615 | Unclassified | 2073 |
| 1296 | Ga0495656_0205769 | 3300046615 | Unclassified | 978 |
| 1297 | Ga0495656_0219373 | 3300046615 | Unclassified | 950 |
| 1298 | Ga0495668_0095384 | 3300046616 | Bacteria | 1628 |
| 1299 | Ga0495634_0007684 | 3300046642 | Bacteria | 8070 |
| 1300 | Ga0495634_0090980 | 3300046642 | Bacteria | 1981 |
| 1301 | Ga0495634_0094676 | 3300046642 | Bacteria | 1935 |
| 1302 | Ga0495611_0117080 | 3300046648 | Bacteria | 1242 |
| 1303 | Ga0495611_0423962 | 3300046648 | Bacteria | 607 |
| 1304 | Ga0495611_0572891 | 3300046648 | Unclassified | 511 |
| 1305 | Ga0495635_0032552 | 3300046663 | Bacteria | 3617 |
| 1306 | Ga0495635_0097529 | 3300046663 | Bacteria | 2009 |
| 1307 | Ga0495635_0143744 | 3300046663 | Bacteria | 1624 |
| 1308 | Ga0495635_0146998 | 3300046663 | Bacteria | 1604 |
| 1309 | Ga0495659_0049277 | 3300046664 | Bacteria | 1529 |
| 1310 | Ga0495659_0085016 | 3300046664 | Bacteria | 1206 |
| 1311 | Ga0495659_0089558 | 3300046664 | Bacteria | 1179 |
| 1312 | Ga0495661_0369150 | 3300046665 | Bacteria | 703 |
| 1313 | Ga0495588_0011592 | 3300046674 | Bacteria | 4141 |
| 1314 | Ga0495588_0124819 | 3300046674 | Bacteria | 1357 |
| 1315 | Ga0495588_0217559 | 3300046674 | Bacteria | 1008 |
| 1316 | Ga0495657_0002882 | 3300046675 | Bacteria | 14276 |
| 1317 | Ga0495657_0007489 | 3300046675 | Bacteria | 8435 |
| 1318 | Ga0495657_0031304 | 3300046675 | Bacteria | 3718 |
| 1319 | Ga0495657_0073721 | 3300046675 | Bacteria | 2222 |
| 1320 | Ga0495657_0757048 | 3300046675 | Unclassified | 556 |
| 1321 | Ga0495599_0181842 | 3300046678 | Bacteria | 1296 |
| 1322 | Ga0495599_0266371 | 3300046678 | Bacteria | 1040 |
| 1323 | Ga0495623_0104581 | 3300046679 | Bacteria | 1721 |
| 1324 | Ga0495646_0039461 | 3300046680 | Bacteria | 2911 |
| 1325 | Ga0495646_0225331 | 3300046680 | Bacteria | 1012 |
| 1326 | Ga0495647_0001687 | 3300046681 | Bacteria | 6841 |
| 1327 | Ga0495647_0016729 | 3300046681 | Archaea | 2587 |
| 1328 | Ga0495647_0022639 | 3300046681 | Bacteria | 2271 |
| 1329 | Ga0495647_0025191 | 3300046681 | Bacteria | 2171 |
| 1330 | Ga0495647_0456477 | 3300046681 | Bacteria | 592 |
| 1331 | Ga0495658_0003974 | 3300046683 | Bacteria | 7289 |
| 1332 | Ga0495658_0008700 | 3300046683 | Bacteria | 5040 |
| 1333 | Ga0495658_0009164 | 3300046683 | Bacteria | 4921 |
| 1334 | Ga0495658_0168164 | 3300046683 | Bacteria | 1355 |
| 1335 | Ga0495658_0276223 | 3300046683 | Unclassified | 1060 |
| 1336 | Ga0495658_0393755 | 3300046683 | Unclassified | 883 |
| 1337 | Ga0495669_0436511 | 3300046684 | Unclassified | 636 |
| 1338 | Ga0495613_0007500 | 3300046689 | Bacteria | 8125 |
| 1339 | Ga0495613_0007806 | 3300046689 | Bacteria | 7962 |
| 1340 | Ga0495613_0058553 | 3300046689 | Unclassified | 2827 |
| 1341 | Ga0495613_0166399 | 3300046689 | Bacteria | 1566 |
| 1342 | Ga0495613_0186013 | 3300046689 | Bacteria | 1470 |
| 1343 | Ga0495624_0017436 | 3300046690 | Bacteria | 4822 |
| 1344 | Ga0495624_0025162 | 3300046690 | Bacteria | 3911 |
| 1345 | Ga0495624_0106819 | 3300046690 | Bacteria | 1722 |
| 1346 | Ga0495624_0116989 | 3300046690 | Bacteria | 1638 |
| 1347 | Ga0495670_0380383 | 3300046691 | Bacteria | 762 |
| 1348 | Ga0495670_0406413 | 3300046691 | Unclassified | 736 |
| 1349 | Ga0495670_0512406 | 3300046691 | Unclassified | 652 |
| 1350 | Ga0495671_0033411 | 3300046692 | Bacteria | 2621 |
| 1351 | Ga0495671_0263162 | 3300046692 | Unclassified | 832 |
| 1352 | Ga0495671_0577595 | 3300046692 | Unclassified | 535 |
| 1353 | Ga0495589_0024325 | 3300046794 | Bacteria | 3079 |
| 1354 | Ga0495589_0050674 | 3300046794 | Bacteria | 2053 |
| 1355 | Ga0495589_0157621 | 3300046794 | Bacteria | 1082 |
| 1356 | Ga0495600_0002865 | 3300046809 | Bacteria | 10041 |
| 1357 | Ga0495600_0048618 | 3300046809 | Bacteria | 2767 |
| 1358 | Ga0495600_0068544 | 3300046809 | Bacteria | 2318 |
| 1359 | Ga0495581_0001208 | 3300047315 | Bacteria | 14210 |
| 1360 | Ga0495581_0005647 | 3300047315 | Bacteria | 7252 |
| 1361 | Ga0495581_0006900 | 3300047315 | Bacteria | 6583 |
| 1362 | Ga0495581_0262662 | 3300047315 | Bacteria | 1009 |
| 1363 | Ga0495604_0038158 | 3300047317 | Bacteria | 3780 |
| 1364 | Ga0495604_0052135 | 3300047317 | Bacteria | 3170 |
| 1365 | Ga0495604_0212373 | 3300047317 | Bacteria | 1336 |
| 1366 | Ga0495636_0096962 | 3300047318 | Bacteria | 1286 |
| 1367 | Ga0495674_0024852 | 3300047319 | Bacteria | 5499 |
| 1368 | Ga0495674_0036549 | 3300047319 | Bacteria | 4420 |
| 1369 | Ga0495674_0046908 | 3300047319 | Bacteria | 3833 |
| 1370 | Ga0495674_0399363 | 3300047319 | Bacteria | 1110 |
| 1371 | Ga0495674_0764728 | 3300047319 | Unclassified | 754 |
| 1372 | Ga0495676_0009426 | 3300047321 | Bacteria | 8891 |
| 1373 | Ga0495676_0011656 | 3300047321 | Bacteria | 7931 |
| 1374 | Ga0495676_0069159 | 3300047321 | Bacteria | 2725 |
| 1375 | Ga0495676_0127580 | 3300047321 | Bacteria | 1841 |
| 1376 | Ga0495676_0618182 | 3300047321 | Bacteria | 705 |
| 1377 | Ga0495680_0003404 | 3300047322 | Bacteria | 15696 |
| 1378 | Ga0495680_0009714 | 3300047322 | Bacteria | 8635 |
| 1379 | Ga0495680_0015569 | 3300047322 | Bacteria | 6559 |
| 1380 | Ga0495680_0070806 | 3300047322 | Bacteria | 2657 |
| 1381 | Ga0495680_0246039 | 3300047322 | Unclassified | 1269 |
| 1382 | Ga0495680_0436988 | 3300047322 | Bacteria | 898 |
| 1383 | Ga0495675_0024154 | 3300047444 | Bacteria | 3875 |
| 1384 | Ga0495675_0059777 | 3300047444 | Bacteria | 2416 |
| 1385 | Ga0495675_0547578 | 3300047444 | Bacteria | 660 |
| 1386 | Ga0495675_0610601 | 3300047444 | Bacteria | 618 |
| 1387 | Ga0495677_0131550 | 3300047445 | Bacteria | 958 |
| 1388 | Ga0495677_0390650 | 3300047445 | Unclassified | 550 |
| 1389 | Ga0495685_103038 | 3300047447 | Bacteria | 942 |
| 1390 | Ga0495685_127005 | 3300047447 | Bacteria | 835 |
| 1391 | Ga0495684_0007256 | 3300047471 | Bacteria | 8598 |
| 1392 | Ga0495684_0043180 | 3300047471 | Bacteria | 3451 |
| 1393 | Ga0495684_0063068 | 3300047471 | Unclassified | 2818 |
| 1394 | Ga0495684_0604102 | 3300047471 | Bacteria | 740 |
| 1395 | Ga0495593_0005150 | 3300047673 | Bacteria | 7726 |
| 1396 | Ga0495593_0089388 | 3300047673 | Bacteria | 1587 |
| 1397 | Ga0495593_0254040 | 3300047673 | Bacteria | 880 |
| 1398 | Ga0495602_0094214 | 3300048088 | Bacteria | 2475 |
| 1399 | Ga0495602_0293140 | 3300048088 | Bacteria | 1193 |
| 1400 | Ga0495602_0425490 | 3300048088 | Unclassified | 942 |
| 1401 | Ga0495614_0004846 | 3300048089 | Bacteria | 6073 |
| 1402 | Ga0495614_0323171 | 3300048089 | Bacteria | 716 |
| 1403 | Ga0495615_0040354 | 3300048090 | Bacteria | 1162 |
| 1404 | Ga0495626_0184609 | 3300048091 | Unclassified | 863 |
| 1405 | Ga0496100_0005825 | 3300048903 | Bacteria | 6666 |
| 1406 | Ga0496100_0044008 | 3300048903 | Bacteria | 2857 |
| 1407 | Ga0496100_0055157 | 3300048903 | Bacteria | 2595 |
| 1408 | Ga0496100_0070479 | 3300048903 | Bacteria | 2331 |
| 1409 | Ga0496100_0095799 | 3300048903 | Bacteria | 2035 |
| 1410 | Ga0496100_0114441 | 3300048903 | Bacteria | 1879 |
| 1411 | Ga0496100_0146099 | 3300048903 | Unclassified | 1682 |
| 1412 | Ga0496100_0152529 | 3300048903 | Bacteria | 1649 |
| 1413 | Ga0496100_0238489 | 3300048903 | Unclassified | 1341 |
| 1414 | Ga0496100_0360325 | 3300048903 | Unclassified | 1100 |
| 1415 | Ga0496100_0548094 | 3300048903 | Bacteria | 894 |
| 1416 | Ga0496100_1498511 | 3300048903 | Unclassified | 533 |
| 1417 | Ga0496101_0002047 | 3300048904 | Bacteria | 12269 |
| 1418 | Ga0496101_0004093 | 3300048904 | Bacteria | 9126 |
| 1419 | Ga0496101_0010090 | 3300048904 | Bacteria | 6226 |
| 1420 | Ga0496101_0013413 | 3300048904 | Bacteria | 5488 |
| 1421 | Ga0496101_0067940 | 3300048904 | Bacteria | 2604 |
| 1422 | Ga0496101_0075113 | 3300048904 | Unclassified | 2487 |
| 1423 | Ga0496101_0080595 | 3300048904 | Unclassified | 2405 |
| 1424 | Ga0496101_0118210 | 3300048904 | Bacteria | 2002 |
| 1425 | Ga0496101_0270776 | 3300048904 | Unclassified | 1326 |
| 1426 | Ga0496101_0293273 | 3300048904 | Bacteria | 1273 |
| 1427 | Ga0496101_0523755 | 3300048904 | Bacteria | 937 |
| 1428 | Ga0496102_0011058 | 3300048905 | Bacteria | 7774 |
| 1429 | Ga0496102_0014471 | 3300048905 | Bacteria | 6855 |
| 1430 | Ga0496102_0058806 | 3300048905 | Bacteria | 3513 |
| 1431 | Ga0496102_0060968 | 3300048905 | Bacteria | 3451 |
| 1432 | Ga0496102_0065835 | 3300048905 | Unclassified | 3322 |
| 1433 | Ga0496102_0074067 | 3300048905 | Bacteria | 3130 |
| 1434 | Ga0496102_0082052 | 3300048905 | Bacteria | 2974 |
| 1435 | Ga0496102_0116052 | 3300048905 | Unclassified | 2498 |
| 1436 | Ga0496102_0116403 | 3300048905 | Bacteria | 2494 |
| 1437 | Ga0496102_0273788 | 3300048905 | Unclassified | 1592 |
| 1438 | Ga0496102_0903700 | 3300048905 | Bacteria | 805 |
| 1439 | Ga0496102_1146694 | 3300048905 | Bacteria | 697 |
| 1440 | Ga0496102_1765814 | 3300048905 | Bacteria | 536 |
| 1441 | Ga0496103_0010922 | 3300048906 | Bacteria | 5375 |
| 1442 | Ga0496103_0044183 | 3300048906 | Bacteria | 2745 |
| 1443 | Ga0496103_0086026 | 3300048906 | Bacteria | 1981 |
| 1444 | Ga0496103_0101894 | 3300048906 | Unclassified | 1818 |
| 1445 | Ga0496103_0115648 | 3300048906 | Bacteria | 1706 |
| 1446 | Ga0496103_0144295 | 3300048906 | Bacteria | 1523 |
| 1447 | Ga0496103_0158013 | 3300048906 | Bacteria | 1454 |
| 1448 | Ga0496103_0257248 | 3300048906 | Bacteria | 1123 |
| 1449 | Ga0496103_0739397 | 3300048906 | Unclassified | 622 |
| 1450 | Ga0496103_0771140 | 3300048906 | Unclassified | 607 |
| 1451 | Ga0496103_0943953 | 3300048906 | Bacteria | 539 |
| 1452 | Ga0496104_0007356 | 3300048907 | Bacteria | 9724 |
| 1453 | Ga0496104_0012742 | 3300048907 | Bacteria | 7574 |
| 1454 | Ga0496104_0015042 | 3300048907 | Bacteria | 7002 |
| 1455 | Ga0496104_0035843 | 3300048907 | Bacteria | 4634 |
| 1456 | Ga0496104_0076396 | 3300048907 | Bacteria | 3190 |
| 1457 | Ga0496104_0081221 | 3300048907 | Bacteria | 3091 |
| 1458 | Ga0496104_0157485 | 3300048907 | Unclassified | 2179 |
| 1459 | Ga0496104_0185026 | 3300048907 | Bacteria | 1994 |
| 1460 | Ga0496104_0322304 | 3300048907 | Unclassified | 1458 |
| 1461 | Ga0496104_1390039 | 3300048907 | Bacteria | 605 |
| 1462 | Ga0496105_0012484 | 3300048908 | Bacteria | 6726 |
| 1463 | Ga0496105_0044992 | 3300048908 | Bacteria | 3642 |
| 1464 | Ga0496105_0053215 | 3300048908 | Bacteria | 3343 |
| 1465 | Ga0496105_0062233 | 3300048908 | Bacteria | 3079 |
| 1466 | Ga0496105_0115849 | 3300048908 | Bacteria | 2210 |
| 1467 | Ga0496105_0195554 | 3300048908 | Bacteria | 1652 |
| 1468 | Ga0496105_0233677 | 3300048908 | Unclassified | 1493 |
| 1469 | Ga0496105_0272561 | 3300048908 | Bacteria | 1366 |
| 1470 | Ga0496105_0362525 | 3300048908 | Bacteria | 1156 |
| 1471 | Ga0496105_1003945 | 3300048908 | Unclassified | 624 |
| 1472 | Ga0496106_0000799 | 3300048909 | Bacteria | 22768 |
| 1473 | Ga0496106_0001574 | 3300048909 | Bacteria | 17165 |
| 1474 | Ga0496106_0003932 | 3300048909 | Bacteria | 11102 |
| 1475 | Ga0496106_0005483 | 3300048909 | Bacteria | 9386 |
| 1476 | Ga0496106_0014611 | 3300048909 | Bacteria | 5802 |
| 1477 | Ga0496106_0039427 | 3300048909 | Bacteria | 3537 |
| 1478 | Ga0496106_0086489 | 3300048909 | Unclassified | 2414 |
| 1479 | Ga0496106_0246025 | 3300048909 | Unclassified | 1429 |
| 1480 | Ga0496106_1257328 | 3300048909 | Bacteria | 576 |
| 1481 | Ga0496107_0000717 | 3300048910 | Bacteria | 18921 |
| 1482 | Ga0496107_0002487 | 3300048910 | Bacteria | 11969 |
| 1483 | Ga0496107_0009850 | 3300048910 | Bacteria | 6628 |
| 1484 | Ga0496107_0016756 | 3300048910 | Bacteria | 5151 |
| 1485 | Ga0496107_0022269 | 3300048910 | Bacteria | 4478 |
| 1486 | Ga0496107_0055259 | 3300048910 | Unclassified | 2868 |
| 1487 | Ga0496107_0056046 | 3300048910 | Bacteria | 2847 |
| 1488 | Ga0496107_0167644 | 3300048910 | Bacteria | 1629 |
| 1489 | Ga0496107_0198951 | 3300048910 | Unclassified | 1489 |
| 1490 | Ga0496107_0212749 | 3300048910 | Bacteria | 1438 |
| 1491 | Ga0496107_0219423 | 3300048910 | Bacteria | 1414 |
| 1492 | Ga0496107_0705900 | 3300048910 | Bacteria | 742 |
| 1493 | Ga0496107_1003046 | 3300048910 | Unclassified | 606 |
| 1494 | Ga0496108_0000945 | 3300048911 | Bacteria | 22605 |
| 1495 | Ga0496108_0012922 | 3300048911 | Bacteria | 6803 |
| 1496 | Ga0496108_0014614 | 3300048911 | Bacteria | 6409 |
| 1497 | Ga0496108_0025821 | 3300048911 | Bacteria | 4844 |
| 1498 | Ga0496108_0030570 | 3300048911 | Bacteria | 4463 |
| 1499 | Ga0496108_0034296 | 3300048911 | Bacteria | 4216 |
| 1500 | Ga0496108_0071680 | 3300048911 | Bacteria | 2924 |
| 1501 | Ga0496108_0100462 | 3300048911 | Bacteria | 2467 |
| 1502 | Ga0496108_0145074 | 3300048911 | Unclassified | 2046 |
| 1503 | Ga0496108_0594933 | 3300048911 | Unclassified | 964 |
| 1504 | Ga0496109_0000523 | 3300048912 | Bacteria | 32527 |
| 1505 | Ga0496109_0006830 | 3300048912 | Bacteria | 9620 |
| 1506 | Ga0496109_0012241 | 3300048912 | Bacteria | 7403 |
| 1507 | Ga0496109_0014408 | 3300048912 | Bacteria | 6879 |
| 1508 | Ga0496109_0015382 | 3300048912 | Bacteria | 6667 |
| 1509 | Ga0496109_0026179 | 3300048912 | Bacteria | 5200 |
| 1510 | Ga0496109_0043976 | 3300048912 | Bacteria | 4050 |
| 1511 | Ga0496109_0088670 | 3300048912 | Bacteria | 2859 |
| 1512 | Ga0496109_0218266 | 3300048912 | Unclassified | 1793 |
| 1513 | Ga0496109_0232548 | 3300048912 | Bacteria | 1734 |
| 1514 | Ga0496109_0325372 | 3300048912 | Unclassified | 1451 |
| 1515 | Ga0496109_0388445 | 3300048912 | Unclassified | 1319 |
| 1516 | Ga0496109_0426592 | 3300048912 | Bacteria | 1253 |
| 1517 | Ga0496109_0456860 | 3300048912 | Bacteria | 1206 |
| 1518 | Ga0496109_0639746 | 3300048912 | Unclassified | 1000 |
| 1519 | Ga0496109_0709463 | 3300048912 | Unclassified | 943 |
| 1520 | Ga0496109_0801705 | 3300048912 | Bacteria | 880 |
| 1521 | Ga0496109_0803665 | 3300048912 | Bacteria | 878 |
| 1522 | Ga0496109_2004898 | 3300048912 | Unclassified | 511 |
| 1523 | Ga0496110_0000677 | 3300048913 | Bacteria | 23384 |
| 1524 | Ga0496110_0016904 | 3300048913 | Bacteria | 6097 |
| 1525 | Ga0496110_0021495 | 3300048913 | Bacteria | 5465 |
| 1526 | Ga0496110_0032996 | 3300048913 | Bacteria | 4476 |
| 1527 | Ga0496110_0033108 | 3300048913 | Bacteria | 4469 |
| 1528 | Ga0496110_0050369 | 3300048913 | Bacteria | 3656 |
| 1529 | Ga0496110_0369734 | 3300048913 | Bacteria | 1306 |
| 1530 | Ga0496110_0462470 | 3300048913 | Bacteria | 1156 |
| 1531 | Ga0496110_0464627 | 3300048913 | Bacteria | 1153 |
| 1532 | Ga0496110_0627743 | 3300048913 | Unclassified | 973 |
| 1533 | Ga0496110_1526395 | 3300048913 | Bacteria | 578 |
| 1534 | Ga0496111_0000744 | 3300048914 | Bacteria | 17364 |
| 1535 | Ga0496111_0002134 | 3300048914 | Bacteria | 11823 |
| 1536 | Ga0496111_0011040 | 3300048914 | Bacteria | 6078 |
| 1537 | Ga0496111_0020928 | 3300048914 | Bacteria | 4561 |
| 1538 | Ga0496111_0025941 | 3300048914 | Bacteria | 4136 |
| 1539 | Ga0496111_0132001 | 3300048914 | Bacteria | 1848 |
| 1540 | Ga0496111_0275370 | 3300048914 | Bacteria | 1248 |
| 1541 | Ga0496111_0361661 | 3300048914 | Bacteria | 1074 |
| 1542 | Ga0496111_0721237 | 3300048914 | Unclassified | 724 |
| 1543 | Ga0496111_1295513 | 3300048914 | Unclassified | 513 |
| 1544 | Ga0496112_0000731 | 3300048915 | Bacteria | 22853 |
| 1545 | Ga0496112_0000874 | 3300048915 | Bacteria | 21603 |
| 1546 | Ga0496112_0003094 | 3300048915 | Bacteria | 13636 |
| 1547 | Ga0496112_0013633 | 3300048915 | Bacteria | 7511 |
| 1548 | Ga0496112_0016012 | 3300048915 | Bacteria | 7011 |
| 1549 | Ga0496112_0016153 | 3300048915 | Bacteria | 6983 |
| 1550 | Ga0496112_0053250 | 3300048915 | Bacteria | 3974 |
| 1551 | Ga0496112_0104965 | 3300048915 | Bacteria | 2795 |
| 1552 | Ga0496112_0120058 | 3300048915 | Bacteria | 2599 |
| 1553 | Ga0496112_0131346 | 3300048915 | Unclassified | 2475 |
| 1554 | Ga0496112_0139713 | 3300048915 | Bacteria | 2392 |
| 1555 | Ga0496112_0217817 | 3300048915 | Unclassified | 1865 |
| 1556 | Ga0496112_0270877 | 3300048915 | Bacteria | 1646 |
| 1557 | Ga0496112_0279855 | 3300048915 | Unclassified | 1615 |
| 1558 | Ga0496112_0297273 | 3300048915 | Bacteria | 1560 |
| 1559 | Ga0496112_0419821 | 3300048915 | Unclassified | 1276 |
| 1560 | Ga0496112_0615909 | 3300048915 | Unclassified | 1017 |
| 1561 | Ga0496112_0770533 | 3300048915 | Unclassified | 888 |
| 1562 | Ga0496112_1745868 | 3300048915 | Unclassified | 534 |
| 1563 | Ga0496113_0001429 | 3300048916 | Bacteria | 13251 |
| 1564 | Ga0496113_0004935 | 3300048916 | Bacteria | 8261 |
| 1565 | Ga0496113_0032226 | 3300048916 | Bacteria | 3808 |
| 1566 | Ga0496113_0035909 | 3300048916 | Bacteria | 3628 |
| 1567 | Ga0496113_0231319 | 3300048916 | Unclassified | 1474 |
| 1568 | Ga0496113_0240006 | 3300048916 | Bacteria | 1446 |
| 1569 | Ga0496113_0286729 | 3300048916 | Archaea | 1317 |
| 1570 | Ga0496113_0321052 | 3300048916 | Unclassified | 1241 |
| 1571 | Ga0496113_0457475 | 3300048916 | Unclassified | 1025 |
| 1572 | Ga0496113_1311430 | 3300048916 | Bacteria | 563 |
| 1573 | Ga0496114_0006868 | 3300048917 | Bacteria | 8964 |
| 1574 | Ga0496114_0009546 | 3300048917 | Bacteria | 7700 |
| 1575 | Ga0496114_0024509 | 3300048917 | Bacteria | 4927 |
| 1576 | Ga0496114_0038353 | 3300048917 | Bacteria | 3964 |
| 1577 | Ga0496114_0042427 | 3300048917 | Bacteria | 3771 |
| 1578 | Ga0496114_0052098 | 3300048917 | Bacteria | 3409 |
| 1579 | Ga0496114_0052891 | 3300048917 | Bacteria | 3384 |
| 1580 | Ga0496114_0075653 | 3300048917 | Unclassified | 2836 |
| 1581 | Ga0496114_0125355 | 3300048917 | Bacteria | 2213 |
| 1582 | Ga0496114_0129105 | 3300048917 | Bacteria | 2181 |
| 1583 | Ga0496114_0174815 | 3300048917 | Unclassified | 1873 |
| 1584 | Ga0496114_0525986 | 3300048917 | Bacteria | 1046 |
| 1585 | Ga0496114_0751861 | 3300048917 | Bacteria | 852 |
| 1586 | Ga0496114_1368815 | 3300048917 | Unclassified | 595 |
| 1587 | Ga0496114_1410462 | 3300048917 | Bacteria | 584 |
| 1588 | Ga0496114_1477079 | 3300048917 | Bacteria | 567 |
| 1589 | Ga0496115_0001511 | 3300048918 | Bacteria | 16712 |
| 1590 | Ga0496115_0006793 | 3300048918 | Bacteria | 8392 |
| 1591 | Ga0496115_0017491 | 3300048918 | Bacteria | 5483 |
| 1592 | Ga0496115_0042367 | 3300048918 | Bacteria | 3626 |
| 1593 | Ga0496115_0046460 | 3300048918 | Bacteria | 3470 |
| 1594 | Ga0496115_0199687 | 3300048918 | Bacteria | 1652 |
| 1595 | Ga0496115_0244740 | 3300048918 | Bacteria | 1478 |
| 1596 | Ga0496115_0293773 | 3300048918 | Archaea | 1332 |
| 1597 | Ga0496115_0439264 | 3300048918 | Unclassified | 1055 |
| 1598 | Ga0496115_0718252 | 3300048918 | Bacteria | 784 |
| 1599 | Ga0496115_1040568 | 3300048918 | Bacteria | 624 |
| 1600 | Ga0501291_068187 | 3300049514 | Unclassified | 684 |
| 1601 | Ga0501031_0000565 | 3300049568 | Bacteria | 21619 |
| 1602 | Ga0501031_0001953 | 3300049568 | Bacteria | 12999 |
| 1603 | Ga0501031_0017346 | 3300049568 | Bacteria | 4677 |
| 1604 | Ga0501031_0052355 | 3300049568 | Bacteria | 2660 |
| 1605 | Ga0501031_0151776 | 3300049568 | Bacteria | 1514 |
| 1606 | Ga0501032_0000274 | 3300049569 | Bacteria | 43406 |
| 1607 | Ga0501032_0036219 | 3300049569 | Bacteria | 3369 |
| 1608 | Ga0501032_0395513 | 3300049569 | Bacteria | 888 |
| 1609 | Ga0501032_0586813 | 3300049569 | Bacteria | 709 |
| 1610 | Ga0501033_0000920 | 3300049570 | Bacteria | 26908 |
| 1611 | Ga0501033_0001164 | 3300049570 | Bacteria | 23800 |
| 1612 | Ga0501033_0192595 | 3300049570 | Bacteria | 1458 |
| 1613 | Ga0501033_0244051 | 3300049570 | Bacteria | 1274 |
| 1614 | Ga0501033_0257882 | 3300049570 | Bacteria | 1234 |
| 1615 | Ga0501033_0861923 | 3300049570 | Bacteria | 610 |
| 1616 | Ga0501034_0041370 | 3300049571 | Bacteria | 4662 |
| 1617 | Ga0501034_0044193 | 3300049571 | Bacteria | 4506 |
| 1618 | Ga0501034_0227380 | 3300049571 | Unclassified | 1816 |
| 1619 | Ga0501034_0812600 | 3300049571 | Bacteria | 827 |
| 1620 | Ga0501036_0000971 | 3300049572 | Bacteria | 21648 |
| 1621 | Ga0501036_0007285 | 3300049572 | Bacteria | 9010 |
| 1622 | Ga0501036_0053329 | 3300049572 | Bacteria | 3424 |
| 1623 | Ga0501036_0069247 | 3300049572 | Bacteria | 2985 |
| 1624 | Ga0501036_0078909 | 3300049572 | Bacteria | 2785 |
| 1625 | Ga0501036_0230126 | 3300049572 | Bacteria | 1556 |
| 1626 | Ga0501036_0275511 | 3300049572 | Bacteria | 1408 |
| 1627 | Ga0501036_0529856 | 3300049572 | Bacteria | 979 |
| 1628 | Ga0501036_0539429 | 3300049572 | Bacteria | 970 |
| 1629 | Ga0501037_0000519 | 3300049573 | Bacteria | 30933 |
| 1630 | Ga0501037_0029289 | 3300049573 | Bacteria | 4067 |
| 1631 | Ga0501037_0074126 | 3300049573 | Bacteria | 2474 |
| 1632 | Ga0501037_0459491 | 3300049573 | Bacteria | 868 |
| 1633 | Ga0501038_0000186 | 3300049574 | Bacteria | 53569 |
| 1634 | Ga0501038_0019415 | 3300049574 | Bacteria | 6125 |
| 1635 | Ga0501038_0052782 | 3300049574 | Bacteria | 3503 |
| 1636 | Ga0501038_0068760 | 3300049574 | Bacteria | 3010 |
| 1637 | Ga0501038_0279708 | 3300049574 | Bacteria | 1314 |
| 1638 | Ga0501038_0492587 | 3300049574 | Archaea | 938 |
| 1639 | Ga0501038_0821105 | 3300049574 | Bacteria | 690 |
| 1640 | Ga0501039_0003315 | 3300049575 | Bacteria | 12041 |
| 1641 | Ga0501039_0005307 | 3300049575 | Bacteria | 9744 |
| 1642 | Ga0501039_0024937 | 3300049575 | Bacteria | 4594 |
| 1643 | Ga0501039_0038293 | 3300049575 | Bacteria | 3703 |
| 1644 | Ga0501039_0252240 | 3300049575 | Bacteria | 1387 |
| 1645 | Ga0501039_0428077 | 3300049575 | Bacteria | 1039 |
| 1646 | Ga0501039_0735603 | 3300049575 | Bacteria | 771 |
| 1647 | Ga0501039_0775047 | 3300049575 | Unclassified | 748 |
| 1648 | Ga0501040_0000605 | 3300049576 | Bacteria | 21929 |
| 1649 | Ga0501040_0011880 | 3300049576 | Bacteria | 5696 |
| 1650 | Ga0501040_0019519 | 3300049576 | Bacteria | 4508 |
| 1651 | Ga0501040_0051514 | 3300049576 | Bacteria | 2816 |
| 1652 | Ga0501040_0066560 | 3300049576 | Bacteria | 2482 |
| 1653 | Ga0501040_0081299 | 3300049576 | Bacteria | 2245 |
| 1654 | Ga0501040_0139950 | 3300049576 | Bacteria | 1704 |
| 1655 | Ga0501040_0177177 | 3300049576 | Bacteria | 1510 |
| 1656 | Ga0501040_0288204 | 3300049576 | Bacteria | 1173 |
| 1657 | Ga0501040_1324146 | 3300049576 | Unclassified | 523 |
| 1658 | Ga0501041_0000039 | 3300049577 | Bacteria | 44027 |
| 1659 | Ga0501041_0001797 | 3300049577 | Bacteria | 12014 |
| 1660 | Ga0501041_0002733 | 3300049577 | Bacteria | 10069 |
| 1661 | Ga0501041_0009157 | 3300049577 | Bacteria | 5830 |
| 1662 | Ga0501041_0012510 | 3300049577 | Bacteria | 5027 |
| 1663 | Ga0501041_0066158 | 3300049577 | Bacteria | 2214 |
| 1664 | Ga0501041_0119918 | 3300049577 | Bacteria | 1634 |
| 1665 | Ga0501041_0128225 | 3300049577 | Unclassified | 1580 |
| 1666 | Ga0501041_0403313 | 3300049577 | Bacteria | 866 |
| 1667 | Ga0501042_0001026 | 3300049578 | Bacteria | 15897 |
| 1668 | Ga0501042_0019739 | 3300049578 | Bacteria | 4685 |
| 1669 | Ga0501042_0020182 | 3300049578 | Bacteria | 4635 |
| 1670 | Ga0501042_0026783 | 3300049578 | Bacteria | 4051 |
| 1671 | Ga0501042_0032814 | 3300049578 | Bacteria | 3678 |
| 1672 | Ga0501042_0068932 | 3300049578 | Bacteria | 2529 |
| 1673 | Ga0501042_0076262 | 3300049578 | Bacteria | 2400 |
| 1674 | Ga0501042_0108302 | 3300049578 | Bacteria | 2000 |
| 1675 | Ga0501042_0153166 | 3300049578 | Bacteria | 1662 |
| 1676 | Ga0501042_0164250 | 3300049578 | Bacteria | 1602 |
| 1677 | Ga0501042_0200642 | 3300049578 | Bacteria | 1438 |
| 1678 | Ga0501043_0000171 | 3300049579 | Bacteria | 58361 |
| 1679 | Ga0501043_0005336 | 3300049579 | Bacteria | 10386 |
| 1680 | Ga0501043_0246023 | 3300049579 | Bacteria | 1378 |
| 1681 | Ga0501043_0426922 | 3300049579 | Bacteria | 999 |
| 1682 | Ga0501046_0000177 | 3300049580 | Bacteria | 65024 |
| 1683 | Ga0501046_0002858 | 3300049580 | Bacteria | 16061 |
| 1684 | Ga0501046_0024694 | 3300049580 | Bacteria | 4925 |
| 1685 | Ga0501046_0039756 | 3300049580 | Bacteria | 3764 |
| 1686 | Ga0501046_0057220 | 3300049580 | Bacteria | 3059 |
| 1687 | Ga0501046_0198614 | 3300049580 | Bacteria | 1493 |
| 1688 | Ga0501046_0213206 | 3300049580 | Bacteria | 1432 |
| 1689 | Ga0501046_0250786 | 3300049580 | Bacteria | 1303 |
| 1690 | Ga0501046_0285826 | 3300049580 | Unclassified | 1207 |
| 1691 | Ga0501046_0421445 | 3300049580 | Unclassified | 962 |
| 1692 | Ga0501046_0507227 | 3300049580 | Archaea | 863 |
| 1693 | Ga0501047_0164513 | 3300049581 | Bacteria | 2089 |
| 1694 | Ga0501047_0379778 | 3300049581 | Unclassified | 1247 |
| 1695 | Ga0501048_0004102 | 3300049582 | Bacteria | 11093 |
| 1696 | Ga0501048_0005297 | 3300049582 | Bacteria | 9822 |
| 1697 | Ga0501048_0067803 | 3300049582 | Bacteria | 2521 |
| 1698 | Ga0501048_0119440 | 3300049582 | Bacteria | 1862 |
| 1699 | Ga0501048_0634680 | 3300049582 | Bacteria | 767 |
| 1700 | Ga0501048_0705697 | 3300049582 | Bacteria | 724 |
| 1701 | Ga0501048_0927255 | 3300049582 | Bacteria | 626 |
| 1702 | Ga0501067_0045266 | 3300049583 | Bacteria | 2444 |
| 1703 | Ga0501067_0130184 | 3300049583 | Unclassified | 1400 |
| 1704 | Ga0501067_0152171 | 3300049583 | Unclassified | 1289 |
| 1705 | Ga0501067_0548967 | 3300049583 | Bacteria | 647 |
| 1706 | Ga0501068_0000051 | 3300049584 | Bacteria | 45579 |
| 1707 | Ga0501068_0001051 | 3300049584 | Bacteria | 14629 |
| 1708 | Ga0501068_0007526 | 3300049584 | Bacteria | 6027 |
| 1709 | Ga0501068_0166715 | 3300049584 | Bacteria | 1389 |
| 1710 | Ga0501068_0193277 | 3300049584 | Bacteria | 1289 |
| 1711 | Ga0501068_0248247 | 3300049584 | Bacteria | 1134 |
| 1712 | Ga0501068_0748922 | 3300049584 | Bacteria | 640 |
| 1713 | Ga0501069_0001394 | 3300049585 | Bacteria | 11864 |
| 1714 | Ga0501069_0003701 | 3300049585 | Bacteria | 7861 |
| 1715 | Ga0501069_0010111 | 3300049585 | Bacteria | 4991 |
| 1716 | Ga0501069_0066832 | 3300049585 | Bacteria | 2010 |
| 1717 | Ga0501069_0116106 | 3300049585 | Archaea | 1527 |
| 1718 | Ga0501069_0237298 | 3300049585 | Unclassified | 1062 |
| 1719 | Ga0501070_0002425 | 3300049586 | Bacteria | 16358 |
| 1720 | Ga0501070_0007771 | 3300049586 | Bacteria | 9090 |
| 1721 | Ga0501070_0028281 | 3300049586 | Bacteria | 4701 |
| 1722 | Ga0501070_0507554 | 3300049586 | Bacteria | 968 |
| 1723 | Ga0501070_1295500 | 3300049586 | Bacteria | 556 |
| 1724 | Ga0501070_1438307 | 3300049586 | Unclassified | 523 |
| 1725 | Ga0501071_0000031 | 3300049587 | Bacteria | 47260 |
| 1726 | Ga0501071_0011778 | 3300049587 | Bacteria | 5899 |
| 1727 | Ga0501071_0016912 | 3300049587 | Bacteria | 5019 |
| 1728 | Ga0501071_0040070 | 3300049587 | Bacteria | 3352 |
| 1729 | Ga0501071_0044164 | 3300049587 | Bacteria | 3196 |
| 1730 | Ga0501071_0046669 | 3300049587 | Bacteria | 3111 |
| 1731 | Ga0501071_0233080 | 3300049587 | Bacteria | 1387 |
| 1732 | Ga0501071_0540740 | 3300049587 | Bacteria | 894 |
| 1733 | Ga0501072_0002062 | 3300049588 | Bacteria | 14942 |
| 1734 | Ga0501072_0003142 | 3300049588 | Bacteria | 12427 |
| 1735 | Ga0501072_0006063 | 3300049588 | Bacteria | 9227 |
| 1736 | Ga0501072_0022648 | 3300049588 | Bacteria | 4873 |
| 1737 | Ga0501072_0032316 | 3300049588 | Bacteria | 4098 |
| 1738 | Ga0501072_0129148 | 3300049588 | Bacteria | 2014 |
| 1739 | Ga0501072_0141023 | 3300049588 | Bacteria | 1921 |
| 1740 | Ga0501072_0296827 | 3300049588 | Bacteria | 1284 |
| 1741 | Ga0501072_0383346 | 3300049588 | Bacteria | 1115 |
| 1742 | Ga0501072_0496581 | 3300049588 | Unclassified | 965 |
| 1743 | Ga0501072_0523333 | 3300049588 | Bacteria | 937 |
| 1744 | Ga0501072_0712948 | 3300049588 | Bacteria | 788 |
| 1745 | Ga0501073_0017065 | 3300049589 | Bacteria | 5258 |
| 1746 | Ga0501073_0029774 | 3300049589 | Bacteria | 3901 |
| 1747 | Ga0501073_0104857 | 3300049589 | Bacteria | 1962 |
| 1748 | Ga0501073_0572017 | 3300049589 | Bacteria | 780 |
| 1749 | Ga0501073_0985562 | 3300049589 | Bacteria | 580 |
| 1750 | Ga0501074_0003677 | 3300049590 | Bacteria | 10875 |
| 1751 | Ga0501074_0006826 | 3300049590 | Bacteria | 8248 |
| 1752 | Ga0501074_0014877 | 3300049590 | Bacteria | 5658 |
| 1753 | Ga0501074_0018032 | 3300049590 | Bacteria | 5127 |
| 1754 | Ga0501074_0063362 | 3300049590 | Bacteria | 2663 |
| 1755 | Ga0501074_0133683 | 3300049590 | Bacteria | 1774 |
| 1756 | Ga0501074_0141311 | 3300049590 | Archaea | 1722 |
| 1757 | Ga0501074_0215252 | 3300049590 | Bacteria | 1368 |
| 1758 | Ga0501074_0522739 | 3300049590 | Bacteria | 840 |
| 1759 | Ga0501074_0678683 | 3300049590 | Bacteria | 727 |
| 1760 | Ga0501074_0788415 | 3300049590 | Unclassified | 670 |
| 1761 | Ga0501075_0000266 | 3300049591 | Bacteria | 28552 |
| 1762 | Ga0501075_0001528 | 3300049591 | Bacteria | 15091 |
| 1763 | Ga0501075_0010268 | 3300049591 | Bacteria | 6578 |
| 1764 | Ga0501075_0015269 | 3300049591 | Bacteria | 5509 |
| 1765 | Ga0501075_0076897 | 3300049591 | Bacteria | 2525 |
| 1766 | Ga0501075_0091392 | 3300049591 | Bacteria | 2310 |
| 1767 | Ga0501075_0103867 | 3300049591 | Bacteria | 2159 |
| 1768 | Ga0501075_0122465 | 3300049591 | Bacteria | 1979 |
| 1769 | Ga0501075_0205297 | 3300049591 | Bacteria | 1503 |
| 1770 | Ga0501075_0842279 | 3300049591 | Bacteria | 698 |
| 1771 | Ga0501075_0897915 | 3300049591 | Bacteria | 674 |
| 1772 | Ga0501076_0000634 | 3300049592 | Bacteria | 22428 |
| 1773 | Ga0501076_0008497 | 3300049592 | Bacteria | 7525 |
| 1774 | Ga0501076_0012482 | 3300049592 | Bacteria | 6353 |
| 1775 | Ga0501076_0051824 | 3300049592 | Bacteria | 3249 |
| 1776 | Ga0501076_0090401 | 3300049592 | Bacteria | 2462 |
| 1777 | Ga0501076_0113434 | 3300049592 | Unclassified | 2192 |
| 1778 | Ga0501076_0221187 | 3300049592 | Bacteria | 1547 |
| 1779 | Ga0501076_0221619 | 3300049592 | Bacteria | 1546 |
| 1780 | Ga0501076_0255931 | 3300049592 | Unclassified | 1433 |
| 1781 | Ga0501076_0333464 | 3300049592 | Unclassified | 1244 |
| 1782 | Ga0501077_0000257 | 3300049593 | Bacteria | 31357 |
| 1783 | Ga0501077_0003870 | 3300049593 | Bacteria | 9023 |
| 1784 | Ga0501077_0024781 | 3300049593 | Bacteria | 3809 |
| 1785 | Ga0501077_0030419 | 3300049593 | Bacteria | 3435 |
| 1786 | Ga0501077_0041091 | 3300049593 | Bacteria | 2944 |
| 1787 | Ga0501077_0047937 | 3300049593 | Bacteria | 2714 |
| 1788 | Ga0501077_0072653 | 3300049593 | Bacteria | 2180 |
| 1789 | Ga0501077_0291939 | 3300049593 | Bacteria | 1038 |
| 1790 | Ga0501077_0675403 | 3300049593 | Bacteria | 664 |
| 1791 | Ga0501217_259182 | 3300049661 | Unclassified | 563 |
| 1792 | Ga0501221_145150 | 3300049704 | Bacteria | 625 |
| 1793 | Ga0501079_0000749 | 3300049741 | Bacteria | 22070 |
| 1794 | Ga0501079_0004333 | 3300049741 | Bacteria | 10530 |
| 1795 | Ga0501079_0013423 | 3300049741 | Bacteria | 6247 |
| 1796 | Ga0501079_0020216 | 3300049741 | Bacteria | 5089 |
| 1797 | Ga0501079_0023311 | 3300049741 | Bacteria | 4751 |
| 1798 | Ga0501079_0033233 | 3300049741 | Bacteria | 3968 |
| 1799 | Ga0501079_0069689 | 3300049741 | Bacteria | 2714 |
| 1800 | Ga0501079_0139619 | 3300049741 | Bacteria | 1887 |
| 1801 | Ga0501079_0148633 | 3300049741 | Bacteria | 1826 |
| 1802 | Ga0501079_0154692 | 3300049741 | Bacteria | 1787 |
| 1803 | Ga0501079_0329771 | 3300049741 | Bacteria | 1195 |
| 1804 | Ga0501080_0000105 | 3300049742 | Bacteria | 57665 |
| 1805 | Ga0501080_0058000 | 3300049742 | Bacteria | 3605 |
| 1806 | Ga0501080_0063349 | 3300049742 | Bacteria | 3441 |
| 1807 | Ga0501080_0096107 | 3300049742 | Bacteria | 2750 |
| 1808 | Ga0501080_0246710 | 3300049742 | Bacteria | 1628 |
| 1809 | Ga0501080_0319669 | 3300049742 | Bacteria | 1405 |
| 1810 | Ga0501080_0354833 | 3300049742 | Bacteria | 1324 |
| 1811 | Ga0501080_0857991 | 3300049742 | Bacteria | 793 |
| 1812 | Ga0501081_0000948 | 3300049743 | Bacteria | 17246 |
| 1813 | Ga0501081_0001230 | 3300049743 | Bacteria | 15579 |
| 1814 | Ga0501081_0030364 | 3300049743 | Bacteria | 3658 |
| 1815 | Ga0501081_0034935 | 3300049743 | Bacteria | 3421 |
| 1816 | Ga0501081_0072719 | 3300049743 | Bacteria | 2397 |
| 1817 | Ga0501081_0082141 | 3300049743 | Unclassified | 2257 |
| 1818 | Ga0501081_0170955 | 3300049743 | Bacteria | 1569 |
| 1819 | Ga0501081_0202073 | 3300049743 | Bacteria | 1441 |
| 1820 | Ga0501081_0228180 | 3300049743 | Bacteria | 1355 |
| 1821 | Ga0501081_0451972 | 3300049743 | Bacteria | 954 |
| 1822 | Ga0501081_0791443 | 3300049743 | Bacteria | 713 |
| 1823 | Ga0501081_1464363 | 3300049743 | Bacteria | 518 |
| 1824 | Ga0501083_0000561 | 3300049744 | Bacteria | 23809 |
| 1825 | Ga0501083_0000664 | 3300049744 | Bacteria | 22332 |
| 1826 | Ga0501083_0002572 | 3300049744 | Bacteria | 12477 |
| 1827 | Ga0501083_0069303 | 3300049744 | Bacteria | 2346 |
| 1828 | Ga0501083_0109143 | 3300049744 | Bacteria | 1820 |
| 1829 | Ga0501083_0260090 | 3300049744 | Bacteria | 1129 |
| 1830 | Ga0501083_0378059 | 3300049744 | Bacteria | 921 |
| 1831 | Ga0501083_0452819 | 3300049744 | Bacteria | 835 |
| 1832 | Ga0501266_106026 | 3300049763 | Bacteria | 504 |
| 1833 | Ga0501035_0000457 | 3300049822 | Bacteria | 45780 |
| 1834 | Ga0501035_0001358 | 3300049822 | Bacteria | 25181 |
| 1835 | Ga0501035_0043355 | 3300049822 | Bacteria | 4054 |
| 1836 | Ga0501035_0173630 | 3300049822 | Bacteria | 1861 |
| 1837 | Ga0501035_0653357 | 3300049822 | Bacteria | 852 |
| 1838 | Ga0501044_0002523 | 3300049823 | Bacteria | 20840 |
| 1839 | Ga0501044_0003404 | 3300049823 | Bacteria | 17914 |
| 1840 | Ga0501044_0005188 | 3300049823 | Bacteria | 14499 |
| 1841 | Ga0501044_0236964 | 3300049823 | Archaea | 1770 |
| 1842 | Ga0501044_0579351 | 3300049823 | Bacteria | 1017 |
| 1843 | Ga0501045_0005910 | 3300049824 | Bacteria | 8466 |
| 1844 | Ga0501045_0010848 | 3300049824 | Bacteria | 6388 |
| 1845 | Ga0501045_0022556 | 3300049824 | Bacteria | 4508 |
| 1846 | Ga0501045_0023433 | 3300049824 | Bacteria | 4425 |
| 1847 | Ga0501045_0033134 | 3300049824 | Bacteria | 3746 |
| 1848 | Ga0501045_0068603 | 3300049824 | Bacteria | 2605 |
| 1849 | Ga0501045_0084164 | 3300049824 | Bacteria | 2346 |
| 1850 | Ga0501045_0094985 | 3300049824 | Bacteria | 2205 |
| 1851 | Ga0501045_0113240 | 3300049824 | Bacteria | 2012 |
| 1852 | Ga0501045_0328296 | 3300049824 | Bacteria | 1138 |
| 1853 | Ga0501212_119299 | 3300049851 | Unclassified | 510 |
| 1854 | nmdc:mga03683_174005_c1 | 3300050489 | Unclassified | 979 |
| 1855 | nmdc:mga0yw44_107220_c1 | 3300050492 | Bacteria | 1786 |
| 1856 | nmdc:mga0yw44_186393_c1 | 3300050492 | Bacteria | 1367 |
| 1857 | nmdc:mga0yw44_392421_c1 | 3300050492 | Bacteria | 938 |
| 1858 | nmdc:mga06z11_659728_c1 | 3300050494 | Unclassified | 637 |
| 1859 | nmdc:mga05p37_107758_c1 | 3300050507 | Bacteria | 3428 |
| 1860 | nmdc:mga05p37_16133_c1 | 3300050507 | Bacteria | 8994 |
| 1861 | nmdc:mga05p37_241126_c1 | 3300050507 | Bacteria | 2174 |
| 1862 | nmdc:mga05p37_28617_c1 | 3300050507 | Bacteria | 6797 |
| 1863 | nmdc:mga05p37_433233_c1 | 3300050507 | Bacteria | 1527 |
| 1864 | nmdc:mga05p37_612894_c1 | 3300050507 | Bacteria | 1226 |
| 1865 | nmdc:mga05p37_630460_c1 | 3300050507 | Unclassified | 1205 |
| 1866 | nmdc:mga05p37_66600_c1 | 3300050507 | Bacteria | 4430 |
| 1867 | nmdc:mga05p37_8862_c1 | 3300050507 | Bacteria | 11885 |
| 1868 | nmdc:mga09592_2440_c1 | 3300050508 | Bacteria | 14997 |
| 1869 | nmdc:mga09592_303312_c1 | 3300050508 | Unclassified | 1385 |
| 1870 | nmdc:mga0qj67_41930_c1 | 3300050509 | Bacteria | 3602 |
| 1871 | nmdc:mga0qj67_990670_c1 | 3300050509 | Archaea | 660 |
| 1872 | nmdc:mga06r32_162353_c1 | 3300050510 | Bacteria | 2217 |
| 1873 | nmdc:mga06r32_198785_c1 | 3300050510 | Bacteria | 1992 |
| 1874 | nmdc:mga06r32_42674_c1 | 3300050510 | Bacteria | 4314 |
| 1875 | nmdc:mga06r32_438180_c1 | 3300050510 | Bacteria | 1287 |
| 1876 | nmdc:mga06r32_832643_c1 | 3300050510 | Bacteria | 882 |
| 1877 | nmdc:mga08y16_1040221_c1 | 3300050511 | Bacteria | 797 |
| 1878 | nmdc:mga08y16_1085803_c1 | 3300050511 | Unclassified | 776 |
| 1879 | nmdc:mga08y16_13727_c1 | 3300050511 | Bacteria | 8529 |
| 1880 | nmdc:mga08y16_156192_c1 | 3300050511 | Bacteria | 2371 |
| 1881 | nmdc:mga08y16_479770_c1 | 3300050511 | Unclassified | 1265 |
| 1882 | nmdc:mga08y16_536081_c1 | 3300050511 | Unclassified | 1186 |
| 1883 | nmdc:mga08y16_6212_c1 | 3300050511 | Bacteria | 12532 |
| 1884 | nmdc:mga08y16_993441_c1 | 3300050511 | Unclassified | 820 |
| 1885 | nmdc:mga0n895_113403_c1 | 3300050512 | Bacteria | 2728 |
| 1886 | nmdc:mga0n895_1302308_c1 | 3300050512 | Bacteria | 697 |
| 1887 | nmdc:mga0n895_1403304_c1 | 3300050512 | Bacteria | 667 |
| 1888 | nmdc:mga0n895_22447_c1 | 3300050512 | Bacteria | 5917 |
| 1889 | nmdc:mga0n895_29349_c1 | 3300050512 | Bacteria | 5245 |
| 1890 | nmdc:mga0n895_347339_c1 | 3300050512 | Unclassified | 1503 |
| 1891 | nmdc:mga0n895_66163_c1 | 3300050512 | Bacteria | 3579 |
| 1892 | nmdc:mga0rr50_160820_c1 | 3300050513 | Bacteria | 1823 |
| 1893 | nmdc:mga0rr50_33179_c1 | 3300050513 | Bacteria | 3686 |
| 1894 | nmdc:mga0rr50_463041_c1 | 3300050513 | Unclassified | 1076 |
| 1895 | nmdc:mga0rr50_794457_c1 | 3300050513 | Unclassified | 807 |
| 1896 | nmdc:mga0rr50_8771_c1 | 3300050513 | Bacteria | 6309 |
| 1897 | nmdc:mga0rr50_99874_c1 | 3300050513 | Unclassified | 2278 |
| 1898 | nmdc:mga08x19_1096607_c1 | 3300050514 | Bacteria | 565 |
| 1899 | nmdc:mga08x19_11008_c1 | 3300050514 | Bacteria | 5444 |
| 1900 | nmdc:mga08x19_1187803_c1 | 3300050514 | Bacteria | 541 |
| 1901 | nmdc:mga08x19_13424_c1 | 3300050514 | Bacteria | 4953 |
| 1902 | nmdc:mga08x19_276154_c1 | 3300050514 | Bacteria | 1164 |
| 1903 | nmdc:mga08x19_39379_c1 | 3300050514 | Bacteria | 3005 |
| 1904 | nmdc:mga0a205_17439_c1 | 3300050515 | Bacteria | 6732 |
| 1905 | nmdc:mga0a205_28604_c1 | 3300050515 | Bacteria | 5330 |
| 1906 | nmdc:mga0a205_362748_c1 | 3300050515 | Bacteria | 1315 |
| 1907 | nmdc:mga0a205_55847_c1 | 3300050515 | Bacteria | 3813 |
| 1908 | nmdc:mga0a205_8214_c1 | 3300050515 | Bacteria | 9486 |
| 1909 | Ga0495601_0014931 | 3300053077 | Bacteria | 4688 |
| 1910 | Ga0495601_0077742 | 3300053077 | Bacteria | 2125 |
| 1911 | Ga0495601_0265709 | 3300053077 | Bacteria | 1119 |
| 1912 | Ga0495601_0715447 | 3300053077 | Bacteria | 638 |
| 1913 | Ga0495612_0183669 | 3300053078 | Bacteria | 919 |
| 1914 | Ga0495612_0348455 | 3300053078 | Bacteria | 668 |
| 1915 | Ga0495655_0085213 | 3300053083 | Bacteria | 911 |
| 1916 | Ga0495595_0008508 | 3300053084 | Bacteria | 4214 |
| 1917 | Ga0495595_0030703 | 3300053084 | Bacteria | 2411 |
| 1918 | Ga0495595_0229203 | 3300053084 | Unclassified | 928 |
| 1919 | Ga0495595_0586744 | 3300053084 | Unclassified | 570 |
| 1920 | Ga0495619_0062721 | 3300053085 | Bacteria | 2474 |
| 1921 | Ga0495619_0096784 | 3300053085 | Bacteria | 2004 |
| 1922 | Ga0495619_0178203 | 3300053085 | Bacteria | 1470 |
| 1923 | Ga0495619_0305120 | 3300053085 | Bacteria | 1103 |
| 1924 | Ga0495619_0307392 | 3300053085 | Bacteria | 1098 |
| 1925 | Ga0495619_0474897 | 3300053085 | Bacteria | 861 |
| 1926 | Ga0495619_0615600 | 3300053085 | Bacteria | 742 |
| 1927 | Ga0495619_0971048 | 3300053085 | Bacteria | 569 |
| 1928 | Ga0495619_1148905 | 3300053085 | Bacteria | 515 |
| 1929 | Ga0501084_0000995 | 3300054114 | Bacteria | 22022 |
| 1930 | Ga0501084_0001035 | 3300054114 | Bacteria | 21607 |
| 1931 | Ga0501084_0001602 | 3300054114 | Bacteria | 17929 |
| 1932 | Ga0501084_0025040 | 3300054114 | Bacteria | 4979 |
| 1933 | Ga0501084_0041168 | 3300054114 | Bacteria | 3864 |
| 1934 | Ga0501084_0052144 | 3300054114 | Bacteria | 3423 |
| 1935 | Ga0501084_0110502 | 3300054114 | Bacteria | 2309 |
| 1936 | Ga0501084_0127115 | 3300054114 | Bacteria | 2145 |
| 1937 | Ga0501084_0132507 | 3300054114 | Bacteria | 2098 |
| 1938 | Ga0501084_0274282 | 3300054114 | Bacteria | 1424 |
| 1939 | Ga0501084_0485282 | 3300054114 | Unclassified | 1044 |
| 1940 | Ga0501084_0493358 | 3300054114 | Bacteria | 1035 |
| 1941 | Ga0501084_0710508 | 3300054114 | Bacteria | 847 |
| 1942 | Ga0590077_016865 | 3300059426 | Bacteria | 1534 |
| 1943 | Ga0501082_0001285 | 3300060353 | Bacteria | 22025 |
| 1944 | Ga0501082_0002542 | 3300060353 | Bacteria | 15978 |
| 1945 | Ga0501082_0027473 | 3300060353 | Bacteria | 4898 |
| 1946 | Ga0501082_0091413 | 3300060353 | Bacteria | 2628 |
| 1947 | Ga0501082_0098581 | 3300060353 | Bacteria | 2527 |
| 1948 | Ga0501082_0119943 | 3300060353 | Bacteria | 2279 |
| 1949 | Ga0501082_0279395 | 3300060353 | Bacteria | 1453 |
| 1950 | Ga0501082_0323530 | 3300060353 | Unclassified | 1344 |
| 1951 | Ga0501082_0713924 | 3300060353 | Bacteria | 877 |
| 1952 | Ga0501082_0755670 | 3300060353 | Bacteria | 851 |
| 1953 | Ga0501082_0814845 | 3300060353 | Archaea | 817 |
| 1954 | Ga0466962_0033068 | 3300061719 | Bacteria | 2474 |
| 1955 | Ga0466962_0165682 | 3300061719 | Unclassified | 1075 |
| 1956 | Ga0466962_0273557 | 3300061719 | Bacteria | 833 |
| 1957 | Ga0466962_0406569 | 3300061719 | Bacteria | 682 |
| 1958 | Ga0530510_0000483 | 3300061734 | Bacteria | 25575 |
| 1959 | Ga0530510_0003271 | 3300061734 | Bacteria | 11143 |
| 1960 | Ga0530510_0008413 | 3300061734 | Bacteria | 7191 |
| 1961 | Ga0530510_0042169 | 3300061734 | Bacteria | 3296 |
| 1962 | Ga0530510_0050183 | 3300061734 | Bacteria | 3013 |
| 1963 | Ga0530510_0130411 | 3300061734 | Bacteria | 1849 |
| 1964 | Ga0530510_0219486 | 3300061734 | Bacteria | 1413 |
| 1965 | Ga0530510_1241338 | 3300061734 | Bacteria | 571 |
| 1966 | Ga0451847_0567380 | |||
| 1967 | JGI24737J22298_10226770 | |||
| 1968 | JGI24744J21845_10006394 | |||
| 1969 | JGI24742J22300_10032619 | |||
| 1970 | JGI25406J46586_10075207 | |||
| 1971 | JGI25407J50210_10004039 | |||
| 1972 | JGI25407J50210_10008409 | |||
| 1973 | Ga0058862_12097182 | |||
| 1974 | Ga0070658_10017458 | |||
| 1975 | Ga0070658_10599467 | |||
| 1976 | Ga0070676_10123021 | |||
| 1977 | Ga0070676_11296682 | |||
| 1978 | Ga0070683_100097361 | |||
| 1979 | Ga0070683_100142815 | |||
| 1980 | Ga0070683_100559210 | |||
| 1981 | Ga0070683_101235695 | |||
| 1982 | Ga0070690_100968183 | |||
| 1983 | Ga0070670_100233967 | |||
| 1984 | Ga0068869_100066126 | |||
| 1985 | Ga0068869_100088433 | |||
| 1986 | Ga0068869_101174937 | |||
| 1987 | Ga0070666_10071585 | |||
| 1988 | Ga0070680_100099227 | |||
| 1989 | Ga0070680_100158195 | |||
| 1990 | Ga0070680_100261476 | |||
| 1991 | Ga0070680_101160004 | |||
| 1992 | Ga0070682_100000724 | |||
| 1993 | Ga0070682_100353853 | |||
| 1994 | Ga0070682_100492699 | |||
| 1995 | Ga0070682_101793144 | |||
| 1996 | Ga0068868_100021473 | |||
| 1997 | Ga0068868_100031465 | |||
| 1998 | Ga0068868_100037051 | |||
| 1999 | Ga0068868_100412417 | |||
| 2000 | Ga0070660_100004795 | |||
| 2001 | Ga0070660_100012584 | |||
| 2002 | Ga0070660_100035695 | |||
| 2003 | Ga0070660_100080555 | |||
| 2004 | Ga0070660_100620462 | |||
| 2005 | Ga0070660_101032960 | |||
| 2006 | Ga0070689_100001164 | |||
| 2007 | Ga0070691_10274266 | |||
| 2008 | Ga0070691_10841359 | |||
| 2009 | Ga0070687_100117055 | |||
| 2010 | Ga0070692_10062692 | |||
| 2011 | Ga0070692_10243144 | |||
| 2012 | Ga0070692_10531806 | |||
| 2013 | Ga0070692_10569908 | |||
| 2014 | Ga0070668_100194587 | |||
| 2015 | Ga0070668_100328762 | |||
| 2016 | Ga0070669_100592106 | |||
| 2017 | Ga0070675_100093736 | |||
| 2018 | Ga0070675_100138855 | |||
| 2019 | Ga0070675_100440446 | |||
| 2020 | Ga0070671_100106400 | |||
| 2021 | Ga0070674_100070769 | |||
| 2022 | Ga0070674_100088494 | |||
| 2023 | Ga0070674_100171053 | |||
| 2024 | Ga0070674_100337666 | |||
| 2025 | Ga0070674_100449858 | |||
| 2026 | Ga0070674_100573692 | |||
| 2027 | Ga0070674_100645764 | |||
| 2028 | Ga0070673_100144366 | |||
| 2029 | Ga0070688_100031102 | |||
| 2030 | Ga0070688_100307199 | |||
| 2031 | Ga0070688_100668004 | |||
| 2032 | Ga0070659_100003178 | |||
| 2033 | Ga0070659_100402607 | |||
| 2034 | Ga0070659_100415626 | |||
| 2035 | Ga0070659_101035686 | |||
| 2036 | Ga0070667_100094285 | |||
| 2037 | Ga0070667_100458895 | |||
| 2038 | Ga0070703_10016513 | |||
| 2039 | Ga0070703_10108310 | |||
| 2040 | Ga0070709_10063361 | |||
| 2041 | Ga0070709_10235018 | |||
| 2042 | Ga0070709_10335885 | |||
| 2043 | Ga0070709_11099465 | |||
| 2044 | Ga0070709_11286633 | |||
| 2045 | Ga0070709_11583593 | |||
| 2046 | Ga0070714_100004641 | |||
| 2047 | Ga0070714_100009404 | |||
| 2048 | Ga0070714_100021468 | |||
| 2049 | Ga0070714_100054262 | |||
| 2050 | Ga0070714_100072186 | |||
| 2051 | Ga0070714_100177175 | |||
| 2052 | Ga0070714_100279502 | |||
| 2053 | Ga0070714_100302028 | |||
| 2054 | Ga0070714_100491228 | |||
| 2055 | Ga0070714_101240172 | |||
| 2056 | Ga0070713_100112608 | |||
| 2057 | Ga0070713_100175288 | |||
| 2058 | Ga0070713_100674034 | |||
| 2059 | Ga0070713_100962494 | |||
| 2060 | Ga0070713_101057460 | |||
| 2061 | Ga0070713_101989177 | |||
| 2062 | Ga0070710_10077042 | |||
| 2063 | Ga0070710_10097550 | |||
| 2064 | Ga0070710_10314580 | |||
| 2065 | Ga0070710_10506106 | |||
| 2066 | Ga0070701_10029400 | |||
| 2067 | Ga0070701_10974226 | |||
| 2068 | Ga0070711_100005292 | |||
| 2069 | Ga0070711_100335146 | |||
| 2070 | Ga0070711_100347812 | |||
| 2071 | Ga0070711_100479998 | |||
| 2072 | Ga0070711_101344084 | |||
| 2073 | Ga0070705_100032809 | |||
| 2074 | Ga0070705_100142209 | |||
| 2075 | Ga0070705_100161336 | |||
| 2076 | Ga0070705_100197641 | |||
| 2077 | Ga0070705_100286981 | |||
| 2078 | Ga0070705_100479506 | |||
| 2079 | Ga0070705_101675539 | |||
| 2080 | Ga0070700_100017962 | |||
| 2081 | Ga0070700_100705534 | |||
| 2082 | Ga0070700_100856377 | |||
| 2083 | Ga0070694_100002541 | |||
| 2084 | Ga0070694_100224112 | |||
| 2085 | Ga0070694_100956813 | |||
| 2086 | Ga0070708_100059650 | |||
| 2087 | Ga0070708_100144183 | |||
| 2088 | Ga0070708_100514941 | |||
| 2089 | Ga0070708_100854210 | |||
| 2090 | Ga0070663_100104925 | |||
| 2091 | Ga0070663_100616716 | |||
| 2092 | Ga0070663_100816012 | |||
| 2093 | Ga0070663_101460446 | |||
| 2094 | Ga0070678_100016378 | |||
| 2095 | Ga0070678_100098940 | |||
| 2096 | Ga0070678_100225644 | |||
| 2097 | Ga0070678_100299146 | |||
| 2098 | Ga0070678_100323794 | |||
| 2099 | Ga0070678_100401937 | |||
| 2100 | Ga0070678_100853536 | |||
| 2101 | Ga0070678_101315656 | |||
| 2102 | Ga0070662_100120899 | |||
| 2103 | Ga0070662_100417504 | |||
| 2104 | Ga0070662_100453067 | |||
| 2105 | Ga0070662_101276775 | |||
| 2106 | Ga0070681_10008425 | |||
| 2107 | Ga0070681_10024213 | |||
| 2108 | Ga0070681_10181531 | |||
| 2109 | Ga0070681_11307142 | |||
| 2110 | Ga0070681_11950120 | |||
| 2111 | Ga0068867_100005114 | |||
| 2112 | Ga0068867_100251077 | |||
| 2113 | Ga0068867_100264654 | |||
| 2114 | Ga0070685_10780219 | |||
| 2115 | Ga0070706_100019334 | |||
| 2116 | Ga0070706_100039954 | |||
| 2117 | Ga0070706_100063962 | |||
| 2118 | Ga0070706_100245793 | |||
| 2119 | Ga0070706_100644267 | |||
| 2120 | Ga0070706_100697149 | |||
| 2121 | Ga0070706_101014677 | |||
| 2122 | Ga0070707_100000876 | |||
| 2123 | Ga0070707_100014709 | |||
| 2124 | Ga0070707_100142740 | |||
| 2125 | Ga0070707_100223602 | |||
| 2126 | Ga0070707_100254843 | |||
| 2127 | Ga0070707_100503632 | |||
| 2128 | Ga0070707_100535984 | |||
| 2129 | Ga0070707_101404098 | |||
| 2130 | Ga0070707_102170021 | |||
| 2131 | Ga0070698_100010606 | |||
| 2132 | Ga0070698_100013685 | |||
| 2133 | Ga0070698_100051873 | |||
| 2134 | Ga0070698_100072239 | |||
| 2135 | Ga0070698_100229314 | |||
| 2136 | Ga0070698_100284728 | |||
| 2137 | Ga0070698_100566529 | |||
| 2138 | Ga0070698_100931958 | |||
| 2139 | Ga0070698_100990651 | |||
| 2140 | Ga0070698_100990800 | |||
| 2141 | Ga0070698_101419543 | |||
| 2142 | Ga0070698_102118226 | |||
| 2143 | Ga0070699_100010261 | |||
| 2144 | Ga0070699_100047910 | |||
| 2145 | Ga0070699_100158488 | |||
| 2146 | Ga0070699_100265330 | |||
| 2147 | Ga0070699_100363138 | |||
| 2148 | Ga0070699_100598294 | |||
| 2149 | Ga0070699_100823004 | |||
| 2150 | Ga0070699_101013289 | |||
| 2151 | Ga0070699_101723486 | |||
| 2152 | Ga0070679_100156727 | |||
| 2153 | Ga0070679_100158088 | |||
| 2154 | Ga0070679_100273022 | |||
| 2155 | Ga0070679_100301997 | |||
| 2156 | Ga0070679_100545873 | |||
| 2157 | Ga0070684_100042465 | |||
| 2158 | Ga0070697_100200450 | |||
| 2159 | Ga0070697_101105278 | |||
| 2160 | Ga0070697_101636157 | |||
| 2161 | Ga0068853_102099934 | |||
| 2162 | Ga0070672_100051152 | |||
| 2163 | Ga0070672_100110878 | |||
| 2164 | Ga0070672_100297156 | |||
| 2165 | Ga0070672_100455698 | |||
| 2166 | Ga0070672_100772991 | |||
| 2167 | Ga0070686_100123364 | |||
| 2168 | Ga0070686_100642333 | |||
| 2169 | Ga0070686_101179751 | |||
| 2170 | Ga0070695_100034587 | |||
| 2171 | Ga0070695_100097243 | |||
| 2172 | Ga0070695_100103679 | |||
| 2173 | Ga0070695_100278029 | |||
| 2174 | Ga0070695_100574641 | |||
| 2175 | Ga0070696_100008682 | |||
| 2176 | Ga0070696_100012464 | |||
| 2177 | Ga0070696_100450255 | |||
| 2178 | Ga0070696_101026665 | |||
| 2179 | Ga0070696_101196695 | |||
| 2180 | Ga0070696_101765274 | |||
| 2181 | Ga0070693_100036720 | |||
| 2182 | Ga0070693_100073851 | |||
| 2183 | Ga0070693_100102540 | |||
| 2184 | Ga0070693_100124315 | |||
| 2185 | Ga0070693_100264590 | |||
| 2186 | Ga0070693_100656928 | |||
| 2187 | Ga0070665_100211979 | |||
| 2188 | Ga0070665_100527452 | |||
| 2189 | Ga0070704_100007778 | |||
| 2190 | Ga0070704_100286559 | |||
| 2191 | Ga0070704_100384330 | |||
| 2192 | Ga0070704_100490434 | |||
| 2193 | Ga0070704_100618264 | |||
| 2194 | Ga0070704_101000668 | |||
| 2195 | Ga0068855_100011694 | |||
| 2196 | Ga0068855_100026071 | |||
| 2197 | Ga0068855_100054074 | |||
| 2198 | Ga0068855_100076167 | |||
| 2199 | Ga0068855_100095580 | |||
| 2200 | Ga0068855_100745323 | |||
| 2201 | Ga0070664_100999464 | |||
| 2202 | Ga0070664_101868090 | |||
| 2203 | Ga0068857_100012071 | |||
| 2204 | Ga0068854_100263133 | |||
| 2205 | Ga0068856_100002288 | |||
| 2206 | Ga0068856_100006131 | |||
| 2207 | Ga0068856_100213729 | |||
| 2208 | Ga0068856_100724824 | |||
| 2209 | Ga0068856_100990614 | |||
| 2210 | Ga0068856_101292017 | |||
| 2211 | Ga0070702_100045252 | |||
| 2212 | Ga0070702_100047635 | |||
| 2213 | Ga0070702_100051895 | |||
| 2214 | Ga0070702_100569966 | |||
| 2215 | Ga0070702_100619599 | |||
| 2216 | Ga0068852_100186519 | |||
| 2217 | Ga0068852_100398170 | |||
| 2218 | Ga0068852_102326828 | |||
| 2219 | Ga0068859_100066787 | |||
| 2220 | Ga0068859_100068771 | |||
| 2221 | Ga0068859_101253902 | |||
| 2222 | Ga0068864_100281527 | |||
| 2223 | Ga0068866_10296046 | |||
| 2224 | Ga0068866_10355344 | |||
| 2225 | Ga0068861_100061062 | |||
| 2226 | Ga0068861_100548529 | |||
| 2227 | Ga0068861_101810463 | |||
| 2228 | Ga0068870_10036532 | |||
| 2229 | Ga0068870_10930004 | |||
| 2230 | Ga0068863_102165100 | |||
| 2231 | Ga0068858_100167631 | |||
| 2232 | Ga0068858_100216107 | |||
| 2233 | Ga0068860_100054202 | |||
| 2234 | Ga0068860_100892634 | |||
| 2235 | Ga0068862_100146178 | |||
| 2236 | Ga0068862_101082901 | |||
| 2237 | Ga0068862_101156284 | |||
| 2238 | Ga0081455_10028173 | |||
| 2239 | Ga0081455_10087699 | |||
| 2240 | Ga0081455_10115946 | |||
| 2241 | Ga0081455_10192003 | |||
| 2242 | Ga0081455_10243433 | |||
| 2243 | Ga0081538_10000562 | |||
| 2244 | Ga0081538_10000853 | |||
| 2245 | Ga0081538_10001225 | |||
| 2246 | Ga0081538_10007406 | |||
| 2247 | Ga0081538_10010402 | |||
| 2248 | Ga0081538_10019642 | |||
| 2249 | Ga0081538_10054341 | |||
| 2250 | Ga0081538_10083202 | |||
| 2251 | Ga0081538_10234738 | |||
| 2252 | Ga0081539_10003901 | |||
| 2253 | Ga0081539_10015861 | |||
| 2254 | Ga0081539_10051470 | |||
| 2255 | Ga0081539_10086606 | |||
| 2256 | Ga0070717_10025852 | |||
| 2257 | Ga0070717_10202222 | |||
| 2258 | Ga0070717_10626624 | |||
| 2259 | Ga0075365_10034867 | |||
| 2260 | Ga0075365_10160485 | |||
| 2261 | Ga0075432_10005707 | |||
| 2262 | Ga0075432_10066592 | |||
| 2263 | Ga0075432_10100204 | |||
| 2264 | Ga0070715_10028985 | |||
| 2265 | Ga0070716_100020975 | |||
| 2266 | Ga0070716_100146645 | |||
| 2267 | Ga0070716_100191536 | |||
| 2268 | Ga0070716_100430722 | |||
| 2269 | Ga0070716_101147048 | |||
| 2270 | Ga0070712_100009723 | |||
| 2271 | Ga0070712_100075379 | |||
| 2272 | Ga0070712_100080069 | |||
| 2273 | Ga0070712_100306712 | |||
| 2274 | Ga0070712_100345656 | |||
| 2275 | Ga0070712_100435608 | |||
| 2276 | Ga0070712_101419925 | |||
| 2277 | Ga0075367_10832747 | |||
| 2278 | Ga0097621_100011800 | |||
| 2279 | Ga0097621_100174180 | |||
| 2280 | Ga0097621_100213561 | |||
| 2281 | Ga0068871_100134410 | |||
| 2282 | Ga0068871_100214794 | |||
| 2283 | Ga0068871_100376888 | |||
| 2284 | Ga0075428_100050603 | |||
| 2285 | Ga0075428_100268792 | |||
| 2286 | Ga0075428_100573004 | |||
| 2287 | Ga0075428_101203178 | |||
| 2288 | Ga0075428_101983677 | |||
| 2289 | Ga0075430_100222135 | |||
| 2290 | Ga0075430_100261228 | |||
| 2291 | Ga0075430_101109700 | |||
| 2292 | Ga0075431_100009745 | |||
| 2293 | Ga0075431_100076028 | |||
| 2294 | Ga0075431_100186447 | |||
| 2295 | Ga0075433_10184272 | |||
| 2296 | Ga0075433_10186541 | |||
| 2297 | Ga0075433_10197241 | |||
| 2298 | Ga0075433_10291887 | |||
| 2299 | Ga0075433_10736973 | |||
| 2300 | Ga0075434_100052068 | |||
| 2301 | Ga0075434_100052483 | |||
| 2302 | Ga0075434_100094216 | |||
| 2303 | Ga0075434_100160015 | |||
| 2304 | Ga0075434_100207228 | |||
| 2305 | Ga0075434_100231680 | |||
| 2306 | Ga0075434_100280016 | |||
| 2307 | Ga0075434_101509570 | |||
| 2308 | Ga0075434_101666872 | |||
| 2309 | Ga0075429_100006033 | |||
| 2310 | Ga0075429_100194385 | |||
| 2311 | Ga0075429_100407100 | |||
| 2312 | Ga0068865_100001518 | |||
| 2313 | Ga0068865_100149598 | |||
| 2314 | Ga0068865_100364237 | |||
| 2315 | Ga0068865_100513771 | |||
| 2316 | Ga0068865_100754853 | |||
| 2317 | Ga0068865_101100865 | |||
| 2318 | Ga0068865_101586257 | |||
| 2319 | Ga0075436_100008310 | |||
| 2320 | Ga0075436_100048885 | |||
| 2321 | Ga0075436_100077952 | |||
| 2322 | Ga0075436_100307289 | |||
| 2323 | Ga0075436_100403334 | |||
| 2324 | Ga0075436_100734759 | |||
| 2325 | Ga0075436_101089983 | |||
| 2326 | Ga0097620_100066788 | |||
| 2327 | Ga0097620_100068770 | |||
| 2328 | Ga0097620_101253855 | |||
| 2329 | Ga0075435_100002001 | |||
| 2330 | Ga0075435_100009053 | |||
| 2331 | Ga0075435_100013824 | |||
| 2332 | Ga0075435_100040550 | |||
| 2333 | Ga0075435_100221331 | |||
| 2334 | Ga0105250_10360533 | |||
| 2335 | Ga0105240_10013310 | |||
| 2336 | Ga0105240_10432243 | |||
| 2337 | Ga0105240_11971471 | |||
| 2338 | Ga0105240_12231899 | |||
| 2339 | Ga0111539_10029604 | |||
| 2340 | Ga0111539_10228515 | |||
| 2341 | Ga0111539_10374009 | |||
| 2342 | Ga0111539_10758251 | |||
| 2343 | Ga0111539_11043617 | |||
| 2344 | Ga0111539_11419980 | |||
| 2345 | Ga0111539_12335322 | |||
| 2346 | Ga0105245_10002378 | |||
| 2347 | Ga0105245_10010538 | |||
| 2348 | Ga0105245_10016039 | |||
| 2349 | Ga0105245_10026837 | |||
| 2350 | Ga0105245_10027993 | |||
| 2351 | Ga0105245_10177381 | |||
| 2352 | Ga0105245_10768795 | |||
| 2353 | Ga0105245_11497091 | |||
| 2354 | Ga0105245_11984730 | |||
| 2355 | Ga0105245_12838075 | |||
| 2356 | Ga0105245_12933283 | |||
| 2357 | Ga0105247_10022659 | |||
| 2358 | Ga0105247_10839932 | |||
| 2359 | Ga0105247_11229638 | |||
| 2360 | Ga0114129_10005388 | |||
| 2361 | Ga0114129_10008675 | |||
| 2362 | Ga0114129_10040341 | |||
| 2363 | Ga0114129_10047239 | |||
| 2364 | Ga0114129_10173819 | |||
| 2365 | Ga0114129_10221020 | |||
| 2366 | Ga0114129_10245304 | |||
| 2367 | Ga0114129_10471642 | |||
| 2368 | Ga0114129_11190216 | |||
| 2369 | Ga0114129_12997658 | |||
| 2370 | Ga0114129_13125366 | |||
| 2371 | Ga0105243_10027910 | |||
| 2372 | Ga0105243_10052582 | |||
| 2373 | Ga0105243_10106557 | |||
| 2374 | Ga0105243_10240380 | |||
| 2375 | Ga0105243_12753586 | |||
| 2376 | Ga0105241_10198782 | |||
| 2377 | Ga0105241_10981413 | |||
| 2378 | Ga0105241_11458632 | |||
| 2379 | Ga0105242_10008443 | |||
| 2380 | Ga0105242_10024840 | |||
| 2381 | Ga0105242_10120030 | |||
| 2382 | Ga0105242_10245765 | |||
| 2383 | Ga0105242_10376029 | |||
| 2384 | Ga0105242_10448917 | |||
| 2385 | Ga0105242_12143359 | |||
| 2386 | Ga0105248_10008379 | |||
| 2387 | Ga0105248_11017689 | |||
| 2388 | Ga0105248_12259279 | |||
| 2389 | Ga0105237_10520886 | |||
| 2390 | Ga0105238_10006132 | |||
| 2391 | Ga0105238_10392678 | |||
| 2392 | Ga0105238_10716228 | |||
| 2393 | Ga0105238_12575289 | |||
| 2394 | Ga0105249_10001066 | |||
| 2395 | Ga0105249_10386296 | |||
| 2396 | Ga0105249_10685121 | |||
| 2397 | Ga0105249_12251100 | |||
| 2398 | Ga0105249_12326922 | |||
| 2399 | Ga0105249_12970872 | |||
| 2400 | Ga0105239_10006889 | |||
| 2401 | Ga0105239_10022722 | |||
| 2402 | Ga0105239_10234932 | |||
| 2403 | Ga0105239_10453373 | |||
| 2404 | Ga0105239_10651874 | |||
| 2405 | Ga0105239_13027409 | |||
| 2406 | Ga0105246_10090198 | |||
| 2407 | Ga0105246_10133644 | |||
| 2408 | Ga0105246_10611534 | |||
| 2409 | Ga0157321_1022019 | |||
| 2410 | Ga0157373_10571147 | |||
| 2411 | Ga0157373_10790347 | |||
| 2412 | Ga0157371_10876157 | |||
| 2413 | Ga0157370_10008957 | |||
| 2414 | Ga0157370_10011605 | |||
| 2415 | Ga0157370_10021485 | |||
| 2416 | Ga0157370_10581521 | |||
| 2417 | Ga0157369_10002298 | |||
| 2418 | Ga0157369_10018218 | |||
| 2419 | Ga0157369_10369578 | |||
| 2420 | Ga0157369_10664886 | |||
| 2421 | Ga0157369_10732624 | |||
| 2422 | Ga0157369_12050789 | |||
| 2423 | Ga0157374_10006816 | |||
| 2424 | Ga0157374_11027978 | |||
| 2425 | Ga0157374_11366903 | |||
| 2426 | Ga0157378_10363346 | |||
| 2427 | Ga0157378_10571851 | |||
| 2428 | Ga0157378_11312841 | |||
| 2429 | Ga0163162_10007126 | |||
| 2430 | Ga0163162_10068726 | |||
| 2431 | Ga0157372_10062694 | |||
| 2432 | Ga0157372_10511293 | |||
| 2433 | Ga0157372_10895525 | |||
| 2434 | Ga0157372_11627991 | |||
| 2435 | Ga0157372_11848106 | |||
| 2436 | Ga0157372_12543911 | |||
| 2437 | Ga0157375_10124007 | |||
| 2438 | Ga0157375_10233570 | |||
| 2439 | Ga0157375_10313664 | |||
| 2440 | Ga0157375_10840723 | |||
| 2441 | Ga0157375_10928123 | |||
| 2442 | Ga0163163_10090122 | |||
| 2443 | Ga0163163_10747369 | |||
| 2444 | Ga0163163_11012849 | |||
| 2445 | Ga0163163_11037752 | |||
| 2446 | Ga0163163_11503159 | |||
| 2447 | Ga0157380_10064114 | |||
| 2448 | Ga0157380_10240371 | |||
| 2449 | Ga0157380_11036642 | |||
| 2450 | Ga0182008_10150105 | |||
| 2451 | Ga0182008_10881057 | |||
| 2452 | Ga0157377_10008690 | |||
| 2453 | Ga0157377_10025409 | |||
| 2454 | Ga0157377_11084471 | |||
| 2455 | Ga0157379_10245504 | |||
| 2456 | Ga0157379_10749500 | |||
| 2457 | Ga0157379_10812705 | |||
| 2458 | Ga0157379_10889147 | |||
| 2459 | Ga0157376_10025044 | |||
| 2460 | Ga0157376_10097436 | |||
| 2461 | Ga0157376_10408014 | |||
| 2462 | Ga0157376_10882916 | |||
| 2463 | Ga0157376_10911999 | |||
| 2464 | Ga0157376_12012877 | |||
| 2465 | Ga0182007_10351269 | |||
| 2466 | Ga0182005_1307918 | |||
| 2467 | Ga0163161_10485117 | |||
| 2468 | Ga0163161_11300143 | |||
| 2469 | Ga0197907_10065360 | |||
| 2470 | Ga0206356_11236435 | |||
| 2471 | Ga0206354_11509267 | |||
| 2472 | Ga0206353_10968799 | |||
| 2473 | Ga0206353_11480980 | |||
| 2474 | Ga0206353_12016091 | |||
| 2475 | Ga0213873_10195572 | |||
| 2476 | Ga0213871_10015656 | |||
| 2477 | Ga0207653_10001347 | |||
| 2478 | Ga0207692_10186608 | |||
| 2479 | Ga0207692_10237492 | |||
| 2480 | Ga0207692_10292174 | |||
| 2481 | Ga0207692_10307069 | |||
| 2482 | Ga0207642_10003349 | |||
| 2483 | Ga0207688_10210317 | |||
| 2484 | Ga0207688_10212351 | |||
| 2485 | Ga0207688_10401861 | |||
| 2486 | Ga0207647_10075870 | |||
| 2487 | Ga0207685_10007078 | |||
| 2488 | Ga0207685_10438335 | |||
| 2489 | Ga0207699_10040087 | |||
| 2490 | Ga0207699_10065044 | |||
| 2491 | Ga0207699_10074517 | |||
| 2492 | Ga0207699_10486038 | |||
| 2493 | Ga0207699_10530288 | |||
| 2494 | Ga0207699_10750668 | |||
| 2495 | Ga0207699_10863588 | |||
| 2496 | Ga0207645_10219858 | |||
| 2497 | Ga0207645_10698301 | |||
| 2498 | Ga0207643_10416065 | |||
| 2499 | Ga0207643_10756380 | |||
| 2500 | Ga0207705_10085132 | |||
| 2501 | Ga0207705_10177943 | |||
| 2502 | Ga0207705_10248385 | |||
| 2503 | Ga0207684_10050496 | |||
| 2504 | Ga0207684_10140613 | |||
| 2505 | Ga0207684_10357755 | |||
| 2506 | Ga0207684_10415672 | |||
| 2507 | Ga0207684_10551359 | |||
| 2508 | Ga0207654_10331074 | |||
| 2509 | Ga0207654_10385247 | |||
| 2510 | Ga0207707_10001299 | |||
| 2511 | Ga0207707_10079600 | |||
| 2512 | Ga0207707_10341760 | |||
| 2513 | Ga0207707_10861068 | |||
| 2514 | Ga0207695_10114961 | |||
| 2515 | Ga0207695_10931034 | |||
| 2516 | Ga0207695_11476554 | |||
| 2517 | Ga0207671_10356252 | |||
| 2518 | Ga0207693_10000183 | |||
| 2519 | Ga0207693_10000543 | |||
| 2520 | Ga0207693_10004718 | |||
| 2521 | Ga0207693_10118547 | |||
| 2522 | Ga0207693_10263454 | |||
| 2523 | Ga0207693_10389104 | |||
| 2524 | Ga0207693_11031568 | |||
| 2525 | Ga0207693_11031591 | |||
| 2526 | Ga0207663_10022230 | |||
| 2527 | Ga0207663_10439320 | |||
| 2528 | Ga0207663_10495530 | |||
| 2529 | Ga0207663_10774029 | |||
| 2530 | Ga0207663_11461776 | |||
| 2531 | Ga0207663_11611665 | |||
| 2532 | Ga0207660_10201701 | |||
| 2533 | Ga0207660_10554816 | |||
| 2534 | Ga0207660_11255522 | |||
| 2535 | Ga0207662_10382893 | |||
| 2536 | Ga0207657_10003624 | |||
| 2537 | Ga0207657_10012052 | |||
| 2538 | Ga0207657_10012634 | |||
| 2539 | Ga0207657_10071676 | |||
| 2540 | Ga0207657_10385561 | |||
| 2541 | Ga0207657_10542382 | |||
| 2542 | Ga0207657_10755239 | |||
| 2543 | Ga0207649_10545013 | |||
| 2544 | Ga0207652_10021367 | |||
| 2545 | Ga0207652_10185066 | |||
| 2546 | Ga0207652_10303651 | |||
| 2547 | Ga0207652_10437217 | |||
| 2548 | Ga0207652_10530816 | |||
| 2549 | Ga0207646_10025319 | |||
| 2550 | Ga0207646_10052541 | |||
| 2551 | Ga0207646_10390990 | |||
| 2552 | Ga0207646_10507311 | |||
| 2553 | Ga0207646_11326255 | |||
| 2554 | Ga0207646_11442757 | |||
| 2555 | Ga0207681_10423505 | |||
| 2556 | Ga0207694_10499456 | |||
| 2557 | Ga0207659_10092558 | |||
| 2558 | Ga0207659_10186154 | |||
| 2559 | Ga0207659_10868070 | |||
| 2560 | Ga0207687_10008291 | |||
| 2561 | Ga0207687_10010129 | |||
| 2562 | Ga0207687_10020256 | |||
| 2563 | Ga0207687_10026619 | |||
| 2564 | Ga0207687_10048987 | |||
| 2565 | Ga0207687_10146343 | |||
| 2566 | Ga0207687_10462302 | |||
| 2567 | Ga0207687_10930344 | |||
| 2568 | Ga0207700_10040505 | |||
| 2569 | Ga0207700_10159450 | |||
| 2570 | Ga0207700_10403419 | |||
| 2571 | Ga0207700_10409502 | |||
| 2572 | Ga0207700_10475041 | |||
| 2573 | Ga0207700_10857433 | |||
| 2574 | Ga0207700_10943279 | |||
| 2575 | Ga0207700_11153775 | |||
| 2576 | Ga0207700_11156866 | |||
| 2577 | Ga0207664_10055197 | |||
| 2578 | Ga0207664_10072260 | |||
| 2579 | Ga0207664_10073052 | |||
| 2580 | Ga0207664_10074962 | |||
| 2581 | Ga0207664_10111135 | |||
| 2582 | Ga0207664_10115264 | |||
| 2583 | Ga0207664_10121549 | |||
| 2584 | Ga0207664_10269823 | |||
| 2585 | Ga0207664_11004510 | |||
| 2586 | Ga0207644_10168324 | |||
| 2587 | Ga0207644_10994542 | |||
| 2588 | Ga0207690_10014593 | |||
| 2589 | Ga0207690_10038686 | |||
| 2590 | Ga0207690_10144533 | |||
| 2591 | Ga0207706_10094006 | |||
| 2592 | Ga0207706_10171296 | |||
| 2593 | Ga0207706_10222488 | |||
| 2594 | Ga0207706_10439565 | |||
| 2595 | Ga0207706_10578108 | |||
| 2596 | Ga0207706_10751561 | |||
| 2597 | Ga0207706_11424707 | |||
| 2598 | Ga0207686_10006015 | |||
| 2599 | Ga0207686_10326493 | |||
| 2600 | Ga0207686_10394458 | |||
| 2601 | Ga0207686_10572299 | |||
| 2602 | Ga0207686_10977724 | |||
| 2603 | Ga0207686_11635864 | |||
| 2604 | Ga0207709_10027389 | |||
| 2605 | Ga0207709_10074810 | |||
| 2606 | Ga0207709_10967028 | |||
| 2607 | Ga0207709_11831278 | |||
| 2608 | Ga0207669_10017540 | |||
| 2609 | Ga0207669_10113132 | |||
| 2610 | Ga0207669_10159444 | |||
| 2611 | Ga0207669_10559199 | |||
| 2612 | Ga0207669_10865386 | |||
| 2613 | Ga0207669_11575028 | |||
| 2614 | Ga0207704_10006979 | |||
| 2615 | Ga0207704_10399170 | |||
| 2616 | Ga0207704_10493587 | |||
| 2617 | Ga0207704_11004425 | |||
| 2618 | Ga0207704_11235625 | |||
| 2619 | Ga0207665_10024756 | |||
| 2620 | Ga0207665_10128324 | |||
| 2621 | Ga0207665_10237511 | |||
| 2622 | Ga0207665_10377125 | |||
| 2623 | Ga0207665_10542206 | |||
| 2624 | Ga0207665_10708851 | |||
| 2625 | Ga0207691_10002533 | |||
| 2626 | Ga0207691_10085597 | |||
| 2627 | Ga0207691_10505621 | |||
| 2628 | Ga0207691_10784277 | |||
| 2629 | Ga0207711_10543310 | |||
| 2630 | Ga0207711_10578692 | |||
| 2631 | Ga0207689_10062101 | |||
| 2632 | Ga0207689_10068349 | |||
| 2633 | Ga0207689_11686307 | |||
| 2634 | Ga0207661_10373742 | |||
| 2635 | Ga0207661_10406482 | |||
| 2636 | Ga0207661_10857491 | |||
| 2637 | Ga0207661_11506895 | |||
| 2638 | Ga0207679_11658692 | |||
| 2639 | Ga0207667_10010035 | |||
| 2640 | Ga0207667_10035781 | |||
| 2641 | Ga0207667_10081555 | |||
| 2642 | Ga0207667_10089933 | |||
| 2643 | Ga0207667_10237570 | |||
| 2644 | Ga0207667_10261152 | |||
| 2645 | Ga0207667_10350547 | |||
| 2646 | Ga0207667_10485782 | |||
| 2647 | Ga0207667_10987400 | |||
| 2648 | Ga0207667_11244043 | |||
| 2649 | Ga0207651_10279360 | |||
| 2650 | Ga0207651_10918973 | |||
| 2651 | Ga0207651_11699104 | |||
| 2652 | Ga0207712_10046737 | |||
| 2653 | Ga0207712_10084523 | |||
| 2654 | Ga0207712_10169992 | |||
| 2655 | Ga0207712_11491705 | |||
| 2656 | Ga0207668_10078854 | |||
| 2657 | Ga0207668_10393280 | |||
| 2658 | Ga0207668_10501072 | |||
| 2659 | Ga0207668_11460826 | |||
| 2660 | Ga0207640_10170221 | |||
| 2661 | Ga0207640_10208501 | |||
| 2662 | Ga0207640_10219622 | |||
| 2663 | Ga0207640_10517574 | |||
| 2664 | Ga0207658_10195007 | |||
| 2665 | Ga0207677_10009894 | |||
| 2666 | Ga0207677_10089729 | |||
| 2667 | Ga0207677_10096958 | |||
| 2668 | Ga0207703_10047912 | |||
| 2669 | Ga0207639_11015348 | |||
| 2670 | Ga0207678_10025112 | |||
| 2671 | Ga0207678_10069443 | |||
| 2672 | Ga0207708_10000064 | |||
| 2673 | Ga0207708_10017082 | |||
| 2674 | Ga0207708_10077448 | |||
| 2675 | Ga0207708_10436636 | |||
| 2676 | Ga0207708_10701388 | |||
| 2677 | Ga0207708_10729420 | |||
| 2678 | Ga0207708_10875708 | |||
| 2679 | Ga0207702_10006561 | |||
| 2680 | Ga0207702_10058251 | |||
| 2681 | Ga0207702_10374513 | |||
| 2682 | Ga0207702_10773139 | |||
| 2683 | Ga0207702_11145600 | |||
| 2684 | Ga0207702_11215883 | |||
| 2685 | Ga0207641_11092359 | |||
| 2686 | Ga0207641_11819067 | |||
| 2687 | Ga0207648_10005420 | |||
| 2688 | Ga0207648_10024380 | |||
| 2689 | Ga0207648_10105969 | |||
| 2690 | Ga0207648_10180099 | |||
| 2691 | Ga0207676_11403462 | |||
| 2692 | Ga0207674_10001429 | |||
| 2693 | Ga0207675_100020980 | |||
| 2694 | Ga0207675_100579607 | |||
| 2695 | Ga0207675_100700350 | |||
| 2696 | Ga0207675_100712749 | |||
| 2697 | Ga0207683_10017237 | |||
| 2698 | Ga0207683_10028633 | |||
| 2699 | Ga0207683_10069241 | |||
| 2700 | Ga0207683_10085967 | |||
| 2701 | Ga0207683_10253638 | |||
| 2702 | Ga0207683_10422387 | |||
| 2703 | Ga0207683_10684889 | |||
| 2704 | Ga0207683_10685419 | |||
| 2705 | Ga0207683_11447543 | |||
| 2706 | Ga0207698_10097584 | |||
| 2707 | Ga0207698_10362749 | |||
| 2708 | Ga0207698_11217106 | |||
| 2709 | Ga0207698_11298181 | |||
| 2710 | Ga0209966_1020796 | |||
| 2711 | Ga0209966_1025320 | |||
| 2712 | Ga0209998_10048638 | |||
| 2713 | Ga0209974_10131539 | |||
| 2714 | Ga0207428_10033357 | |||
| 2715 | Ga0207428_10186739 | |||
| 2716 | Ga0207428_10837891 | |||
| 2717 | Ga0207428_10839898 | |||
| 2718 | Ga0207428_11143834 | |||
| 2719 | Ga0268266_10171787 | |||
| 2720 | Ga0268265_10053613 | |||
| 2721 | Ga0268265_10643562 | |||
| 2722 | Ga0268265_12615626 | |||
| 2723 | Ga0268264_10087916 | |||
| 2724 | Ga0268264_11740478 | |||
| 2725 | Ga0265337_1032915 | |||
| 2726 | Ga0265337_1034853 | |||
| 2727 | Ga0265337_1056877 | |||
| 2728 | Ga0265326_10018324 | |||
| 2729 | Ga0265326_10049685 | |||
| 2730 | Ga0265319_1004602 | |||
| 2731 | Ga0265319_1015323 | |||
| 2732 | Ga0265319_1020214 | |||
| 2733 | Ga0265334_10035955 | |||
| 2734 | Ga0265334_10110953 | |||
| 2735 | Ga0265318_10010540 | |||
| 2736 | Ga0265318_10016917 | |||
| 2737 | Ga0265318_10023732 | |||
| 2738 | Ga0265318_10046336 | |||
| 2739 | Ga0265323_10086001 | |||
| 2740 | Ga0265323_10278201 | |||
| 2741 | Ga0265322_10034519 | |||
| 2742 | Ga0265322_10121619 | |||
| 2743 | Ga0265336_10025979 | |||
| 2744 | Ga0265336_10177978 | |||
| 2745 | Ga0265338_10002399 | |||
| 2746 | Ga0265338_10017798 | |||
| 2747 | Ga0265338_10053386 | |||
| 2748 | Ga0265338_10067363 | |||
| 2749 | Ga0265338_10072949 | |||
| 2750 | Ga0265338_10389296 | |||
| 2751 | Ga0265338_10391792 | |||
| 2752 | Ga0265338_10686886 | |||
| 2753 | Ga0265324_10077670 | |||
| 2754 | Ga0265330_10026164 | |||
| 2755 | Ga0265330_10284256 | |||
| 2756 | Ga0265330_10385019 | |||
| 2757 | Ga0265332_10085953 | |||
| 2758 | Ga0265328_10002801 | |||
| 2759 | Ga0265320_10073146 | |||
| 2760 | Ga0265320_10134358 | |||
| 2761 | Ga0265320_10277542 | |||
| 2762 | Ga0265325_10044376 | |||
| 2763 | Ga0265325_10048042 | |||
| 2764 | Ga0265329_10024571 | |||
| 2765 | Ga0265340_10014348 | |||
| 2766 | Ga0265340_10020600 | |||
| 2767 | Ga0265340_10041231 | |||
| 2768 | Ga0265339_10001458 | |||
| 2769 | Ga0265339_10140375 | |||
| 2770 | Ga0265339_10162764 | |||
| 2771 | Ga0265339_10232554 | |||
| 2772 | Ga0265331_10020805 | |||
| 2773 | Ga0265331_10102087 | |||
| 2774 | Ga0265331_10501725 | |||
| 2775 | Ga0265327_10022468 | |||
| 2776 | Ga0265327_10032775 | |||
| 2777 | Ga0265327_10082280 | |||
| 2778 | Ga0265327_10135973 | |||
| 2779 | Ga0265327_10401038 | |||
| 2780 | Ga0265316_10111601 | |||
| 2781 | Ga0265316_10253868 | |||
| 2782 | Ga0265316_10287909 | |||
| 2783 | Ga0265316_10346252 | |||
| 2784 | Ga0265316_10490129 | |||
| 2785 | Ga0307408_100572705 | |||
| 2786 | Ga0307408_101418174 | |||
| 2787 | Ga0265313_10051943 | |||
| 2788 | Ga0265313_10085378 | |||
| 2789 | Ga0265314_10009344 | |||
| 2790 | Ga0265314_10051195 | |||
| 2791 | Ga0265314_10188459 | |||
| 2792 | Ga0265342_10038976 | |||
| 2793 | Ga0265342_10053412 | |||
| 2794 | Ga0265342_10093305 | |||
| 2795 | Ga0307405_10031541 | |||
| 2796 | Ga0307405_10218643 | |||
| 2797 | Ga0307405_10581213 | |||
| 2798 | Ga0307405_11360502 | |||
| 2799 | Ga0307413_10173135 | |||
| 2800 | Ga0307413_10344472 | |||
| 2801 | Ga0307413_10349947 | |||
| 2802 | Ga0307410_10304766 | |||
| 2803 | Ga0307406_11100863 | |||
| 2804 | Ga0307406_11322785 | |||
| 2805 | Ga0307406_11858598 | |||
| 2806 | Ga0307407_10073999 | |||
| 2807 | Ga0307407_10754469 | |||
| 2808 | Ga0307407_11690675 | |||
| 2809 | Ga0307412_10326431 | |||
| 2810 | Ga0307412_10635561 | |||
| 2811 | Ga0307412_11016305 | |||
| 2812 | Ga0307412_11904862 | |||
| 2813 | Ga0307409_100009147 | |||
| 2814 | Ga0307409_100174426 | |||
| 2815 | Ga0307409_100285406 | |||
| 2816 | Ga0307409_100296371 | |||
| 2817 | Ga0307409_100816969 | |||
| 2818 | Ga0307409_100948282 | |||
| 2819 | Ga0307409_101117060 | |||
| 2820 | Ga0307416_100062659 | |||
| 2821 | Ga0307416_100251858 | |||
| 2822 | Ga0307416_100267610 | |||
| 2823 | Ga0307416_100303129 | |||
| 2824 | Ga0307416_100379253 | |||
| 2825 | Ga0307416_100539468 | |||
| 2826 | Ga0307416_100553267 | |||
| 2827 | Ga0307411_10234904 | |||
| 2828 | Ga0307411_10327579 | |||
| 2829 | Ga0307411_10967596 | |||
| 2830 | Ga0307415_100124797 | |||
| 2831 | Ga0307415_100153264 | |||
| 2832 | Ga0307415_100157345 | |||
| 2833 | Ga0307415_100427408 | |||
| 2834 | Ga0307415_102480776 | |||
| 2835 | Ga0373930_0004430 | |||
| 2836 | Ga0373948_0003274 | |||
| 2837 | Ga0373958_0061717 | |||
| 2838 | Ga0373959_0007931 | |||
| 2839 | Ga0373938_0021207 | |||
| 2840 | Ga0373926_0014653 | |||
| 2841 | Ga0373928_0006626 | |||
| 2842 | Ga0373944_0004151 | |||
| 2843 | Ga0373944_0042736 | |||
| 2844 | Ga0373949_0021547 | |||
| 2845 | Ga0373951_0071532 | |||
| 2846 | Ga0373952_0006581 | |||
| 2847 | Ga0373952_0276349 | |||
| 2848 | Ga0373923_0119327 | |||
| 2849 | Ga0373932_0004244 | |||
| 2850 | Ga0373936_0039974 | |||
| 2851 | Ga0373939_0020387 | |||
| 2852 | Ga0373939_0077596 | |||
| 2853 | Ga0373941_0026995 | |||
| 2854 | Ga0373945_0003225 | |||
| 2855 | Ga0373945_0268313 | |||
| 2856 | Ga0373953_0027035 | |||
| 2857 | Ga0373953_0184037 | |||
| 2858 | Ga0373954_0016832 | |||
| 2859 | Ga0373954_0120414 | |||
| 2860 | Ga0373956_0078972 | |||
| 2861 | Ga0373956_0210625 | |||
| 2862 | Ga0373957_0042468 | |||
| 2863 | Ga0373957_0095228 | |||
| 2864 | Ga0373960_0007094 | |||
| 2865 | Ga0373943_0004177 | |||
| 2866 | Ga0373943_0012814 | |||
| 2867 | Ga0373943_0050429 | |||
| 2868 | Ga0373943_0956838 | |||
| 2869 | Ga0373946_0004366 | |||
| 2870 | Ga0373946_0039458 | |||
| 2871 | Ga0373946_0545260 | |||
| 2872 | Ga0373955_0029377 | |||
| 2873 | Ga0373955_0251613 | |||
| 2874 | Ga0373955_0820082 | |||
| 2875 | Ga0373942_0037964 | |||
| 2876 | Ga0373961_0036653 | |||
| 2877 | Ga0373961_0094780 | |||
| 2878 | Ga0373962_0004892 | |||
| 2879 | Ga0373924_0007579 | |||
| 2880 | Ga0373931_0022247 | |||
| 2881 | Ga0373931_0339168 | |||
| 2882 | Ga0373931_0740670 | |||
| 2883 | Ga0373935_0002406 | |||
| 2884 | Ga0373935_0061654 | |||
| 2885 | Ga0373935_0174469 | |||
| 2886 | Ga0373927_0052812 | |||
| 2887 | Ga0373933_0059558 | |||
| 2888 | Ga0373933_0291521 | |||
| 2889 | Ga0373933_0442261 | |||
| 2890 | Ga0373933_1118709 | |||
| 2891 | Ga0373947_0004917 | |||
| 2892 | Ga0373947_0020348 | |||
| 2893 | Ga0373947_0072008 | |||
| 2894 | Ga0373947_0091353 | |||
| 2895 | Ga0373947_0146209 | |||
| 2896 | Ga0373947_0413025 | |||
| 2897 | Ga0373937_0021717 | |||
| 2898 | Ga0373937_0283198 | |||
| 2899 | Ga0373937_2164911 | |||
| 2900 | Ga0373925_0005095 | |||
| 2901 | Ga0373925_0188309 | |||
| 2902 | Ga0373925_0223285 | |||
| 2903 | Ga0373925_0306801 | |||
| 2904 | Ga0373925_0621532 | |||
| 2905 | Ga0373925_1018832 | |||
| 2906 | Ga0373925_1255480 | |||
| 2907 | Ga0395899_0002854 | |||
| 2908 | Ga0395899_0005973 | |||
| 2909 | Ga0395899_0008716 | |||
| 2910 | Ga0395899_0009725 | |||
| 2911 | Ga0395899_0010577 | |||
| 2912 | Ga0395899_0016967 | |||
| 2913 | Ga0395899_0032880 | |||
| 2914 | Ga0395899_0048050 | |||
| 2915 | Ga0395899_0050955 | |||
| 2916 | Ga0395899_0064701 | |||
| 2917 | Ga0395899_0083770 | |||
| 2918 | Ga0395899_0101194 | |||
| 2919 | Ga0395899_0139195 | |||
| 2920 | Ga0395899_0208298 | |||
| 2921 | Ga0395899_0305632 | |||
| 2922 | Ga0395899_0351280 | |||
| 2923 | Ga0395899_0720510 | |||
| 2924 | Ga0395899_0958102 | |||
| 2925 | Ga0395899_0976239 | |||
| 2926 | Ga0395900_0008078 | |||
| 2927 | Ga0395900_0008413 | |||
| 2928 | Ga0395900_0009665 | |||
| 2929 | Ga0395900_0015917 | |||
| 2930 | Ga0395900_0026666 | |||
| 2931 | Ga0395900_0030328 | |||
| 2932 | Ga0395900_0032967 | |||
| 2933 | Ga0395900_0039951 | |||
| 2934 | Ga0395900_0040112 | |||
| 2935 | Ga0395900_0069741 | |||
| 2936 | Ga0395900_0086330 | |||
| 2937 | Ga0395900_0093684 | |||
| 2938 | Ga0395900_0127274 | |||
| 2939 | Ga0395900_0146797 | |||
| 2940 | Ga0395900_0203228 | |||
| 2941 | Ga0395900_0205324 | |||
| 2942 | Ga0395900_0342635 | |||
| 2943 | Ga0395900_0504119 | |||
| 2944 | Ga0395900_0564400 | |||
| 2945 | Ga0395900_0625422 | |||
| 2946 | Ga0395900_0659422 | |||
| 2947 | Ga0395900_0781776 | |||
| 2948 | Ga0395900_0894232 | |||
| 2949 | Ga0395900_0977138 | |||
| 2950 | Ga0395900_1261977 | |||
| 2951 | Ga0395898_0004818 | |||
| 2952 | Ga0395898_0005838 | |||
| 2953 | Ga0395898_0009573 | |||
| 2954 | Ga0395898_0014829 | |||
| 2955 | Ga0395898_0023975 | |||
| 2956 | Ga0395898_0025913 | |||
| 2957 | Ga0395898_0026252 | |||
| 2958 | Ga0395898_0031174 | |||
| 2959 | Ga0395898_0031424 | |||
| 2960 | Ga0395898_0044970 | |||
| 2961 | Ga0395898_0055709 | |||
| 2962 | Ga0395898_0065774 | |||
| 2963 | Ga0395898_0076622 | |||
| 2964 | Ga0395898_0094649 | |||
| 2965 | Ga0395898_0129251 | |||
| 2966 | Ga0395898_0146920 | |||
| 2967 | Ga0395898_0146990 | |||
| 2968 | Ga0395898_0151251 | |||
| 2969 | Ga0395898_0151360 | |||
| 2970 | Ga0395898_0341458 | |||
| 2971 | Ga0395898_0393459 | |||
| 2972 | Ga0395898_0460543 | |||
| 2973 | Ga0395898_0504946 | |||
| 2974 | Ga0395898_0613941 | |||
| 2975 | Ga0395898_0784324 | |||
| 2976 | Ga0395898_1062438 | |||
| 2977 | Ga0395898_1236522 | |||
| 2978 | Ga0395905_0006664 | |||
| 2979 | Ga0395905_0008040 | |||
| 2980 | Ga0395905_0010274 | |||
| 2981 | Ga0395905_0013469 | |||
| 2982 | Ga0395905_0036864 | |||
| 2983 | Ga0395905_0037343 | |||
| 2984 | Ga0395905_0064361 | |||
| 2985 | Ga0395905_0072421 | |||
| 2986 | Ga0395905_0077520 | |||
| 2987 | Ga0395905_0083118 | |||
| 2988 | Ga0395905_0104634 | |||
| 2989 | Ga0395905_0189416 | |||
| 2990 | Ga0395905_0273039 | |||
| 2991 | Ga0395905_0285434 | |||
| 2992 | Ga0395905_0300869 | |||
| 2993 | Ga0395905_0324709 | |||
| 2994 | Ga0395905_0659004 | |||
| 2995 | Ga0395905_1018030 | |||
| 2996 | Ga0395905_1085159 | |||
| 2997 | Ga0395905_1126279 | |||
| 2998 | Ga0395901_0000731 | |||
| 2999 | Ga0395901_0002352 | |||
| 3000 | Ga0395901_0003039 | |||
| 3001 | Ga0395901_0009320 | |||
| 3002 | Ga0395901_0009671 | |||
| 3003 | Ga0395901_0011114 | |||
| 3004 | Ga0395901_0015241 | |||
| 3005 | Ga0395901_0027918 | |||
| 3006 | Ga0395901_0035405 | |||
| 3007 | Ga0395901_0037870 | |||
| 3008 | Ga0395901_0060611 | |||
| 3009 | Ga0395901_0064308 | |||
| 3010 | Ga0395901_0071864 | |||
| 3011 | Ga0395901_0074680 | |||
| 3012 | Ga0395901_0111538 | |||
| 3013 | Ga0395901_0119478 | |||
| 3014 | Ga0395901_0128562 | |||
| 3015 | Ga0395901_0142756 | |||
| 3016 | Ga0395901_0158514 | |||
| 3017 | Ga0395901_0163307 | |||
| 3018 | Ga0395901_0238164 | |||
| 3019 | Ga0395901_0243505 | |||
| 3020 | Ga0395901_0303240 | |||
| 3021 | Ga0395901_0323259 | |||
| 3022 | Ga0395901_0330304 | |||
| 3023 | Ga0395901_0340022 | |||
| 3024 | Ga0395901_0403287 | |||
| 3025 | Ga0395901_0465851 | |||
| 3026 | Ga0395901_0551056 | |||
| 3027 | Ga0395901_0580790 | |||
| 3028 | Ga0395901_0745638 | |||
| 3029 | Ga0395901_0769497 | |||
| 3030 | Ga0395901_0895255 | |||
| 3031 | Ga0395901_1158586 | |||
| 3032 | Ga0395901_1200750 | |||
| 3033 | Ga0395901_1413672 | |||
| 3034 | Ga0395901_1832786 | |||
| 3035 | Ga0395901_1980533 | |||
| 3036 | Ga0242420_072882 | |||
| 3037 | Ga0436360_0109394 | |||
| 3038 | Ga0436363_0834990 | |||
| 3039 | Ga0436363_1509554 | |||
| 3040 | Ga0436362_0876451 | |||
| 3041 | Ga0436362_0950133 | |||
| 3042 | Ga0439438_041642 | |||
| 3043 | Ga0439461_0002121 | |||
| 3044 | Ga0439461_0011001 | |||
| 3045 | Ga0439466_0029918 | |||
| 3046 | Ga0439466_0110845 | |||
| 3047 | Ga0439465_0260355 | |||
| 3048 | Ga0451802_2055700 | |||
| 3049 | Ga0451807_0430671 | |||
| 3050 | Ga0451845_0039632 | |||
| 3051 | Ga0451853_0221711 | |||
| 3052 | Ga0451853_2921298 | |||
| 3053 | Ga0451853_3912091 | |||
| 3054 | Ga0439437_035967 | |||
| 3055 | Ga0439441_021194 | |||
| 3056 | Ga0439456_091856 | |||
| 3057 | Ga0450912_003398 | |||
| 3058 | Ga0450913_029854 | |||
| 3059 | Ga0450914_003882 | |||
| 3060 | Ga0450915_012003 | |||
| 3061 | Ga0450920_023652 | |||
| 3062 | Ga0450905_017857 | |||
| 3063 | Ga0450907_071417 | |||
| 3064 | Ga0450910_022011 | |||
| 3065 | Ga0439446_0001277 | |||
| 3066 | Ga0439458_0029379 | |||
| 3067 | Ga0439458_0093884 | |||
| 3068 | Ga0450908_087066 | |||
| 3069 | Ga0439434_0165211 | |||
| 3070 | Ga0439459_0017868 | |||
| 3071 | Ga0439459_0076260 | |||
| 3072 | Ga0439460_0308629 | |||
| 3073 | Ga0450916_032177 | |||
| 3074 | Ga0450918_048381 | |||
| 3075 | Ga0451577_1811052 | |||
| 3076 | Ga0466969_0072078 | |||
| 3077 | Ga0466972_0103354 | |||
| 3078 | Ga0466965_0317508 | |||
| 3079 | Ga0466966_0020014 | |||
| 3080 | Ga0466966_0040366 | |||
| 3081 | Ga0466966_0262271 | |||
| 3082 | Ga0466961_0001959 | |||
| 3083 | Ga0466961_0048623 | |||
| 3084 | Ga0466961_0237862 | |||
| 3085 | Ga0466961_0425221 | |||
| 3086 | Ga0466963_0001943 | |||
| 3087 | Ga0466963_0003712 | |||
| 3088 | Ga0466963_0030304 | |||
| 3089 | Ga0466963_0229897 | |||
| 3090 | Ga0466963_0280817 | |||
| 3091 | Ga0466963_0328288 | |||
| 3092 | Ga0466963_0381020 | |||
| 3093 | Ga0466963_0722076 | |||
| 3094 | Ga0466964_0008287 | |||
| 3095 | Ga0466964_0069408 | |||
| 3096 | Ga0466964_0141382 | |||
| 3097 | Ga0466964_0206258 | |||
| 3098 | Ga0466964_0232954 | |||
| 3099 | Ga0466971_0036954 | |||
| 3100 | Ga0466971_0674651 | |||
| 3101 | Ga0466968_0276298 | |||
| 3102 | Ga0466968_0404405 | |||
| 3103 | Ga0466970_0288062 | |||
| 3104 | Ga0466957_0070751 | |||
| 3105 | Ga0466957_0071289 | |||
| 3106 | Ga0466957_0425722 | |||
| 3107 | Ga0466960_0028065 | |||
| 3108 | Ga0466960_0133700 | |||
| 3109 | Ga0466960_0142471 | |||
| 3110 | Ga0466960_0292868 | |||
| 3111 | Ga0466960_0423780 | |||
| 3112 | Ga0466960_0951788 | |||
| 3113 | Ga0466959_0041892 | |||
| 3114 | Ga0451576_0619700 | |||
| 3115 | Ga0451576_1382027 | |||
| 3116 | Ga0466958_0010663 | |||
| 3117 | Ga0466958_0020060 | |||
| 3118 | Ga0466958_0029162 | |||
| 3119 | Ga0466958_0057741 | |||
| 3120 | Ga0466958_0303385 | |||
| 3121 | Ga0466958_0586667 | |||
| 3122 | Ga0466967_0048200 | |||
| 3123 | Ga0466967_0057421 | |||
| 3124 | Ga0466967_0067626 | |||
| 3125 | Ga0466967_0088768 | |||
| 3126 | Ga0466967_0140751 | |||
| 3127 | Ga0466967_0147375 | |||
| 3128 | Ga0466967_0219133 | |||
| 3129 | Ga0466967_0331894 | |||
| 3130 | Ga0466967_0350144 | |||
| 3131 | Ga0466967_0472538 | |||
| 3132 | Ga0466967_0685596 | |||
| 3133 | Ga0466967_1022804 | |||
| 3134 | Ga0466967_1231651 | |||
| 3135 | Ga0466967_1567611 | |||
| 3136 | Ga0466967_1998216 | |||
| 3137 | Ga0495627_183681 | |||
| 3138 | Ga0495592_0124239 | |||
| 3139 | Ga0495592_0338318 | |||
| 3140 | Ga0495592_0551373 | |||
| 3141 | Ga0495603_0016929 | |||
| 3142 | Ga0495603_0024832 | |||
| 3143 | Ga0495603_0031659 | |||
| 3144 | Ga0495603_0109821 | |||
| 3145 | Ga0495603_0153831 | |||
| 3146 | Ga0495603_0272775 | |||
| 3147 | Ga0495603_0859238 | |||
| 3148 | Ga0495591_074442 | |||
| 3149 | Ga0495629_0018401 | |||
| 3150 | Ga0495629_0021356 | |||
| 3151 | Ga0495629_0051575 | |||
| 3152 | Ga0495629_0117540 | |||
| 3153 | Ga0495629_0128519 | |||
| 3154 | Ga0495629_0162190 | |||
| 3155 | Ga0495629_0180342 | |||
| 3156 | Ga0495629_0239086 | |||
| 3157 | Ga0495641_0022352 | |||
| 3158 | Ga0495641_0105834 | |||
| 3159 | Ga0495641_0135112 | |||
| 3160 | Ga0495641_0139027 | |||
| 3161 | Ga0495651_0033546 | |||
| 3162 | Ga0495651_0161083 | |||
| 3163 | Ga0495651_0260480 | |||
| 3164 | Ga0495651_0280540 | |||
| 3165 | Ga0495653_0002135 | |||
| 3166 | Ga0495653_0048424 | |||
| 3167 | Ga0495653_0060322 | |||
| 3168 | Ga0495653_0297898 | |||
| 3169 | Ga0495653_0352827 | |||
| 3170 | Ga0495580_0382500 | |||
| 3171 | Ga0495580_0435600 | |||
| 3172 | Ga0495582_0009920 | |||
| 3173 | Ga0495582_0019313 | |||
| 3174 | Ga0495582_0043094 | |||
| 3175 | Ga0495582_0270330 | |||
| 3176 | Ga0495582_0477323 | |||
| 3177 | Ga0495582_0569907 | |||
| 3178 | Ga0495582_0908820 | |||
| 3179 | Ga0495605_0019864 | |||
| 3180 | Ga0495605_0123957 | |||
| 3181 | Ga0495605_0297710 | |||
| 3182 | Ga0495639_0022510 | |||
| 3183 | Ga0495639_0189944 | |||
| 3184 | Ga0495639_0253705 | |||
| 3185 | Ga0495662_0171984 | |||
| 3186 | Ga0495584_0085645 | |||
| 3187 | Ga0495584_0138004 | |||
| 3188 | Ga0495584_0376732 | |||
| 3189 | Ga0495584_0509945 | |||
| 3190 | Ga0495585_0261894 | |||
| 3191 | Ga0495594_0042427 | |||
| 3192 | Ga0495594_0088064 | |||
| 3193 | Ga0495594_0265545 | |||
| 3194 | Ga0495594_0344430 | |||
| 3195 | Ga0495594_0434930 | |||
| 3196 | Ga0495594_0846771 | |||
| 3197 | Ga0495596_0338128 | |||
| 3198 | Ga0495607_0142132 | |||
| 3199 | Ga0495607_0176188 | |||
| 3200 | Ga0495607_0256639 | |||
| 3201 | Ga0495608_0003222 | |||
| 3202 | Ga0495608_0012504 | |||
| 3203 | Ga0495608_0027502 | |||
| 3204 | Ga0495608_0354443 | |||
| 3205 | Ga0495618_0053359 | |||
| 3206 | Ga0495618_0617144 | |||
| 3207 | Ga0495618_0735679 | |||
| 3208 | Ga0495620_0079227 | |||
| 3209 | Ga0495628_0029204 | |||
| 3210 | Ga0495628_0242493 | |||
| 3211 | Ga0495628_0288182 | |||
| 3212 | Ga0495630_0005488 | |||
| 3213 | Ga0495630_0012217 | |||
| 3214 | Ga0495630_0014654 | |||
| 3215 | Ga0495630_0049662 | |||
| 3216 | Ga0495630_0300427 | |||
| 3217 | Ga0495630_0377004 | |||
| 3218 | Ga0495630_0664051 | |||
| 3219 | Ga0495630_0763889 | |||
| 3220 | Ga0495630_0895376 | |||
| 3221 | Ga0495631_0074822 | |||
| 3222 | Ga0495631_0128341 | |||
| 3223 | Ga0495644_0041791 | |||
| 3224 | Ga0495644_0150987 | |||
| 3225 | Ga0495644_0216083 | |||
| 3226 | Ga0495644_0348068 | |||
| 3227 | Ga0495663_0060997 | |||
| 3228 | Ga0495666_0004926 | |||
| 3229 | Ga0495666_0114106 | |||
| 3230 | Ga0495642_0215819 | |||
| 3231 | Ga0495652_0056986 | |||
| 3232 | Ga0495652_0186191 | |||
| 3233 | Ga0495652_0359291 | |||
| 3234 | Ga0495652_0486924 | |||
| 3235 | Ga0495654_0155520 | |||
| 3236 | Ga0495665_0003066 | |||
| 3237 | Ga0495640_0005710 | |||
| 3238 | Ga0495640_0059272 | |||
| 3239 | Ga0495640_0203888 | |||
| 3240 | Ga0495640_0268404 | |||
| 3241 | Ga0495586_0010275 | |||
| 3242 | Ga0495586_0237032 | |||
| 3243 | Ga0495586_0418289 | |||
| 3244 | Ga0495587_0018904 | |||
| 3245 | Ga0495587_0276083 | |||
| 3246 | Ga0495587_0458999 | |||
| 3247 | Ga0495598_0217895 | |||
| 3248 | Ga0495598_0248517 | |||
| 3249 | Ga0495609_0058397 | |||
| 3250 | Ga0495609_0160602 | |||
| 3251 | Ga0495609_0278146 | |||
| 3252 | Ga0495597_0044856 | |||
| 3253 | Ga0495645_0075828 | |||
| 3254 | Ga0495645_0247901 | |||
| 3255 | Ga0495667_0002394 | |||
| 3256 | Ga0495667_0011408 | |||
| 3257 | Ga0495667_0059259 | |||
| 3258 | Ga0495667_0384780 | |||
| 3259 | Ga0495667_0824746 | |||
| 3260 | Ga0495656_0034484 | |||
| 3261 | Ga0495656_0205769 | |||
| 3262 | Ga0495656_0219373 | |||
| 3263 | Ga0495668_0095384 | |||
| 3264 | Ga0495634_0007684 | |||
| 3265 | Ga0495634_0090980 | |||
| 3266 | Ga0495634_0094676 | |||
| 3267 | Ga0495611_0117080 | |||
| 3268 | Ga0495611_0423962 | |||
| 3269 | Ga0495611_0572891 | |||
| 3270 | Ga0495635_0032552 | |||
| 3271 | Ga0495635_0097529 | |||
| 3272 | Ga0495635_0143744 | |||
| 3273 | Ga0495635_0146998 | |||
| 3274 | Ga0495659_0049277 | |||
| 3275 | Ga0495659_0085016 | |||
| 3276 | Ga0495659_0089558 | |||
| 3277 | Ga0495661_0369150 | |||
| 3278 | Ga0495588_0011592 | |||
| 3279 | Ga0495588_0124819 | |||
| 3280 | Ga0495588_0217559 | |||
| 3281 | Ga0495657_0002882 | |||
| 3282 | Ga0495657_0007489 | |||
| 3283 | Ga0495657_0031304 | |||
| 3284 | Ga0495657_0073721 | |||
| 3285 | Ga0495657_0757048 | |||
| 3286 | Ga0495599_0181842 | |||
| 3287 | Ga0495599_0266371 | |||
| 3288 | Ga0495623_0104581 | |||
| 3289 | Ga0495646_0039461 | |||
| 3290 | Ga0495646_0225331 | |||
| 3291 | Ga0495647_0001687 | |||
| 3292 | Ga0495647_0016729 | |||
| 3293 | Ga0495647_0022639 | |||
| 3294 | Ga0495647_0025191 | |||
| 3295 | Ga0495647_0456477 | |||
| 3296 | Ga0495658_0003974 | |||
| 3297 | Ga0495658_0008700 | |||
| 3298 | Ga0495658_0009164 | |||
| 3299 | Ga0495658_0168164 | |||
| 3300 | Ga0495658_0276223 | |||
| 3301 | Ga0495658_0393755 | |||
| 3302 | Ga0495669_0436511 | |||
| 3303 | Ga0495613_0007500 | |||
| 3304 | Ga0495613_0007806 | |||
| 3305 | Ga0495613_0058553 | |||
| 3306 | Ga0495613_0166399 | |||
| 3307 | Ga0495613_0186013 | |||
| 3308 | Ga0495624_0017436 | |||
| 3309 | Ga0495624_0025162 | |||
| 3310 | Ga0495624_0106819 | |||
| 3311 | Ga0495624_0116989 | |||
| 3312 | Ga0495670_0380383 | |||
| 3313 | Ga0495670_0406413 | |||
| 3314 | Ga0495670_0512406 | |||
| 3315 | Ga0495671_0033411 | |||
| 3316 | Ga0495671_0263162 | |||
| 3317 | Ga0495671_0577595 | |||
| 3318 | Ga0495589_0024325 | |||
| 3319 | Ga0495589_0050674 | |||
| 3320 | Ga0495589_0157621 | |||
| 3321 | Ga0495600_0002865 | |||
| 3322 | Ga0495600_0048618 | |||
| 3323 | Ga0495600_0068544 | |||
| 3324 | Ga0495581_0001208 | |||
| 3325 | Ga0495581_0005647 | |||
| 3326 | Ga0495581_0006900 | |||
| 3327 | Ga0495581_0262662 | |||
| 3328 | Ga0495604_0038158 | |||
| 3329 | Ga0495604_0052135 | |||
| 3330 | Ga0495604_0212373 | |||
| 3331 | Ga0495636_0096962 | |||
| 3332 | Ga0495674_0024852 | |||
| 3333 | Ga0495674_0036549 | |||
| 3334 | Ga0495674_0046908 | |||
| 3335 | Ga0495674_0399363 | |||
| 3336 | Ga0495674_0764728 | |||
| 3337 | Ga0495676_0009426 | |||
| 3338 | Ga0495676_0011656 | |||
| 3339 | Ga0495676_0069159 | |||
| 3340 | Ga0495676_0127580 | |||
| 3341 | Ga0495676_0618182 | |||
| 3342 | Ga0495680_0003404 | |||
| 3343 | Ga0495680_0009714 | |||
| 3344 | Ga0495680_0015569 | |||
| 3345 | Ga0495680_0070806 | |||
| 3346 | Ga0495680_0246039 | |||
| 3347 | Ga0495680_0436988 | |||
| 3348 | Ga0495675_0024154 | |||
| 3349 | Ga0495675_0059777 | |||
| 3350 | Ga0495675_0547578 | |||
| 3351 | Ga0495675_0610601 | |||
| 3352 | Ga0495677_0131550 | |||
| 3353 | Ga0495677_0390650 | |||
| 3354 | Ga0495685_103038 | |||
| 3355 | Ga0495685_127005 | |||
| 3356 | Ga0495684_0007256 | |||
| 3357 | Ga0495684_0043180 | |||
| 3358 | Ga0495684_0063068 | |||
| 3359 | Ga0495684_0604102 | |||
| 3360 | Ga0495593_0005150 | |||
| 3361 | Ga0495593_0089388 | |||
| 3362 | Ga0495593_0254040 | |||
| 3363 | Ga0495602_0094214 | |||
| 3364 | Ga0495602_0293140 | |||
| 3365 | Ga0495602_0425490 | |||
| 3366 | Ga0495614_0004846 | |||
| 3367 | Ga0495614_0323171 | |||
| 3368 | Ga0495615_0040354 | |||
| 3369 | Ga0495626_0184609 | |||
| 3370 | Ga0496100_0005825 | |||
| 3371 | Ga0496100_0044008 | |||
| 3372 | Ga0496100_0055157 | |||
| 3373 | Ga0496100_0070479 | |||
| 3374 | Ga0496100_0095799 | |||
| 3375 | Ga0496100_0114441 | |||
| 3376 | Ga0496100_0146099 | |||
| 3377 | Ga0496100_0152529 | |||
| 3378 | Ga0496100_0238489 | |||
| 3379 | Ga0496100_0360325 | |||
| 3380 | Ga0496100_0548094 | |||
| 3381 | Ga0496100_1498511 | |||
| 3382 | Ga0496101_0002047 | |||
| 3383 | Ga0496101_0004093 | |||
| 3384 | Ga0496101_0010090 | |||
| 3385 | Ga0496101_0013413 | |||
| 3386 | Ga0496101_0067940 | |||
| 3387 | Ga0496101_0075113 | |||
| 3388 | Ga0496101_0080595 | |||
| 3389 | Ga0496101_0118210 | |||
| 3390 | Ga0496101_0270776 | |||
| 3391 | Ga0496101_0293273 | |||
| 3392 | Ga0496101_0523755 | |||
| 3393 | Ga0496102_0011058 | |||
| 3394 | Ga0496102_0014471 | |||
| 3395 | Ga0496102_0058806 | |||
| 3396 | Ga0496102_0060968 | |||
| 3397 | Ga0496102_0065835 | |||
| 3398 | Ga0496102_0074067 | |||
| 3399 | Ga0496102_0082052 | |||
| 3400 | Ga0496102_0116052 | |||
| 3401 | Ga0496102_0116403 | |||
| 3402 | Ga0496102_0273788 | |||
| 3403 | Ga0496102_0903700 | |||
| 3404 | Ga0496102_1146694 | |||
| 3405 | Ga0496102_1765814 | |||
| 3406 | Ga0496103_0010922 | |||
| 3407 | Ga0496103_0044183 | |||
| 3408 | Ga0496103_0086026 | |||
| 3409 | Ga0496103_0101894 | |||
| 3410 | Ga0496103_0115648 | |||
| 3411 | Ga0496103_0144295 | |||
| 3412 | Ga0496103_0158013 | |||
| 3413 | Ga0496103_0257248 | |||
| 3414 | Ga0496103_0739397 | |||
| 3415 | Ga0496103_0771140 | |||
| 3416 | Ga0496103_0943953 | |||
| 3417 | Ga0496104_0007356 | |||
| 3418 | Ga0496104_0012742 | |||
| 3419 | Ga0496104_0015042 | |||
| 3420 | Ga0496104_0035843 | |||
| 3421 | Ga0496104_0076396 | |||
| 3422 | Ga0496104_0081221 | |||
| 3423 | Ga0496104_0157485 | |||
| 3424 | Ga0496104_0185026 | |||
| 3425 | Ga0496104_0322304 | |||
| 3426 | Ga0496104_1390039 | |||
| 3427 | Ga0496105_0012484 | |||
| 3428 | Ga0496105_0044992 | |||
| 3429 | Ga0496105_0053215 | |||
| 3430 | Ga0496105_0062233 | |||
| 3431 | Ga0496105_0115849 | |||
| 3432 | Ga0496105_0195554 | |||
| 3433 | Ga0496105_0233677 | |||
| 3434 | Ga0496105_0272561 | |||
| 3435 | Ga0496105_0362525 | |||
| 3436 | Ga0496105_1003945 | |||
| 3437 | Ga0496106_0000799 | |||
| 3438 | Ga0496106_0001574 | |||
| 3439 | Ga0496106_0003932 | |||
| 3440 | Ga0496106_0005483 | |||
| 3441 | Ga0496106_0014611 | |||
| 3442 | Ga0496106_0039427 | |||
| 3443 | Ga0496106_0086489 | |||
| 3444 | Ga0496106_0246025 | |||
| 3445 | Ga0496106_1257328 | |||
| 3446 | Ga0496107_0000717 | |||
| 3447 | Ga0496107_0002487 | |||
| 3448 | Ga0496107_0009850 | |||
| 3449 | Ga0496107_0016756 | |||
| 3450 | Ga0496107_0022269 | |||
| 3451 | Ga0496107_0055259 | |||
| 3452 | Ga0496107_0056046 | |||
| 3453 | Ga0496107_0167644 | |||
| 3454 | Ga0496107_0198951 | |||
| 3455 | Ga0496107_0212749 | |||
| 3456 | Ga0496107_0219423 | |||
| 3457 | Ga0496107_0705900 | |||
| 3458 | Ga0496107_1003046 | |||
| 3459 | Ga0496108_0000945 | |||
| 3460 | Ga0496108_0012922 | |||
| 3461 | Ga0496108_0014614 | |||
| 3462 | Ga0496108_0025821 | |||
| 3463 | Ga0496108_0030570 | |||
| 3464 | Ga0496108_0034296 | |||
| 3465 | Ga0496108_0071680 | |||
| 3466 | Ga0496108_0100462 | |||
| 3467 | Ga0496108_0145074 | |||
| 3468 | Ga0496108_0594933 | |||
| 3469 | Ga0496109_0000523 | |||
| 3470 | Ga0496109_0006830 | |||
| 3471 | Ga0496109_0012241 | |||
| 3472 | Ga0496109_0014408 | |||
| 3473 | Ga0496109_0015382 | |||
| 3474 | Ga0496109_0026179 | |||
| 3475 | Ga0496109_0043976 | |||
| 3476 | Ga0496109_0088670 | |||
| 3477 | Ga0496109_0218266 | |||
| 3478 | Ga0496109_0232548 | |||
| 3479 | Ga0496109_0325372 | |||
| 3480 | Ga0496109_0388445 | |||
| 3481 | Ga0496109_0426592 | |||
| 3482 | Ga0496109_0456860 | |||
| 3483 | Ga0496109_0639746 | |||
| 3484 | Ga0496109_0709463 | |||
| 3485 | Ga0496109_0801705 | |||
| 3486 | Ga0496109_0803665 | |||
| 3487 | Ga0496109_2004898 | |||
| 3488 | Ga0496110_0000677 | |||
| 3489 | Ga0496110_0016904 | |||
| 3490 | Ga0496110_0021495 | |||
| 3491 | Ga0496110_0032996 | |||
| 3492 | Ga0496110_0033108 | |||
| 3493 | Ga0496110_0050369 | |||
| 3494 | Ga0496110_0369734 | |||
| 3495 | Ga0496110_0462470 | |||
| 3496 | Ga0496110_0464627 | |||
| 3497 | Ga0496110_0627743 | |||
| 3498 | Ga0496110_1526395 | |||
| 3499 | Ga0496111_0000744 | |||
| 3500 | Ga0496111_0002134 | |||
| 3501 | Ga0496111_0011040 | |||
| 3502 | Ga0496111_0020928 | |||
| 3503 | Ga0496111_0025941 | |||
| 3504 | Ga0496111_0132001 | |||
| 3505 | Ga0496111_0275370 | |||
| 3506 | Ga0496111_0361661 | |||
| 3507 | Ga0496111_0721237 | |||
| 3508 | Ga0496111_1295513 | |||
| 3509 | Ga0496112_0000731 | |||
| 3510 | Ga0496112_0000874 | |||
| 3511 | Ga0496112_0003094 | |||
| 3512 | Ga0496112_0013633 | |||
| 3513 | Ga0496112_0016012 | |||
| 3514 | Ga0496112_0016153 | |||
| 3515 | Ga0496112_0053250 | |||
| 3516 | Ga0496112_0104965 | |||
| 3517 | Ga0496112_0120058 | |||
| 3518 | Ga0496112_0131346 | |||
| 3519 | Ga0496112_0139713 | |||
| 3520 | Ga0496112_0217817 | |||
| 3521 | Ga0496112_0270877 | |||
| 3522 | Ga0496112_0279855 | |||
| 3523 | Ga0496112_0297273 | |||
| 3524 | Ga0496112_0419821 | |||
| 3525 | Ga0496112_0615909 | |||
| 3526 | Ga0496112_0770533 | |||
| 3527 | Ga0496112_1745868 | |||
| 3528 | Ga0496113_0001429 | |||
| 3529 | Ga0496113_0004935 | |||
| 3530 | Ga0496113_0032226 | |||
| 3531 | Ga0496113_0035909 | |||
| 3532 | Ga0496113_0231319 | |||
| 3533 | Ga0496113_0240006 | |||
| 3534 | Ga0496113_0286729 | |||
| 3535 | Ga0496113_0321052 | |||
| 3536 | Ga0496113_0457475 | |||
| 3537 | Ga0496113_1311430 | |||
| 3538 | Ga0496114_0006868 | |||
| 3539 | Ga0496114_0009546 | |||
| 3540 | Ga0496114_0024509 | |||
| 3541 | Ga0496114_0038353 | |||
| 3542 | Ga0496114_0042427 | |||
| 3543 | Ga0496114_0052098 | |||
| 3544 | Ga0496114_0052891 | |||
| 3545 | Ga0496114_0075653 | |||
| 3546 | Ga0496114_0125355 | |||
| 3547 | Ga0496114_0129105 | |||
| 3548 | Ga0496114_0174815 | |||
| 3549 | Ga0496114_0525986 | |||
| 3550 | Ga0496114_0751861 | |||
| 3551 | Ga0496114_1368815 | |||
| 3552 | Ga0496114_1410462 | |||
| 3553 | Ga0496114_1477079 | |||
| 3554 | Ga0496115_0001511 | |||
| 3555 | Ga0496115_0006793 | |||
| 3556 | Ga0496115_0017491 | |||
| 3557 | Ga0496115_0042367 | |||
| 3558 | Ga0496115_0046460 | |||
| 3559 | Ga0496115_0199687 | |||
| 3560 | Ga0496115_0244740 | |||
| 3561 | Ga0496115_0293773 | |||
| 3562 | Ga0496115_0439264 | |||
| 3563 | Ga0496115_0718252 | |||
| 3564 | Ga0496115_1040568 | |||
| 3565 | Ga0501291_068187 | |||
| 3566 | Ga0501031_0000565 | |||
| 3567 | Ga0501031_0001953 | |||
| 3568 | Ga0501031_0017346 | |||
| 3569 | Ga0501031_0052355 | |||
| 3570 | Ga0501031_0151776 | |||
| 3571 | Ga0501032_0000274 | |||
| 3572 | Ga0501032_0036219 | |||
| 3573 | Ga0501032_0395513 | |||
| 3574 | Ga0501032_0586813 | |||
| 3575 | Ga0501033_0000920 | |||
| 3576 | Ga0501033_0001164 | |||
| 3577 | Ga0501033_0192595 | |||
| 3578 | Ga0501033_0244051 | |||
| 3579 | Ga0501033_0257882 | |||
| 3580 | Ga0501033_0861923 | |||
| 3581 | Ga0501034_0041370 | |||
| 3582 | Ga0501034_0044193 | |||
| 3583 | Ga0501034_0227380 | |||
| 3584 | Ga0501034_0812600 | |||
| 3585 | Ga0501036_0000971 | |||
| 3586 | Ga0501036_0007285 | |||
| 3587 | Ga0501036_0053329 | |||
| 3588 | Ga0501036_0069247 | |||
| 3589 | Ga0501036_0078909 | |||
| 3590 | Ga0501036_0230126 | |||
| 3591 | Ga0501036_0275511 | |||
| 3592 | Ga0501036_0529856 | |||
| 3593 | Ga0501036_0539429 | |||
| 3594 | Ga0501037_0000519 | |||
| 3595 | Ga0501037_0029289 | |||
| 3596 | Ga0501037_0074126 | |||
| 3597 | Ga0501037_0459491 | |||
| 3598 | Ga0501038_0000186 | |||
| 3599 | Ga0501038_0019415 | |||
| 3600 | Ga0501038_0052782 | |||
| 3601 | Ga0501038_0068760 | |||
| 3602 | Ga0501038_0279708 | |||
| 3603 | Ga0501038_0492587 | |||
| 3604 | Ga0501038_0821105 | |||
| 3605 | Ga0501039_0003315 | |||
| 3606 | Ga0501039_0005307 | |||
| 3607 | Ga0501039_0024937 | |||
| 3608 | Ga0501039_0038293 | |||
| 3609 | Ga0501039_0252240 | |||
| 3610 | Ga0501039_0428077 | |||
| 3611 | Ga0501039_0735603 | |||
| 3612 | Ga0501039_0775047 | |||
| 3613 | Ga0501040_0000605 | |||
| 3614 | Ga0501040_0011880 | |||
| 3615 | Ga0501040_0019519 | |||
| 3616 | Ga0501040_0051514 | |||
| 3617 | Ga0501040_0066560 | |||
| 3618 | Ga0501040_0081299 | |||
| 3619 | Ga0501040_0139950 | |||
| 3620 | Ga0501040_0177177 | |||
| 3621 | Ga0501040_0288204 | |||
| 3622 | Ga0501040_1324146 | |||
| 3623 | Ga0501041_0000039 | |||
| 3624 | Ga0501041_0001797 | |||
| 3625 | Ga0501041_0002733 | |||
| 3626 | Ga0501041_0009157 | |||
| 3627 | Ga0501041_0012510 | |||
| 3628 | Ga0501041_0066158 | |||
| 3629 | Ga0501041_0119918 | |||
| 3630 | Ga0501041_0128225 | |||
| 3631 | Ga0501041_0403313 | |||
| 3632 | Ga0501042_0001026 | |||
| 3633 | Ga0501042_0019739 | |||
| 3634 | Ga0501042_0020182 | |||
| 3635 | Ga0501042_0026783 | |||
| 3636 | Ga0501042_0032814 | |||
| 3637 | Ga0501042_0068932 | |||
| 3638 | Ga0501042_0076262 | |||
| 3639 | Ga0501042_0108302 | |||
| 3640 | Ga0501042_0153166 | |||
| 3641 | Ga0501042_0164250 | |||
| 3642 | Ga0501042_0200642 | |||
| 3643 | Ga0501043_0000171 | |||
| 3644 | Ga0501043_0005336 | |||
| 3645 | Ga0501043_0246023 | |||
| 3646 | Ga0501043_0426922 | |||
| 3647 | Ga0501046_0000177 | |||
| 3648 | Ga0501046_0002858 | |||
| 3649 | Ga0501046_0024694 | |||
| 3650 | Ga0501046_0039756 | |||
| 3651 | Ga0501046_0057220 | |||
| 3652 | Ga0501046_0198614 | |||
| 3653 | Ga0501046_0213206 | |||
| 3654 | Ga0501046_0250786 | |||
| 3655 | Ga0501046_0285826 | |||
| 3656 | Ga0501046_0421445 | |||
| 3657 | Ga0501046_0507227 | |||
| 3658 | Ga0501047_0164513 | |||
| 3659 | Ga0501047_0379778 | |||
| 3660 | Ga0501048_0004102 | |||
| 3661 | Ga0501048_0005297 | |||
| 3662 | Ga0501048_0067803 | |||
| 3663 | Ga0501048_0119440 | |||
| 3664 | Ga0501048_0634680 | |||
| 3665 | Ga0501048_0705697 | |||
| 3666 | Ga0501048_0927255 | |||
| 3667 | Ga0501067_0045266 | |||
| 3668 | Ga0501067_0130184 | |||
| 3669 | Ga0501067_0152171 | |||
| 3670 | Ga0501067_0548967 | |||
| 3671 | Ga0501068_0000051 | |||
| 3672 | Ga0501068_0001051 | |||
| 3673 | Ga0501068_0007526 | |||
| 3674 | Ga0501068_0166715 | |||
| 3675 | Ga0501068_0193277 | |||
| 3676 | Ga0501068_0248247 | |||
| 3677 | Ga0501068_0748922 | |||
| 3678 | Ga0501069_0001394 | |||
| 3679 | Ga0501069_0003701 | |||
| 3680 | Ga0501069_0010111 | |||
| 3681 | Ga0501069_0066832 | |||
| 3682 | Ga0501069_0116106 | |||
| 3683 | Ga0501069_0237298 | |||
| 3684 | Ga0501070_0002425 | |||
| 3685 | Ga0501070_0007771 | |||
| 3686 | Ga0501070_0028281 | |||
| 3687 | Ga0501070_0507554 | |||
| 3688 | Ga0501070_1295500 | |||
| 3689 | Ga0501070_1438307 | |||
| 3690 | Ga0501071_0000031 | |||
| 3691 | Ga0501071_0011778 | |||
| 3692 | Ga0501071_0016912 | |||
| 3693 | Ga0501071_0040070 | |||
| 3694 | Ga0501071_0044164 | |||
| 3695 | Ga0501071_0046669 | |||
| 3696 | Ga0501071_0233080 | |||
| 3697 | Ga0501071_0540740 | |||
| 3698 | Ga0501072_0002062 | |||
| 3699 | Ga0501072_0003142 | |||
| 3700 | Ga0501072_0006063 | |||
| 3701 | Ga0501072_0022648 | |||
| 3702 | Ga0501072_0032316 | |||
| 3703 | Ga0501072_0129148 | |||
| 3704 | Ga0501072_0141023 | |||
| 3705 | Ga0501072_0296827 | |||
| 3706 | Ga0501072_0383346 | |||
| 3707 | Ga0501072_0496581 | |||
| 3708 | Ga0501072_0523333 | |||
| 3709 | Ga0501072_0712948 | |||
| 3710 | Ga0501073_0017065 | |||
| 3711 | Ga0501073_0029774 | |||
| 3712 | Ga0501073_0104857 | |||
| 3713 | Ga0501073_0572017 | |||
| 3714 | Ga0501073_0985562 | |||
| 3715 | Ga0501074_0003677 | |||
| 3716 | Ga0501074_0006826 | |||
| 3717 | Ga0501074_0014877 | |||
| 3718 | Ga0501074_0018032 | |||
| 3719 | Ga0501074_0063362 | |||
| 3720 | Ga0501074_0133683 | |||
| 3721 | Ga0501074_0141311 | |||
| 3722 | Ga0501074_0215252 | |||
| 3723 | Ga0501074_0522739 | |||
| 3724 | Ga0501074_0678683 | |||
| 3725 | Ga0501074_0788415 | |||
| 3726 | Ga0501075_0000266 | |||
| 3727 | Ga0501075_0001528 | |||
| 3728 | Ga0501075_0010268 | |||
| 3729 | Ga0501075_0015269 | |||
| 3730 | Ga0501075_0076897 | |||
| 3731 | Ga0501075_0091392 | |||
| 3732 | Ga0501075_0103867 | |||
| 3733 | Ga0501075_0122465 | |||
| 3734 | Ga0501075_0205297 | |||
| 3735 | Ga0501075_0842279 | |||
| 3736 | Ga0501075_0897915 | |||
| 3737 | Ga0501076_0000634 | |||
| 3738 | Ga0501076_0008497 | |||
| 3739 | Ga0501076_0012482 | |||
| 3740 | Ga0501076_0051824 | |||
| 3741 | Ga0501076_0090401 | |||
| 3742 | Ga0501076_0113434 | |||
| 3743 | Ga0501076_0221187 | |||
| 3744 | Ga0501076_0221619 | |||
| 3745 | Ga0501076_0255931 | |||
| 3746 | Ga0501076_0333464 | |||
| 3747 | Ga0501077_0000257 | |||
| 3748 | Ga0501077_0003870 | |||
| 3749 | Ga0501077_0024781 | |||
| 3750 | Ga0501077_0030419 | |||
| 3751 | Ga0501077_0041091 | |||
| 3752 | Ga0501077_0047937 | |||
| 3753 | Ga0501077_0072653 | |||
| 3754 | Ga0501077_0291939 | |||
| 3755 | Ga0501077_0675403 | |||
| 3756 | Ga0501217_259182 | |||
| 3757 | Ga0501221_145150 | |||
| 3758 | Ga0501079_0000749 | |||
| 3759 | Ga0501079_0004333 | |||
| 3760 | Ga0501079_0013423 | |||
| 3761 | Ga0501079_0020216 | |||
| 3762 | Ga0501079_0023311 | |||
| 3763 | Ga0501079_0033233 | |||
| 3764 | Ga0501079_0069689 | |||
| 3765 | Ga0501079_0139619 | |||
| 3766 | Ga0501079_0148633 | |||
| 3767 | Ga0501079_0154692 | |||
| 3768 | Ga0501079_0329771 | |||
| 3769 | Ga0501080_0000105 | |||
| 3770 | Ga0501080_0058000 | |||
| 3771 | Ga0501080_0063349 | |||
| 3772 | Ga0501080_0096107 | |||
| 3773 | Ga0501080_0246710 | |||
| 3774 | Ga0501080_0319669 | |||
| 3775 | Ga0501080_0354833 | |||
| 3776 | Ga0501080_0857991 | |||
| 3777 | Ga0501081_0000948 | |||
| 3778 | Ga0501081_0001230 | |||
| 3779 | Ga0501081_0030364 | |||
| 3780 | Ga0501081_0034935 | |||
| 3781 | Ga0501081_0072719 | |||
| 3782 | Ga0501081_0082141 | |||
| 3783 | Ga0501081_0170955 | |||
| 3784 | Ga0501081_0202073 | |||
| 3785 | Ga0501081_0228180 | |||
| 3786 | Ga0501081_0451972 | |||
| 3787 | Ga0501081_0791443 | |||
| 3788 | Ga0501081_1464363 | |||
| 3789 | Ga0501083_0000561 | |||
| 3790 | Ga0501083_0000664 | |||
| 3791 | Ga0501083_0002572 | |||
| 3792 | Ga0501083_0069303 | |||
| 3793 | Ga0501083_0109143 | |||
| 3794 | Ga0501083_0260090 | |||
| 3795 | Ga0501083_0378059 | |||
| 3796 | Ga0501083_0452819 | |||
| 3797 | Ga0501266_106026 | |||
| 3798 | Ga0501035_0000457 | |||
| 3799 | Ga0501035_0001358 | |||
| 3800 | Ga0501035_0043355 | |||
| 3801 | Ga0501035_0173630 | |||
| 3802 | Ga0501035_0653357 | |||
| 3803 | Ga0501044_0002523 | |||
| 3804 | Ga0501044_0003404 | |||
| 3805 | Ga0501044_0005188 | |||
| 3806 | Ga0501044_0236964 | |||
| 3807 | Ga0501044_0579351 | |||
| 3808 | Ga0501045_0005910 | |||
| 3809 | Ga0501045_0010848 | |||
| 3810 | Ga0501045_0022556 | |||
| 3811 | Ga0501045_0023433 | |||
| 3812 | Ga0501045_0033134 | |||
| 3813 | Ga0501045_0068603 | |||
| 3814 | Ga0501045_0084164 | |||
| 3815 | Ga0501045_0094985 | |||
| 3816 | Ga0501045_0113240 | |||
| 3817 | Ga0501045_0328296 | |||
| 3818 | Ga0501212_119299 | |||
| 3819 | nmdc:mga03683_174005_c1 | |||
| 3820 | nmdc:mga0yw44_107220_c1 | |||
| 3821 | nmdc:mga0yw44_186393_c1 | |||
| 3822 | nmdc:mga0yw44_392421_c1 | |||
| 3823 | nmdc:mga06z11_659728_c1 | |||
| 3824 | nmdc:mga05p37_107758_c1 | |||
| 3825 | nmdc:mga05p37_16133_c1 | |||
| 3826 | nmdc:mga05p37_241126_c1 | |||
| 3827 | nmdc:mga05p37_28617_c1 | |||
| 3828 | nmdc:mga05p37_433233_c1 | |||
| 3829 | nmdc:mga05p37_612894_c1 | |||
| 3830 | nmdc:mga05p37_630460_c1 | |||
| 3831 | nmdc:mga05p37_66600_c1 | |||
| 3832 | nmdc:mga05p37_8862_c1 | |||
| 3833 | nmdc:mga09592_2440_c1 | |||
| 3834 | nmdc:mga09592_303312_c1 | |||
| 3835 | nmdc:mga0qj67_41930_c1 | |||
| 3836 | nmdc:mga0qj67_990670_c1 | |||
| 3837 | nmdc:mga06r32_162353_c1 | |||
| 3838 | nmdc:mga06r32_198785_c1 | |||
| 3839 | nmdc:mga06r32_42674_c1 | |||
| 3840 | nmdc:mga06r32_438180_c1 | |||
| 3841 | nmdc:mga06r32_832643_c1 | |||
| 3842 | nmdc:mga08y16_1040221_c1 | |||
| 3843 | nmdc:mga08y16_1085803_c1 | |||
| 3844 | nmdc:mga08y16_13727_c1 | |||
| 3845 | nmdc:mga08y16_156192_c1 | |||
| 3846 | nmdc:mga08y16_479770_c1 | |||
| 3847 | nmdc:mga08y16_536081_c1 | |||
| 3848 | nmdc:mga08y16_6212_c1 | |||
| 3849 | nmdc:mga08y16_993441_c1 | |||
| 3850 | nmdc:mga0n895_113403_c1 | |||
| 3851 | nmdc:mga0n895_1302308_c1 | |||
| 3852 | nmdc:mga0n895_1403304_c1 | |||
| 3853 | nmdc:mga0n895_22447_c1 | |||
| 3854 | nmdc:mga0n895_29349_c1 | |||
| 3855 | nmdc:mga0n895_347339_c1 | |||
| 3856 | nmdc:mga0n895_66163_c1 | |||
| 3857 | nmdc:mga0rr50_160820_c1 | |||
| 3858 | nmdc:mga0rr50_33179_c1 | |||
| 3859 | nmdc:mga0rr50_463041_c1 | |||
| 3860 | nmdc:mga0rr50_794457_c1 | |||
| 3861 | nmdc:mga0rr50_8771_c1 | |||
| 3862 | nmdc:mga0rr50_99874_c1 | |||
| 3863 | nmdc:mga08x19_1096607_c1 | |||
| 3864 | nmdc:mga08x19_11008_c1 | |||
| 3865 | nmdc:mga08x19_1187803_c1 | |||
| 3866 | nmdc:mga08x19_13424_c1 | |||
| 3867 | nmdc:mga08x19_276154_c1 | |||
| 3868 | nmdc:mga08x19_39379_c1 | |||
| 3869 | nmdc:mga0a205_17439_c1 | |||
| 3870 | nmdc:mga0a205_28604_c1 | |||
| 3871 | nmdc:mga0a205_362748_c1 | |||
| 3872 | nmdc:mga0a205_55847_c1 | |||
| 3873 | nmdc:mga0a205_8214_c1 | |||
| 3874 | Ga0495601_0014931 | |||
| 3875 | Ga0495601_0077742 | |||
| 3876 | Ga0495601_0265709 | |||
| 3877 | Ga0495601_0715447 | |||
| 3878 | Ga0495612_0183669 | |||
| 3879 | Ga0495612_0348455 | |||
| 3880 | Ga0495655_0085213 | |||
| 3881 | Ga0495595_0008508 | |||
| 3882 | Ga0495595_0030703 | |||
| 3883 | Ga0495595_0229203 | |||
| 3884 | Ga0495595_0586744 | |||
| 3885 | Ga0495619_0062721 | |||
| 3886 | Ga0495619_0096784 | |||
| 3887 | Ga0495619_0178203 | |||
| 3888 | Ga0495619_0305120 | |||
| 3889 | Ga0495619_0307392 | |||
| 3890 | Ga0495619_0474897 | |||
| 3891 | Ga0495619_0615600 | |||
| 3892 | Ga0495619_0971048 | |||
| 3893 | Ga0495619_1148905 | |||
| 3894 | Ga0501084_0000995 | |||
| 3895 | Ga0501084_0001035 | |||
| 3896 | Ga0501084_0001602 | |||
| 3897 | Ga0501084_0025040 | |||
| 3898 | Ga0501084_0041168 | |||
| 3899 | Ga0501084_0052144 | |||
| 3900 | Ga0501084_0110502 | |||
| 3901 | Ga0501084_0127115 | |||
| 3902 | Ga0501084_0132507 | |||
| 3903 | Ga0501084_0274282 | |||
| 3904 | Ga0501084_0485282 | |||
| 3905 | Ga0501084_0493358 | |||
| 3906 | Ga0501084_0710508 | |||
| 3907 | Ga0590077_016865 | |||
| 3908 | Ga0501082_0001285 | |||
| 3909 | Ga0501082_0002542 | |||
| 3910 | Ga0501082_0027473 | |||
| 3911 | Ga0501082_0091413 | |||
| 3912 | Ga0501082_0098581 | |||
| 3913 | Ga0501082_0119943 | |||
| 3914 | Ga0501082_0279395 | |||
| 3915 | Ga0501082_0323530 | |||
| 3916 | Ga0501082_0713924 | |||
| 3917 | Ga0501082_0755670 | |||
| 3918 | Ga0501082_0814845 | |||
| 3919 | Ga0466962_0033068 | |||
| 3920 | Ga0466962_0165682 | |||
| 3921 | Ga0466962_0273557 | |||
| 3922 | Ga0466962_0406569 | |||
| 3923 | Ga0530510_0000483 | |||
| 3924 | Ga0530510_0003271 | |||
| 3925 | Ga0530510_0008413 | |||
| 3926 | Ga0530510_0042169 | |||
| 3927 | Ga0530510_0050183 | |||
| 3928 | Ga0530510_0130411 | |||
| 3929 | Ga0530510_0219486 | |||
| 3930 | Ga0530510_1241338 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2was-assembly2.cif.gz_E | structure of the fungal type i fas ppt domain | 0.9559 | 1 | 120 |
| 2was-assembly2.cif.gz_F | structure of the fungal type i fas ppt domain | 0.9528 | 3 | 120 |
| 2was-assembly2.cif.gz_D | structure of the fungal type i fas ppt domain | 0.9483 | 1 | 119 |
| 2was-assembly2.cif.gz_E | structure of the fungal type i fas ppt domain | 0.9472 | 1 | 120 |
| 2was-assembly2.cif.gz_D | structure of the fungal type i fas ppt domain | 0.9397 | 1 | 119 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2wasC00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain | 0.9376 | 3 | 120 | 3.90.470.20 |
| 2wasC00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain | 0.9212 | 3 | 120 | 3.90.470.20 |
| 5xuhB00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain | 0.9055 | 2 | 120 | 3.90.470.20 |
| 4jm7A01 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain | 0.881 | 2 | 120 | 3.90.470.20 |
| 5cmoC00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain | 0.8809 | 2 | 120 | 3.90.470.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9CS80-F1-model_v4 | Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) | 0.9959 | 2 | 120 |
GO:0000287
GO:0005737 GO:0006633 GO:0008897 |
| AF-A0A538HY81-F1-model_v4 | Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) | 0.9847 | 6 | 120 |
GO:0000287
GO:0005737 GO:0006633 GO:0008897 GO:0016791 |
| AF-A0A7W1N7E0-F1-model_v4 | Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) | 0.9826 | 2 | 118 |
GO:0000287
GO:0005737 GO:0006633 GO:0008897 |
| AF-A0A6J6Q453-F1-model_v4 | Unannotated protein | 0.9822 | 2 | 118 |
GO:0000287
GO:0006633 GO:0008897 |
| AF-A0A7V8XE16-F1-model_v4 | Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) | 0.9766 | 2 | 122 |
GO:0000287
GO:0005737 GO:0006633 GO:0008897 |