F496159

General Info

Members Datasets Scaffolds Average Seq Length
1965 484 3930 122

Family's Representative Sequence

Representative Sequence 3300041503|Ga0451847_0567380|Ga0451847_0567380_137_571
Length 144
Sequence VAAEMPGHSAVLDEEPDEPGSHGGVGVDLIEIARIRRALERYPAFRERCFTEAERAYCESRPNPAQHYAARFAGKEAVGKALGFGVARAFAWRDIEIAGRPKPSVRLSGRVAGWAERVGAGAIDLSMTHSRELANAVAVVDEER

Samples

Sample ID Description Type Environment
1 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
134 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
141 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
142 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
207 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
211 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
212 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
213 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
214 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
215 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
216 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
217 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
218 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
219 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
220 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
221 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
222 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
223 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
224 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
225 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
226 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
227 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
228 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
229 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
230 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
231 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
232 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
233 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
234 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
235 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
236 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
237 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
238 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
239 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
240 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
241 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
242 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
243 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
244 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
245 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
246 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
247 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
248 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
249 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
250 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
251 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
252 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
253 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
254 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
255 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
256 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
257 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
258 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
259 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
260 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
261 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
262 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
263 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
264 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
265 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
266 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
267 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
268 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
269 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
270 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
271 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
272 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
273 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
274 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
275 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
276 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
277 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
278 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
279 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
280 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
281 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
282 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
283 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
284 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
285 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
286 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
287 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
288 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
289 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
290 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
291 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
292 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
293 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
294 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
295 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
296 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
297 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
298 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
299 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
300 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
301 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
302 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
303 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
304 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
305 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
306 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
307 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
308 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
309 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
310 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
311 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
312 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
313 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
314 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
315 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
316 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
317 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
318 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
319 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
320 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
321 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
322 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
323 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
324 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
325 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
326 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
327 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
328 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
329 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
330 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
331 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
332 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
333 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
334 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
335 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
336 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
337 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
338 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
339 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
340 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
341 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
342 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
343 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
344 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
345 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
346 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
347 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
348 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
349 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
350 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
351 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
352 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
353 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
354 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
355 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
356 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
357 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
358 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
359 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
360 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
361 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
362 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
363 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
364 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
365 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
366 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
367 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
368 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
369 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
370 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
371 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
372 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
373 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
374 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
375 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
376 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
377 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
378 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
379 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
380 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
381 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
382 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
383 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
384 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
385 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
386 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
387 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
388 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
389 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
390 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
391 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
392 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
393 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
394 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
395 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
396 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
397 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
398 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
399 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
400 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
401 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
402 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
403 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
404 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
405 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
406 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
407 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
408 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
409 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
410 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
411 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
412 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
413 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
414 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
415 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
416 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
417 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
418 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
419 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
420 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
421 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
422 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
423 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
424 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
425 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
426 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
429 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
442 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
443 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
444 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
445 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
446 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
447 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
448 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
449 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
450 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
451 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
452 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
453 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
454 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
455 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
456 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
457 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
458 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
459 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
460 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
462 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
463 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
464 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
465 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
466 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
467 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
468 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
469 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
470 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
471 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
472 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
473 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
474 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
475 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
476 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
477 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
478 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
479 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
480 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
481 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
482 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
483 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
484 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 10.03
Rhizosphere 89.21
Stem 0
Stem Tuber 0
Unclassified 17.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451847_0567380 3300041503 Bacteria 732
2 JGI24737J22298_10226770 3300001990 Bacteria 551
3 JGI24744J21845_10006394 3300002077 Unclassified 2445
4 JGI24742J22300_10032619 3300002244 Archaea 913
5 JGI25406J46586_10075207 3300003203 Bacteria 1048
6 JGI25407J50210_10004039 3300003373 Bacteria 3561
7 JGI25407J50210_10008409 3300003373 Bacteria 2601
8 Ga0058862_12097182 3300004803 Bacteria 505
9 Ga0070658_10017458 3300005327 Bacteria 5741
10 Ga0070658_10599467 3300005327 Unclassified 955
11 Ga0070676_10123021 3300005328 Bacteria 1631
12 Ga0070676_11296682 3300005328 Bacteria 556
13 Ga0070683_100097361 3300005329 Bacteria 2768
14 Ga0070683_100142815 3300005329 Bacteria 2268
15 Ga0070683_100559210 3300005329 Unclassified 1094
16 Ga0070683_101235695 3300005329 Unclassified 718
17 Ga0070690_100968183 3300005330 Bacteria 669
18 Ga0070670_100233967 3300005331 Bacteria 1599
19 Ga0068869_100066126 3300005334 Bacteria 2663
20 Ga0068869_100088433 3300005334 Bacteria 2325
21 Ga0068869_101174937 3300005334 Bacteria 674
22 Ga0070666_10071585 3300005335 Bacteria 2360
23 Ga0070680_100099227 3300005336 Bacteria 2416
24 Ga0070680_100158195 3300005336 Unclassified 1903
25 Ga0070680_100261476 3300005336 Archaea 1464
26 Ga0070680_101160004 3300005336 Bacteria 668
27 Ga0070682_100000724 3300005337 Bacteria 19777
28 Ga0070682_100353853 3300005337 Bacteria 1096
29 Ga0070682_100492699 3300005337 Unclassified 948
30 Ga0070682_101793144 3300005337 Bacteria 535
31 Ga0068868_100021473 3300005338 Bacteria 4861
32 Ga0068868_100031465 3300005338 Bacteria 4076
33 Ga0068868_100037051 3300005338 Bacteria 3779
34 Ga0068868_100412417 3300005338 Bacteria 1168
35 Ga0070660_100004795 3300005339 Bacteria 9351
36 Ga0070660_100012584 3300005339 Bacteria 6043
37 Ga0070660_100035695 3300005339 Bacteria 3764
38 Ga0070660_100080555 3300005339 Bacteria 2555
39 Ga0070660_100620462 3300005339 Bacteria 905
40 Ga0070660_101032960 3300005339 Bacteria 695
41 Ga0070689_100001164 3300005340 Bacteria 16615
42 Ga0070691_10274266 3300005341 Bacteria 913
43 Ga0070691_10841359 3300005341 Unclassified 562
44 Ga0070687_100117055 3300005343 Bacteria 1518
45 Ga0070692_10062692 3300005345 Bacteria 1962
46 Ga0070692_10243144 3300005345 Bacteria 1074
47 Ga0070692_10531806 3300005345 Unclassified 767
48 Ga0070692_10569908 3300005345 Bacteria 745
49 Ga0070668_100194587 3300005347 Bacteria 1662
50 Ga0070668_100328762 3300005347 Archaea 1289
51 Ga0070669_100592106 3300005353 Unclassified 928
52 Ga0070675_100093736 3300005354 Bacteria 2518
53 Ga0070675_100138855 3300005354 Bacteria 2076
54 Ga0070675_100440446 3300005354 Bacteria 1167
55 Ga0070671_100106400 3300005355 Unclassified 2355
56 Ga0070674_100070769 3300005356 Bacteria 2465
57 Ga0070674_100088494 3300005356 Bacteria 2229
58 Ga0070674_100171053 3300005356 Bacteria 1656
59 Ga0070674_100337666 3300005356 Unclassified 1213
60 Ga0070674_100449858 3300005356 Bacteria 1063
61 Ga0070674_100573692 3300005356 Unclassified 950
62 Ga0070674_100645764 3300005356 Bacteria 899
63 Ga0070673_100144366 3300005364 Bacteria 2011
64 Ga0070688_100031102 3300005365 Bacteria 3209
65 Ga0070688_100307199 3300005365 Bacteria 1148
66 Ga0070688_100668004 3300005365 Bacteria 802
67 Ga0070659_100003178 3300005366 Bacteria 11692
68 Ga0070659_100402607 3300005366 Archaea 1155
69 Ga0070659_100415626 3300005366 Unclassified 1137
70 Ga0070659_101035686 3300005366 Bacteria 721
71 Ga0070667_100094285 3300005367 Unclassified 2579
72 Ga0070667_100458895 3300005367 Bacteria 1165
73 Ga0070703_10016513 3300005406 Bacteria 2119
74 Ga0070703_10108310 3300005406 Archaea 990
75 Ga0070709_10063361 3300005434 Bacteria 2361
76 Ga0070709_10235018 3300005434 Bacteria 1313
77 Ga0070709_10335885 3300005434 Bacteria 1113
78 Ga0070709_11099465 3300005434 Bacteria 636
79 Ga0070709_11286633 3300005434 Bacteria 589
80 Ga0070709_11583593 3300005434 Bacteria 533
81 Ga0070714_100004641 3300005435 Bacteria 10368
82 Ga0070714_100009404 3300005435 Bacteria 7685
83 Ga0070714_100021468 3300005435 Bacteria 5283
84 Ga0070714_100054262 3300005435 Bacteria 3423
85 Ga0070714_100072186 3300005435 Bacteria 2987
86 Ga0070714_100177175 3300005435 Bacteria 1938
87 Ga0070714_100279502 3300005435 Bacteria 1550
88 Ga0070714_100302028 3300005435 Bacteria 1492
89 Ga0070714_100491228 3300005435 Unclassified 1170
90 Ga0070714_101240172 3300005435 Bacteria 728
91 Ga0070713_100112608 3300005436 Bacteria 2374
92 Ga0070713_100175288 3300005436 Bacteria 1924
93 Ga0070713_100674034 3300005436 Bacteria 986
94 Ga0070713_100962494 3300005436 Bacteria 823
95 Ga0070713_101057460 3300005436 Bacteria 784
96 Ga0070713_101989177 3300005436 Bacteria 564
97 Ga0070710_10077042 3300005437 Bacteria 1937
98 Ga0070710_10097550 3300005437 Unclassified 1744
99 Ga0070710_10314580 3300005437 Bacteria 1026
100 Ga0070710_10506106 3300005437 Unclassified 827
101 Ga0070701_10029400 3300005438 Unclassified 2710
102 Ga0070701_10974226 3300005438 Bacteria 590
103 Ga0070711_100005292 3300005439 Bacteria 7705
104 Ga0070711_100335146 3300005439 Bacteria 1212
105 Ga0070711_100347812 3300005439 Unclassified 1191
106 Ga0070711_100479998 3300005439 Bacteria 1022
107 Ga0070711_101344084 3300005439 Bacteria 621
108 Ga0070705_100032809 3300005440 Unclassified 2888
109 Ga0070705_100142209 3300005440 Unclassified 1580
110 Ga0070705_100161336 3300005440 Unclassified 1499
111 Ga0070705_100197641 3300005440 Bacteria 1376
112 Ga0070705_100286981 3300005440 Bacteria 1173
113 Ga0070705_100479506 3300005440 Unclassified 939
114 Ga0070705_101675539 3300005440 Bacteria 537
115 Ga0070700_100017962 3300005441 Bacteria 4057
116 Ga0070700_100705534 3300005441 Unclassified 803
117 Ga0070700_100856377 3300005441 Bacteria 736
118 Ga0070694_100002541 3300005444 Bacteria 10773
119 Ga0070694_100224112 3300005444 Bacteria 1411
120 Ga0070694_100956813 3300005444 Bacteria 709
121 Ga0070708_100059650 3300005445 Bacteria 3403
122 Ga0070708_100144183 3300005445 Bacteria 2211
123 Ga0070708_100514941 3300005445 Bacteria 1128
124 Ga0070708_100854210 3300005445 Bacteria 855
125 Ga0070663_100104925 3300005455 Unclassified 2115
126 Ga0070663_100616716 3300005455 Unclassified 914
127 Ga0070663_100816012 3300005455 Bacteria 801
128 Ga0070663_101460446 3300005455 Unclassified 607
129 Ga0070678_100016378 3300005456 Bacteria 4742
130 Ga0070678_100098940 3300005456 Bacteria 2256
131 Ga0070678_100225644 3300005456 Bacteria 1559
132 Ga0070678_100299146 3300005456 Bacteria 1367
133 Ga0070678_100323794 3300005456 Bacteria 1317
134 Ga0070678_100401937 3300005456 Bacteria 1190
135 Ga0070678_100853536 3300005456 Bacteria 830
136 Ga0070678_101315656 3300005456 Bacteria 673
137 Ga0070662_100120899 3300005457 Bacteria 2007
138 Ga0070662_100417504 3300005457 Bacteria 1109
139 Ga0070662_100453067 3300005457 Bacteria 1065
140 Ga0070662_101276775 3300005457 Bacteria 632
141 Ga0070681_10008425 3300005458 Bacteria 10099
142 Ga0070681_10024213 3300005458 Bacteria 6112
143 Ga0070681_10181531 3300005458 Bacteria 2026
144 Ga0070681_11307142 3300005458 Bacteria 648
145 Ga0070681_11950120 3300005458 Bacteria 515
146 Ga0068867_100005114 3300005459 Bacteria 9268
147 Ga0068867_100251077 3300005459 Bacteria 1438
148 Ga0068867_100264654 3300005459 Bacteria 1403
149 Ga0070685_10780219 3300005466 Bacteria 703
150 Ga0070706_100019334 3300005467 Bacteria 6283
151 Ga0070706_100039954 3300005467 Bacteria 4331
152 Ga0070706_100063962 3300005467 Bacteria 3400
153 Ga0070706_100245793 3300005467 Bacteria 1671
154 Ga0070706_100644267 3300005467 Bacteria 984
155 Ga0070706_100697149 3300005467 Bacteria 942
156 Ga0070706_101014677 3300005467 Bacteria 765
157 Ga0070707_100000876 3300005468 Bacteria 29832
158 Ga0070707_100014709 3300005468 Bacteria 7335
159 Ga0070707_100142740 3300005468 Unclassified 2330
160 Ga0070707_100223602 3300005468 Bacteria 1833
161 Ga0070707_100254843 3300005468 Bacteria 1708
162 Ga0070707_100503632 3300005468 Bacteria 1173
163 Ga0070707_100535984 3300005468 Bacteria 1133
164 Ga0070707_101404098 3300005468 Unclassified 665
165 Ga0070707_102170021 3300005468 Bacteria 523
166 Ga0070698_100010606 3300005471 Bacteria 9816
167 Ga0070698_100013685 3300005471 Bacteria 8589
168 Ga0070698_100051873 3300005471 Bacteria 4176
169 Ga0070698_100072239 3300005471 Bacteria 3459
170 Ga0070698_100229314 3300005471 Bacteria 1790
171 Ga0070698_100284728 3300005471 Bacteria 1584
172 Ga0070698_100566529 3300005471 Bacteria 1076
173 Ga0070698_100931958 3300005471 Bacteria 815
174 Ga0070698_100990651 3300005471 Bacteria 788
175 Ga0070698_100990800 3300005471 Bacteria 787
176 Ga0070698_101419543 3300005471 Unclassified 645
177 Ga0070698_102118226 3300005471 Bacteria 516
178 Ga0070699_100010261 3300005518 Bacteria 8101
179 Ga0070699_100047910 3300005518 Bacteria 3698
180 Ga0070699_100158488 3300005518 Bacteria 2003
181 Ga0070699_100265330 3300005518 Bacteria 1536
182 Ga0070699_100363138 3300005518 Bacteria 1306
183 Ga0070699_100598294 3300005518 Bacteria 1005
184 Ga0070699_100823004 3300005518 Bacteria 850
185 Ga0070699_101013289 3300005518 Unclassified 761
186 Ga0070699_101723486 3300005518 Unclassified 574
187 Ga0070679_100156727 3300005530 Bacteria 2252
188 Ga0070679_100158088 3300005530 Bacteria 2241
189 Ga0070679_100273022 3300005530 Bacteria 1644
190 Ga0070679_100301997 3300005530 Bacteria 1551
191 Ga0070679_100545873 3300005530 Bacteria 1103
192 Ga0070684_100042465 3300005535 Bacteria 3925
193 Ga0070697_100200450 3300005536 Bacteria 1696
194 Ga0070697_101105278 3300005536 Unclassified 706
195 Ga0070697_101636157 3300005536 Unclassified 576
196 Ga0068853_102099934 3300005539 Bacteria 548
197 Ga0070672_100051152 3300005543 Bacteria 3220
198 Ga0070672_100110878 3300005543 Bacteria 2236
199 Ga0070672_100297156 3300005543 Bacteria 1368
200 Ga0070672_100455698 3300005543 Unclassified 1102
201 Ga0070672_100772991 3300005543 Bacteria 844
202 Ga0070686_100123364 3300005544 Bacteria 1782
203 Ga0070686_100642333 3300005544 Unclassified 841
204 Ga0070686_101179751 3300005544 Unclassified 635
205 Ga0070695_100034587 3300005545 Bacteria 3169
206 Ga0070695_100097243 3300005545 Bacteria 1977
207 Ga0070695_100103679 3300005545 Bacteria 1919
208 Ga0070695_100278029 3300005545 Bacteria 1229
209 Ga0070695_100574641 3300005545 Bacteria 882
210 Ga0070696_100008682 3300005546 Bacteria 6800
211 Ga0070696_100012464 3300005546 Bacteria 5705
212 Ga0070696_100450255 3300005546 Bacteria 1016
213 Ga0070696_101026665 3300005546 Bacteria 690
214 Ga0070696_101196695 3300005546 Bacteria 642
215 Ga0070696_101765274 3300005546 Unclassified 534
216 Ga0070693_100036720 3300005547 Bacteria 2726
217 Ga0070693_100073851 3300005547 Bacteria 2016
218 Ga0070693_100102540 3300005547 Unclassified 1745
219 Ga0070693_100124315 3300005547 Bacteria 1604
220 Ga0070693_100264590 3300005547 Unclassified 1145
221 Ga0070693_100656928 3300005547 Unclassified 763
222 Ga0070665_100211979 3300005548 Bacteria 1938
223 Ga0070665_100527452 3300005548 Bacteria 1193
224 Ga0070704_100007778 3300005549 Bacteria 6390
225 Ga0070704_100286559 3300005549 Bacteria 1367
226 Ga0070704_100384330 3300005549 Bacteria 1194
227 Ga0070704_100490434 3300005549 Bacteria 1064
228 Ga0070704_100618264 3300005549 Bacteria 954
229 Ga0070704_101000668 3300005549 Bacteria 756
230 Ga0068855_100011694 3300005563 Bacteria 10606
231 Ga0068855_100026071 3300005563 Bacteria 6992
232 Ga0068855_100054074 3300005563 Bacteria 4721
233 Ga0068855_100076167 3300005563 Bacteria 3894
234 Ga0068855_100095580 3300005563 Bacteria 3425
235 Ga0068855_100745323 3300005563 Bacteria 1045
236 Ga0070664_100999464 3300005564 Unclassified 786
237 Ga0070664_101868090 3300005564 Bacteria 570
238 Ga0068857_100012071 3300005577 Bacteria 7511
239 Ga0068854_100263133 3300005578 Unclassified 1382
240 Ga0068856_100002288 3300005614 Bacteria 19758
241 Ga0068856_100006131 3300005614 Bacteria 11801
242 Ga0068856_100213729 3300005614 Unclassified 1944
243 Ga0068856_100724824 3300005614 Unclassified 1015
244 Ga0068856_100990614 3300005614 Bacteria 859
245 Ga0068856_101292017 3300005614 Unclassified 745
246 Ga0070702_100045252 3300005615 Bacteria 2489
247 Ga0070702_100047635 3300005615 Unclassified 2436
248 Ga0070702_100051895 3300005615 Bacteria 2350
249 Ga0070702_100569966 3300005615 Unclassified 844
250 Ga0070702_100619599 3300005615 Bacteria 814
251 Ga0068852_100186519 3300005616 Unclassified 1954
252 Ga0068852_100398170 3300005616 Unclassified 1354
253 Ga0068852_102326828 3300005616 Bacteria 557
254 Ga0068859_100066787 3300005617 Bacteria 3632
255 Ga0068859_100068771 3300005617 Bacteria 3576
256 Ga0068859_101253902 3300005617 Unclassified 817
257 Ga0068864_100281527 3300005618 Bacteria 1552
258 Ga0068866_10296046 3300005718 Bacteria 1009
259 Ga0068866_10355344 3300005718 Unclassified 932
260 Ga0068861_100061062 3300005719 Bacteria 2891
261 Ga0068861_100548529 3300005719 Bacteria 1053
262 Ga0068861_101810463 3300005719 Bacteria 606
263 Ga0068870_10036532 3300005840 Bacteria 2528
264 Ga0068870_10930004 3300005840 Bacteria 616
265 Ga0068863_102165100 3300005841 Unclassified 566
266 Ga0068858_100167631 3300005842 Bacteria 2070
267 Ga0068858_100216107 3300005842 Unclassified 1815
268 Ga0068860_100054202 3300005843 Bacteria 3812
269 Ga0068860_100892634 3300005843 Bacteria 905
270 Ga0068862_100146178 3300005844 Bacteria 2101
271 Ga0068862_101082901 3300005844 Bacteria 796
272 Ga0068862_101156284 3300005844 Bacteria 771
273 Ga0081455_10028173 3300005937 Bacteria 5135
274 Ga0081455_10087699 3300005937 Bacteria 2531
275 Ga0081455_10115946 3300005937 Bacteria 2119
276 Ga0081455_10192003 3300005937 Archaea 1537
277 Ga0081455_10243433 3300005937 Bacteria 1320
278 Ga0081538_10000562 3300005981 Bacteria 41236
279 Ga0081538_10000853 3300005981 Bacteria 32893
280 Ga0081538_10001225 3300005981 Bacteria 26911
281 Ga0081538_10007406 3300005981 Bacteria 9503
282 Ga0081538_10010402 3300005981 Bacteria 7627
283 Ga0081538_10019642 3300005981 Bacteria 5008
284 Ga0081538_10054341 3300005981 Bacteria 2369
285 Ga0081538_10083202 3300005981 Bacteria 1692
286 Ga0081538_10234738 3300005981 Archaea 713
287 Ga0081539_10003901 3300005985 Bacteria 17357
288 Ga0081539_10015861 3300005985 Bacteria 5435
289 Ga0081539_10051470 3300005985 Unclassified 2320
290 Ga0081539_10086606 3300005985 Bacteria 1629
291 Ga0070717_10025852 3300006028 Bacteria 4677
292 Ga0070717_10202222 3300006028 Bacteria 1740
293 Ga0070717_10626624 3300006028 Bacteria 976
294 Ga0075365_10034867 3300006038 Bacteria 3253
295 Ga0075365_10160485 3300006038 Bacteria 1566
296 Ga0075432_10005707 3300006058 Bacteria 4237
297 Ga0075432_10066592 3300006058 Bacteria 1289
298 Ga0075432_10100204 3300006058 Bacteria 1070
299 Ga0070715_10028985 3300006163 Bacteria 2226
300 Ga0070716_100020975 3300006173 Bacteria 3437
301 Ga0070716_100146645 3300006173 Bacteria 1512
302 Ga0070716_100191536 3300006173 Unclassified 1352
303 Ga0070716_100430722 3300006173 Unclassified 956
304 Ga0070716_101147048 3300006173 Bacteria 622
305 Ga0070712_100009723 3300006175 Bacteria 6061
306 Ga0070712_100075379 3300006175 Bacteria 2426
307 Ga0070712_100080069 3300006175 Unclassified 2363
308 Ga0070712_100306712 3300006175 Unclassified 1286
309 Ga0070712_100345656 3300006175 Bacteria 1216
310 Ga0070712_100435608 3300006175 Unclassified 1089
311 Ga0070712_101419925 3300006175 Bacteria 606
312 Ga0075367_10832747 3300006178 Unclassified 588
313 Ga0097621_100011800 3300006237 Bacteria 6453
314 Ga0097621_100174180 3300006237 Bacteria 1856
315 Ga0097621_100213561 3300006237 Bacteria 1679
316 Ga0068871_100134410 3300006358 Unclassified 2100
317 Ga0068871_100214794 3300006358 Bacteria 1665
318 Ga0068871_100376888 3300006358 Unclassified 1260
319 Ga0075428_100050603 3300006844 Bacteria 4556
320 Ga0075428_100268792 3300006844 Bacteria 1835
321 Ga0075428_100573004 3300006844 Unclassified 1206
322 Ga0075428_101203178 3300006844 Bacteria 799
323 Ga0075428_101983677 3300006844 Bacteria 603
324 Ga0075430_100222135 3300006846 Bacteria 1567
325 Ga0075430_100261228 3300006846 Bacteria 1434
326 Ga0075430_101109700 3300006846 Archaea 651
327 Ga0075431_100009745 3300006847 Bacteria 9647
328 Ga0075431_100076028 3300006847 Bacteria 3465
329 Ga0075431_100186447 3300006847 Unclassified 2127
330 Ga0075433_10184272 3300006852 Unclassified 1857
331 Ga0075433_10186541 3300006852 Bacteria 1845
332 Ga0075433_10197241 3300006852 Unclassified 1790
333 Ga0075433_10291887 3300006852 Bacteria 1444
334 Ga0075433_10736973 3300006852 Unclassified 862
335 Ga0075434_100052068 3300006871 Bacteria 4068
336 Ga0075434_100052483 3300006871 Bacteria 4051
337 Ga0075434_100094216 3300006871 Bacteria 2999
338 Ga0075434_100160015 3300006871 Bacteria 2271
339 Ga0075434_100207228 3300006871 Bacteria 1981
340 Ga0075434_100231680 3300006871 Bacteria 1866
341 Ga0075434_100280016 3300006871 Unclassified 1687
342 Ga0075434_101509570 3300006871 Unclassified 681
343 Ga0075434_101666872 3300006871 Bacteria 646
344 Ga0075429_100006033 3300006880 Bacteria 10478
345 Ga0075429_100194385 3300006880 Unclassified 1777
346 Ga0075429_100407100 3300006880 Unclassified 1191
347 Ga0068865_100001518 3300006881 Bacteria 13527
348 Ga0068865_100149598 3300006881 Bacteria 1770
349 Ga0068865_100364237 3300006881 Bacteria 1175
350 Ga0068865_100513771 3300006881 Bacteria 1001
351 Ga0068865_100754853 3300006881 Bacteria 836
352 Ga0068865_101100865 3300006881 Bacteria 700
353 Ga0068865_101586257 3300006881 Bacteria 588
354 Ga0075436_100008310 3300006914 Bacteria 7100
355 Ga0075436_100048885 3300006914 Bacteria 2918
356 Ga0075436_100077952 3300006914 Bacteria 2295
357 Ga0075436_100307289 3300006914 Bacteria 1137
358 Ga0075436_100403334 3300006914 Bacteria 991
359 Ga0075436_100734759 3300006914 Unclassified 732
360 Ga0075436_101089983 3300006914 Bacteria 601
361 Ga0097620_100066788 3300006931 Bacteria 3632
362 Ga0097620_100068770 3300006931 Bacteria 3576
363 Ga0097620_101253855 3300006931 Unclassified 817
364 Ga0075435_100002001 3300007076 Bacteria 13341
365 Ga0075435_100009053 3300007076 Bacteria 7182
366 Ga0075435_100013824 3300007076 Bacteria 6018
367 Ga0075435_100040550 3300007076 Bacteria 3719
368 Ga0075435_100221331 3300007076 Bacteria 1607
369 Ga0105250_10360533 3300009092 Bacteria 638
370 Ga0105240_10013310 3300009093 Bacteria 11307
371 Ga0105240_10432243 3300009093 Bacteria 1477
372 Ga0105240_11971471 3300009093 Unclassified 607
373 Ga0105240_12231899 3300009093 Bacteria 567
374 Ga0111539_10029604 3300009094 Bacteria 6666
375 Ga0111539_10228515 3300009094 Unclassified 2167
376 Ga0111539_10374009 3300009094 Bacteria 1658
377 Ga0111539_10758251 3300009094 Unclassified 1129
378 Ga0111539_11043617 3300009094 Unclassified 950
379 Ga0111539_11419980 3300009094 Bacteria 805
380 Ga0111539_12335322 3300009094 Unclassified 620
381 Ga0105245_10002378 3300009098 Bacteria 17012
382 Ga0105245_10010538 3300009098 Bacteria 8043
383 Ga0105245_10016039 3300009098 Bacteria 6527
384 Ga0105245_10026837 3300009098 Bacteria 5071
385 Ga0105245_10027993 3300009098 Bacteria 4968
386 Ga0105245_10177381 3300009098 Bacteria 2033
387 Ga0105245_10768795 3300009098 Unclassified 1000
388 Ga0105245_11497091 3300009098 Unclassified 726
389 Ga0105245_11984730 3300009098 Bacteria 635
390 Ga0105245_12838075 3300009098 Bacteria 537
391 Ga0105245_12933283 3300009098 Bacteria 529
392 Ga0105247_10022659 3300009101 Bacteria 3783
393 Ga0105247_10839932 3300009101 Bacteria 704
394 Ga0105247_11229638 3300009101 Bacteria 598
395 Ga0114129_10005388 3300009147 Bacteria 18059
396 Ga0114129_10008675 3300009147 Bacteria 14490
397 Ga0114129_10040341 3300009147 Bacteria 6581
398 Ga0114129_10047239 3300009147 Bacteria 6050
399 Ga0114129_10173819 3300009147 Unclassified 2935
400 Ga0114129_10221020 3300009147 Unclassified 2555
401 Ga0114129_10245304 3300009147 Bacteria 2407
402 Ga0114129_10471642 3300009147 Bacteria 1643
403 Ga0114129_11190216 3300009147 Bacteria 950
404 Ga0114129_12997658 3300009147 Unclassified 555
405 Ga0114129_13125366 3300009147 Bacteria 541
406 Ga0105243_10027910 3300009148 Bacteria 4330
407 Ga0105243_10052582 3300009148 Bacteria 3227
408 Ga0105243_10106557 3300009148 Bacteria 2337
409 Ga0105243_10240380 3300009148 Bacteria 1611
410 Ga0105243_12753586 3300009148 Unclassified 532
411 Ga0105241_10198782 3300009174 Bacteria 1673
412 Ga0105241_10981413 3300009174 Unclassified 789
413 Ga0105241_11458632 3300009174 Bacteria 657
414 Ga0105242_10008443 3300009176 Bacteria 7914
415 Ga0105242_10024840 3300009176 Bacteria 4736
416 Ga0105242_10120030 3300009176 Bacteria 2254
417 Ga0105242_10245765 3300009176 Bacteria 1610
418 Ga0105242_10376029 3300009176 Bacteria 1319
419 Ga0105242_10448917 3300009176 Bacteria 1215
420 Ga0105242_12143359 3300009176 Bacteria 603
421 Ga0105248_10008379 3300009177 Bacteria 11351
422 Ga0105248_11017689 3300009177 Bacteria 936
423 Ga0105248_12259279 3300009177 Bacteria 619
424 Ga0105237_10520886 3300009545 Unclassified 1195
425 Ga0105238_10006132 3300009551 Bacteria 11932
426 Ga0105238_10392678 3300009551 Unclassified 1380
427 Ga0105238_10716228 3300009551 Bacteria 1013
428 Ga0105238_12575289 3300009551 Bacteria 545
429 Ga0105249_10001066 3300009553 Bacteria 24325
430 Ga0105249_10386296 3300009553 Bacteria 1427
431 Ga0105249_10685121 3300009553 Unclassified 1084
432 Ga0105249_12251100 3300009553 Bacteria 618
433 Ga0105249_12326922 3300009553 Unclassified 608
434 Ga0105249_12970872 3300009553 Bacteria 544
435 Ga0105239_10006889 3300010375 Bacteria 13111
436 Ga0105239_10022722 3300010375 Bacteria 6914
437 Ga0105239_10234932 3300010375 Bacteria 2057
438 Ga0105239_10453373 3300010375 Unclassified 1455
439 Ga0105239_10651874 3300010375 Unclassified 1203
440 Ga0105239_13027409 3300010375 Bacteria 548
441 Ga0105246_10090198 3300011119 Bacteria 2207
442 Ga0105246_10133644 3300011119 Bacteria 1856
443 Ga0105246_10611534 3300011119 Bacteria 943
444 Ga0157321_1022019 3300012487 Unclassified 592
445 Ga0157373_10571147 3300013100 Bacteria 821
446 Ga0157373_10790347 3300013100 Bacteria 699
447 Ga0157371_10876157 3300013102 Bacteria 680
448 Ga0157370_10008957 3300013104 Bacteria 10747
449 Ga0157370_10011605 3300013104 Bacteria 9198
450 Ga0157370_10021485 3300013104 Bacteria 6431
451 Ga0157370_10581521 3300013104 Unclassified 1026
452 Ga0157369_10002298 3300013105 Bacteria 22996
453 Ga0157369_10018218 3300013105 Bacteria 7875
454 Ga0157369_10369578 3300013105 Bacteria 1489
455 Ga0157369_10664886 3300013105 Bacteria 1074
456 Ga0157369_10732624 3300013105 Bacteria 1017
457 Ga0157369_12050789 3300013105 Bacteria 580
458 Ga0157374_10006816 3300013296 Bacteria 9718
459 Ga0157374_11027978 3300013296 Unclassified 843
460 Ga0157374_11366903 3300013296 Bacteria 731
461 Ga0157378_10363346 3300013297 Bacteria 1417
462 Ga0157378_10571851 3300013297 Bacteria 1138
463 Ga0157378_11312841 3300013297 Bacteria 765
464 Ga0163162_10007126 3300013306 Bacteria 10851
465 Ga0163162_10068726 3300013306 Bacteria 3594
466 Ga0157372_10062694 3300013307 Bacteria 4166
467 Ga0157372_10511293 3300013307 Bacteria 1400
468 Ga0157372_10895525 3300013307 Bacteria 1030
469 Ga0157372_11627991 3300013307 Bacteria 743
470 Ga0157372_11848106 3300013307 Unclassified 694
471 Ga0157372_12543911 3300013307 Bacteria 588
472 Ga0157375_10124007 3300013308 Bacteria 2696
473 Ga0157375_10233570 3300013308 Unclassified 1998
474 Ga0157375_10313664 3300013308 Bacteria 1732
475 Ga0157375_10840723 3300013308 Unclassified 1065
476 Ga0157375_10928123 3300013308 Bacteria 1013
477 Ga0163163_10090122 3300014325 Bacteria 3080
478 Ga0163163_10747369 3300014325 Bacteria 1041
479 Ga0163163_11012849 3300014325 Unclassified 894
480 Ga0163163_11037752 3300014325 Bacteria 883
481 Ga0163163_11503159 3300014325 Unclassified 735
482 Ga0157380_10064114 3300014326 Bacteria 2948
483 Ga0157380_10240371 3300014326 Bacteria 1632
484 Ga0157380_11036642 3300014326 Bacteria 856
485 Ga0182008_10150105 3300014497 Bacteria 1169
486 Ga0182008_10881057 3300014497 Bacteria 525
487 Ga0157377_10008690 3300014745 Bacteria 4961
488 Ga0157377_10025409 3300014745 Bacteria 3159
489 Ga0157377_11084471 3300014745 Bacteria 612
490 Ga0157379_10245504 3300014968 Bacteria 1624
491 Ga0157379_10749500 3300014968 Bacteria 919
492 Ga0157379_10812705 3300014968 Bacteria 883
493 Ga0157379_10889147 3300014968 Unclassified 844
494 Ga0157376_10025044 3300014969 Bacteria 4695
495 Ga0157376_10097436 3300014969 Unclassified 2562
496 Ga0157376_10408014 3300014969 Bacteria 1315
497 Ga0157376_10882916 3300014969 Bacteria 911
498 Ga0157376_10911999 3300014969 Bacteria 897
499 Ga0157376_12012877 3300014969 Unclassified 615
500 Ga0182007_10351269 3300015262 Bacteria 554
501 Ga0182005_1307918 3300015265 Unclassified 501
502 Ga0163161_10485117 3300017792 Bacteria 1004
503 Ga0163161_11300143 3300017792 Bacteria 632
504 Ga0197907_10065360 3300020069 Bacteria 1884
505 Ga0206356_11236435 3300020070 Bacteria 2417
506 Ga0206354_11509267 3300020081 Bacteria 5110
507 Ga0206353_10968799 3300020082 Bacteria 1059
508 Ga0206353_11480980 3300020082 Bacteria 637
509 Ga0206353_12016091 3300020082 Bacteria 3625
510 Ga0213873_10195572 3300021358 Bacteria 626
511 Ga0213871_10015656 3300021441 Bacteria 1816
512 Ga0207653_10001347 3300025885 Bacteria 7986
513 Ga0207692_10186608 3300025898 Unclassified 1211
514 Ga0207692_10237492 3300025898 Bacteria 1087
515 Ga0207692_10292174 3300025898 Unclassified 989
516 Ga0207692_10307069 3300025898 Bacteria 967
517 Ga0207642_10003349 3300025899 Bacteria 5047
518 Ga0207688_10210317 3300025901 Unclassified 1168
519 Ga0207688_10212351 3300025901 Bacteria 1163
520 Ga0207688_10401861 3300025901 Bacteria 850
521 Ga0207647_10075870 3300025904 Unclassified 2023
522 Ga0207685_10007078 3300025905 Bacteria 3103
523 Ga0207685_10438335 3300025905 Unclassified 677
524 Ga0207699_10040087 3300025906 Unclassified 2696
525 Ga0207699_10065044 3300025906 Bacteria 2209
526 Ga0207699_10074517 3300025906 Bacteria 2085
527 Ga0207699_10486038 3300025906 Archaea 890
528 Ga0207699_10530288 3300025906 Bacteria 852
529 Ga0207699_10750668 3300025906 Bacteria 716
530 Ga0207699_10863588 3300025906 Bacteria 667
531 Ga0207645_10219858 3300025907 Unclassified 1252
532 Ga0207645_10698301 3300025907 Bacteria 690
533 Ga0207643_10416065 3300025908 Bacteria 852
534 Ga0207643_10756380 3300025908 Bacteria 629
535 Ga0207705_10085132 3300025909 Unclassified 2309
536 Ga0207705_10177943 3300025909 Bacteria 1604
537 Ga0207705_10248385 3300025909 Bacteria 1357
538 Ga0207684_10050496 3300025910 Bacteria 3528
539 Ga0207684_10140613 3300025910 Bacteria 2075
540 Ga0207684_10357755 3300025910 Bacteria 1256
541 Ga0207684_10415672 3300025910 Bacteria 1156
542 Ga0207684_10551359 3300025910 Bacteria 986
543 Ga0207654_10331074 3300025911 Bacteria 1044
544 Ga0207654_10385247 3300025911 Bacteria 972
545 Ga0207707_10001299 3300025912 Bacteria 23250
546 Ga0207707_10079600 3300025912 Bacteria 2861
547 Ga0207707_10341760 3300025912 Unclassified 1290
548 Ga0207707_10861068 3300025912 Bacteria 751
549 Ga0207695_10114961 3300025913 Unclassified 2666
550 Ga0207695_10931034 3300025913 Bacteria 748
551 Ga0207695_11476554 3300025913 Bacteria 560
552 Ga0207671_10356252 3300025914 Unclassified 1161
553 Ga0207693_10000183 3300025915 Bacteria 57157
554 Ga0207693_10000543 3300025915 Bacteria 34121
555 Ga0207693_10004718 3300025915 Bacteria 11466
556 Ga0207693_10118547 3300025915 Bacteria 2078
557 Ga0207693_10263454 3300025915 Bacteria 1351
558 Ga0207693_10389104 3300025915 Unclassified 1090
559 Ga0207693_11031568 3300025915 Bacteria 627
560 Ga0207693_11031591 3300025915 Bacteria 627
561 Ga0207663_10022230 3300025916 Bacteria 3623
562 Ga0207663_10439320 3300025916 Bacteria 1005
563 Ga0207663_10495530 3300025916 Bacteria 948
564 Ga0207663_10774029 3300025916 Unclassified 763
565 Ga0207663_11461776 3300025916 Bacteria 550
566 Ga0207663_11611665 3300025916 Bacteria 522
567 Ga0207660_10201701 3300025917 Archaea 1554
568 Ga0207660_10554816 3300025917 Bacteria 934
569 Ga0207660_11255522 3300025917 Bacteria 602
570 Ga0207662_10382893 3300025918 Bacteria 951
571 Ga0207657_10003624 3300025919 Bacteria 16448
572 Ga0207657_10012052 3300025919 Bacteria 8551
573 Ga0207657_10012634 3300025919 Bacteria 8323
574 Ga0207657_10071676 3300025919 Unclassified 2933
575 Ga0207657_10385561 3300025919 Bacteria 1103
576 Ga0207657_10542382 3300025919 Bacteria 910
577 Ga0207657_10755239 3300025919 Bacteria 753
578 Ga0207649_10545013 3300025920 Bacteria 887
579 Ga0207652_10021367 3300025921 Bacteria 5343
580 Ga0207652_10185066 3300025921 Bacteria 1873
581 Ga0207652_10303651 3300025921 Bacteria 1441
582 Ga0207652_10437217 3300025921 Bacteria 1180
583 Ga0207652_10530816 3300025921 Bacteria 1058
584 Ga0207646_10025319 3300025922 Bacteria 5429
585 Ga0207646_10052541 3300025922 Bacteria 3646
586 Ga0207646_10390990 3300025922 Bacteria 1256
587 Ga0207646_10507311 3300025922 Bacteria 1086
588 Ga0207646_11326255 3300025922 Bacteria 628
589 Ga0207646_11442757 3300025922 Bacteria 597
590 Ga0207681_10423505 3300025923 Unclassified 1079
591 Ga0207694_10499456 3300025924 Unclassified 1018
592 Ga0207659_10092558 3300025926 Bacteria 2261
593 Ga0207659_10186154 3300025926 Unclassified 1649
594 Ga0207659_10868070 3300025926 Bacteria 776
595 Ga0207687_10008291 3300025927 Bacteria 6797
596 Ga0207687_10010129 3300025927 Bacteria 6164
597 Ga0207687_10020256 3300025927 Bacteria 4412
598 Ga0207687_10026619 3300025927 Bacteria 3873
599 Ga0207687_10048987 3300025927 Bacteria 2936
600 Ga0207687_10146343 3300025927 Unclassified 1798
601 Ga0207687_10462302 3300025927 Bacteria 1054
602 Ga0207687_10930344 3300025927 Unclassified 744
603 Ga0207700_10040505 3300025928 Bacteria 3401
604 Ga0207700_10159450 3300025928 Bacteria 1872
605 Ga0207700_10403419 3300025928 Bacteria 1198
606 Ga0207700_10409502 3300025928 Archaea 1189
607 Ga0207700_10475041 3300025928 Bacteria 1104
608 Ga0207700_10857433 3300025928 Unclassified 813
609 Ga0207700_10943279 3300025928 Unclassified 772
610 Ga0207700_11153775 3300025928 Bacteria 692
611 Ga0207700_11156866 3300025928 Bacteria 691
612 Ga0207664_10055197 3300025929 Bacteria 3152
613 Ga0207664_10072260 3300025929 Bacteria 2781
614 Ga0207664_10073052 3300025929 Bacteria 2767
615 Ga0207664_10074962 3300025929 Bacteria 2735
616 Ga0207664_10111135 3300025929 Bacteria 2280
617 Ga0207664_10115264 3300025929 Bacteria 2240
618 Ga0207664_10121549 3300025929 Bacteria 2186
619 Ga0207664_10269823 3300025929 Bacteria 1490
620 Ga0207664_11004510 3300025929 Bacteria 748
621 Ga0207644_10168324 3300025931 Unclassified 1709
622 Ga0207644_10994542 3300025931 Unclassified 704
623 Ga0207690_10014593 3300025932 Bacteria 4745
624 Ga0207690_10038686 3300025932 Bacteria 3106
625 Ga0207690_10144533 3300025932 Bacteria 1757
626 Ga0207706_10094006 3300025933 Bacteria 2637
627 Ga0207706_10171296 3300025933 Unclassified 1907
628 Ga0207706_10222488 3300025933 Bacteria 1652
629 Ga0207706_10439565 3300025933 Bacteria 1129
630 Ga0207706_10578108 3300025933 Bacteria 966
631 Ga0207706_10751561 3300025933 Bacteria 831
632 Ga0207706_11424707 3300025933 Unclassified 568
633 Ga0207686_10006015 3300025934 Bacteria 6513
634 Ga0207686_10326493 3300025934 Bacteria 1148
635 Ga0207686_10394458 3300025934 Bacteria 1052
636 Ga0207686_10572299 3300025934 Bacteria 886
637 Ga0207686_10977724 3300025934 Bacteria 686
638 Ga0207686_11635864 3300025934 Bacteria 532
639 Ga0207709_10027389 3300025935 Bacteria 3283
640 Ga0207709_10074810 3300025935 Bacteria 2163
641 Ga0207709_10967028 3300025935 Unclassified 695
642 Ga0207709_11831278 3300025935 Unclassified 505
643 Ga0207669_10017540 3300025937 Bacteria 3676
644 Ga0207669_10113132 3300025937 Unclassified 1824
645 Ga0207669_10159444 3300025937 Bacteria 1591
646 Ga0207669_10559199 3300025937 Bacteria 924
647 Ga0207669_10865386 3300025937 Bacteria 753
648 Ga0207669_11575028 3300025937 Bacteria 561
649 Ga0207704_10006979 3300025938 Bacteria 5303
650 Ga0207704_10399170 3300025938 Bacteria 1084
651 Ga0207704_10493587 3300025938 Bacteria 985
652 Ga0207704_11004425 3300025938 Bacteria 706
653 Ga0207704_11235625 3300025938 Bacteria 638
654 Ga0207665_10024756 3300025939 Bacteria 3959
655 Ga0207665_10128324 3300025939 Bacteria 1797
656 Ga0207665_10237511 3300025939 Unclassified 1342
657 Ga0207665_10377125 3300025939 Bacteria 1076
658 Ga0207665_10542206 3300025939 Bacteria 903
659 Ga0207665_10708851 3300025939 Bacteria 791
660 Ga0207691_10002533 3300025940 Bacteria 17854
661 Ga0207691_10085597 3300025940 Bacteria 2829
662 Ga0207691_10505621 3300025940 Unclassified 1026
663 Ga0207691_10784277 3300025940 Bacteria 801
664 Ga0207711_10543310 3300025941 Bacteria 1084
665 Ga0207711_10578692 3300025941 Archaea 1047
666 Ga0207689_10062101 3300025942 Bacteria 3072
667 Ga0207689_10068349 3300025942 Bacteria 2920
668 Ga0207689_11686307 3300025942 Unclassified 525
669 Ga0207661_10373742 3300025944 Bacteria 1289
670 Ga0207661_10406482 3300025944 Bacteria 1235
671 Ga0207661_10857491 3300025944 Bacteria 836
672 Ga0207661_11506895 3300025944 Bacteria 616
673 Ga0207679_11658692 3300025945 Bacteria 585
674 Ga0207667_10010035 3300025949 Bacteria 11102
675 Ga0207667_10035781 3300025949 Bacteria 5326
676 Ga0207667_10081555 3300025949 Bacteria 3351
677 Ga0207667_10089933 3300025949 Bacteria 3172
678 Ga0207667_10237570 3300025949 Unclassified 1865
679 Ga0207667_10261152 3300025949 Unclassified 1771
680 Ga0207667_10350547 3300025949 Bacteria 1505
681 Ga0207667_10485782 3300025949 Unclassified 1253
682 Ga0207667_10987400 3300025949 Unclassified 830
683 Ga0207667_11244043 3300025949 Bacteria 722
684 Ga0207651_10279360 3300025960 Bacteria 1379
685 Ga0207651_10918973 3300025960 Bacteria 780
686 Ga0207651_11699104 3300025960 Bacteria 568
687 Ga0207712_10046737 3300025961 Bacteria 3002
688 Ga0207712_10084523 3300025961 Bacteria 2319
689 Ga0207712_10169992 3300025961 Unclassified 1703
690 Ga0207712_11491705 3300025961 Bacteria 606
691 Ga0207668_10078854 3300025972 Bacteria 2380
692 Ga0207668_10393280 3300025972 Unclassified 1170
693 Ga0207668_10501072 3300025972 Bacteria 1045
694 Ga0207668_11460826 3300025972 Bacteria 617
695 Ga0207640_10170221 3300025981 Unclassified 1622
696 Ga0207640_10208501 3300025981 Bacteria 1487
697 Ga0207640_10219622 3300025981 Bacteria 1454
698 Ga0207640_10517574 3300025981 Bacteria 996
699 Ga0207658_10195007 3300025986 Bacteria 1687
700 Ga0207677_10009894 3300026023 Bacteria 5376
701 Ga0207677_10089729 3300026023 Bacteria 2232
702 Ga0207677_10096958 3300026023 Bacteria 2159
703 Ga0207703_10047912 3300026035 Bacteria 3447
704 Ga0207639_11015348 3300026041 Bacteria 777
705 Ga0207678_10025112 3300026067 Bacteria 5203
706 Ga0207678_10069443 3300026067 Bacteria 3021
707 Ga0207708_10000064 3300026075 Bacteria 85366
708 Ga0207708_10017082 3300026075 Bacteria 5461
709 Ga0207708_10077448 3300026075 Bacteria 2552
710 Ga0207708_10436636 3300026075 Unclassified 1088
711 Ga0207708_10701388 3300026075 Bacteria 865
712 Ga0207708_10729420 3300026075 Bacteria 849
713 Ga0207708_10875708 3300026075 Bacteria 776
714 Ga0207702_10006561 3300026078 Bacteria 10009
715 Ga0207702_10058251 3300026078 Bacteria 3287
716 Ga0207702_10374513 3300026078 Bacteria 1368
717 Ga0207702_10773139 3300026078 Bacteria 949
718 Ga0207702_11145600 3300026078 Unclassified 772
719 Ga0207702_11215883 3300026078 Bacteria 748
720 Ga0207641_11092359 3300026088 Bacteria 796
721 Ga0207641_11819067 3300026088 Unclassified 611
722 Ga0207648_10005420 3300026089 Bacteria 12856
723 Ga0207648_10024380 3300026089 Bacteria 5400
724 Ga0207648_10105969 3300026089 Bacteria 2466
725 Ga0207648_10180099 3300026089 Bacteria 1870
726 Ga0207676_11403462 3300026095 Bacteria 694
727 Ga0207674_10001429 3300026116 Bacteria 30846
728 Ga0207675_100020980 3300026118 Bacteria 6091
729 Ga0207675_100579607 3300026118 Bacteria 1123
730 Ga0207675_100700350 3300026118 Bacteria 1022
731 Ga0207675_100712749 3300026118 Bacteria 1013
732 Ga0207683_10017237 3300026121 Bacteria 6151
733 Ga0207683_10028633 3300026121 Bacteria 4818
734 Ga0207683_10069241 3300026121 Bacteria 3116
735 Ga0207683_10085967 3300026121 Bacteria 2796
736 Ga0207683_10253638 3300026121 Bacteria 1606
737 Ga0207683_10422387 3300026121 Bacteria 1228
738 Ga0207683_10684889 3300026121 Bacteria 950
739 Ga0207683_10685419 3300026121 Bacteria 950
740 Ga0207683_11447543 3300026121 Bacteria 635
741 Ga0207698_10097584 3300026142 Bacteria 2425
742 Ga0207698_10362749 3300026142 Unclassified 1373
743 Ga0207698_11217106 3300026142 Bacteria 767
744 Ga0207698_11298181 3300026142 Bacteria 742
745 Ga0209966_1020796 3300027695 Bacteria 1274
746 Ga0209966_1025320 3300027695 Bacteria 1177
747 Ga0209998_10048638 3300027717 Bacteria 977
748 Ga0209974_10131539 3300027876 Bacteria 893
749 Ga0207428_10033357 3300027907 Bacteria 4229
750 Ga0207428_10186739 3300027907 Bacteria 1564
751 Ga0207428_10837891 3300027907 Bacteria 652
752 Ga0207428_10839898 3300027907 Unclassified 651
753 Ga0207428_11143834 3300027907 Bacteria 543
754 Ga0268266_10171787 3300028379 Bacteria 1968
755 Ga0268265_10053613 3300028380 Bacteria 3056
756 Ga0268265_10643562 3300028380 Bacteria 1018
757 Ga0268265_12615626 3300028380 Bacteria 510
758 Ga0268264_10087916 3300028381 Bacteria 2673
759 Ga0268264_11740478 3300028381 Bacteria 634
760 Ga0265337_1032915 3300028556 Bacteria 1532
761 Ga0265337_1034853 3300028556 Bacteria 1477
762 Ga0265337_1056877 3300028556 Bacteria 1090
763 Ga0265326_10018324 3300028558 Unclassified 2016
764 Ga0265326_10049685 3300028558 Bacteria 1188
765 Ga0265319_1004602 3300028563 Bacteria 6787
766 Ga0265319_1015323 3300028563 Bacteria 2977
767 Ga0265319_1020214 3300028563 Bacteria 2473
768 Ga0265334_10035955 3300028573 Bacteria 1957
769 Ga0265334_10110953 3300028573 Bacteria 986
770 Ga0265318_10010540 3300028577 Bacteria 4019
771 Ga0265318_10016917 3300028577 Bacteria 3003
772 Ga0265318_10023732 3300028577 Unclassified 2441
773 Ga0265318_10046336 3300028577 Unclassified 1641
774 Ga0265323_10086001 3300028653 Unclassified 1057
775 Ga0265323_10278201 3300028653 Bacteria 519
776 Ga0265322_10034519 3300028654 Bacteria 1441
777 Ga0265322_10121619 3300028654 Unclassified 743
778 Ga0265336_10025979 3300028666 Bacteria 1842
779 Ga0265336_10177978 3300028666 Bacteria 633
780 Ga0265338_10002399 3300028800 Bacteria 28183
781 Ga0265338_10017798 3300028800 Bacteria 7640
782 Ga0265338_10053386 3300028800 Bacteria 3616
783 Ga0265338_10067363 3300028800 Bacteria 3092
784 Ga0265338_10072949 3300028800 Bacteria 2928
785 Ga0265338_10389296 3300028800 Unclassified 995
786 Ga0265338_10391792 3300028800 Bacteria 992
787 Ga0265338_10686886 3300028800 Bacteria 707
788 Ga0265324_10077670 3300029957 Bacteria 1129
789 Ga0265330_10026164 3300031235 Bacteria 2641
790 Ga0265330_10284256 3300031235 Bacteria 697
791 Ga0265330_10385019 3300031235 Unclassified 593
792 Ga0265332_10085953 3300031238 Bacteria 1332
793 Ga0265328_10002801 3300031239 Bacteria 7804
794 Ga0265320_10073146 3300031240 Bacteria 1611
795 Ga0265320_10134358 3300031240 Bacteria 1123
796 Ga0265320_10277542 3300031240 Bacteria 742
797 Ga0265325_10044376 3300031241 Bacteria 2315
798 Ga0265325_10048042 3300031241 Bacteria 2207
799 Ga0265329_10024571 3300031242 Bacteria 1999
800 Ga0265340_10014348 3300031247 Bacteria 4142
801 Ga0265340_10020600 3300031247 Bacteria 3386
802 Ga0265340_10041231 3300031247 Bacteria 2270
803 Ga0265339_10001458 3300031249 Bacteria 17517
804 Ga0265339_10140375 3300031249 Bacteria 1229
805 Ga0265339_10162764 3300031249 Bacteria 1122
806 Ga0265339_10232554 3300031249 Unclassified 898
807 Ga0265331_10020805 3300031250 Bacteria 3362
808 Ga0265331_10102087 3300031250 Bacteria 1319
809 Ga0265331_10501725 3300031250 Bacteria 546
810 Ga0265327_10022468 3300031251 Bacteria 3770
811 Ga0265327_10032775 3300031251 Bacteria 2904
812 Ga0265327_10082280 3300031251 Bacteria 1587
813 Ga0265327_10135973 3300031251 Bacteria 1152
814 Ga0265327_10401038 3300031251 Bacteria 595
815 Ga0265316_10111601 3300031344 Bacteria 2070
816 Ga0265316_10253868 3300031344 Unclassified 1291
817 Ga0265316_10287909 3300031344 Bacteria 1199
818 Ga0265316_10346252 3300031344 Bacteria 1076
819 Ga0265316_10490129 3300031344 Bacteria 879
820 Ga0307408_100572705 3300031548 Bacteria 999
821 Ga0307408_101418174 3300031548 Bacteria 654
822 Ga0265313_10051943 3300031595 Bacteria 1958
823 Ga0265313_10085378 3300031595 Bacteria 1426
824 Ga0265314_10009344 3300031711 Bacteria 8295
825 Ga0265314_10051195 3300031711 Bacteria 2877
826 Ga0265314_10188459 3300031711 Bacteria 1229
827 Ga0265342_10038976 3300031712 Bacteria 2890
828 Ga0265342_10053412 3300031712 Bacteria 2404
829 Ga0265342_10093305 3300031712 Bacteria 1723
830 Ga0307405_10031541 3300031731 Bacteria 3122
831 Ga0307405_10218643 3300031731 Bacteria 1396
832 Ga0307405_10581213 3300031731 Bacteria 911
833 Ga0307405_11360502 3300031731 Unclassified 619
834 Ga0307413_10173135 3300031824 Bacteria 1530
835 Ga0307413_10344472 3300031824 Bacteria 1147
836 Ga0307413_10349947 3300031824 Bacteria 1140
837 Ga0307410_10304766 3300031852 Bacteria 1258
838 Ga0307406_11100863 3300031901 Unclassified 686
839 Ga0307406_11322785 3300031901 Bacteria 629
840 Ga0307406_11858598 3300031901 Bacteria 536
841 Ga0307407_10073999 3300031903 Bacteria 2037
842 Ga0307407_10754469 3300031903 Bacteria 737
843 Ga0307407_11690675 3300031903 Unclassified 504
844 Ga0307412_10326431 3300031911 Bacteria 1223
845 Ga0307412_10635561 3300031911 Bacteria 908
846 Ga0307412_11016305 3300031911 Bacteria 733
847 Ga0307412_11904862 3300031911 Bacteria 549
848 Ga0307409_100009147 3300031995 Bacteria 6071
849 Ga0307409_100174426 3300031995 Bacteria 1896
850 Ga0307409_100285406 3300031995 Bacteria 1528
851 Ga0307409_100296371 3300031995 Bacteria 1502
852 Ga0307409_100816969 3300031995 Bacteria 941
853 Ga0307409_100948282 3300031995 Bacteria 876
854 Ga0307409_101117060 3300031995 Bacteria 810
855 Ga0307416_100062659 3300032002 Bacteria 3042
856 Ga0307416_100251858 3300032002 Bacteria 1719
857 Ga0307416_100267610 3300032002 Bacteria 1675
858 Ga0307416_100303129 3300032002 Unclassified 1589
859 Ga0307416_100379253 3300032002 Bacteria 1443
860 Ga0307416_100539468 3300032002 Bacteria 1238
861 Ga0307416_100553267 3300032002 Bacteria 1224
862 Ga0307411_10234904 3300032005 Bacteria 1431
863 Ga0307411_10327579 3300032005 Bacteria 1240
864 Ga0307411_10967596 3300032005 Unclassified 760
865 Ga0307415_100124797 3300032126 Bacteria 1938
866 Ga0307415_100153264 3300032126 Bacteria 1776
867 Ga0307415_100157345 3300032126 Unclassified 1756
868 Ga0307415_100427408 3300032126 Unclassified 1139
869 Ga0307415_102480776 3300032126 Bacteria 510
870 Ga0373930_0004430 3300034816 Bacteria 2286
871 Ga0373948_0003274 3300034817 Bacteria 2479
872 Ga0373958_0061717 3300034819 Unclassified 813
873 Ga0373959_0007931 3300034820 Unclassified 1794
874 Ga0373938_0021207 3300034957 Unclassified 1315
875 Ga0373926_0014653 3300035083 Bacteria 2667
876 Ga0373928_0006626 3300035084 Bacteria 2228
877 Ga0373944_0004151 3300035089 Bacteria 3763
878 Ga0373944_0042736 3300035089 Bacteria 1406
879 Ga0373949_0021547 3300035090 Bacteria 1480
880 Ga0373951_0071532 3300035091 Unclassified 884
881 Ga0373952_0006581 3300035092 Bacteria 2152
882 Ga0373952_0276349 3300035092 Unclassified 516
883 Ga0373923_0119327 3300035111 Bacteria 1177
884 Ga0373932_0004244 3300035112 Bacteria 3403
885 Ga0373936_0039974 3300035113 Bacteria 1878
886 Ga0373939_0020387 3300035114 Bacteria 1800
887 Ga0373939_0077596 3300035114 Bacteria 1096
888 Ga0373941_0026995 3300035115 Bacteria 1672
889 Ga0373945_0003225 3300035116 Bacteria 5120
890 Ga0373945_0268313 3300035116 Bacteria 725
891 Ga0373953_0027035 3300035117 Bacteria 2202
892 Ga0373953_0184037 3300035117 Bacteria 902
893 Ga0373954_0016832 3300035118 Bacteria 3279
894 Ga0373954_0120414 3300035118 Bacteria 1274
895 Ga0373956_0078972 3300035119 Bacteria 1508
896 Ga0373956_0210625 3300035119 Bacteria 922
897 Ga0373957_0042468 3300035120 Bacteria 1716
898 Ga0373957_0095228 3300035120 Bacteria 1187
899 Ga0373960_0007094 3300035121 Bacteria 2645
900 Ga0373943_0004177 3300035170 Bacteria 6552
901 Ga0373943_0012814 3300035170 Bacteria 3779
902 Ga0373943_0050429 3300035170 Bacteria 2045
903 Ga0373943_0956838 3300035170 Unclassified 513
904 Ga0373946_0004366 3300035171 Bacteria 5064
905 Ga0373946_0039458 3300035171 Bacteria 1928
906 Ga0373946_0545260 3300035171 Unclassified 598
907 Ga0373955_0029377 3300035172 Bacteria 2858
908 Ga0373955_0251613 3300035172 Bacteria 1059
909 Ga0373955_0820082 3300035172 Unclassified 572
910 Ga0373942_0037964 3300035207 Unclassified 1304
911 Ga0373961_0036653 3300035241 Unclassified 1398
912 Ga0373961_0094780 3300035241 Bacteria 959
913 Ga0373962_0004892 3300035242 Bacteria 3238
914 Ga0373924_0007579 3300035410 Bacteria 3921
915 Ga0373931_0022247 3300035691 Bacteria 3189
916 Ga0373931_0339168 3300035691 Bacteria 938
917 Ga0373931_0740670 3300035691 Bacteria 652
918 Ga0373935_0002406 3300035692 Bacteria 10709
919 Ga0373935_0061654 3300035692 Bacteria 2401
920 Ga0373935_0174469 3300035692 Bacteria 1472
921 Ga0373927_0052812 3300035695 Bacteria 2628
922 Ga0373933_0059558 3300035724 Bacteria 2300
923 Ga0373933_0291521 3300035724 Bacteria 1055
924 Ga0373933_0442261 3300035724 Bacteria 850
925 Ga0373933_1118709 3300035724 Bacteria 519
926 Ga0373947_0004917 3300035725 Bacteria 7814
927 Ga0373947_0020348 3300035725 Bacteria 3831
928 Ga0373947_0072008 3300035725 Bacteria 2121
929 Ga0373947_0091353 3300035725 Bacteria 1899
930 Ga0373947_0146209 3300035725 Unclassified 1520
931 Ga0373947_0413025 3300035725 Unclassified 911
932 Ga0373937_0021717 3300036401 Bacteria 5762
933 Ga0373937_0283198 3300036401 Bacteria 1565
934 Ga0373937_2164911 3300036401 Bacteria 502
935 Ga0373925_0005095 3300037068 Bacteria 9839
936 Ga0373925_0188309 3300037068 Bacteria 1636
937 Ga0373925_0223285 3300037068 Bacteria 1504
938 Ga0373925_0306801 3300037068 Bacteria 1282
939 Ga0373925_0621532 3300037068 Unclassified 890
940 Ga0373925_1018832 3300037068 Bacteria 682
941 Ga0373925_1255480 3300037068 Unclassified 608
942 Ga0395899_0002854 3300037312 Bacteria 13911
943 Ga0395899_0005973 3300037312 Bacteria 9455
944 Ga0395899_0008716 3300037312 Bacteria 7808
945 Ga0395899_0009725 3300037312 Bacteria 7380
946 Ga0395899_0010577 3300037312 Bacteria 7070
947 Ga0395899_0016967 3300037312 Bacteria 5550
948 Ga0395899_0032880 3300037312 Unclassified 3897
949 Ga0395899_0048050 3300037312 Bacteria 3176
950 Ga0395899_0050955 3300037312 Bacteria 3073
951 Ga0395899_0064701 3300037312 Unclassified 2688
952 Ga0395899_0083770 3300037312 Bacteria 2319
953 Ga0395899_0101194 3300037312 Bacteria 2080
954 Ga0395899_0139195 3300037312 Bacteria 1728
955 Ga0395899_0208298 3300037312 Bacteria 1360
956 Ga0395899_0305632 3300037312 Bacteria 1075
957 Ga0395899_0351280 3300037312 Bacteria 986
958 Ga0395899_0720510 3300037312 Bacteria 624
959 Ga0395899_0958102 3300037312 Unclassified 518
960 Ga0395899_0976239 3300037312 Bacteria 512
961 Ga0395900_0008078 3300037418 Bacteria 10831
962 Ga0395900_0008413 3300037418 Bacteria 10614
963 Ga0395900_0009665 3300037418 Bacteria 9887
964 Ga0395900_0015917 3300037418 Bacteria 7662
965 Ga0395900_0026666 3300037418 Bacteria 5916
966 Ga0395900_0030328 3300037418 Bacteria 5552
967 Ga0395900_0032967 3300037418 Bacteria 5330
968 Ga0395900_0039951 3300037418 Bacteria 4835
969 Ga0395900_0040112 3300037418 Bacteria 4825
970 Ga0395900_0069741 3300037418 Bacteria 3613
971 Ga0395900_0086330 3300037418 Bacteria 3225
972 Ga0395900_0093684 3300037418 Bacteria 3085
973 Ga0395900_0127274 3300037418 Bacteria 2612
974 Ga0395900_0146797 3300037418 Bacteria 2412
975 Ga0395900_0203228 3300037418 Bacteria 2003
976 Ga0395900_0205324 3300037418 Bacteria 1991
977 Ga0395900_0342635 3300037418 Bacteria 1470
978 Ga0395900_0504119 3300037418 Bacteria 1160
979 Ga0395900_0564400 3300037418 Bacteria 1081
980 Ga0395900_0625422 3300037418 Bacteria 1015
981 Ga0395900_0659422 3300037418 Bacteria 982
982 Ga0395900_0781776 3300037418 Bacteria 883
983 Ga0395900_0894232 3300037418 Bacteria 812
984 Ga0395900_0977138 3300037418 Bacteria 767
985 Ga0395900_1261977 3300037418 Unclassified 653
986 Ga0395898_0004818 3300037466 Bacteria 14678
987 Ga0395898_0005838 3300037466 Bacteria 13245
988 Ga0395898_0009573 3300037466 Bacteria 10174
989 Ga0395898_0014829 3300037466 Bacteria 8001
990 Ga0395898_0023975 3300037466 Bacteria 6157
991 Ga0395898_0025913 3300037466 Bacteria 5904
992 Ga0395898_0026252 3300037466 Bacteria 5863
993 Ga0395898_0031174 3300037466 Bacteria 5330
994 Ga0395898_0031424 3300037466 Bacteria 5305
995 Ga0395898_0044970 3300037466 Bacteria 4341
996 Ga0395898_0055709 3300037466 Bacteria 3856
997 Ga0395898_0065774 3300037466 Bacteria 3514
998 Ga0395898_0076622 3300037466 Bacteria 3229
999 Ga0395898_0094649 3300037466 Bacteria 2871
1000 Ga0395898_0129251 3300037466 Bacteria 2420
1001 Ga0395898_0146920 3300037466 Bacteria 2256
1002 Ga0395898_0146990 3300037466 Bacteria 2256
1003 Ga0395898_0151251 3300037466 Bacteria 2220
1004 Ga0395898_0151360 3300037466 Bacteria 2220
1005 Ga0395898_0341458 3300037466 Bacteria 1428
1006 Ga0395898_0393459 3300037466 Bacteria 1321
1007 Ga0395898_0460543 3300037466 Unclassified 1211
1008 Ga0395898_0504946 3300037466 Unclassified 1150
1009 Ga0395898_0613941 3300037466 Unclassified 1030
1010 Ga0395898_0784324 3300037466 Unclassified 893
1011 Ga0395898_1062438 3300037466 Bacteria 744
1012 Ga0395898_1236522 3300037466 Unclassified 677
1013 Ga0395905_0006664 3300037471 Bacteria 11579
1014 Ga0395905_0008040 3300037471 Bacteria 10420
1015 Ga0395905_0010274 3300037471 Bacteria 9113
1016 Ga0395905_0013469 3300037471 Bacteria 7837
1017 Ga0395905_0036864 3300037471 Bacteria 4592
1018 Ga0395905_0037343 3300037471 Bacteria 4561
1019 Ga0395905_0064361 3300037471 Bacteria 3431
1020 Ga0395905_0072421 3300037471 Bacteria 3230
1021 Ga0395905_0077520 3300037471 Bacteria 3114
1022 Ga0395905_0083118 3300037471 Bacteria 3000
1023 Ga0395905_0104634 3300037471 Bacteria 2657
1024 Ga0395905_0189416 3300037471 Bacteria 1930
1025 Ga0395905_0273039 3300037471 Bacteria 1577
1026 Ga0395905_0285434 3300037471 Bacteria 1537
1027 Ga0395905_0300869 3300037471 Bacteria 1491
1028 Ga0395905_0324709 3300037471 Unclassified 1429
1029 Ga0395905_0659004 3300037471 Bacteria 949
1030 Ga0395905_1018030 3300037471 Bacteria 731
1031 Ga0395905_1085159 3300037471 Unclassified 704
1032 Ga0395905_1126279 3300037471 Bacteria 688
1033 Ga0395901_0000731 3300038443 Bacteria 37223
1034 Ga0395901_0002352 3300038443 Bacteria 19227
1035 Ga0395901_0003039 3300038443 Bacteria 16910
1036 Ga0395901_0009320 3300038443 Bacteria 9951
1037 Ga0395901_0009671 3300038443 Bacteria 9776
1038 Ga0395901_0011114 3300038443 Bacteria 9124
1039 Ga0395901_0015241 3300038443 Bacteria 7822
1040 Ga0395901_0027918 3300038443 Bacteria 5803
1041 Ga0395901_0035405 3300038443 Bacteria 5157
1042 Ga0395901_0037870 3300038443 Bacteria 4987
1043 Ga0395901_0060611 3300038443 Bacteria 3937
1044 Ga0395901_0064308 3300038443 Bacteria 3818
1045 Ga0395901_0071864 3300038443 Bacteria 3606
1046 Ga0395901_0074680 3300038443 Bacteria 3536
1047 Ga0395901_0111538 3300038443 Unclassified 2872
1048 Ga0395901_0119478 3300038443 Bacteria 2770
1049 Ga0395901_0128562 3300038443 Bacteria 2663
1050 Ga0395901_0142756 3300038443 Bacteria 2517
1051 Ga0395901_0158514 3300038443 Bacteria 2377
1052 Ga0395901_0163307 3300038443 Bacteria 2339
1053 Ga0395901_0238164 3300038443 Bacteria 1898
1054 Ga0395901_0243505 3300038443 Bacteria 1875
1055 Ga0395901_0303240 3300038443 Bacteria 1656
1056 Ga0395901_0323259 3300038443 Bacteria 1596
1057 Ga0395901_0330304 3300038443 Bacteria 1576
1058 Ga0395901_0340022 3300038443 Bacteria 1551
1059 Ga0395901_0403287 3300038443 Bacteria 1404
1060 Ga0395901_0465851 3300038443 Bacteria 1290
1061 Ga0395901_0551056 3300038443 Bacteria 1169
1062 Ga0395901_0580790 3300038443 Bacteria 1132
1063 Ga0395901_0745638 3300038443 Bacteria 973
1064 Ga0395901_0769497 3300038443 Bacteria 954
1065 Ga0395901_0895255 3300038443 Unclassified 870
1066 Ga0395901_1158586 3300038443 Bacteria 741
1067 Ga0395901_1200750 3300038443 Unclassified 724
1068 Ga0395901_1413672 3300038443 Bacteria 654
1069 Ga0395901_1832786 3300038443 Bacteria 555
1070 Ga0395901_1980533 3300038443 Unclassified 529
1071 Ga0242420_072882 3300038996 Bacteria 700
1072 Ga0436360_0109394 3300039438 Bacteria 6992
1073 Ga0436363_0834990 3300039450 Unclassified 635
1074 Ga0436363_1509554 3300039450 Unclassified 575
1075 Ga0436362_0876451 3300039453 Bacteria 552
1076 Ga0436362_0950133 3300039453 Unclassified 885
1077 Ga0439438_041642 3300041405 Bacteria 1190
1078 Ga0439461_0002121 3300041410 Bacteria 3137
1079 Ga0439461_0011001 3300041410 Bacteria 1672
1080 Ga0439466_0029918 3300041411 Bacteria 1871
1081 Ga0439466_0110845 3300041411 Unclassified 851
1082 Ga0439465_0260355 3300041413 Unclassified 643
1083 Ga0451802_2055700 3300041460 Unclassified 910
1084 Ga0451807_0430671 3300041486 Bacteria 579
1085 Ga0451845_0039632 3300041501 Bacteria 696
1086 Ga0451853_0221711 3300041512 Unclassified 700
1087 Ga0451853_2921298 3300041512 Unclassified 1021
1088 Ga0451853_3912091 3300041512 Bacteria 535
1089 Ga0439437_035967 3300042000 Bacteria 633
1090 Ga0439441_021194 3300042001 Bacteria 1197
1091 Ga0439456_091856 3300042013 Bacteria 683
1092 Ga0450912_003398 3300042116 Unclassified 1131
1093 Ga0450913_029854 3300042117 Bacteria 534
1094 Ga0450914_003882 3300042118 Bacteria 1180
1095 Ga0450915_012003 3300042119 Unclassified 621
1096 Ga0450920_023652 3300042122 Bacteria 1191
1097 Ga0450905_017857 3300042142 Bacteria 1031
1098 Ga0450907_071417 3300042146 Bacteria 601
1099 Ga0450910_022011 3300042147 Bacteria 968
1100 Ga0439446_0001277 3300042156 Bacteria 5653
1101 Ga0439458_0029379 3300042157 Bacteria 1304
1102 Ga0439458_0093884 3300042157 Bacteria 774
1103 Ga0450908_087066 3300042184 Bacteria 564
1104 Ga0439434_0165211 3300042435 Bacteria 737
1105 Ga0439459_0017868 3300042438 Bacteria 1327
1106 Ga0439459_0076260 3300042438 Bacteria 784
1107 Ga0439460_0308629 3300042461 Bacteria 554
1108 Ga0450916_032177 3300042530 Bacteria 768
1109 Ga0450918_048381 3300042531 Bacteria 772
1110 Ga0451577_1811052 3300042876 Bacteria 536
1111 Ga0466969_0072078 3300044656 Bacteria 1660
1112 Ga0466972_0103354 3300044658 Bacteria 1348
1113 Ga0466965_0317508 3300044683 Bacteria 848
1114 Ga0466966_0020014 3300044684 Bacteria 4403
1115 Ga0466966_0040366 3300044684 Bacteria 3004
1116 Ga0466966_0262271 3300044684 Bacteria 1040
1117 Ga0466961_0001959 3300044693 Bacteria 12830
1118 Ga0466961_0048623 3300044693 Unclassified 2711
1119 Ga0466961_0237862 3300044693 Unclassified 1120
1120 Ga0466961_0425221 3300044693 Bacteria 805
1121 Ga0466963_0001943 3300044694 Bacteria 11331
1122 Ga0466963_0003712 3300044694 Bacteria 8780
1123 Ga0466963_0030304 3300044694 Bacteria 3490
1124 Ga0466963_0229897 3300044694 Unclassified 1299
1125 Ga0466963_0280817 3300044694 Unclassified 1170
1126 Ga0466963_0328288 3300044694 Bacteria 1077
1127 Ga0466963_0381020 3300044694 Bacteria 994
1128 Ga0466963_0722076 3300044694 Unclassified 703
1129 Ga0466964_0008287 3300044706 Bacteria 3901
1130 Ga0466964_0069408 3300044706 Unclassified 1486
1131 Ga0466964_0141382 3300044706 Bacteria 1106
1132 Ga0466964_0206258 3300044706 Bacteria 947
1133 Ga0466964_0232954 3300044706 Bacteria 900
1134 Ga0466971_0036954 3300044719 Bacteria 2190
1135 Ga0466971_0674651 3300044719 Bacteria 519
1136 Ga0466968_0276298 3300044735 Unclassified 803
1137 Ga0466968_0404405 3300044735 Bacteria 670
1138 Ga0466970_0288062 3300044765 Bacteria 924
1139 Ga0466957_0070751 3300044842 Bacteria 2156
1140 Ga0466957_0071289 3300044842 Bacteria 2149
1141 Ga0466957_0425722 3300044842 Bacteria 911
1142 Ga0466960_0028065 3300044901 Bacteria 2574
1143 Ga0466960_0133700 3300044901 Bacteria 1312
1144 Ga0466960_0142471 3300044901 Bacteria 1274
1145 Ga0466960_0292868 3300044901 Bacteria 915
1146 Ga0466960_0423780 3300044901 Bacteria 770
1147 Ga0466960_0951788 3300044901 Bacteria 526
1148 Ga0466959_0041892 3300045049 Bacteria 3379
1149 Ga0451576_0619700 3300045051 Bacteria 1137
1150 Ga0451576_1382027 3300045051 Bacteria 733
1151 Ga0466958_0010663 3300045836 Bacteria 5154
1152 Ga0466958_0020060 3300045836 Bacteria 3896
1153 Ga0466958_0029162 3300045836 Bacteria 3273
1154 Ga0466958_0057741 3300045836 Bacteria 2359
1155 Ga0466958_0303385 3300045836 Bacteria 1025
1156 Ga0466958_0586667 3300045836 Bacteria 725
1157 Ga0466967_0048200 3300045976 Bacteria 3719
1158 Ga0466967_0057421 3300045976 Bacteria 3436
1159 Ga0466967_0067626 3300045976 Bacteria 3187
1160 Ga0466967_0088768 3300045976 Bacteria 2806
1161 Ga0466967_0140751 3300045976 Bacteria 2247
1162 Ga0466967_0147375 3300045976 Unclassified 2196
1163 Ga0466967_0219133 3300045976 Bacteria 1807
1164 Ga0466967_0331894 3300045976 Bacteria 1469
1165 Ga0466967_0350144 3300045976 Bacteria 1429
1166 Ga0466967_0472538 3300045976 Bacteria 1227
1167 Ga0466967_0685596 3300045976 Bacteria 1014
1168 Ga0466967_1022804 3300045976 Bacteria 823
1169 Ga0466967_1231651 3300045976 Bacteria 745
1170 Ga0466967_1567611 3300045976 Bacteria 656
1171 Ga0466967_1998216 3300045976 Unclassified 576
1172 Ga0495627_183681 3300046453 Bacteria 579
1173 Ga0495592_0124239 3300046454 Bacteria 1812
1174 Ga0495592_0338318 3300046454 Bacteria 968
1175 Ga0495592_0551373 3300046454 Bacteria 709
1176 Ga0495603_0016929 3300046455 Bacteria 4411
1177 Ga0495603_0024832 3300046455 Bacteria 3626
1178 Ga0495603_0031659 3300046455 Bacteria 3184
1179 Ga0495603_0109821 3300046455 Bacteria 1609
1180 Ga0495603_0153831 3300046455 Unclassified 1335
1181 Ga0495603_0272775 3300046455 Bacteria 973
1182 Ga0495603_0859238 3300046455 Unclassified 516
1183 Ga0495591_074442 3300046458 Unclassified 876
1184 Ga0495629_0018401 3300046459 Bacteria 5001
1185 Ga0495629_0021356 3300046459 Bacteria 4620
1186 Ga0495629_0051575 3300046459 Bacteria 2879
1187 Ga0495629_0117540 3300046459 Bacteria 1853
1188 Ga0495629_0128519 3300046459 Bacteria 1765
1189 Ga0495629_0162190 3300046459 Unclassified 1553
1190 Ga0495629_0180342 3300046459 Bacteria 1464
1191 Ga0495629_0239086 3300046459 Bacteria 1251
1192 Ga0495641_0022352 3300046461 Bacteria 3166
1193 Ga0495641_0105834 3300046461 Bacteria 1255
1194 Ga0495641_0135112 3300046461 Bacteria 1101
1195 Ga0495641_0139027 3300046461 Unclassified 1085
1196 Ga0495651_0033546 3300046462 Bacteria 4004
1197 Ga0495651_0161083 3300046462 Bacteria 1607
1198 Ga0495651_0260480 3300046462 Bacteria 1180
1199 Ga0495651_0280540 3300046462 Unclassified 1126
1200 Ga0495653_0002135 3300046463 Bacteria 15594
1201 Ga0495653_0048424 3300046463 Bacteria 3281
1202 Ga0495653_0060322 3300046463 Bacteria 2874
1203 Ga0495653_0297898 3300046463 Unclassified 1053
1204 Ga0495653_0352827 3300046463 Bacteria 945
1205 Ga0495580_0382500 3300046472 Bacteria 950
1206 Ga0495580_0435600 3300046472 Bacteria 881
1207 Ga0495582_0009920 3300046473 Bacteria 5240
1208 Ga0495582_0019313 3300046473 Bacteria 3726
1209 Ga0495582_0043094 3300046473 Bacteria 2485
1210 Ga0495582_0270330 3300046473 Bacteria 975
1211 Ga0495582_0477323 3300046473 Bacteria 720
1212 Ga0495582_0569907 3300046473 Bacteria 655
1213 Ga0495582_0908820 3300046473 Bacteria 509
1214 Ga0495605_0019864 3300046474 Bacteria 3578
1215 Ga0495605_0123957 3300046474 Unclassified 1170
1216 Ga0495605_0297710 3300046474 Bacteria 683
1217 Ga0495639_0022510 3300046475 Bacteria 2765
1218 Ga0495639_0189944 3300046475 Bacteria 1002
1219 Ga0495639_0253705 3300046475 Bacteria 870
1220 Ga0495662_0171984 3300046476 Bacteria 1067
1221 Ga0495584_0085645 3300046491 Unclassified 1588
1222 Ga0495584_0138004 3300046491 Unclassified 1238
1223 Ga0495584_0376732 3300046491 Unclassified 721
1224 Ga0495584_0509945 3300046491 Unclassified 613
1225 Ga0495585_0261894 3300046492 Unclassified 860
1226 Ga0495594_0042427 3300046499 Bacteria 2491
1227 Ga0495594_0088064 3300046499 Bacteria 1738
1228 Ga0495594_0265545 3300046499 Bacteria 977
1229 Ga0495594_0344430 3300046499 Bacteria 849
1230 Ga0495594_0434930 3300046499 Bacteria 746
1231 Ga0495594_0846771 3300046499 Bacteria 515
1232 Ga0495596_0338128 3300046500 Unclassified 586
1233 Ga0495607_0142132 3300046501 Bacteria 1237
1234 Ga0495607_0176188 3300046501 Bacteria 1076
1235 Ga0495607_0256639 3300046501 Unclassified 839
1236 Ga0495608_0003222 3300046511 Bacteria 11685
1237 Ga0495608_0012504 3300046511 Bacteria 5890
1238 Ga0495608_0027502 3300046511 Bacteria 3869
1239 Ga0495608_0354443 3300046511 Bacteria 903
1240 Ga0495618_0053359 3300046514 Bacteria 2556
1241 Ga0495618_0617144 3300046514 Bacteria 644
1242 Ga0495618_0735679 3300046514 Bacteria 578
1243 Ga0495620_0079227 3300046515 Unclassified 1331
1244 Ga0495628_0029204 3300046516 Bacteria 4474
1245 Ga0495628_0242493 3300046516 Bacteria 1348
1246 Ga0495628_0288182 3300046516 Bacteria 1218
1247 Ga0495630_0005488 3300046517 Bacteria 8950
1248 Ga0495630_0012217 3300046517 Bacteria 6229
1249 Ga0495630_0014654 3300046517 Bacteria 5715
1250 Ga0495630_0049662 3300046517 Bacteria 3139
1251 Ga0495630_0300427 3300046517 Bacteria 1227
1252 Ga0495630_0377004 3300046517 Bacteria 1086
1253 Ga0495630_0664051 3300046517 Bacteria 798
1254 Ga0495630_0763889 3300046517 Unclassified 738
1255 Ga0495630_0895376 3300046517 Bacteria 676
1256 Ga0495631_0074822 3300046518 Bacteria 1462
1257 Ga0495631_0128341 3300046518 Bacteria 1090
1258 Ga0495644_0041791 3300046523 Bacteria 1727
1259 Ga0495644_0150987 3300046523 Bacteria 889
1260 Ga0495644_0216083 3300046523 Unclassified 741
1261 Ga0495644_0348068 3300046523 Unclassified 583
1262 Ga0495663_0060997 3300046525 Bacteria 1186
1263 Ga0495666_0004926 3300046526 Bacteria 6759
1264 Ga0495666_0114106 3300046526 Bacteria 1268
1265 Ga0495642_0215819 3300046528 Bacteria 837
1266 Ga0495652_0056986 3300046529 Bacteria 3316
1267 Ga0495652_0186191 3300046529 Unclassified 1588
1268 Ga0495652_0359291 3300046529 Bacteria 1041
1269 Ga0495652_0486924 3300046529 Bacteria 857
1270 Ga0495654_0155520 3300046530 Bacteria 1008
1271 Ga0495665_0003066 3300046531 Bacteria 9037
1272 Ga0495640_0005710 3300046533 Bacteria 9891
1273 Ga0495640_0059272 3300046533 Bacteria 2608
1274 Ga0495640_0203888 3300046533 Bacteria 1252
1275 Ga0495640_0268404 3300046533 Bacteria 1065
1276 Ga0495586_0010275 3300046535 Bacteria 4979
1277 Ga0495586_0237032 3300046535 Archaea 1039
1278 Ga0495586_0418289 3300046535 Bacteria 772
1279 Ga0495587_0018904 3300046536 Bacteria 4271
1280 Ga0495587_0276083 3300046536 Bacteria 942
1281 Ga0495587_0458999 3300046536 Bacteria 705
1282 Ga0495598_0217895 3300046537 Unclassified 696
1283 Ga0495598_0248517 3300046537 Bacteria 658
1284 Ga0495609_0058397 3300046538 Bacteria 1706
1285 Ga0495609_0160602 3300046538 Bacteria 953
1286 Ga0495609_0278146 3300046538 Unclassified 685
1287 Ga0495597_0044856 3300046542 Bacteria 1965
1288 Ga0495645_0075828 3300046543 Bacteria 2421
1289 Ga0495645_0247901 3300046543 Bacteria 1185
1290 Ga0495667_0002394 3300046559 Bacteria 12542
1291 Ga0495667_0011408 3300046559 Bacteria 6014
1292 Ga0495667_0059259 3300046559 Bacteria 2513
1293 Ga0495667_0384780 3300046559 Bacteria 884
1294 Ga0495667_0824746 3300046559 Bacteria 571
1295 Ga0495656_0034484 3300046615 Unclassified 2073
1296 Ga0495656_0205769 3300046615 Unclassified 978
1297 Ga0495656_0219373 3300046615 Unclassified 950
1298 Ga0495668_0095384 3300046616 Bacteria 1628
1299 Ga0495634_0007684 3300046642 Bacteria 8070
1300 Ga0495634_0090980 3300046642 Bacteria 1981
1301 Ga0495634_0094676 3300046642 Bacteria 1935
1302 Ga0495611_0117080 3300046648 Bacteria 1242
1303 Ga0495611_0423962 3300046648 Bacteria 607
1304 Ga0495611_0572891 3300046648 Unclassified 511
1305 Ga0495635_0032552 3300046663 Bacteria 3617
1306 Ga0495635_0097529 3300046663 Bacteria 2009
1307 Ga0495635_0143744 3300046663 Bacteria 1624
1308 Ga0495635_0146998 3300046663 Bacteria 1604
1309 Ga0495659_0049277 3300046664 Bacteria 1529
1310 Ga0495659_0085016 3300046664 Bacteria 1206
1311 Ga0495659_0089558 3300046664 Bacteria 1179
1312 Ga0495661_0369150 3300046665 Bacteria 703
1313 Ga0495588_0011592 3300046674 Bacteria 4141
1314 Ga0495588_0124819 3300046674 Bacteria 1357
1315 Ga0495588_0217559 3300046674 Bacteria 1008
1316 Ga0495657_0002882 3300046675 Bacteria 14276
1317 Ga0495657_0007489 3300046675 Bacteria 8435
1318 Ga0495657_0031304 3300046675 Bacteria 3718
1319 Ga0495657_0073721 3300046675 Bacteria 2222
1320 Ga0495657_0757048 3300046675 Unclassified 556
1321 Ga0495599_0181842 3300046678 Bacteria 1296
1322 Ga0495599_0266371 3300046678 Bacteria 1040
1323 Ga0495623_0104581 3300046679 Bacteria 1721
1324 Ga0495646_0039461 3300046680 Bacteria 2911
1325 Ga0495646_0225331 3300046680 Bacteria 1012
1326 Ga0495647_0001687 3300046681 Bacteria 6841
1327 Ga0495647_0016729 3300046681 Archaea 2587
1328 Ga0495647_0022639 3300046681 Bacteria 2271
1329 Ga0495647_0025191 3300046681 Bacteria 2171
1330 Ga0495647_0456477 3300046681 Bacteria 592
1331 Ga0495658_0003974 3300046683 Bacteria 7289
1332 Ga0495658_0008700 3300046683 Bacteria 5040
1333 Ga0495658_0009164 3300046683 Bacteria 4921
1334 Ga0495658_0168164 3300046683 Bacteria 1355
1335 Ga0495658_0276223 3300046683 Unclassified 1060
1336 Ga0495658_0393755 3300046683 Unclassified 883
1337 Ga0495669_0436511 3300046684 Unclassified 636
1338 Ga0495613_0007500 3300046689 Bacteria 8125
1339 Ga0495613_0007806 3300046689 Bacteria 7962
1340 Ga0495613_0058553 3300046689 Unclassified 2827
1341 Ga0495613_0166399 3300046689 Bacteria 1566
1342 Ga0495613_0186013 3300046689 Bacteria 1470
1343 Ga0495624_0017436 3300046690 Bacteria 4822
1344 Ga0495624_0025162 3300046690 Bacteria 3911
1345 Ga0495624_0106819 3300046690 Bacteria 1722
1346 Ga0495624_0116989 3300046690 Bacteria 1638
1347 Ga0495670_0380383 3300046691 Bacteria 762
1348 Ga0495670_0406413 3300046691 Unclassified 736
1349 Ga0495670_0512406 3300046691 Unclassified 652
1350 Ga0495671_0033411 3300046692 Bacteria 2621
1351 Ga0495671_0263162 3300046692 Unclassified 832
1352 Ga0495671_0577595 3300046692 Unclassified 535
1353 Ga0495589_0024325 3300046794 Bacteria 3079
1354 Ga0495589_0050674 3300046794 Bacteria 2053
1355 Ga0495589_0157621 3300046794 Bacteria 1082
1356 Ga0495600_0002865 3300046809 Bacteria 10041
1357 Ga0495600_0048618 3300046809 Bacteria 2767
1358 Ga0495600_0068544 3300046809 Bacteria 2318
1359 Ga0495581_0001208 3300047315 Bacteria 14210
1360 Ga0495581_0005647 3300047315 Bacteria 7252
1361 Ga0495581_0006900 3300047315 Bacteria 6583
1362 Ga0495581_0262662 3300047315 Bacteria 1009
1363 Ga0495604_0038158 3300047317 Bacteria 3780
1364 Ga0495604_0052135 3300047317 Bacteria 3170
1365 Ga0495604_0212373 3300047317 Bacteria 1336
1366 Ga0495636_0096962 3300047318 Bacteria 1286
1367 Ga0495674_0024852 3300047319 Bacteria 5499
1368 Ga0495674_0036549 3300047319 Bacteria 4420
1369 Ga0495674_0046908 3300047319 Bacteria 3833
1370 Ga0495674_0399363 3300047319 Bacteria 1110
1371 Ga0495674_0764728 3300047319 Unclassified 754
1372 Ga0495676_0009426 3300047321 Bacteria 8891
1373 Ga0495676_0011656 3300047321 Bacteria 7931
1374 Ga0495676_0069159 3300047321 Bacteria 2725
1375 Ga0495676_0127580 3300047321 Bacteria 1841
1376 Ga0495676_0618182 3300047321 Bacteria 705
1377 Ga0495680_0003404 3300047322 Bacteria 15696
1378 Ga0495680_0009714 3300047322 Bacteria 8635
1379 Ga0495680_0015569 3300047322 Bacteria 6559
1380 Ga0495680_0070806 3300047322 Bacteria 2657
1381 Ga0495680_0246039 3300047322 Unclassified 1269
1382 Ga0495680_0436988 3300047322 Bacteria 898
1383 Ga0495675_0024154 3300047444 Bacteria 3875
1384 Ga0495675_0059777 3300047444 Bacteria 2416
1385 Ga0495675_0547578 3300047444 Bacteria 660
1386 Ga0495675_0610601 3300047444 Bacteria 618
1387 Ga0495677_0131550 3300047445 Bacteria 958
1388 Ga0495677_0390650 3300047445 Unclassified 550
1389 Ga0495685_103038 3300047447 Bacteria 942
1390 Ga0495685_127005 3300047447 Bacteria 835
1391 Ga0495684_0007256 3300047471 Bacteria 8598
1392 Ga0495684_0043180 3300047471 Bacteria 3451
1393 Ga0495684_0063068 3300047471 Unclassified 2818
1394 Ga0495684_0604102 3300047471 Bacteria 740
1395 Ga0495593_0005150 3300047673 Bacteria 7726
1396 Ga0495593_0089388 3300047673 Bacteria 1587
1397 Ga0495593_0254040 3300047673 Bacteria 880
1398 Ga0495602_0094214 3300048088 Bacteria 2475
1399 Ga0495602_0293140 3300048088 Bacteria 1193
1400 Ga0495602_0425490 3300048088 Unclassified 942
1401 Ga0495614_0004846 3300048089 Bacteria 6073
1402 Ga0495614_0323171 3300048089 Bacteria 716
1403 Ga0495615_0040354 3300048090 Bacteria 1162
1404 Ga0495626_0184609 3300048091 Unclassified 863
1405 Ga0496100_0005825 3300048903 Bacteria 6666
1406 Ga0496100_0044008 3300048903 Bacteria 2857
1407 Ga0496100_0055157 3300048903 Bacteria 2595
1408 Ga0496100_0070479 3300048903 Bacteria 2331
1409 Ga0496100_0095799 3300048903 Bacteria 2035
1410 Ga0496100_0114441 3300048903 Bacteria 1879
1411 Ga0496100_0146099 3300048903 Unclassified 1682
1412 Ga0496100_0152529 3300048903 Bacteria 1649
1413 Ga0496100_0238489 3300048903 Unclassified 1341
1414 Ga0496100_0360325 3300048903 Unclassified 1100
1415 Ga0496100_0548094 3300048903 Bacteria 894
1416 Ga0496100_1498511 3300048903 Unclassified 533
1417 Ga0496101_0002047 3300048904 Bacteria 12269
1418 Ga0496101_0004093 3300048904 Bacteria 9126
1419 Ga0496101_0010090 3300048904 Bacteria 6226
1420 Ga0496101_0013413 3300048904 Bacteria 5488
1421 Ga0496101_0067940 3300048904 Bacteria 2604
1422 Ga0496101_0075113 3300048904 Unclassified 2487
1423 Ga0496101_0080595 3300048904 Unclassified 2405
1424 Ga0496101_0118210 3300048904 Bacteria 2002
1425 Ga0496101_0270776 3300048904 Unclassified 1326
1426 Ga0496101_0293273 3300048904 Bacteria 1273
1427 Ga0496101_0523755 3300048904 Bacteria 937
1428 Ga0496102_0011058 3300048905 Bacteria 7774
1429 Ga0496102_0014471 3300048905 Bacteria 6855
1430 Ga0496102_0058806 3300048905 Bacteria 3513
1431 Ga0496102_0060968 3300048905 Bacteria 3451
1432 Ga0496102_0065835 3300048905 Unclassified 3322
1433 Ga0496102_0074067 3300048905 Bacteria 3130
1434 Ga0496102_0082052 3300048905 Bacteria 2974
1435 Ga0496102_0116052 3300048905 Unclassified 2498
1436 Ga0496102_0116403 3300048905 Bacteria 2494
1437 Ga0496102_0273788 3300048905 Unclassified 1592
1438 Ga0496102_0903700 3300048905 Bacteria 805
1439 Ga0496102_1146694 3300048905 Bacteria 697
1440 Ga0496102_1765814 3300048905 Bacteria 536
1441 Ga0496103_0010922 3300048906 Bacteria 5375
1442 Ga0496103_0044183 3300048906 Bacteria 2745
1443 Ga0496103_0086026 3300048906 Bacteria 1981
1444 Ga0496103_0101894 3300048906 Unclassified 1818
1445 Ga0496103_0115648 3300048906 Bacteria 1706
1446 Ga0496103_0144295 3300048906 Bacteria 1523
1447 Ga0496103_0158013 3300048906 Bacteria 1454
1448 Ga0496103_0257248 3300048906 Bacteria 1123
1449 Ga0496103_0739397 3300048906 Unclassified 622
1450 Ga0496103_0771140 3300048906 Unclassified 607
1451 Ga0496103_0943953 3300048906 Bacteria 539
1452 Ga0496104_0007356 3300048907 Bacteria 9724
1453 Ga0496104_0012742 3300048907 Bacteria 7574
1454 Ga0496104_0015042 3300048907 Bacteria 7002
1455 Ga0496104_0035843 3300048907 Bacteria 4634
1456 Ga0496104_0076396 3300048907 Bacteria 3190
1457 Ga0496104_0081221 3300048907 Bacteria 3091
1458 Ga0496104_0157485 3300048907 Unclassified 2179
1459 Ga0496104_0185026 3300048907 Bacteria 1994
1460 Ga0496104_0322304 3300048907 Unclassified 1458
1461 Ga0496104_1390039 3300048907 Bacteria 605
1462 Ga0496105_0012484 3300048908 Bacteria 6726
1463 Ga0496105_0044992 3300048908 Bacteria 3642
1464 Ga0496105_0053215 3300048908 Bacteria 3343
1465 Ga0496105_0062233 3300048908 Bacteria 3079
1466 Ga0496105_0115849 3300048908 Bacteria 2210
1467 Ga0496105_0195554 3300048908 Bacteria 1652
1468 Ga0496105_0233677 3300048908 Unclassified 1493
1469 Ga0496105_0272561 3300048908 Bacteria 1366
1470 Ga0496105_0362525 3300048908 Bacteria 1156
1471 Ga0496105_1003945 3300048908 Unclassified 624
1472 Ga0496106_0000799 3300048909 Bacteria 22768
1473 Ga0496106_0001574 3300048909 Bacteria 17165
1474 Ga0496106_0003932 3300048909 Bacteria 11102
1475 Ga0496106_0005483 3300048909 Bacteria 9386
1476 Ga0496106_0014611 3300048909 Bacteria 5802
1477 Ga0496106_0039427 3300048909 Bacteria 3537
1478 Ga0496106_0086489 3300048909 Unclassified 2414
1479 Ga0496106_0246025 3300048909 Unclassified 1429
1480 Ga0496106_1257328 3300048909 Bacteria 576
1481 Ga0496107_0000717 3300048910 Bacteria 18921
1482 Ga0496107_0002487 3300048910 Bacteria 11969
1483 Ga0496107_0009850 3300048910 Bacteria 6628
1484 Ga0496107_0016756 3300048910 Bacteria 5151
1485 Ga0496107_0022269 3300048910 Bacteria 4478
1486 Ga0496107_0055259 3300048910 Unclassified 2868
1487 Ga0496107_0056046 3300048910 Bacteria 2847
1488 Ga0496107_0167644 3300048910 Bacteria 1629
1489 Ga0496107_0198951 3300048910 Unclassified 1489
1490 Ga0496107_0212749 3300048910 Bacteria 1438
1491 Ga0496107_0219423 3300048910 Bacteria 1414
1492 Ga0496107_0705900 3300048910 Bacteria 742
1493 Ga0496107_1003046 3300048910 Unclassified 606
1494 Ga0496108_0000945 3300048911 Bacteria 22605
1495 Ga0496108_0012922 3300048911 Bacteria 6803
1496 Ga0496108_0014614 3300048911 Bacteria 6409
1497 Ga0496108_0025821 3300048911 Bacteria 4844
1498 Ga0496108_0030570 3300048911 Bacteria 4463
1499 Ga0496108_0034296 3300048911 Bacteria 4216
1500 Ga0496108_0071680 3300048911 Bacteria 2924
1501 Ga0496108_0100462 3300048911 Bacteria 2467
1502 Ga0496108_0145074 3300048911 Unclassified 2046
1503 Ga0496108_0594933 3300048911 Unclassified 964
1504 Ga0496109_0000523 3300048912 Bacteria 32527
1505 Ga0496109_0006830 3300048912 Bacteria 9620
1506 Ga0496109_0012241 3300048912 Bacteria 7403
1507 Ga0496109_0014408 3300048912 Bacteria 6879
1508 Ga0496109_0015382 3300048912 Bacteria 6667
1509 Ga0496109_0026179 3300048912 Bacteria 5200
1510 Ga0496109_0043976 3300048912 Bacteria 4050
1511 Ga0496109_0088670 3300048912 Bacteria 2859
1512 Ga0496109_0218266 3300048912 Unclassified 1793
1513 Ga0496109_0232548 3300048912 Bacteria 1734
1514 Ga0496109_0325372 3300048912 Unclassified 1451
1515 Ga0496109_0388445 3300048912 Unclassified 1319
1516 Ga0496109_0426592 3300048912 Bacteria 1253
1517 Ga0496109_0456860 3300048912 Bacteria 1206
1518 Ga0496109_0639746 3300048912 Unclassified 1000
1519 Ga0496109_0709463 3300048912 Unclassified 943
1520 Ga0496109_0801705 3300048912 Bacteria 880
1521 Ga0496109_0803665 3300048912 Bacteria 878
1522 Ga0496109_2004898 3300048912 Unclassified 511
1523 Ga0496110_0000677 3300048913 Bacteria 23384
1524 Ga0496110_0016904 3300048913 Bacteria 6097
1525 Ga0496110_0021495 3300048913 Bacteria 5465
1526 Ga0496110_0032996 3300048913 Bacteria 4476
1527 Ga0496110_0033108 3300048913 Bacteria 4469
1528 Ga0496110_0050369 3300048913 Bacteria 3656
1529 Ga0496110_0369734 3300048913 Bacteria 1306
1530 Ga0496110_0462470 3300048913 Bacteria 1156
1531 Ga0496110_0464627 3300048913 Bacteria 1153
1532 Ga0496110_0627743 3300048913 Unclassified 973
1533 Ga0496110_1526395 3300048913 Bacteria 578
1534 Ga0496111_0000744 3300048914 Bacteria 17364
1535 Ga0496111_0002134 3300048914 Bacteria 11823
1536 Ga0496111_0011040 3300048914 Bacteria 6078
1537 Ga0496111_0020928 3300048914 Bacteria 4561
1538 Ga0496111_0025941 3300048914 Bacteria 4136
1539 Ga0496111_0132001 3300048914 Bacteria 1848
1540 Ga0496111_0275370 3300048914 Bacteria 1248
1541 Ga0496111_0361661 3300048914 Bacteria 1074
1542 Ga0496111_0721237 3300048914 Unclassified 724
1543 Ga0496111_1295513 3300048914 Unclassified 513
1544 Ga0496112_0000731 3300048915 Bacteria 22853
1545 Ga0496112_0000874 3300048915 Bacteria 21603
1546 Ga0496112_0003094 3300048915 Bacteria 13636
1547 Ga0496112_0013633 3300048915 Bacteria 7511
1548 Ga0496112_0016012 3300048915 Bacteria 7011
1549 Ga0496112_0016153 3300048915 Bacteria 6983
1550 Ga0496112_0053250 3300048915 Bacteria 3974
1551 Ga0496112_0104965 3300048915 Bacteria 2795
1552 Ga0496112_0120058 3300048915 Bacteria 2599
1553 Ga0496112_0131346 3300048915 Unclassified 2475
1554 Ga0496112_0139713 3300048915 Bacteria 2392
1555 Ga0496112_0217817 3300048915 Unclassified 1865
1556 Ga0496112_0270877 3300048915 Bacteria 1646
1557 Ga0496112_0279855 3300048915 Unclassified 1615
1558 Ga0496112_0297273 3300048915 Bacteria 1560
1559 Ga0496112_0419821 3300048915 Unclassified 1276
1560 Ga0496112_0615909 3300048915 Unclassified 1017
1561 Ga0496112_0770533 3300048915 Unclassified 888
1562 Ga0496112_1745868 3300048915 Unclassified 534
1563 Ga0496113_0001429 3300048916 Bacteria 13251
1564 Ga0496113_0004935 3300048916 Bacteria 8261
1565 Ga0496113_0032226 3300048916 Bacteria 3808
1566 Ga0496113_0035909 3300048916 Bacteria 3628
1567 Ga0496113_0231319 3300048916 Unclassified 1474
1568 Ga0496113_0240006 3300048916 Bacteria 1446
1569 Ga0496113_0286729 3300048916 Archaea 1317
1570 Ga0496113_0321052 3300048916 Unclassified 1241
1571 Ga0496113_0457475 3300048916 Unclassified 1025
1572 Ga0496113_1311430 3300048916 Bacteria 563
1573 Ga0496114_0006868 3300048917 Bacteria 8964
1574 Ga0496114_0009546 3300048917 Bacteria 7700
1575 Ga0496114_0024509 3300048917 Bacteria 4927
1576 Ga0496114_0038353 3300048917 Bacteria 3964
1577 Ga0496114_0042427 3300048917 Bacteria 3771
1578 Ga0496114_0052098 3300048917 Bacteria 3409
1579 Ga0496114_0052891 3300048917 Bacteria 3384
1580 Ga0496114_0075653 3300048917 Unclassified 2836
1581 Ga0496114_0125355 3300048917 Bacteria 2213
1582 Ga0496114_0129105 3300048917 Bacteria 2181
1583 Ga0496114_0174815 3300048917 Unclassified 1873
1584 Ga0496114_0525986 3300048917 Bacteria 1046
1585 Ga0496114_0751861 3300048917 Bacteria 852
1586 Ga0496114_1368815 3300048917 Unclassified 595
1587 Ga0496114_1410462 3300048917 Bacteria 584
1588 Ga0496114_1477079 3300048917 Bacteria 567
1589 Ga0496115_0001511 3300048918 Bacteria 16712
1590 Ga0496115_0006793 3300048918 Bacteria 8392
1591 Ga0496115_0017491 3300048918 Bacteria 5483
1592 Ga0496115_0042367 3300048918 Bacteria 3626
1593 Ga0496115_0046460 3300048918 Bacteria 3470
1594 Ga0496115_0199687 3300048918 Bacteria 1652
1595 Ga0496115_0244740 3300048918 Bacteria 1478
1596 Ga0496115_0293773 3300048918 Archaea 1332
1597 Ga0496115_0439264 3300048918 Unclassified 1055
1598 Ga0496115_0718252 3300048918 Bacteria 784
1599 Ga0496115_1040568 3300048918 Bacteria 624
1600 Ga0501291_068187 3300049514 Unclassified 684
1601 Ga0501031_0000565 3300049568 Bacteria 21619
1602 Ga0501031_0001953 3300049568 Bacteria 12999
1603 Ga0501031_0017346 3300049568 Bacteria 4677
1604 Ga0501031_0052355 3300049568 Bacteria 2660
1605 Ga0501031_0151776 3300049568 Bacteria 1514
1606 Ga0501032_0000274 3300049569 Bacteria 43406
1607 Ga0501032_0036219 3300049569 Bacteria 3369
1608 Ga0501032_0395513 3300049569 Bacteria 888
1609 Ga0501032_0586813 3300049569 Bacteria 709
1610 Ga0501033_0000920 3300049570 Bacteria 26908
1611 Ga0501033_0001164 3300049570 Bacteria 23800
1612 Ga0501033_0192595 3300049570 Bacteria 1458
1613 Ga0501033_0244051 3300049570 Bacteria 1274
1614 Ga0501033_0257882 3300049570 Bacteria 1234
1615 Ga0501033_0861923 3300049570 Bacteria 610
1616 Ga0501034_0041370 3300049571 Bacteria 4662
1617 Ga0501034_0044193 3300049571 Bacteria 4506
1618 Ga0501034_0227380 3300049571 Unclassified 1816
1619 Ga0501034_0812600 3300049571 Bacteria 827
1620 Ga0501036_0000971 3300049572 Bacteria 21648
1621 Ga0501036_0007285 3300049572 Bacteria 9010
1622 Ga0501036_0053329 3300049572 Bacteria 3424
1623 Ga0501036_0069247 3300049572 Bacteria 2985
1624 Ga0501036_0078909 3300049572 Bacteria 2785
1625 Ga0501036_0230126 3300049572 Bacteria 1556
1626 Ga0501036_0275511 3300049572 Bacteria 1408
1627 Ga0501036_0529856 3300049572 Bacteria 979
1628 Ga0501036_0539429 3300049572 Bacteria 970
1629 Ga0501037_0000519 3300049573 Bacteria 30933
1630 Ga0501037_0029289 3300049573 Bacteria 4067
1631 Ga0501037_0074126 3300049573 Bacteria 2474
1632 Ga0501037_0459491 3300049573 Bacteria 868
1633 Ga0501038_0000186 3300049574 Bacteria 53569
1634 Ga0501038_0019415 3300049574 Bacteria 6125
1635 Ga0501038_0052782 3300049574 Bacteria 3503
1636 Ga0501038_0068760 3300049574 Bacteria 3010
1637 Ga0501038_0279708 3300049574 Bacteria 1314
1638 Ga0501038_0492587 3300049574 Archaea 938
1639 Ga0501038_0821105 3300049574 Bacteria 690
1640 Ga0501039_0003315 3300049575 Bacteria 12041
1641 Ga0501039_0005307 3300049575 Bacteria 9744
1642 Ga0501039_0024937 3300049575 Bacteria 4594
1643 Ga0501039_0038293 3300049575 Bacteria 3703
1644 Ga0501039_0252240 3300049575 Bacteria 1387
1645 Ga0501039_0428077 3300049575 Bacteria 1039
1646 Ga0501039_0735603 3300049575 Bacteria 771
1647 Ga0501039_0775047 3300049575 Unclassified 748
1648 Ga0501040_0000605 3300049576 Bacteria 21929
1649 Ga0501040_0011880 3300049576 Bacteria 5696
1650 Ga0501040_0019519 3300049576 Bacteria 4508
1651 Ga0501040_0051514 3300049576 Bacteria 2816
1652 Ga0501040_0066560 3300049576 Bacteria 2482
1653 Ga0501040_0081299 3300049576 Bacteria 2245
1654 Ga0501040_0139950 3300049576 Bacteria 1704
1655 Ga0501040_0177177 3300049576 Bacteria 1510
1656 Ga0501040_0288204 3300049576 Bacteria 1173
1657 Ga0501040_1324146 3300049576 Unclassified 523
1658 Ga0501041_0000039 3300049577 Bacteria 44027
1659 Ga0501041_0001797 3300049577 Bacteria 12014
1660 Ga0501041_0002733 3300049577 Bacteria 10069
1661 Ga0501041_0009157 3300049577 Bacteria 5830
1662 Ga0501041_0012510 3300049577 Bacteria 5027
1663 Ga0501041_0066158 3300049577 Bacteria 2214
1664 Ga0501041_0119918 3300049577 Bacteria 1634
1665 Ga0501041_0128225 3300049577 Unclassified 1580
1666 Ga0501041_0403313 3300049577 Bacteria 866
1667 Ga0501042_0001026 3300049578 Bacteria 15897
1668 Ga0501042_0019739 3300049578 Bacteria 4685
1669 Ga0501042_0020182 3300049578 Bacteria 4635
1670 Ga0501042_0026783 3300049578 Bacteria 4051
1671 Ga0501042_0032814 3300049578 Bacteria 3678
1672 Ga0501042_0068932 3300049578 Bacteria 2529
1673 Ga0501042_0076262 3300049578 Bacteria 2400
1674 Ga0501042_0108302 3300049578 Bacteria 2000
1675 Ga0501042_0153166 3300049578 Bacteria 1662
1676 Ga0501042_0164250 3300049578 Bacteria 1602
1677 Ga0501042_0200642 3300049578 Bacteria 1438
1678 Ga0501043_0000171 3300049579 Bacteria 58361
1679 Ga0501043_0005336 3300049579 Bacteria 10386
1680 Ga0501043_0246023 3300049579 Bacteria 1378
1681 Ga0501043_0426922 3300049579 Bacteria 999
1682 Ga0501046_0000177 3300049580 Bacteria 65024
1683 Ga0501046_0002858 3300049580 Bacteria 16061
1684 Ga0501046_0024694 3300049580 Bacteria 4925
1685 Ga0501046_0039756 3300049580 Bacteria 3764
1686 Ga0501046_0057220 3300049580 Bacteria 3059
1687 Ga0501046_0198614 3300049580 Bacteria 1493
1688 Ga0501046_0213206 3300049580 Bacteria 1432
1689 Ga0501046_0250786 3300049580 Bacteria 1303
1690 Ga0501046_0285826 3300049580 Unclassified 1207
1691 Ga0501046_0421445 3300049580 Unclassified 962
1692 Ga0501046_0507227 3300049580 Archaea 863
1693 Ga0501047_0164513 3300049581 Bacteria 2089
1694 Ga0501047_0379778 3300049581 Unclassified 1247
1695 Ga0501048_0004102 3300049582 Bacteria 11093
1696 Ga0501048_0005297 3300049582 Bacteria 9822
1697 Ga0501048_0067803 3300049582 Bacteria 2521
1698 Ga0501048_0119440 3300049582 Bacteria 1862
1699 Ga0501048_0634680 3300049582 Bacteria 767
1700 Ga0501048_0705697 3300049582 Bacteria 724
1701 Ga0501048_0927255 3300049582 Bacteria 626
1702 Ga0501067_0045266 3300049583 Bacteria 2444
1703 Ga0501067_0130184 3300049583 Unclassified 1400
1704 Ga0501067_0152171 3300049583 Unclassified 1289
1705 Ga0501067_0548967 3300049583 Bacteria 647
1706 Ga0501068_0000051 3300049584 Bacteria 45579
1707 Ga0501068_0001051 3300049584 Bacteria 14629
1708 Ga0501068_0007526 3300049584 Bacteria 6027
1709 Ga0501068_0166715 3300049584 Bacteria 1389
1710 Ga0501068_0193277 3300049584 Bacteria 1289
1711 Ga0501068_0248247 3300049584 Bacteria 1134
1712 Ga0501068_0748922 3300049584 Bacteria 640
1713 Ga0501069_0001394 3300049585 Bacteria 11864
1714 Ga0501069_0003701 3300049585 Bacteria 7861
1715 Ga0501069_0010111 3300049585 Bacteria 4991
1716 Ga0501069_0066832 3300049585 Bacteria 2010
1717 Ga0501069_0116106 3300049585 Archaea 1527
1718 Ga0501069_0237298 3300049585 Unclassified 1062
1719 Ga0501070_0002425 3300049586 Bacteria 16358
1720 Ga0501070_0007771 3300049586 Bacteria 9090
1721 Ga0501070_0028281 3300049586 Bacteria 4701
1722 Ga0501070_0507554 3300049586 Bacteria 968
1723 Ga0501070_1295500 3300049586 Bacteria 556
1724 Ga0501070_1438307 3300049586 Unclassified 523
1725 Ga0501071_0000031 3300049587 Bacteria 47260
1726 Ga0501071_0011778 3300049587 Bacteria 5899
1727 Ga0501071_0016912 3300049587 Bacteria 5019
1728 Ga0501071_0040070 3300049587 Bacteria 3352
1729 Ga0501071_0044164 3300049587 Bacteria 3196
1730 Ga0501071_0046669 3300049587 Bacteria 3111
1731 Ga0501071_0233080 3300049587 Bacteria 1387
1732 Ga0501071_0540740 3300049587 Bacteria 894
1733 Ga0501072_0002062 3300049588 Bacteria 14942
1734 Ga0501072_0003142 3300049588 Bacteria 12427
1735 Ga0501072_0006063 3300049588 Bacteria 9227
1736 Ga0501072_0022648 3300049588 Bacteria 4873
1737 Ga0501072_0032316 3300049588 Bacteria 4098
1738 Ga0501072_0129148 3300049588 Bacteria 2014
1739 Ga0501072_0141023 3300049588 Bacteria 1921
1740 Ga0501072_0296827 3300049588 Bacteria 1284
1741 Ga0501072_0383346 3300049588 Bacteria 1115
1742 Ga0501072_0496581 3300049588 Unclassified 965
1743 Ga0501072_0523333 3300049588 Bacteria 937
1744 Ga0501072_0712948 3300049588 Bacteria 788
1745 Ga0501073_0017065 3300049589 Bacteria 5258
1746 Ga0501073_0029774 3300049589 Bacteria 3901
1747 Ga0501073_0104857 3300049589 Bacteria 1962
1748 Ga0501073_0572017 3300049589 Bacteria 780
1749 Ga0501073_0985562 3300049589 Bacteria 580
1750 Ga0501074_0003677 3300049590 Bacteria 10875
1751 Ga0501074_0006826 3300049590 Bacteria 8248
1752 Ga0501074_0014877 3300049590 Bacteria 5658
1753 Ga0501074_0018032 3300049590 Bacteria 5127
1754 Ga0501074_0063362 3300049590 Bacteria 2663
1755 Ga0501074_0133683 3300049590 Bacteria 1774
1756 Ga0501074_0141311 3300049590 Archaea 1722
1757 Ga0501074_0215252 3300049590 Bacteria 1368
1758 Ga0501074_0522739 3300049590 Bacteria 840
1759 Ga0501074_0678683 3300049590 Bacteria 727
1760 Ga0501074_0788415 3300049590 Unclassified 670
1761 Ga0501075_0000266 3300049591 Bacteria 28552
1762 Ga0501075_0001528 3300049591 Bacteria 15091
1763 Ga0501075_0010268 3300049591 Bacteria 6578
1764 Ga0501075_0015269 3300049591 Bacteria 5509
1765 Ga0501075_0076897 3300049591 Bacteria 2525
1766 Ga0501075_0091392 3300049591 Bacteria 2310
1767 Ga0501075_0103867 3300049591 Bacteria 2159
1768 Ga0501075_0122465 3300049591 Bacteria 1979
1769 Ga0501075_0205297 3300049591 Bacteria 1503
1770 Ga0501075_0842279 3300049591 Bacteria 698
1771 Ga0501075_0897915 3300049591 Bacteria 674
1772 Ga0501076_0000634 3300049592 Bacteria 22428
1773 Ga0501076_0008497 3300049592 Bacteria 7525
1774 Ga0501076_0012482 3300049592 Bacteria 6353
1775 Ga0501076_0051824 3300049592 Bacteria 3249
1776 Ga0501076_0090401 3300049592 Bacteria 2462
1777 Ga0501076_0113434 3300049592 Unclassified 2192
1778 Ga0501076_0221187 3300049592 Bacteria 1547
1779 Ga0501076_0221619 3300049592 Bacteria 1546
1780 Ga0501076_0255931 3300049592 Unclassified 1433
1781 Ga0501076_0333464 3300049592 Unclassified 1244
1782 Ga0501077_0000257 3300049593 Bacteria 31357
1783 Ga0501077_0003870 3300049593 Bacteria 9023
1784 Ga0501077_0024781 3300049593 Bacteria 3809
1785 Ga0501077_0030419 3300049593 Bacteria 3435
1786 Ga0501077_0041091 3300049593 Bacteria 2944
1787 Ga0501077_0047937 3300049593 Bacteria 2714
1788 Ga0501077_0072653 3300049593 Bacteria 2180
1789 Ga0501077_0291939 3300049593 Bacteria 1038
1790 Ga0501077_0675403 3300049593 Bacteria 664
1791 Ga0501217_259182 3300049661 Unclassified 563
1792 Ga0501221_145150 3300049704 Bacteria 625
1793 Ga0501079_0000749 3300049741 Bacteria 22070
1794 Ga0501079_0004333 3300049741 Bacteria 10530
1795 Ga0501079_0013423 3300049741 Bacteria 6247
1796 Ga0501079_0020216 3300049741 Bacteria 5089
1797 Ga0501079_0023311 3300049741 Bacteria 4751
1798 Ga0501079_0033233 3300049741 Bacteria 3968
1799 Ga0501079_0069689 3300049741 Bacteria 2714
1800 Ga0501079_0139619 3300049741 Bacteria 1887
1801 Ga0501079_0148633 3300049741 Bacteria 1826
1802 Ga0501079_0154692 3300049741 Bacteria 1787
1803 Ga0501079_0329771 3300049741 Bacteria 1195
1804 Ga0501080_0000105 3300049742 Bacteria 57665
1805 Ga0501080_0058000 3300049742 Bacteria 3605
1806 Ga0501080_0063349 3300049742 Bacteria 3441
1807 Ga0501080_0096107 3300049742 Bacteria 2750
1808 Ga0501080_0246710 3300049742 Bacteria 1628
1809 Ga0501080_0319669 3300049742 Bacteria 1405
1810 Ga0501080_0354833 3300049742 Bacteria 1324
1811 Ga0501080_0857991 3300049742 Bacteria 793
1812 Ga0501081_0000948 3300049743 Bacteria 17246
1813 Ga0501081_0001230 3300049743 Bacteria 15579
1814 Ga0501081_0030364 3300049743 Bacteria 3658
1815 Ga0501081_0034935 3300049743 Bacteria 3421
1816 Ga0501081_0072719 3300049743 Bacteria 2397
1817 Ga0501081_0082141 3300049743 Unclassified 2257
1818 Ga0501081_0170955 3300049743 Bacteria 1569
1819 Ga0501081_0202073 3300049743 Bacteria 1441
1820 Ga0501081_0228180 3300049743 Bacteria 1355
1821 Ga0501081_0451972 3300049743 Bacteria 954
1822 Ga0501081_0791443 3300049743 Bacteria 713
1823 Ga0501081_1464363 3300049743 Bacteria 518
1824 Ga0501083_0000561 3300049744 Bacteria 23809
1825 Ga0501083_0000664 3300049744 Bacteria 22332
1826 Ga0501083_0002572 3300049744 Bacteria 12477
1827 Ga0501083_0069303 3300049744 Bacteria 2346
1828 Ga0501083_0109143 3300049744 Bacteria 1820
1829 Ga0501083_0260090 3300049744 Bacteria 1129
1830 Ga0501083_0378059 3300049744 Bacteria 921
1831 Ga0501083_0452819 3300049744 Bacteria 835
1832 Ga0501266_106026 3300049763 Bacteria 504
1833 Ga0501035_0000457 3300049822 Bacteria 45780
1834 Ga0501035_0001358 3300049822 Bacteria 25181
1835 Ga0501035_0043355 3300049822 Bacteria 4054
1836 Ga0501035_0173630 3300049822 Bacteria 1861
1837 Ga0501035_0653357 3300049822 Bacteria 852
1838 Ga0501044_0002523 3300049823 Bacteria 20840
1839 Ga0501044_0003404 3300049823 Bacteria 17914
1840 Ga0501044_0005188 3300049823 Bacteria 14499
1841 Ga0501044_0236964 3300049823 Archaea 1770
1842 Ga0501044_0579351 3300049823 Bacteria 1017
1843 Ga0501045_0005910 3300049824 Bacteria 8466
1844 Ga0501045_0010848 3300049824 Bacteria 6388
1845 Ga0501045_0022556 3300049824 Bacteria 4508
1846 Ga0501045_0023433 3300049824 Bacteria 4425
1847 Ga0501045_0033134 3300049824 Bacteria 3746
1848 Ga0501045_0068603 3300049824 Bacteria 2605
1849 Ga0501045_0084164 3300049824 Bacteria 2346
1850 Ga0501045_0094985 3300049824 Bacteria 2205
1851 Ga0501045_0113240 3300049824 Bacteria 2012
1852 Ga0501045_0328296 3300049824 Bacteria 1138
1853 Ga0501212_119299 3300049851 Unclassified 510
1854 nmdc:mga03683_174005_c1 3300050489 Unclassified 979
1855 nmdc:mga0yw44_107220_c1 3300050492 Bacteria 1786
1856 nmdc:mga0yw44_186393_c1 3300050492 Bacteria 1367
1857 nmdc:mga0yw44_392421_c1 3300050492 Bacteria 938
1858 nmdc:mga06z11_659728_c1 3300050494 Unclassified 637
1859 nmdc:mga05p37_107758_c1 3300050507 Bacteria 3428
1860 nmdc:mga05p37_16133_c1 3300050507 Bacteria 8994
1861 nmdc:mga05p37_241126_c1 3300050507 Bacteria 2174
1862 nmdc:mga05p37_28617_c1 3300050507 Bacteria 6797
1863 nmdc:mga05p37_433233_c1 3300050507 Bacteria 1527
1864 nmdc:mga05p37_612894_c1 3300050507 Bacteria 1226
1865 nmdc:mga05p37_630460_c1 3300050507 Unclassified 1205
1866 nmdc:mga05p37_66600_c1 3300050507 Bacteria 4430
1867 nmdc:mga05p37_8862_c1 3300050507 Bacteria 11885
1868 nmdc:mga09592_2440_c1 3300050508 Bacteria 14997
1869 nmdc:mga09592_303312_c1 3300050508 Unclassified 1385
1870 nmdc:mga0qj67_41930_c1 3300050509 Bacteria 3602
1871 nmdc:mga0qj67_990670_c1 3300050509 Archaea 660
1872 nmdc:mga06r32_162353_c1 3300050510 Bacteria 2217
1873 nmdc:mga06r32_198785_c1 3300050510 Bacteria 1992
1874 nmdc:mga06r32_42674_c1 3300050510 Bacteria 4314
1875 nmdc:mga06r32_438180_c1 3300050510 Bacteria 1287
1876 nmdc:mga06r32_832643_c1 3300050510 Bacteria 882
1877 nmdc:mga08y16_1040221_c1 3300050511 Bacteria 797
1878 nmdc:mga08y16_1085803_c1 3300050511 Unclassified 776
1879 nmdc:mga08y16_13727_c1 3300050511 Bacteria 8529
1880 nmdc:mga08y16_156192_c1 3300050511 Bacteria 2371
1881 nmdc:mga08y16_479770_c1 3300050511 Unclassified 1265
1882 nmdc:mga08y16_536081_c1 3300050511 Unclassified 1186
1883 nmdc:mga08y16_6212_c1 3300050511 Bacteria 12532
1884 nmdc:mga08y16_993441_c1 3300050511 Unclassified 820
1885 nmdc:mga0n895_113403_c1 3300050512 Bacteria 2728
1886 nmdc:mga0n895_1302308_c1 3300050512 Bacteria 697
1887 nmdc:mga0n895_1403304_c1 3300050512 Bacteria 667
1888 nmdc:mga0n895_22447_c1 3300050512 Bacteria 5917
1889 nmdc:mga0n895_29349_c1 3300050512 Bacteria 5245
1890 nmdc:mga0n895_347339_c1 3300050512 Unclassified 1503
1891 nmdc:mga0n895_66163_c1 3300050512 Bacteria 3579
1892 nmdc:mga0rr50_160820_c1 3300050513 Bacteria 1823
1893 nmdc:mga0rr50_33179_c1 3300050513 Bacteria 3686
1894 nmdc:mga0rr50_463041_c1 3300050513 Unclassified 1076
1895 nmdc:mga0rr50_794457_c1 3300050513 Unclassified 807
1896 nmdc:mga0rr50_8771_c1 3300050513 Bacteria 6309
1897 nmdc:mga0rr50_99874_c1 3300050513 Unclassified 2278
1898 nmdc:mga08x19_1096607_c1 3300050514 Bacteria 565
1899 nmdc:mga08x19_11008_c1 3300050514 Bacteria 5444
1900 nmdc:mga08x19_1187803_c1 3300050514 Bacteria 541
1901 nmdc:mga08x19_13424_c1 3300050514 Bacteria 4953
1902 nmdc:mga08x19_276154_c1 3300050514 Bacteria 1164
1903 nmdc:mga08x19_39379_c1 3300050514 Bacteria 3005
1904 nmdc:mga0a205_17439_c1 3300050515 Bacteria 6732
1905 nmdc:mga0a205_28604_c1 3300050515 Bacteria 5330
1906 nmdc:mga0a205_362748_c1 3300050515 Bacteria 1315
1907 nmdc:mga0a205_55847_c1 3300050515 Bacteria 3813
1908 nmdc:mga0a205_8214_c1 3300050515 Bacteria 9486
1909 Ga0495601_0014931 3300053077 Bacteria 4688
1910 Ga0495601_0077742 3300053077 Bacteria 2125
1911 Ga0495601_0265709 3300053077 Bacteria 1119
1912 Ga0495601_0715447 3300053077 Bacteria 638
1913 Ga0495612_0183669 3300053078 Bacteria 919
1914 Ga0495612_0348455 3300053078 Bacteria 668
1915 Ga0495655_0085213 3300053083 Bacteria 911
1916 Ga0495595_0008508 3300053084 Bacteria 4214
1917 Ga0495595_0030703 3300053084 Bacteria 2411
1918 Ga0495595_0229203 3300053084 Unclassified 928
1919 Ga0495595_0586744 3300053084 Unclassified 570
1920 Ga0495619_0062721 3300053085 Bacteria 2474
1921 Ga0495619_0096784 3300053085 Bacteria 2004
1922 Ga0495619_0178203 3300053085 Bacteria 1470
1923 Ga0495619_0305120 3300053085 Bacteria 1103
1924 Ga0495619_0307392 3300053085 Bacteria 1098
1925 Ga0495619_0474897 3300053085 Bacteria 861
1926 Ga0495619_0615600 3300053085 Bacteria 742
1927 Ga0495619_0971048 3300053085 Bacteria 569
1928 Ga0495619_1148905 3300053085 Bacteria 515
1929 Ga0501084_0000995 3300054114 Bacteria 22022
1930 Ga0501084_0001035 3300054114 Bacteria 21607
1931 Ga0501084_0001602 3300054114 Bacteria 17929
1932 Ga0501084_0025040 3300054114 Bacteria 4979
1933 Ga0501084_0041168 3300054114 Bacteria 3864
1934 Ga0501084_0052144 3300054114 Bacteria 3423
1935 Ga0501084_0110502 3300054114 Bacteria 2309
1936 Ga0501084_0127115 3300054114 Bacteria 2145
1937 Ga0501084_0132507 3300054114 Bacteria 2098
1938 Ga0501084_0274282 3300054114 Bacteria 1424
1939 Ga0501084_0485282 3300054114 Unclassified 1044
1940 Ga0501084_0493358 3300054114 Bacteria 1035
1941 Ga0501084_0710508 3300054114 Bacteria 847
1942 Ga0590077_016865 3300059426 Bacteria 1534
1943 Ga0501082_0001285 3300060353 Bacteria 22025
1944 Ga0501082_0002542 3300060353 Bacteria 15978
1945 Ga0501082_0027473 3300060353 Bacteria 4898
1946 Ga0501082_0091413 3300060353 Bacteria 2628
1947 Ga0501082_0098581 3300060353 Bacteria 2527
1948 Ga0501082_0119943 3300060353 Bacteria 2279
1949 Ga0501082_0279395 3300060353 Bacteria 1453
1950 Ga0501082_0323530 3300060353 Unclassified 1344
1951 Ga0501082_0713924 3300060353 Bacteria 877
1952 Ga0501082_0755670 3300060353 Bacteria 851
1953 Ga0501082_0814845 3300060353 Archaea 817
1954 Ga0466962_0033068 3300061719 Bacteria 2474
1955 Ga0466962_0165682 3300061719 Unclassified 1075
1956 Ga0466962_0273557 3300061719 Bacteria 833
1957 Ga0466962_0406569 3300061719 Bacteria 682
1958 Ga0530510_0000483 3300061734 Bacteria 25575
1959 Ga0530510_0003271 3300061734 Bacteria 11143
1960 Ga0530510_0008413 3300061734 Bacteria 7191
1961 Ga0530510_0042169 3300061734 Bacteria 3296
1962 Ga0530510_0050183 3300061734 Bacteria 3013
1963 Ga0530510_0130411 3300061734 Bacteria 1849
1964 Ga0530510_0219486 3300061734 Bacteria 1413
1965 Ga0530510_1241338 3300061734 Bacteria 571
1966 Ga0451847_0567380
1967 JGI24737J22298_10226770
1968 JGI24744J21845_10006394
1969 JGI24742J22300_10032619
1970 JGI25406J46586_10075207
1971 JGI25407J50210_10004039
1972 JGI25407J50210_10008409
1973 Ga0058862_12097182
1974 Ga0070658_10017458
1975 Ga0070658_10599467
1976 Ga0070676_10123021
1977 Ga0070676_11296682
1978 Ga0070683_100097361
1979 Ga0070683_100142815
1980 Ga0070683_100559210
1981 Ga0070683_101235695
1982 Ga0070690_100968183
1983 Ga0070670_100233967
1984 Ga0068869_100066126
1985 Ga0068869_100088433
1986 Ga0068869_101174937
1987 Ga0070666_10071585
1988 Ga0070680_100099227
1989 Ga0070680_100158195
1990 Ga0070680_100261476
1991 Ga0070680_101160004
1992 Ga0070682_100000724
1993 Ga0070682_100353853
1994 Ga0070682_100492699
1995 Ga0070682_101793144
1996 Ga0068868_100021473
1997 Ga0068868_100031465
1998 Ga0068868_100037051
1999 Ga0068868_100412417
2000 Ga0070660_100004795
2001 Ga0070660_100012584
2002 Ga0070660_100035695
2003 Ga0070660_100080555
2004 Ga0070660_100620462
2005 Ga0070660_101032960
2006 Ga0070689_100001164
2007 Ga0070691_10274266
2008 Ga0070691_10841359
2009 Ga0070687_100117055
2010 Ga0070692_10062692
2011 Ga0070692_10243144
2012 Ga0070692_10531806
2013 Ga0070692_10569908
2014 Ga0070668_100194587
2015 Ga0070668_100328762
2016 Ga0070669_100592106
2017 Ga0070675_100093736
2018 Ga0070675_100138855
2019 Ga0070675_100440446
2020 Ga0070671_100106400
2021 Ga0070674_100070769
2022 Ga0070674_100088494
2023 Ga0070674_100171053
2024 Ga0070674_100337666
2025 Ga0070674_100449858
2026 Ga0070674_100573692
2027 Ga0070674_100645764
2028 Ga0070673_100144366
2029 Ga0070688_100031102
2030 Ga0070688_100307199
2031 Ga0070688_100668004
2032 Ga0070659_100003178
2033 Ga0070659_100402607
2034 Ga0070659_100415626
2035 Ga0070659_101035686
2036 Ga0070667_100094285
2037 Ga0070667_100458895
2038 Ga0070703_10016513
2039 Ga0070703_10108310
2040 Ga0070709_10063361
2041 Ga0070709_10235018
2042 Ga0070709_10335885
2043 Ga0070709_11099465
2044 Ga0070709_11286633
2045 Ga0070709_11583593
2046 Ga0070714_100004641
2047 Ga0070714_100009404
2048 Ga0070714_100021468
2049 Ga0070714_100054262
2050 Ga0070714_100072186
2051 Ga0070714_100177175
2052 Ga0070714_100279502
2053 Ga0070714_100302028
2054 Ga0070714_100491228
2055 Ga0070714_101240172
2056 Ga0070713_100112608
2057 Ga0070713_100175288
2058 Ga0070713_100674034
2059 Ga0070713_100962494
2060 Ga0070713_101057460
2061 Ga0070713_101989177
2062 Ga0070710_10077042
2063 Ga0070710_10097550
2064 Ga0070710_10314580
2065 Ga0070710_10506106
2066 Ga0070701_10029400
2067 Ga0070701_10974226
2068 Ga0070711_100005292
2069 Ga0070711_100335146
2070 Ga0070711_100347812
2071 Ga0070711_100479998
2072 Ga0070711_101344084
2073 Ga0070705_100032809
2074 Ga0070705_100142209
2075 Ga0070705_100161336
2076 Ga0070705_100197641
2077 Ga0070705_100286981
2078 Ga0070705_100479506
2079 Ga0070705_101675539
2080 Ga0070700_100017962
2081 Ga0070700_100705534
2082 Ga0070700_100856377
2083 Ga0070694_100002541
2084 Ga0070694_100224112
2085 Ga0070694_100956813
2086 Ga0070708_100059650
2087 Ga0070708_100144183
2088 Ga0070708_100514941
2089 Ga0070708_100854210
2090 Ga0070663_100104925
2091 Ga0070663_100616716
2092 Ga0070663_100816012
2093 Ga0070663_101460446
2094 Ga0070678_100016378
2095 Ga0070678_100098940
2096 Ga0070678_100225644
2097 Ga0070678_100299146
2098 Ga0070678_100323794
2099 Ga0070678_100401937
2100 Ga0070678_100853536
2101 Ga0070678_101315656
2102 Ga0070662_100120899
2103 Ga0070662_100417504
2104 Ga0070662_100453067
2105 Ga0070662_101276775
2106 Ga0070681_10008425
2107 Ga0070681_10024213
2108 Ga0070681_10181531
2109 Ga0070681_11307142
2110 Ga0070681_11950120
2111 Ga0068867_100005114
2112 Ga0068867_100251077
2113 Ga0068867_100264654
2114 Ga0070685_10780219
2115 Ga0070706_100019334
2116 Ga0070706_100039954
2117 Ga0070706_100063962
2118 Ga0070706_100245793
2119 Ga0070706_100644267
2120 Ga0070706_100697149
2121 Ga0070706_101014677
2122 Ga0070707_100000876
2123 Ga0070707_100014709
2124 Ga0070707_100142740
2125 Ga0070707_100223602
2126 Ga0070707_100254843
2127 Ga0070707_100503632
2128 Ga0070707_100535984
2129 Ga0070707_101404098
2130 Ga0070707_102170021
2131 Ga0070698_100010606
2132 Ga0070698_100013685
2133 Ga0070698_100051873
2134 Ga0070698_100072239
2135 Ga0070698_100229314
2136 Ga0070698_100284728
2137 Ga0070698_100566529
2138 Ga0070698_100931958
2139 Ga0070698_100990651
2140 Ga0070698_100990800
2141 Ga0070698_101419543
2142 Ga0070698_102118226
2143 Ga0070699_100010261
2144 Ga0070699_100047910
2145 Ga0070699_100158488
2146 Ga0070699_100265330
2147 Ga0070699_100363138
2148 Ga0070699_100598294
2149 Ga0070699_100823004
2150 Ga0070699_101013289
2151 Ga0070699_101723486
2152 Ga0070679_100156727
2153 Ga0070679_100158088
2154 Ga0070679_100273022
2155 Ga0070679_100301997
2156 Ga0070679_100545873
2157 Ga0070684_100042465
2158 Ga0070697_100200450
2159 Ga0070697_101105278
2160 Ga0070697_101636157
2161 Ga0068853_102099934
2162 Ga0070672_100051152
2163 Ga0070672_100110878
2164 Ga0070672_100297156
2165 Ga0070672_100455698
2166 Ga0070672_100772991
2167 Ga0070686_100123364
2168 Ga0070686_100642333
2169 Ga0070686_101179751
2170 Ga0070695_100034587
2171 Ga0070695_100097243
2172 Ga0070695_100103679
2173 Ga0070695_100278029
2174 Ga0070695_100574641
2175 Ga0070696_100008682
2176 Ga0070696_100012464
2177 Ga0070696_100450255
2178 Ga0070696_101026665
2179 Ga0070696_101196695
2180 Ga0070696_101765274
2181 Ga0070693_100036720
2182 Ga0070693_100073851
2183 Ga0070693_100102540
2184 Ga0070693_100124315
2185 Ga0070693_100264590
2186 Ga0070693_100656928
2187 Ga0070665_100211979
2188 Ga0070665_100527452
2189 Ga0070704_100007778
2190 Ga0070704_100286559
2191 Ga0070704_100384330
2192 Ga0070704_100490434
2193 Ga0070704_100618264
2194 Ga0070704_101000668
2195 Ga0068855_100011694
2196 Ga0068855_100026071
2197 Ga0068855_100054074
2198 Ga0068855_100076167
2199 Ga0068855_100095580
2200 Ga0068855_100745323
2201 Ga0070664_100999464
2202 Ga0070664_101868090
2203 Ga0068857_100012071
2204 Ga0068854_100263133
2205 Ga0068856_100002288
2206 Ga0068856_100006131
2207 Ga0068856_100213729
2208 Ga0068856_100724824
2209 Ga0068856_100990614
2210 Ga0068856_101292017
2211 Ga0070702_100045252
2212 Ga0070702_100047635
2213 Ga0070702_100051895
2214 Ga0070702_100569966
2215 Ga0070702_100619599
2216 Ga0068852_100186519
2217 Ga0068852_100398170
2218 Ga0068852_102326828
2219 Ga0068859_100066787
2220 Ga0068859_100068771
2221 Ga0068859_101253902
2222 Ga0068864_100281527
2223 Ga0068866_10296046
2224 Ga0068866_10355344
2225 Ga0068861_100061062
2226 Ga0068861_100548529
2227 Ga0068861_101810463
2228 Ga0068870_10036532
2229 Ga0068870_10930004
2230 Ga0068863_102165100
2231 Ga0068858_100167631
2232 Ga0068858_100216107
2233 Ga0068860_100054202
2234 Ga0068860_100892634
2235 Ga0068862_100146178
2236 Ga0068862_101082901
2237 Ga0068862_101156284
2238 Ga0081455_10028173
2239 Ga0081455_10087699
2240 Ga0081455_10115946
2241 Ga0081455_10192003
2242 Ga0081455_10243433
2243 Ga0081538_10000562
2244 Ga0081538_10000853
2245 Ga0081538_10001225
2246 Ga0081538_10007406
2247 Ga0081538_10010402
2248 Ga0081538_10019642
2249 Ga0081538_10054341
2250 Ga0081538_10083202
2251 Ga0081538_10234738
2252 Ga0081539_10003901
2253 Ga0081539_10015861
2254 Ga0081539_10051470
2255 Ga0081539_10086606
2256 Ga0070717_10025852
2257 Ga0070717_10202222
2258 Ga0070717_10626624
2259 Ga0075365_10034867
2260 Ga0075365_10160485
2261 Ga0075432_10005707
2262 Ga0075432_10066592
2263 Ga0075432_10100204
2264 Ga0070715_10028985
2265 Ga0070716_100020975
2266 Ga0070716_100146645
2267 Ga0070716_100191536
2268 Ga0070716_100430722
2269 Ga0070716_101147048
2270 Ga0070712_100009723
2271 Ga0070712_100075379
2272 Ga0070712_100080069
2273 Ga0070712_100306712
2274 Ga0070712_100345656
2275 Ga0070712_100435608
2276 Ga0070712_101419925
2277 Ga0075367_10832747
2278 Ga0097621_100011800
2279 Ga0097621_100174180
2280 Ga0097621_100213561
2281 Ga0068871_100134410
2282 Ga0068871_100214794
2283 Ga0068871_100376888
2284 Ga0075428_100050603
2285 Ga0075428_100268792
2286 Ga0075428_100573004
2287 Ga0075428_101203178
2288 Ga0075428_101983677
2289 Ga0075430_100222135
2290 Ga0075430_100261228
2291 Ga0075430_101109700
2292 Ga0075431_100009745
2293 Ga0075431_100076028
2294 Ga0075431_100186447
2295 Ga0075433_10184272
2296 Ga0075433_10186541
2297 Ga0075433_10197241
2298 Ga0075433_10291887
2299 Ga0075433_10736973
2300 Ga0075434_100052068
2301 Ga0075434_100052483
2302 Ga0075434_100094216
2303 Ga0075434_100160015
2304 Ga0075434_100207228
2305 Ga0075434_100231680
2306 Ga0075434_100280016
2307 Ga0075434_101509570
2308 Ga0075434_101666872
2309 Ga0075429_100006033
2310 Ga0075429_100194385
2311 Ga0075429_100407100
2312 Ga0068865_100001518
2313 Ga0068865_100149598
2314 Ga0068865_100364237
2315 Ga0068865_100513771
2316 Ga0068865_100754853
2317 Ga0068865_101100865
2318 Ga0068865_101586257
2319 Ga0075436_100008310
2320 Ga0075436_100048885
2321 Ga0075436_100077952
2322 Ga0075436_100307289
2323 Ga0075436_100403334
2324 Ga0075436_100734759
2325 Ga0075436_101089983
2326 Ga0097620_100066788
2327 Ga0097620_100068770
2328 Ga0097620_101253855
2329 Ga0075435_100002001
2330 Ga0075435_100009053
2331 Ga0075435_100013824
2332 Ga0075435_100040550
2333 Ga0075435_100221331
2334 Ga0105250_10360533
2335 Ga0105240_10013310
2336 Ga0105240_10432243
2337 Ga0105240_11971471
2338 Ga0105240_12231899
2339 Ga0111539_10029604
2340 Ga0111539_10228515
2341 Ga0111539_10374009
2342 Ga0111539_10758251
2343 Ga0111539_11043617
2344 Ga0111539_11419980
2345 Ga0111539_12335322
2346 Ga0105245_10002378
2347 Ga0105245_10010538
2348 Ga0105245_10016039
2349 Ga0105245_10026837
2350 Ga0105245_10027993
2351 Ga0105245_10177381
2352 Ga0105245_10768795
2353 Ga0105245_11497091
2354 Ga0105245_11984730
2355 Ga0105245_12838075
2356 Ga0105245_12933283
2357 Ga0105247_10022659
2358 Ga0105247_10839932
2359 Ga0105247_11229638
2360 Ga0114129_10005388
2361 Ga0114129_10008675
2362 Ga0114129_10040341
2363 Ga0114129_10047239
2364 Ga0114129_10173819
2365 Ga0114129_10221020
2366 Ga0114129_10245304
2367 Ga0114129_10471642
2368 Ga0114129_11190216
2369 Ga0114129_12997658
2370 Ga0114129_13125366
2371 Ga0105243_10027910
2372 Ga0105243_10052582
2373 Ga0105243_10106557
2374 Ga0105243_10240380
2375 Ga0105243_12753586
2376 Ga0105241_10198782
2377 Ga0105241_10981413
2378 Ga0105241_11458632
2379 Ga0105242_10008443
2380 Ga0105242_10024840
2381 Ga0105242_10120030
2382 Ga0105242_10245765
2383 Ga0105242_10376029
2384 Ga0105242_10448917
2385 Ga0105242_12143359
2386 Ga0105248_10008379
2387 Ga0105248_11017689
2388 Ga0105248_12259279
2389 Ga0105237_10520886
2390 Ga0105238_10006132
2391 Ga0105238_10392678
2392 Ga0105238_10716228
2393 Ga0105238_12575289
2394 Ga0105249_10001066
2395 Ga0105249_10386296
2396 Ga0105249_10685121
2397 Ga0105249_12251100
2398 Ga0105249_12326922
2399 Ga0105249_12970872
2400 Ga0105239_10006889
2401 Ga0105239_10022722
2402 Ga0105239_10234932
2403 Ga0105239_10453373
2404 Ga0105239_10651874
2405 Ga0105239_13027409
2406 Ga0105246_10090198
2407 Ga0105246_10133644
2408 Ga0105246_10611534
2409 Ga0157321_1022019
2410 Ga0157373_10571147
2411 Ga0157373_10790347
2412 Ga0157371_10876157
2413 Ga0157370_10008957
2414 Ga0157370_10011605
2415 Ga0157370_10021485
2416 Ga0157370_10581521
2417 Ga0157369_10002298
2418 Ga0157369_10018218
2419 Ga0157369_10369578
2420 Ga0157369_10664886
2421 Ga0157369_10732624
2422 Ga0157369_12050789
2423 Ga0157374_10006816
2424 Ga0157374_11027978
2425 Ga0157374_11366903
2426 Ga0157378_10363346
2427 Ga0157378_10571851
2428 Ga0157378_11312841
2429 Ga0163162_10007126
2430 Ga0163162_10068726
2431 Ga0157372_10062694
2432 Ga0157372_10511293
2433 Ga0157372_10895525
2434 Ga0157372_11627991
2435 Ga0157372_11848106
2436 Ga0157372_12543911
2437 Ga0157375_10124007
2438 Ga0157375_10233570
2439 Ga0157375_10313664
2440 Ga0157375_10840723
2441 Ga0157375_10928123
2442 Ga0163163_10090122
2443 Ga0163163_10747369
2444 Ga0163163_11012849
2445 Ga0163163_11037752
2446 Ga0163163_11503159
2447 Ga0157380_10064114
2448 Ga0157380_10240371
2449 Ga0157380_11036642
2450 Ga0182008_10150105
2451 Ga0182008_10881057
2452 Ga0157377_10008690
2453 Ga0157377_10025409
2454 Ga0157377_11084471
2455 Ga0157379_10245504
2456 Ga0157379_10749500
2457 Ga0157379_10812705
2458 Ga0157379_10889147
2459 Ga0157376_10025044
2460 Ga0157376_10097436
2461 Ga0157376_10408014
2462 Ga0157376_10882916
2463 Ga0157376_10911999
2464 Ga0157376_12012877
2465 Ga0182007_10351269
2466 Ga0182005_1307918
2467 Ga0163161_10485117
2468 Ga0163161_11300143
2469 Ga0197907_10065360
2470 Ga0206356_11236435
2471 Ga0206354_11509267
2472 Ga0206353_10968799
2473 Ga0206353_11480980
2474 Ga0206353_12016091
2475 Ga0213873_10195572
2476 Ga0213871_10015656
2477 Ga0207653_10001347
2478 Ga0207692_10186608
2479 Ga0207692_10237492
2480 Ga0207692_10292174
2481 Ga0207692_10307069
2482 Ga0207642_10003349
2483 Ga0207688_10210317
2484 Ga0207688_10212351
2485 Ga0207688_10401861
2486 Ga0207647_10075870
2487 Ga0207685_10007078
2488 Ga0207685_10438335
2489 Ga0207699_10040087
2490 Ga0207699_10065044
2491 Ga0207699_10074517
2492 Ga0207699_10486038
2493 Ga0207699_10530288
2494 Ga0207699_10750668
2495 Ga0207699_10863588
2496 Ga0207645_10219858
2497 Ga0207645_10698301
2498 Ga0207643_10416065
2499 Ga0207643_10756380
2500 Ga0207705_10085132
2501 Ga0207705_10177943
2502 Ga0207705_10248385
2503 Ga0207684_10050496
2504 Ga0207684_10140613
2505 Ga0207684_10357755
2506 Ga0207684_10415672
2507 Ga0207684_10551359
2508 Ga0207654_10331074
2509 Ga0207654_10385247
2510 Ga0207707_10001299
2511 Ga0207707_10079600
2512 Ga0207707_10341760
2513 Ga0207707_10861068
2514 Ga0207695_10114961
2515 Ga0207695_10931034
2516 Ga0207695_11476554
2517 Ga0207671_10356252
2518 Ga0207693_10000183
2519 Ga0207693_10000543
2520 Ga0207693_10004718
2521 Ga0207693_10118547
2522 Ga0207693_10263454
2523 Ga0207693_10389104
2524 Ga0207693_11031568
2525 Ga0207693_11031591
2526 Ga0207663_10022230
2527 Ga0207663_10439320
2528 Ga0207663_10495530
2529 Ga0207663_10774029
2530 Ga0207663_11461776
2531 Ga0207663_11611665
2532 Ga0207660_10201701
2533 Ga0207660_10554816
2534 Ga0207660_11255522
2535 Ga0207662_10382893
2536 Ga0207657_10003624
2537 Ga0207657_10012052
2538 Ga0207657_10012634
2539 Ga0207657_10071676
2540 Ga0207657_10385561
2541 Ga0207657_10542382
2542 Ga0207657_10755239
2543 Ga0207649_10545013
2544 Ga0207652_10021367
2545 Ga0207652_10185066
2546 Ga0207652_10303651
2547 Ga0207652_10437217
2548 Ga0207652_10530816
2549 Ga0207646_10025319
2550 Ga0207646_10052541
2551 Ga0207646_10390990
2552 Ga0207646_10507311
2553 Ga0207646_11326255
2554 Ga0207646_11442757
2555 Ga0207681_10423505
2556 Ga0207694_10499456
2557 Ga0207659_10092558
2558 Ga0207659_10186154
2559 Ga0207659_10868070
2560 Ga0207687_10008291
2561 Ga0207687_10010129
2562 Ga0207687_10020256
2563 Ga0207687_10026619
2564 Ga0207687_10048987
2565 Ga0207687_10146343
2566 Ga0207687_10462302
2567 Ga0207687_10930344
2568 Ga0207700_10040505
2569 Ga0207700_10159450
2570 Ga0207700_10403419
2571 Ga0207700_10409502
2572 Ga0207700_10475041
2573 Ga0207700_10857433
2574 Ga0207700_10943279
2575 Ga0207700_11153775
2576 Ga0207700_11156866
2577 Ga0207664_10055197
2578 Ga0207664_10072260
2579 Ga0207664_10073052
2580 Ga0207664_10074962
2581 Ga0207664_10111135
2582 Ga0207664_10115264
2583 Ga0207664_10121549
2584 Ga0207664_10269823
2585 Ga0207664_11004510
2586 Ga0207644_10168324
2587 Ga0207644_10994542
2588 Ga0207690_10014593
2589 Ga0207690_10038686
2590 Ga0207690_10144533
2591 Ga0207706_10094006
2592 Ga0207706_10171296
2593 Ga0207706_10222488
2594 Ga0207706_10439565
2595 Ga0207706_10578108
2596 Ga0207706_10751561
2597 Ga0207706_11424707
2598 Ga0207686_10006015
2599 Ga0207686_10326493
2600 Ga0207686_10394458
2601 Ga0207686_10572299
2602 Ga0207686_10977724
2603 Ga0207686_11635864
2604 Ga0207709_10027389
2605 Ga0207709_10074810
2606 Ga0207709_10967028
2607 Ga0207709_11831278
2608 Ga0207669_10017540
2609 Ga0207669_10113132
2610 Ga0207669_10159444
2611 Ga0207669_10559199
2612 Ga0207669_10865386
2613 Ga0207669_11575028
2614 Ga0207704_10006979
2615 Ga0207704_10399170
2616 Ga0207704_10493587
2617 Ga0207704_11004425
2618 Ga0207704_11235625
2619 Ga0207665_10024756
2620 Ga0207665_10128324
2621 Ga0207665_10237511
2622 Ga0207665_10377125
2623 Ga0207665_10542206
2624 Ga0207665_10708851
2625 Ga0207691_10002533
2626 Ga0207691_10085597
2627 Ga0207691_10505621
2628 Ga0207691_10784277
2629 Ga0207711_10543310
2630 Ga0207711_10578692
2631 Ga0207689_10062101
2632 Ga0207689_10068349
2633 Ga0207689_11686307
2634 Ga0207661_10373742
2635 Ga0207661_10406482
2636 Ga0207661_10857491
2637 Ga0207661_11506895
2638 Ga0207679_11658692
2639 Ga0207667_10010035
2640 Ga0207667_10035781
2641 Ga0207667_10081555
2642 Ga0207667_10089933
2643 Ga0207667_10237570
2644 Ga0207667_10261152
2645 Ga0207667_10350547
2646 Ga0207667_10485782
2647 Ga0207667_10987400
2648 Ga0207667_11244043
2649 Ga0207651_10279360
2650 Ga0207651_10918973
2651 Ga0207651_11699104
2652 Ga0207712_10046737
2653 Ga0207712_10084523
2654 Ga0207712_10169992
2655 Ga0207712_11491705
2656 Ga0207668_10078854
2657 Ga0207668_10393280
2658 Ga0207668_10501072
2659 Ga0207668_11460826
2660 Ga0207640_10170221
2661 Ga0207640_10208501
2662 Ga0207640_10219622
2663 Ga0207640_10517574
2664 Ga0207658_10195007
2665 Ga0207677_10009894
2666 Ga0207677_10089729
2667 Ga0207677_10096958
2668 Ga0207703_10047912
2669 Ga0207639_11015348
2670 Ga0207678_10025112
2671 Ga0207678_10069443
2672 Ga0207708_10000064
2673 Ga0207708_10017082
2674 Ga0207708_10077448
2675 Ga0207708_10436636
2676 Ga0207708_10701388
2677 Ga0207708_10729420
2678 Ga0207708_10875708
2679 Ga0207702_10006561
2680 Ga0207702_10058251
2681 Ga0207702_10374513
2682 Ga0207702_10773139
2683 Ga0207702_11145600
2684 Ga0207702_11215883
2685 Ga0207641_11092359
2686 Ga0207641_11819067
2687 Ga0207648_10005420
2688 Ga0207648_10024380
2689 Ga0207648_10105969
2690 Ga0207648_10180099
2691 Ga0207676_11403462
2692 Ga0207674_10001429
2693 Ga0207675_100020980
2694 Ga0207675_100579607
2695 Ga0207675_100700350
2696 Ga0207675_100712749
2697 Ga0207683_10017237
2698 Ga0207683_10028633
2699 Ga0207683_10069241
2700 Ga0207683_10085967
2701 Ga0207683_10253638
2702 Ga0207683_10422387
2703 Ga0207683_10684889
2704 Ga0207683_10685419
2705 Ga0207683_11447543
2706 Ga0207698_10097584
2707 Ga0207698_10362749
2708 Ga0207698_11217106
2709 Ga0207698_11298181
2710 Ga0209966_1020796
2711 Ga0209966_1025320
2712 Ga0209998_10048638
2713 Ga0209974_10131539
2714 Ga0207428_10033357
2715 Ga0207428_10186739
2716 Ga0207428_10837891
2717 Ga0207428_10839898
2718 Ga0207428_11143834
2719 Ga0268266_10171787
2720 Ga0268265_10053613
2721 Ga0268265_10643562
2722 Ga0268265_12615626
2723 Ga0268264_10087916
2724 Ga0268264_11740478
2725 Ga0265337_1032915
2726 Ga0265337_1034853
2727 Ga0265337_1056877
2728 Ga0265326_10018324
2729 Ga0265326_10049685
2730 Ga0265319_1004602
2731 Ga0265319_1015323
2732 Ga0265319_1020214
2733 Ga0265334_10035955
2734 Ga0265334_10110953
2735 Ga0265318_10010540
2736 Ga0265318_10016917
2737 Ga0265318_10023732
2738 Ga0265318_10046336
2739 Ga0265323_10086001
2740 Ga0265323_10278201
2741 Ga0265322_10034519
2742 Ga0265322_10121619
2743 Ga0265336_10025979
2744 Ga0265336_10177978
2745 Ga0265338_10002399
2746 Ga0265338_10017798
2747 Ga0265338_10053386
2748 Ga0265338_10067363
2749 Ga0265338_10072949
2750 Ga0265338_10389296
2751 Ga0265338_10391792
2752 Ga0265338_10686886
2753 Ga0265324_10077670
2754 Ga0265330_10026164
2755 Ga0265330_10284256
2756 Ga0265330_10385019
2757 Ga0265332_10085953
2758 Ga0265328_10002801
2759 Ga0265320_10073146
2760 Ga0265320_10134358
2761 Ga0265320_10277542
2762 Ga0265325_10044376
2763 Ga0265325_10048042
2764 Ga0265329_10024571
2765 Ga0265340_10014348
2766 Ga0265340_10020600
2767 Ga0265340_10041231
2768 Ga0265339_10001458
2769 Ga0265339_10140375
2770 Ga0265339_10162764
2771 Ga0265339_10232554
2772 Ga0265331_10020805
2773 Ga0265331_10102087
2774 Ga0265331_10501725
2775 Ga0265327_10022468
2776 Ga0265327_10032775
2777 Ga0265327_10082280
2778 Ga0265327_10135973
2779 Ga0265327_10401038
2780 Ga0265316_10111601
2781 Ga0265316_10253868
2782 Ga0265316_10287909
2783 Ga0265316_10346252
2784 Ga0265316_10490129
2785 Ga0307408_100572705
2786 Ga0307408_101418174
2787 Ga0265313_10051943
2788 Ga0265313_10085378
2789 Ga0265314_10009344
2790 Ga0265314_10051195
2791 Ga0265314_10188459
2792 Ga0265342_10038976
2793 Ga0265342_10053412
2794 Ga0265342_10093305
2795 Ga0307405_10031541
2796 Ga0307405_10218643
2797 Ga0307405_10581213
2798 Ga0307405_11360502
2799 Ga0307413_10173135
2800 Ga0307413_10344472
2801 Ga0307413_10349947
2802 Ga0307410_10304766
2803 Ga0307406_11100863
2804 Ga0307406_11322785
2805 Ga0307406_11858598
2806 Ga0307407_10073999
2807 Ga0307407_10754469
2808 Ga0307407_11690675
2809 Ga0307412_10326431
2810 Ga0307412_10635561
2811 Ga0307412_11016305
2812 Ga0307412_11904862
2813 Ga0307409_100009147
2814 Ga0307409_100174426
2815 Ga0307409_100285406
2816 Ga0307409_100296371
2817 Ga0307409_100816969
2818 Ga0307409_100948282
2819 Ga0307409_101117060
2820 Ga0307416_100062659
2821 Ga0307416_100251858
2822 Ga0307416_100267610
2823 Ga0307416_100303129
2824 Ga0307416_100379253
2825 Ga0307416_100539468
2826 Ga0307416_100553267
2827 Ga0307411_10234904
2828 Ga0307411_10327579
2829 Ga0307411_10967596
2830 Ga0307415_100124797
2831 Ga0307415_100153264
2832 Ga0307415_100157345
2833 Ga0307415_100427408
2834 Ga0307415_102480776
2835 Ga0373930_0004430
2836 Ga0373948_0003274
2837 Ga0373958_0061717
2838 Ga0373959_0007931
2839 Ga0373938_0021207
2840 Ga0373926_0014653
2841 Ga0373928_0006626
2842 Ga0373944_0004151
2843 Ga0373944_0042736
2844 Ga0373949_0021547
2845 Ga0373951_0071532
2846 Ga0373952_0006581
2847 Ga0373952_0276349
2848 Ga0373923_0119327
2849 Ga0373932_0004244
2850 Ga0373936_0039974
2851 Ga0373939_0020387
2852 Ga0373939_0077596
2853 Ga0373941_0026995
2854 Ga0373945_0003225
2855 Ga0373945_0268313
2856 Ga0373953_0027035
2857 Ga0373953_0184037
2858 Ga0373954_0016832
2859 Ga0373954_0120414
2860 Ga0373956_0078972
2861 Ga0373956_0210625
2862 Ga0373957_0042468
2863 Ga0373957_0095228
2864 Ga0373960_0007094
2865 Ga0373943_0004177
2866 Ga0373943_0012814
2867 Ga0373943_0050429
2868 Ga0373943_0956838
2869 Ga0373946_0004366
2870 Ga0373946_0039458
2871 Ga0373946_0545260
2872 Ga0373955_0029377
2873 Ga0373955_0251613
2874 Ga0373955_0820082
2875 Ga0373942_0037964
2876 Ga0373961_0036653
2877 Ga0373961_0094780
2878 Ga0373962_0004892
2879 Ga0373924_0007579
2880 Ga0373931_0022247
2881 Ga0373931_0339168
2882 Ga0373931_0740670
2883 Ga0373935_0002406
2884 Ga0373935_0061654
2885 Ga0373935_0174469
2886 Ga0373927_0052812
2887 Ga0373933_0059558
2888 Ga0373933_0291521
2889 Ga0373933_0442261
2890 Ga0373933_1118709
2891 Ga0373947_0004917
2892 Ga0373947_0020348
2893 Ga0373947_0072008
2894 Ga0373947_0091353
2895 Ga0373947_0146209
2896 Ga0373947_0413025
2897 Ga0373937_0021717
2898 Ga0373937_0283198
2899 Ga0373937_2164911
2900 Ga0373925_0005095
2901 Ga0373925_0188309
2902 Ga0373925_0223285
2903 Ga0373925_0306801
2904 Ga0373925_0621532
2905 Ga0373925_1018832
2906 Ga0373925_1255480
2907 Ga0395899_0002854
2908 Ga0395899_0005973
2909 Ga0395899_0008716
2910 Ga0395899_0009725
2911 Ga0395899_0010577
2912 Ga0395899_0016967
2913 Ga0395899_0032880
2914 Ga0395899_0048050
2915 Ga0395899_0050955
2916 Ga0395899_0064701
2917 Ga0395899_0083770
2918 Ga0395899_0101194
2919 Ga0395899_0139195
2920 Ga0395899_0208298
2921 Ga0395899_0305632
2922 Ga0395899_0351280
2923 Ga0395899_0720510
2924 Ga0395899_0958102
2925 Ga0395899_0976239
2926 Ga0395900_0008078
2927 Ga0395900_0008413
2928 Ga0395900_0009665
2929 Ga0395900_0015917
2930 Ga0395900_0026666
2931 Ga0395900_0030328
2932 Ga0395900_0032967
2933 Ga0395900_0039951
2934 Ga0395900_0040112
2935 Ga0395900_0069741
2936 Ga0395900_0086330
2937 Ga0395900_0093684
2938 Ga0395900_0127274
2939 Ga0395900_0146797
2940 Ga0395900_0203228
2941 Ga0395900_0205324
2942 Ga0395900_0342635
2943 Ga0395900_0504119
2944 Ga0395900_0564400
2945 Ga0395900_0625422
2946 Ga0395900_0659422
2947 Ga0395900_0781776
2948 Ga0395900_0894232
2949 Ga0395900_0977138
2950 Ga0395900_1261977
2951 Ga0395898_0004818
2952 Ga0395898_0005838
2953 Ga0395898_0009573
2954 Ga0395898_0014829
2955 Ga0395898_0023975
2956 Ga0395898_0025913
2957 Ga0395898_0026252
2958 Ga0395898_0031174
2959 Ga0395898_0031424
2960 Ga0395898_0044970
2961 Ga0395898_0055709
2962 Ga0395898_0065774
2963 Ga0395898_0076622
2964 Ga0395898_0094649
2965 Ga0395898_0129251
2966 Ga0395898_0146920
2967 Ga0395898_0146990
2968 Ga0395898_0151251
2969 Ga0395898_0151360
2970 Ga0395898_0341458
2971 Ga0395898_0393459
2972 Ga0395898_0460543
2973 Ga0395898_0504946
2974 Ga0395898_0613941
2975 Ga0395898_0784324
2976 Ga0395898_1062438
2977 Ga0395898_1236522
2978 Ga0395905_0006664
2979 Ga0395905_0008040
2980 Ga0395905_0010274
2981 Ga0395905_0013469
2982 Ga0395905_0036864
2983 Ga0395905_0037343
2984 Ga0395905_0064361
2985 Ga0395905_0072421
2986 Ga0395905_0077520
2987 Ga0395905_0083118
2988 Ga0395905_0104634
2989 Ga0395905_0189416
2990 Ga0395905_0273039
2991 Ga0395905_0285434
2992 Ga0395905_0300869
2993 Ga0395905_0324709
2994 Ga0395905_0659004
2995 Ga0395905_1018030
2996 Ga0395905_1085159
2997 Ga0395905_1126279
2998 Ga0395901_0000731
2999 Ga0395901_0002352
3000 Ga0395901_0003039
3001 Ga0395901_0009320
3002 Ga0395901_0009671
3003 Ga0395901_0011114
3004 Ga0395901_0015241
3005 Ga0395901_0027918
3006 Ga0395901_0035405
3007 Ga0395901_0037870
3008 Ga0395901_0060611
3009 Ga0395901_0064308
3010 Ga0395901_0071864
3011 Ga0395901_0074680
3012 Ga0395901_0111538
3013 Ga0395901_0119478
3014 Ga0395901_0128562
3015 Ga0395901_0142756
3016 Ga0395901_0158514
3017 Ga0395901_0163307
3018 Ga0395901_0238164
3019 Ga0395901_0243505
3020 Ga0395901_0303240
3021 Ga0395901_0323259
3022 Ga0395901_0330304
3023 Ga0395901_0340022
3024 Ga0395901_0403287
3025 Ga0395901_0465851
3026 Ga0395901_0551056
3027 Ga0395901_0580790
3028 Ga0395901_0745638
3029 Ga0395901_0769497
3030 Ga0395901_0895255
3031 Ga0395901_1158586
3032 Ga0395901_1200750
3033 Ga0395901_1413672
3034 Ga0395901_1832786
3035 Ga0395901_1980533
3036 Ga0242420_072882
3037 Ga0436360_0109394
3038 Ga0436363_0834990
3039 Ga0436363_1509554
3040 Ga0436362_0876451
3041 Ga0436362_0950133
3042 Ga0439438_041642
3043 Ga0439461_0002121
3044 Ga0439461_0011001
3045 Ga0439466_0029918
3046 Ga0439466_0110845
3047 Ga0439465_0260355
3048 Ga0451802_2055700
3049 Ga0451807_0430671
3050 Ga0451845_0039632
3051 Ga0451853_0221711
3052 Ga0451853_2921298
3053 Ga0451853_3912091
3054 Ga0439437_035967
3055 Ga0439441_021194
3056 Ga0439456_091856
3057 Ga0450912_003398
3058 Ga0450913_029854
3059 Ga0450914_003882
3060 Ga0450915_012003
3061 Ga0450920_023652
3062 Ga0450905_017857
3063 Ga0450907_071417
3064 Ga0450910_022011
3065 Ga0439446_0001277
3066 Ga0439458_0029379
3067 Ga0439458_0093884
3068 Ga0450908_087066
3069 Ga0439434_0165211
3070 Ga0439459_0017868
3071 Ga0439459_0076260
3072 Ga0439460_0308629
3073 Ga0450916_032177
3074 Ga0450918_048381
3075 Ga0451577_1811052
3076 Ga0466969_0072078
3077 Ga0466972_0103354
3078 Ga0466965_0317508
3079 Ga0466966_0020014
3080 Ga0466966_0040366
3081 Ga0466966_0262271
3082 Ga0466961_0001959
3083 Ga0466961_0048623
3084 Ga0466961_0237862
3085 Ga0466961_0425221
3086 Ga0466963_0001943
3087 Ga0466963_0003712
3088 Ga0466963_0030304
3089 Ga0466963_0229897
3090 Ga0466963_0280817
3091 Ga0466963_0328288
3092 Ga0466963_0381020
3093 Ga0466963_0722076
3094 Ga0466964_0008287
3095 Ga0466964_0069408
3096 Ga0466964_0141382
3097 Ga0466964_0206258
3098 Ga0466964_0232954
3099 Ga0466971_0036954
3100 Ga0466971_0674651
3101 Ga0466968_0276298
3102 Ga0466968_0404405
3103 Ga0466970_0288062
3104 Ga0466957_0070751
3105 Ga0466957_0071289
3106 Ga0466957_0425722
3107 Ga0466960_0028065
3108 Ga0466960_0133700
3109 Ga0466960_0142471
3110 Ga0466960_0292868
3111 Ga0466960_0423780
3112 Ga0466960_0951788
3113 Ga0466959_0041892
3114 Ga0451576_0619700
3115 Ga0451576_1382027
3116 Ga0466958_0010663
3117 Ga0466958_0020060
3118 Ga0466958_0029162
3119 Ga0466958_0057741
3120 Ga0466958_0303385
3121 Ga0466958_0586667
3122 Ga0466967_0048200
3123 Ga0466967_0057421
3124 Ga0466967_0067626
3125 Ga0466967_0088768
3126 Ga0466967_0140751
3127 Ga0466967_0147375
3128 Ga0466967_0219133
3129 Ga0466967_0331894
3130 Ga0466967_0350144
3131 Ga0466967_0472538
3132 Ga0466967_0685596
3133 Ga0466967_1022804
3134 Ga0466967_1231651
3135 Ga0466967_1567611
3136 Ga0466967_1998216
3137 Ga0495627_183681
3138 Ga0495592_0124239
3139 Ga0495592_0338318
3140 Ga0495592_0551373
3141 Ga0495603_0016929
3142 Ga0495603_0024832
3143 Ga0495603_0031659
3144 Ga0495603_0109821
3145 Ga0495603_0153831
3146 Ga0495603_0272775
3147 Ga0495603_0859238
3148 Ga0495591_074442
3149 Ga0495629_0018401
3150 Ga0495629_0021356
3151 Ga0495629_0051575
3152 Ga0495629_0117540
3153 Ga0495629_0128519
3154 Ga0495629_0162190
3155 Ga0495629_0180342
3156 Ga0495629_0239086
3157 Ga0495641_0022352
3158 Ga0495641_0105834
3159 Ga0495641_0135112
3160 Ga0495641_0139027
3161 Ga0495651_0033546
3162 Ga0495651_0161083
3163 Ga0495651_0260480
3164 Ga0495651_0280540
3165 Ga0495653_0002135
3166 Ga0495653_0048424
3167 Ga0495653_0060322
3168 Ga0495653_0297898
3169 Ga0495653_0352827
3170 Ga0495580_0382500
3171 Ga0495580_0435600
3172 Ga0495582_0009920
3173 Ga0495582_0019313
3174 Ga0495582_0043094
3175 Ga0495582_0270330
3176 Ga0495582_0477323
3177 Ga0495582_0569907
3178 Ga0495582_0908820
3179 Ga0495605_0019864
3180 Ga0495605_0123957
3181 Ga0495605_0297710
3182 Ga0495639_0022510
3183 Ga0495639_0189944
3184 Ga0495639_0253705
3185 Ga0495662_0171984
3186 Ga0495584_0085645
3187 Ga0495584_0138004
3188 Ga0495584_0376732
3189 Ga0495584_0509945
3190 Ga0495585_0261894
3191 Ga0495594_0042427
3192 Ga0495594_0088064
3193 Ga0495594_0265545
3194 Ga0495594_0344430
3195 Ga0495594_0434930
3196 Ga0495594_0846771
3197 Ga0495596_0338128
3198 Ga0495607_0142132
3199 Ga0495607_0176188
3200 Ga0495607_0256639
3201 Ga0495608_0003222
3202 Ga0495608_0012504
3203 Ga0495608_0027502
3204 Ga0495608_0354443
3205 Ga0495618_0053359
3206 Ga0495618_0617144
3207 Ga0495618_0735679
3208 Ga0495620_0079227
3209 Ga0495628_0029204
3210 Ga0495628_0242493
3211 Ga0495628_0288182
3212 Ga0495630_0005488
3213 Ga0495630_0012217
3214 Ga0495630_0014654
3215 Ga0495630_0049662
3216 Ga0495630_0300427
3217 Ga0495630_0377004
3218 Ga0495630_0664051
3219 Ga0495630_0763889
3220 Ga0495630_0895376
3221 Ga0495631_0074822
3222 Ga0495631_0128341
3223 Ga0495644_0041791
3224 Ga0495644_0150987
3225 Ga0495644_0216083
3226 Ga0495644_0348068
3227 Ga0495663_0060997
3228 Ga0495666_0004926
3229 Ga0495666_0114106
3230 Ga0495642_0215819
3231 Ga0495652_0056986
3232 Ga0495652_0186191
3233 Ga0495652_0359291
3234 Ga0495652_0486924
3235 Ga0495654_0155520
3236 Ga0495665_0003066
3237 Ga0495640_0005710
3238 Ga0495640_0059272
3239 Ga0495640_0203888
3240 Ga0495640_0268404
3241 Ga0495586_0010275
3242 Ga0495586_0237032
3243 Ga0495586_0418289
3244 Ga0495587_0018904
3245 Ga0495587_0276083
3246 Ga0495587_0458999
3247 Ga0495598_0217895
3248 Ga0495598_0248517
3249 Ga0495609_0058397
3250 Ga0495609_0160602
3251 Ga0495609_0278146
3252 Ga0495597_0044856
3253 Ga0495645_0075828
3254 Ga0495645_0247901
3255 Ga0495667_0002394
3256 Ga0495667_0011408
3257 Ga0495667_0059259
3258 Ga0495667_0384780
3259 Ga0495667_0824746
3260 Ga0495656_0034484
3261 Ga0495656_0205769
3262 Ga0495656_0219373
3263 Ga0495668_0095384
3264 Ga0495634_0007684
3265 Ga0495634_0090980
3266 Ga0495634_0094676
3267 Ga0495611_0117080
3268 Ga0495611_0423962
3269 Ga0495611_0572891
3270 Ga0495635_0032552
3271 Ga0495635_0097529
3272 Ga0495635_0143744
3273 Ga0495635_0146998
3274 Ga0495659_0049277
3275 Ga0495659_0085016
3276 Ga0495659_0089558
3277 Ga0495661_0369150
3278 Ga0495588_0011592
3279 Ga0495588_0124819
3280 Ga0495588_0217559
3281 Ga0495657_0002882
3282 Ga0495657_0007489
3283 Ga0495657_0031304
3284 Ga0495657_0073721
3285 Ga0495657_0757048
3286 Ga0495599_0181842
3287 Ga0495599_0266371
3288 Ga0495623_0104581
3289 Ga0495646_0039461
3290 Ga0495646_0225331
3291 Ga0495647_0001687
3292 Ga0495647_0016729
3293 Ga0495647_0022639
3294 Ga0495647_0025191
3295 Ga0495647_0456477
3296 Ga0495658_0003974
3297 Ga0495658_0008700
3298 Ga0495658_0009164
3299 Ga0495658_0168164
3300 Ga0495658_0276223
3301 Ga0495658_0393755
3302 Ga0495669_0436511
3303 Ga0495613_0007500
3304 Ga0495613_0007806
3305 Ga0495613_0058553
3306 Ga0495613_0166399
3307 Ga0495613_0186013
3308 Ga0495624_0017436
3309 Ga0495624_0025162
3310 Ga0495624_0106819
3311 Ga0495624_0116989
3312 Ga0495670_0380383
3313 Ga0495670_0406413
3314 Ga0495670_0512406
3315 Ga0495671_0033411
3316 Ga0495671_0263162
3317 Ga0495671_0577595
3318 Ga0495589_0024325
3319 Ga0495589_0050674
3320 Ga0495589_0157621
3321 Ga0495600_0002865
3322 Ga0495600_0048618
3323 Ga0495600_0068544
3324 Ga0495581_0001208
3325 Ga0495581_0005647
3326 Ga0495581_0006900
3327 Ga0495581_0262662
3328 Ga0495604_0038158
3329 Ga0495604_0052135
3330 Ga0495604_0212373
3331 Ga0495636_0096962
3332 Ga0495674_0024852
3333 Ga0495674_0036549
3334 Ga0495674_0046908
3335 Ga0495674_0399363
3336 Ga0495674_0764728
3337 Ga0495676_0009426
3338 Ga0495676_0011656
3339 Ga0495676_0069159
3340 Ga0495676_0127580
3341 Ga0495676_0618182
3342 Ga0495680_0003404
3343 Ga0495680_0009714
3344 Ga0495680_0015569
3345 Ga0495680_0070806
3346 Ga0495680_0246039
3347 Ga0495680_0436988
3348 Ga0495675_0024154
3349 Ga0495675_0059777
3350 Ga0495675_0547578
3351 Ga0495675_0610601
3352 Ga0495677_0131550
3353 Ga0495677_0390650
3354 Ga0495685_103038
3355 Ga0495685_127005
3356 Ga0495684_0007256
3357 Ga0495684_0043180
3358 Ga0495684_0063068
3359 Ga0495684_0604102
3360 Ga0495593_0005150
3361 Ga0495593_0089388
3362 Ga0495593_0254040
3363 Ga0495602_0094214
3364 Ga0495602_0293140
3365 Ga0495602_0425490
3366 Ga0495614_0004846
3367 Ga0495614_0323171
3368 Ga0495615_0040354
3369 Ga0495626_0184609
3370 Ga0496100_0005825
3371 Ga0496100_0044008
3372 Ga0496100_0055157
3373 Ga0496100_0070479
3374 Ga0496100_0095799
3375 Ga0496100_0114441
3376 Ga0496100_0146099
3377 Ga0496100_0152529
3378 Ga0496100_0238489
3379 Ga0496100_0360325
3380 Ga0496100_0548094
3381 Ga0496100_1498511
3382 Ga0496101_0002047
3383 Ga0496101_0004093
3384 Ga0496101_0010090
3385 Ga0496101_0013413
3386 Ga0496101_0067940
3387 Ga0496101_0075113
3388 Ga0496101_0080595
3389 Ga0496101_0118210
3390 Ga0496101_0270776
3391 Ga0496101_0293273
3392 Ga0496101_0523755
3393 Ga0496102_0011058
3394 Ga0496102_0014471
3395 Ga0496102_0058806
3396 Ga0496102_0060968
3397 Ga0496102_0065835
3398 Ga0496102_0074067
3399 Ga0496102_0082052
3400 Ga0496102_0116052
3401 Ga0496102_0116403
3402 Ga0496102_0273788
3403 Ga0496102_0903700
3404 Ga0496102_1146694
3405 Ga0496102_1765814
3406 Ga0496103_0010922
3407 Ga0496103_0044183
3408 Ga0496103_0086026
3409 Ga0496103_0101894
3410 Ga0496103_0115648
3411 Ga0496103_0144295
3412 Ga0496103_0158013
3413 Ga0496103_0257248
3414 Ga0496103_0739397
3415 Ga0496103_0771140
3416 Ga0496103_0943953
3417 Ga0496104_0007356
3418 Ga0496104_0012742
3419 Ga0496104_0015042
3420 Ga0496104_0035843
3421 Ga0496104_0076396
3422 Ga0496104_0081221
3423 Ga0496104_0157485
3424 Ga0496104_0185026
3425 Ga0496104_0322304
3426 Ga0496104_1390039
3427 Ga0496105_0012484
3428 Ga0496105_0044992
3429 Ga0496105_0053215
3430 Ga0496105_0062233
3431 Ga0496105_0115849
3432 Ga0496105_0195554
3433 Ga0496105_0233677
3434 Ga0496105_0272561
3435 Ga0496105_0362525
3436 Ga0496105_1003945
3437 Ga0496106_0000799
3438 Ga0496106_0001574
3439 Ga0496106_0003932
3440 Ga0496106_0005483
3441 Ga0496106_0014611
3442 Ga0496106_0039427
3443 Ga0496106_0086489
3444 Ga0496106_0246025
3445 Ga0496106_1257328
3446 Ga0496107_0000717
3447 Ga0496107_0002487
3448 Ga0496107_0009850
3449 Ga0496107_0016756
3450 Ga0496107_0022269
3451 Ga0496107_0055259
3452 Ga0496107_0056046
3453 Ga0496107_0167644
3454 Ga0496107_0198951
3455 Ga0496107_0212749
3456 Ga0496107_0219423
3457 Ga0496107_0705900
3458 Ga0496107_1003046
3459 Ga0496108_0000945
3460 Ga0496108_0012922
3461 Ga0496108_0014614
3462 Ga0496108_0025821
3463 Ga0496108_0030570
3464 Ga0496108_0034296
3465 Ga0496108_0071680
3466 Ga0496108_0100462
3467 Ga0496108_0145074
3468 Ga0496108_0594933
3469 Ga0496109_0000523
3470 Ga0496109_0006830
3471 Ga0496109_0012241
3472 Ga0496109_0014408
3473 Ga0496109_0015382
3474 Ga0496109_0026179
3475 Ga0496109_0043976
3476 Ga0496109_0088670
3477 Ga0496109_0218266
3478 Ga0496109_0232548
3479 Ga0496109_0325372
3480 Ga0496109_0388445
3481 Ga0496109_0426592
3482 Ga0496109_0456860
3483 Ga0496109_0639746
3484 Ga0496109_0709463
3485 Ga0496109_0801705
3486 Ga0496109_0803665
3487 Ga0496109_2004898
3488 Ga0496110_0000677
3489 Ga0496110_0016904
3490 Ga0496110_0021495
3491 Ga0496110_0032996
3492 Ga0496110_0033108
3493 Ga0496110_0050369
3494 Ga0496110_0369734
3495 Ga0496110_0462470
3496 Ga0496110_0464627
3497 Ga0496110_0627743
3498 Ga0496110_1526395
3499 Ga0496111_0000744
3500 Ga0496111_0002134
3501 Ga0496111_0011040
3502 Ga0496111_0020928
3503 Ga0496111_0025941
3504 Ga0496111_0132001
3505 Ga0496111_0275370
3506 Ga0496111_0361661
3507 Ga0496111_0721237
3508 Ga0496111_1295513
3509 Ga0496112_0000731
3510 Ga0496112_0000874
3511 Ga0496112_0003094
3512 Ga0496112_0013633
3513 Ga0496112_0016012
3514 Ga0496112_0016153
3515 Ga0496112_0053250
3516 Ga0496112_0104965
3517 Ga0496112_0120058
3518 Ga0496112_0131346
3519 Ga0496112_0139713
3520 Ga0496112_0217817
3521 Ga0496112_0270877
3522 Ga0496112_0279855
3523 Ga0496112_0297273
3524 Ga0496112_0419821
3525 Ga0496112_0615909
3526 Ga0496112_0770533
3527 Ga0496112_1745868
3528 Ga0496113_0001429
3529 Ga0496113_0004935
3530 Ga0496113_0032226
3531 Ga0496113_0035909
3532 Ga0496113_0231319
3533 Ga0496113_0240006
3534 Ga0496113_0286729
3535 Ga0496113_0321052
3536 Ga0496113_0457475
3537 Ga0496113_1311430
3538 Ga0496114_0006868
3539 Ga0496114_0009546
3540 Ga0496114_0024509
3541 Ga0496114_0038353
3542 Ga0496114_0042427
3543 Ga0496114_0052098
3544 Ga0496114_0052891
3545 Ga0496114_0075653
3546 Ga0496114_0125355
3547 Ga0496114_0129105
3548 Ga0496114_0174815
3549 Ga0496114_0525986
3550 Ga0496114_0751861
3551 Ga0496114_1368815
3552 Ga0496114_1410462
3553 Ga0496114_1477079
3554 Ga0496115_0001511
3555 Ga0496115_0006793
3556 Ga0496115_0017491
3557 Ga0496115_0042367
3558 Ga0496115_0046460
3559 Ga0496115_0199687
3560 Ga0496115_0244740
3561 Ga0496115_0293773
3562 Ga0496115_0439264
3563 Ga0496115_0718252
3564 Ga0496115_1040568
3565 Ga0501291_068187
3566 Ga0501031_0000565
3567 Ga0501031_0001953
3568 Ga0501031_0017346
3569 Ga0501031_0052355
3570 Ga0501031_0151776
3571 Ga0501032_0000274
3572 Ga0501032_0036219
3573 Ga0501032_0395513
3574 Ga0501032_0586813
3575 Ga0501033_0000920
3576 Ga0501033_0001164
3577 Ga0501033_0192595
3578 Ga0501033_0244051
3579 Ga0501033_0257882
3580 Ga0501033_0861923
3581 Ga0501034_0041370
3582 Ga0501034_0044193
3583 Ga0501034_0227380
3584 Ga0501034_0812600
3585 Ga0501036_0000971
3586 Ga0501036_0007285
3587 Ga0501036_0053329
3588 Ga0501036_0069247
3589 Ga0501036_0078909
3590 Ga0501036_0230126
3591 Ga0501036_0275511
3592 Ga0501036_0529856
3593 Ga0501036_0539429
3594 Ga0501037_0000519
3595 Ga0501037_0029289
3596 Ga0501037_0074126
3597 Ga0501037_0459491
3598 Ga0501038_0000186
3599 Ga0501038_0019415
3600 Ga0501038_0052782
3601 Ga0501038_0068760
3602 Ga0501038_0279708
3603 Ga0501038_0492587
3604 Ga0501038_0821105
3605 Ga0501039_0003315
3606 Ga0501039_0005307
3607 Ga0501039_0024937
3608 Ga0501039_0038293
3609 Ga0501039_0252240
3610 Ga0501039_0428077
3611 Ga0501039_0735603
3612 Ga0501039_0775047
3613 Ga0501040_0000605
3614 Ga0501040_0011880
3615 Ga0501040_0019519
3616 Ga0501040_0051514
3617 Ga0501040_0066560
3618 Ga0501040_0081299
3619 Ga0501040_0139950
3620 Ga0501040_0177177
3621 Ga0501040_0288204
3622 Ga0501040_1324146
3623 Ga0501041_0000039
3624 Ga0501041_0001797
3625 Ga0501041_0002733
3626 Ga0501041_0009157
3627 Ga0501041_0012510
3628 Ga0501041_0066158
3629 Ga0501041_0119918
3630 Ga0501041_0128225
3631 Ga0501041_0403313
3632 Ga0501042_0001026
3633 Ga0501042_0019739
3634 Ga0501042_0020182
3635 Ga0501042_0026783
3636 Ga0501042_0032814
3637 Ga0501042_0068932
3638 Ga0501042_0076262
3639 Ga0501042_0108302
3640 Ga0501042_0153166
3641 Ga0501042_0164250
3642 Ga0501042_0200642
3643 Ga0501043_0000171
3644 Ga0501043_0005336
3645 Ga0501043_0246023
3646 Ga0501043_0426922
3647 Ga0501046_0000177
3648 Ga0501046_0002858
3649 Ga0501046_0024694
3650 Ga0501046_0039756
3651 Ga0501046_0057220
3652 Ga0501046_0198614
3653 Ga0501046_0213206
3654 Ga0501046_0250786
3655 Ga0501046_0285826
3656 Ga0501046_0421445
3657 Ga0501046_0507227
3658 Ga0501047_0164513
3659 Ga0501047_0379778
3660 Ga0501048_0004102
3661 Ga0501048_0005297
3662 Ga0501048_0067803
3663 Ga0501048_0119440
3664 Ga0501048_0634680
3665 Ga0501048_0705697
3666 Ga0501048_0927255
3667 Ga0501067_0045266
3668 Ga0501067_0130184
3669 Ga0501067_0152171
3670 Ga0501067_0548967
3671 Ga0501068_0000051
3672 Ga0501068_0001051
3673 Ga0501068_0007526
3674 Ga0501068_0166715
3675 Ga0501068_0193277
3676 Ga0501068_0248247
3677 Ga0501068_0748922
3678 Ga0501069_0001394
3679 Ga0501069_0003701
3680 Ga0501069_0010111
3681 Ga0501069_0066832
3682 Ga0501069_0116106
3683 Ga0501069_0237298
3684 Ga0501070_0002425
3685 Ga0501070_0007771
3686 Ga0501070_0028281
3687 Ga0501070_0507554
3688 Ga0501070_1295500
3689 Ga0501070_1438307
3690 Ga0501071_0000031
3691 Ga0501071_0011778
3692 Ga0501071_0016912
3693 Ga0501071_0040070
3694 Ga0501071_0044164
3695 Ga0501071_0046669
3696 Ga0501071_0233080
3697 Ga0501071_0540740
3698 Ga0501072_0002062
3699 Ga0501072_0003142
3700 Ga0501072_0006063
3701 Ga0501072_0022648
3702 Ga0501072_0032316
3703 Ga0501072_0129148
3704 Ga0501072_0141023
3705 Ga0501072_0296827
3706 Ga0501072_0383346
3707 Ga0501072_0496581
3708 Ga0501072_0523333
3709 Ga0501072_0712948
3710 Ga0501073_0017065
3711 Ga0501073_0029774
3712 Ga0501073_0104857
3713 Ga0501073_0572017
3714 Ga0501073_0985562
3715 Ga0501074_0003677
3716 Ga0501074_0006826
3717 Ga0501074_0014877
3718 Ga0501074_0018032
3719 Ga0501074_0063362
3720 Ga0501074_0133683
3721 Ga0501074_0141311
3722 Ga0501074_0215252
3723 Ga0501074_0522739
3724 Ga0501074_0678683
3725 Ga0501074_0788415
3726 Ga0501075_0000266
3727 Ga0501075_0001528
3728 Ga0501075_0010268
3729 Ga0501075_0015269
3730 Ga0501075_0076897
3731 Ga0501075_0091392
3732 Ga0501075_0103867
3733 Ga0501075_0122465
3734 Ga0501075_0205297
3735 Ga0501075_0842279
3736 Ga0501075_0897915
3737 Ga0501076_0000634
3738 Ga0501076_0008497
3739 Ga0501076_0012482
3740 Ga0501076_0051824
3741 Ga0501076_0090401
3742 Ga0501076_0113434
3743 Ga0501076_0221187
3744 Ga0501076_0221619
3745 Ga0501076_0255931
3746 Ga0501076_0333464
3747 Ga0501077_0000257
3748 Ga0501077_0003870
3749 Ga0501077_0024781
3750 Ga0501077_0030419
3751 Ga0501077_0041091
3752 Ga0501077_0047937
3753 Ga0501077_0072653
3754 Ga0501077_0291939
3755 Ga0501077_0675403
3756 Ga0501217_259182
3757 Ga0501221_145150
3758 Ga0501079_0000749
3759 Ga0501079_0004333
3760 Ga0501079_0013423
3761 Ga0501079_0020216
3762 Ga0501079_0023311
3763 Ga0501079_0033233
3764 Ga0501079_0069689
3765 Ga0501079_0139619
3766 Ga0501079_0148633
3767 Ga0501079_0154692
3768 Ga0501079_0329771
3769 Ga0501080_0000105
3770 Ga0501080_0058000
3771 Ga0501080_0063349
3772 Ga0501080_0096107
3773 Ga0501080_0246710
3774 Ga0501080_0319669
3775 Ga0501080_0354833
3776 Ga0501080_0857991
3777 Ga0501081_0000948
3778 Ga0501081_0001230
3779 Ga0501081_0030364
3780 Ga0501081_0034935
3781 Ga0501081_0072719
3782 Ga0501081_0082141
3783 Ga0501081_0170955
3784 Ga0501081_0202073
3785 Ga0501081_0228180
3786 Ga0501081_0451972
3787 Ga0501081_0791443
3788 Ga0501081_1464363
3789 Ga0501083_0000561
3790 Ga0501083_0000664
3791 Ga0501083_0002572
3792 Ga0501083_0069303
3793 Ga0501083_0109143
3794 Ga0501083_0260090
3795 Ga0501083_0378059
3796 Ga0501083_0452819
3797 Ga0501266_106026
3798 Ga0501035_0000457
3799 Ga0501035_0001358
3800 Ga0501035_0043355
3801 Ga0501035_0173630
3802 Ga0501035_0653357
3803 Ga0501044_0002523
3804 Ga0501044_0003404
3805 Ga0501044_0005188
3806 Ga0501044_0236964
3807 Ga0501044_0579351
3808 Ga0501045_0005910
3809 Ga0501045_0010848
3810 Ga0501045_0022556
3811 Ga0501045_0023433
3812 Ga0501045_0033134
3813 Ga0501045_0068603
3814 Ga0501045_0084164
3815 Ga0501045_0094985
3816 Ga0501045_0113240
3817 Ga0501045_0328296
3818 Ga0501212_119299
3819 nmdc:mga03683_174005_c1
3820 nmdc:mga0yw44_107220_c1
3821 nmdc:mga0yw44_186393_c1
3822 nmdc:mga0yw44_392421_c1
3823 nmdc:mga06z11_659728_c1
3824 nmdc:mga05p37_107758_c1
3825 nmdc:mga05p37_16133_c1
3826 nmdc:mga05p37_241126_c1
3827 nmdc:mga05p37_28617_c1
3828 nmdc:mga05p37_433233_c1
3829 nmdc:mga05p37_612894_c1
3830 nmdc:mga05p37_630460_c1
3831 nmdc:mga05p37_66600_c1
3832 nmdc:mga05p37_8862_c1
3833 nmdc:mga09592_2440_c1
3834 nmdc:mga09592_303312_c1
3835 nmdc:mga0qj67_41930_c1
3836 nmdc:mga0qj67_990670_c1
3837 nmdc:mga06r32_162353_c1
3838 nmdc:mga06r32_198785_c1
3839 nmdc:mga06r32_42674_c1
3840 nmdc:mga06r32_438180_c1
3841 nmdc:mga06r32_832643_c1
3842 nmdc:mga08y16_1040221_c1
3843 nmdc:mga08y16_1085803_c1
3844 nmdc:mga08y16_13727_c1
3845 nmdc:mga08y16_156192_c1
3846 nmdc:mga08y16_479770_c1
3847 nmdc:mga08y16_536081_c1
3848 nmdc:mga08y16_6212_c1
3849 nmdc:mga08y16_993441_c1
3850 nmdc:mga0n895_113403_c1
3851 nmdc:mga0n895_1302308_c1
3852 nmdc:mga0n895_1403304_c1
3853 nmdc:mga0n895_22447_c1
3854 nmdc:mga0n895_29349_c1
3855 nmdc:mga0n895_347339_c1
3856 nmdc:mga0n895_66163_c1
3857 nmdc:mga0rr50_160820_c1
3858 nmdc:mga0rr50_33179_c1
3859 nmdc:mga0rr50_463041_c1
3860 nmdc:mga0rr50_794457_c1
3861 nmdc:mga0rr50_8771_c1
3862 nmdc:mga0rr50_99874_c1
3863 nmdc:mga08x19_1096607_c1
3864 nmdc:mga08x19_11008_c1
3865 nmdc:mga08x19_1187803_c1
3866 nmdc:mga08x19_13424_c1
3867 nmdc:mga08x19_276154_c1
3868 nmdc:mga08x19_39379_c1
3869 nmdc:mga0a205_17439_c1
3870 nmdc:mga0a205_28604_c1
3871 nmdc:mga0a205_362748_c1
3872 nmdc:mga0a205_55847_c1
3873 nmdc:mga0a205_8214_c1
3874 Ga0495601_0014931
3875 Ga0495601_0077742
3876 Ga0495601_0265709
3877 Ga0495601_0715447
3878 Ga0495612_0183669
3879 Ga0495612_0348455
3880 Ga0495655_0085213
3881 Ga0495595_0008508
3882 Ga0495595_0030703
3883 Ga0495595_0229203
3884 Ga0495595_0586744
3885 Ga0495619_0062721
3886 Ga0495619_0096784
3887 Ga0495619_0178203
3888 Ga0495619_0305120
3889 Ga0495619_0307392
3890 Ga0495619_0474897
3891 Ga0495619_0615600
3892 Ga0495619_0971048
3893 Ga0495619_1148905
3894 Ga0501084_0000995
3895 Ga0501084_0001035
3896 Ga0501084_0001602
3897 Ga0501084_0025040
3898 Ga0501084_0041168
3899 Ga0501084_0052144
3900 Ga0501084_0110502
3901 Ga0501084_0127115
3902 Ga0501084_0132507
3903 Ga0501084_0274282
3904 Ga0501084_0485282
3905 Ga0501084_0493358
3906 Ga0501084_0710508
3907 Ga0590077_016865
3908 Ga0501082_0001285
3909 Ga0501082_0002542
3910 Ga0501082_0027473
3911 Ga0501082_0091413
3912 Ga0501082_0098581
3913 Ga0501082_0119943
3914 Ga0501082_0279395
3915 Ga0501082_0323530
3916 Ga0501082_0713924
3917 Ga0501082_0755670
3918 Ga0501082_0814845
3919 Ga0466962_0033068
3920 Ga0466962_0165682
3921 Ga0466962_0273557
3922 Ga0466962_0406569
3923 Ga0530510_0000483
3924 Ga0530510_0003271
3925 Ga0530510_0008413
3926 Ga0530510_0042169
3927 Ga0530510_0050183
3928 Ga0530510_0130411
3929 Ga0530510_0219486
3930 Ga0530510_1241338

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01648

ACPS

4'-phosphopantetheinyl transferase superfamily

24

138

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2was-assembly2.cif.gz_E structure of the fungal type i fas ppt domain 0.9559 1 120
2was-assembly2.cif.gz_F structure of the fungal type i fas ppt domain 0.9528 3 120
2was-assembly2.cif.gz_D structure of the fungal type i fas ppt domain 0.9483 1 119
2was-assembly2.cif.gz_E structure of the fungal type i fas ppt domain 0.9472 1 120
2was-assembly2.cif.gz_D structure of the fungal type i fas ppt domain 0.9397 1 119
ID Description Score Start End Superfamily
2wasC00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9376 3 120 3.90.470.20
2wasC00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9212 3 120 3.90.470.20
5xuhB00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9055 2 120 3.90.470.20
4jm7A01 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.881 2 120 3.90.470.20
5cmoC00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.8809 2 120 3.90.470.20
ID Description Score Start End GO Terms
AF-A0A7V9CS80-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9959 2 120 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A538HY81-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9847 6 120 GO:0000287
GO:0005737
GO:0006633
GO:0008897
GO:0016791
AF-A0A7W1N7E0-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9826 2 118 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A6J6Q453-F1-model_v4 Unannotated protein 0.9822 2 118 GO:0000287
GO:0006633
GO:0008897
AF-A0A7V8XE16-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9766 2 122 GO:0000287
GO:0005737
GO:0006633
GO:0008897

Map