F496145

General Info

Members Datasets Scaffolds Average Seq Length
1958 472 3916 81

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100144441|Ga0070683_1001444413
Length 87
Sequence MIDPRIDELLSHTPTDGGPASRYALVIVSAKRARQINNYHHQLGEGMGLEDAPPPLVESRSKNYLTMAMEEIAHGKLTFSYGAPQAQ

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
6 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
15 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
16 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
17 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
46 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
51 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
62 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
63 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
64 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
94 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
95 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
96 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
97 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
98 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
99 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
100 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
101 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
102 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
103 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
104 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
105 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
106 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
107 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
108 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
110 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
111 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
112 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
113 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
114 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
115 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
116 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
117 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
118 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
121 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
122 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
123 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
124 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
127 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
130 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
136 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
137 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
138 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
139 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
140 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
141 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
142 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
143 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
144 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
145 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
146 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
147 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
148 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
149 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
150 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
151 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
152 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
153 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
154 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
155 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
156 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
230 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
234 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
235 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
236 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
237 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
238 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
239 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
240 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
241 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
242 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
243 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
244 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
245 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
246 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
247 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
248 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
249 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
250 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
251 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
252 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
253 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
254 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
255 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
256 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
257 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
258 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
259 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
260 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
261 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
262 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
263 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
264 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
265 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
266 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
267 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
269 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
270 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
271 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
272 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
273 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
274 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
275 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
276 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
277 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
278 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
279 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
280 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
281 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
282 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
283 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
284 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
285 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
286 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
287 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
288 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
289 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
290 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
291 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
292 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
293 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
294 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
295 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
296 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
297 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
298 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
299 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
300 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
301 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
302 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
303 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
304 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
305 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
306 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
307 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
308 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
309 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
310 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
311 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
312 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
313 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
314 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
315 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
316 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
317 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
318 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
319 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
320 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
321 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
322 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
323 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
324 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
325 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
326 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
327 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
328 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
329 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
330 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
331 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
332 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
333 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
334 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
335 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
336 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
337 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
338 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
339 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
340 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
341 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
342 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
343 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
344 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
345 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
346 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
347 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
348 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
349 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
350 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
351 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
352 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
353 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
354 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
355 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
356 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
357 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
358 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
359 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
360 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
361 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
362 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
363 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
364 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
365 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
366 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
367 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
368 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
369 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
370 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
371 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
372 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
373 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
374 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
375 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
376 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
377 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
378 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
379 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
380 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
381 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
382 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
383 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
384 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
385 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
386 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
387 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
388 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
389 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
390 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
391 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
392 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
393 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
394 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
395 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
396 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
397 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
398 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
399 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
400 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
401 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
402 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
403 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
405 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
419 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
420 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
421 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
422 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
423 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
424 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
425 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
426 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
427 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
428 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
429 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
430 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
431 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
432 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
433 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
434 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
435 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
436 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
439 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
440 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
441 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
442 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
443 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
444 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
445 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
446 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
447 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
448 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
449 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
450 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
451 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
452 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
453 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
454 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
455 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
456 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
457 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
458 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
459 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
460 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
461 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
472 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.43
Nodule 0
Rhizoplane 6.79
Rhizosphere 91.37
Stem 0
Stem Tuber 0
Unclassified 9.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100144441 3300005329 Bacteria 2254
2 ARcpr5oldR_c002177 3300000041 Bacteria 1845
3 ARcpr5yngRDRAFT_c003093 3300000043 Bacteria 1670
4 ARSoilOldRDRAFT_c029933 3300000044 Unclassified 501
5 ARCol0yngRDRAFT_1012314 3300000652 Unclassified 633
6 JGI24746J21847_1033644 3300001977 Bacteria 708
7 JGI24739J22299_10029318 3300001989 Unclassified 1915
8 JGI24737J22298_10203090 3300001990 Bacteria 585
9 JGI24743J22301_10011312 3300001991 Bacteria 1606
10 JGI24750J21931_1080031 3300002070 Bacteria 542
11 JGI24748J21848_1037401 3300002074 Bacteria 612
12 JGI24738J21930_10026763 3300002075 Bacteria 1183
13 JGI24744J21845_10010582 3300002077 Bacteria 1890
14 JGI24744J21845_10042346 3300002077 Bacteria 850
15 JGI24033J26618_1025498 3300002155 Bacteria 776
16 JGI24742J22300_10052558 3300002244 Bacteria 740
17 JGI24742J22300_10115031 3300002244 Bacteria 528
18 JGI24742J22300_10120749 3300002244 Bacteria 517
19 JGI24751J29686_10012957 3300002459 Bacteria 1722
20 JGI24751J29686_10105521 3300002459 Unclassified 589
21 JGI25406J46586_10007814 3300003203 Bacteria 4865
22 Ga0058859_11466280 3300004798 Bacteria 525
23 Ga0065712_10321828 3300005290 Bacteria 827
24 Ga0070658_10034020 3300005327 Bacteria 4101
25 Ga0070658_10223620 3300005327 Unclassified 1593
26 Ga0070676_10295817 3300005328 Bacteria 1096
27 Ga0070676_10802745 3300005328 Bacteria 694
28 Ga0070676_11240665 3300005328 Bacteria 568
29 Ga0070683_100030559 3300005329 Bacteria 4892
30 Ga0070683_100093597 3300005329 Bacteria 2823
31 Ga0070683_100107520 3300005329 Unclassified 2630
32 Ga0070683_100628841 3300005329 Bacteria 1028
33 Ga0070683_101219148 3300005329 Bacteria 723
34 Ga0070683_101915058 3300005329 Bacteria 570
35 Ga0070690_100088437 3300005330 Bacteria 2036
36 Ga0070690_100189897 3300005330 Bacteria 1424
37 Ga0070690_100440579 3300005330 Bacteria 964
38 Ga0070670_100035122 3300005331 Bacteria 4315
39 Ga0070670_100090955 3300005331 Bacteria 2623
40 Ga0070670_101571225 3300005331 Bacteria 604
41 Ga0070677_10181722 3300005333 Bacteria 1002
42 Ga0070677_10479080 3300005333 Unclassified 671
43 Ga0068869_100095555 3300005334 Bacteria 2242
44 Ga0068869_100242077 3300005334 Bacteria 1438
45 Ga0068869_100910443 3300005334 Bacteria 761
46 Ga0068869_101499566 3300005334 Unclassified 599
47 Ga0070666_10187625 3300005335 Bacteria 1452
48 Ga0070666_10254454 3300005335 Bacteria 1244
49 Ga0070666_10351510 3300005335 Bacteria 1055
50 Ga0070666_10757817 3300005335 Bacteria 714
51 Ga0070680_100094191 3300005336 Bacteria 2482
52 Ga0070680_100280581 3300005336 Bacteria 1411
53 Ga0070682_100021835 3300005337 Bacteria 3783
54 Ga0070682_100145702 3300005337 Bacteria 1619
55 Ga0070682_100146983 3300005337 Bacteria 1613
56 Ga0070682_100222468 3300005337 Bacteria 1344
57 Ga0070682_101494996 3300005337 Bacteria 581
58 Ga0070682_101703143 3300005337 Unclassified 548
59 Ga0068868_100004645 3300005338 Bacteria 9641
60 Ga0068868_100036276 3300005338 Bacteria 3815
61 Ga0068868_100036558 3300005338 Bacteria 3802
62 Ga0068868_100107743 3300005338 Bacteria 2261
63 Ga0068868_100306229 3300005338 Bacteria 1351
64 Ga0068868_100411464 3300005338 Bacteria 1169
65 Ga0068868_100505075 3300005338 Unclassified 1060
66 Ga0068868_100583503 3300005338 Bacteria 988
67 Ga0068868_101332347 3300005338 Bacteria 668
68 Ga0068868_101506434 3300005338 Bacteria 630
69 Ga0068868_101602335 3300005338 Bacteria 612
70 Ga0070660_100051168 3300005339 Bacteria 3180
71 Ga0070660_100212716 3300005339 Bacteria 1570
72 Ga0070660_100216349 3300005339 Bacteria 1556
73 Ga0070660_100384759 3300005339 Bacteria 1158
74 Ga0070660_101565459 3300005339 Bacteria 561
75 Ga0070660_101639298 3300005339 Bacteria 548
76 Ga0070660_101717161 3300005339 Unclassified 535
77 Ga0070689_100075585 3300005340 Bacteria 2637
78 Ga0070689_100392350 3300005340 Bacteria 1172
79 Ga0070689_100474709 3300005340 Bacteria 1067
80 Ga0070691_10000781 3300005341 Bacteria 12645
81 Ga0070691_10050107 3300005341 Bacteria 1992
82 Ga0070687_100035058 3300005343 Bacteria 2488
83 Ga0070687_100050997 3300005343 Bacteria 2140
84 Ga0070687_100057945 3300005343 Bacteria 2033
85 Ga0070687_100231667 3300005343 Viruses 1137
86 Ga0070687_100400774 3300005343 Bacteria 900
87 Ga0070661_100127493 3300005344 Bacteria 1910
88 Ga0070661_100291282 3300005344 Bacteria 1268
89 Ga0070661_100350634 3300005344 Bacteria 1158
90 Ga0070661_100584411 3300005344 Bacteria 902
91 Ga0070661_100615685 3300005344 Bacteria 879
92 Ga0070661_101165736 3300005344 Bacteria 644
93 Ga0070692_10006436 3300005345 Bacteria 5099
94 Ga0070692_10019140 3300005345 Unclassified 3302
95 Ga0070692_10244186 3300005345 Bacteria 1072
96 Ga0070692_10525884 3300005345 Viruses 771
97 Ga0070668_100052043 3300005347 Bacteria 3156
98 Ga0070668_100138126 3300005347 Bacteria 1962
99 Ga0070668_100765461 3300005347 Bacteria 856
100 Ga0070669_100116311 3300005353 Bacteria 2035
101 Ga0070669_100137167 3300005353 Bacteria 1883
102 Ga0070669_101121927 3300005353 Bacteria 678
103 Ga0070669_101461091 3300005353 Bacteria 594
104 Ga0070669_101625241 3300005353 Unclassified 563
105 Ga0070669_101702887 3300005353 Bacteria 550
106 Ga0070675_100059601 3300005354 Bacteria 3149
107 Ga0070675_100086477 3300005354 Unclassified 2620
108 Ga0070675_100114149 3300005354 Bacteria 2289
109 Ga0070675_100355596 3300005354 Bacteria 1300
110 Ga0070675_100369674 3300005354 Bacteria 1275
111 Ga0070671_100132893 3300005355 Unclassified 2096
112 Ga0070671_100276851 3300005355 Bacteria 1427
113 Ga0070671_100377988 3300005355 Bacteria 1210
114 Ga0070674_100012612 3300005356 Bacteria 5195
115 Ga0070674_100017188 3300005356 Bacteria 4545
116 Ga0070674_100018721 3300005356 Bacteria 4385
117 Ga0070674_100068919 3300005356 Bacteria 2494
118 Ga0070674_100108733 3300005356 Bacteria 2032
119 Ga0070674_100171519 3300005356 Bacteria 1654
120 Ga0070674_100331376 3300005356 Bacteria 1223
121 Ga0070674_100383673 3300005356 Bacteria 1144
122 Ga0070674_100539557 3300005356 Bacteria 977
123 Ga0070674_101460090 3300005356 Bacteria 614
124 Ga0070674_101705391 3300005356 Bacteria 570
125 Ga0070673_100051568 3300005364 Bacteria 3223
126 Ga0070673_100628174 3300005364 Unclassified 982
127 Ga0070673_100703896 3300005364 Bacteria 928
128 Ga0070673_101095620 3300005364 Bacteria 744
129 Ga0070673_101784467 3300005364 Bacteria 583
130 Ga0070673_102046588 3300005364 Bacteria 544
131 Ga0070688_100008188 3300005365 Bacteria 5664
132 Ga0070688_100034129 3300005365 Bacteria 3079
133 Ga0070688_100500419 3300005365 Bacteria 916
134 Ga0070688_100951268 3300005365 Unclassified 680
135 Ga0070688_101644248 3300005365 Bacteria 525
136 Ga0070659_100039369 3300005366 Bacteria 3690
137 Ga0070659_100063946 3300005366 Bacteria 2911
138 Ga0070659_100597798 3300005366 Bacteria 948
139 Ga0070659_100953356 3300005366 Bacteria 752
140 Ga0070659_101014896 3300005366 Unclassified 729
141 Ga0070659_101801151 3300005366 Bacteria 548
142 Ga0070667_100753352 3300005367 Bacteria 903
143 Ga0070667_100957960 3300005367 Bacteria 798
144 Ga0070703_10016151 3300005406 Bacteria 2141
145 Ga0070703_10036500 3300005406 Bacteria 1510
146 Ga0070703_10156817 3300005406 Unclassified 860
147 Ga0070709_10067280 3300005434 Bacteria 2300
148 Ga0070713_100278927 3300005436 Bacteria 1533
149 Ga0070713_102195319 3300005436 Bacteria 535
150 Ga0070710_10009995 3300005437 Bacteria 4651
151 Ga0070710_11051265 3300005437 Bacteria 596
152 Ga0070701_10011271 3300005438 Bacteria 3990
153 Ga0070701_10075200 3300005438 Unclassified 1815
154 Ga0070701_10177726 3300005438 Bacteria 1244
155 Ga0070701_10227411 3300005438 Bacteria 1115
156 Ga0070701_10343113 3300005438 Bacteria 931
157 Ga0070701_10514926 3300005438 Unclassified 779
158 Ga0070701_10690002 3300005438 Bacteria 686
159 Ga0070701_11357721 3300005438 Bacteria 510
160 Ga0070711_100017725 3300005439 Bacteria 4537
161 Ga0070711_100052554 3300005439 Bacteria 2804
162 Ga0070711_101542818 3300005439 Bacteria 580
163 Ga0070705_100128329 3300005440 Bacteria 1650
164 Ga0070705_100186589 3300005440 Bacteria 1409
165 Ga0070705_100273433 3300005440 Bacteria 1197
166 Ga0070705_100557331 3300005440 Bacteria 880
167 Ga0070700_100008857 3300005441 Bacteria 5501
168 Ga0070700_100015485 3300005441 Unclassified 4325
169 Ga0070700_100021254 3300005441 Bacteria 3770
170 Ga0070700_100078357 3300005441 Bacteria 2127
171 Ga0070700_100241941 3300005441 Bacteria 1290
172 Ga0070700_100332074 3300005441 Bacteria 1121
173 Ga0070700_100827844 3300005441 Bacteria 748
174 Ga0070700_101834976 3300005441 Bacteria 523
175 Ga0070694_100006011 3300005444 Bacteria 7362
176 Ga0070694_100072927 3300005444 Bacteria 2370
177 Ga0070694_100469242 3300005444 Bacteria 997
178 Ga0070694_100579264 3300005444 Bacteria 902
179 Ga0070708_100023029 3300005445 Bacteria 5291
180 Ga0070708_100440174 3300005445 Bacteria 1229
181 Ga0070663_100129955 3300005455 Bacteria 1912
182 Ga0070663_100131454 3300005455 Bacteria 1901
183 Ga0070663_101422877 3300005455 Bacteria 614
184 Ga0070678_100001665 3300005456 Bacteria 11902
185 Ga0070678_100004139 3300005456 Bacteria 8174
186 Ga0070678_100099170 3300005456 Bacteria 2254
187 Ga0070678_100424304 3300005456 Bacteria 1160
188 Ga0070678_100571999 3300005456 Bacteria 1005
189 Ga0070678_100862365 3300005456 Bacteria 826
190 Ga0070678_101258248 3300005456 Bacteria 688
191 Ga0070678_101717593 3300005456 Bacteria 591
192 Ga0070678_102226809 3300005456 Bacteria 520
193 Ga0070662_100022184 3300005457 Bacteria 4342
194 Ga0070662_100164014 3300005457 Unclassified 1740
195 Ga0070662_100431495 3300005457 Bacteria 1091
196 Ga0070662_100737896 3300005457 Bacteria 835
197 Ga0070662_101062150 3300005457 Bacteria 694
198 Ga0070681_10086083 3300005458 Bacteria 3095
199 Ga0070681_10538165 3300005458 Bacteria 1082
200 Ga0070681_10776921 3300005458 Bacteria 875
201 Ga0070681_10825285 3300005458 Bacteria 845
202 Ga0070681_11359076 3300005458 Bacteria 634
203 Ga0068867_100000419 3300005459 Bacteria 28327
204 Ga0068867_100082047 3300005459 Bacteria 2432
205 Ga0068867_100226075 3300005459 Bacteria 1510
206 Ga0068867_100411630 3300005459 Bacteria 1143
207 Ga0068867_100431975 3300005459 Bacteria 1118
208 Ga0068867_100863571 3300005459 Bacteria 811
209 Ga0068867_101211148 3300005459 Bacteria 694
210 Ga0068867_101351710 3300005459 Bacteria 659
211 Ga0068867_101450244 3300005459 Unclassified 638
212 Ga0068867_101822016 3300005459 Unclassified 572
213 Ga0070685_10003141 3300005466 Bacteria 8398
214 Ga0070685_10009061 3300005466 Bacteria 5135
215 Ga0070685_10012527 3300005466 Bacteria 4459
216 Ga0070685_10024284 3300005466 Bacteria 3327
217 Ga0070685_10115620 3300005466 Bacteria 1659
218 Ga0070685_10295037 3300005466 Bacteria 1091
219 Ga0070685_11595472 3300005466 Bacteria 505
220 Ga0070706_100007379 3300005467 Bacteria 10314
221 Ga0070706_100085948 3300005467 Bacteria 2914
222 Ga0070706_100524596 3300005467 Bacteria 1102
223 Ga0070707_100000635 3300005468 Bacteria 35108
224 Ga0070707_100042074 3300005468 Bacteria 4373
225 Ga0070707_101431018 3300005468 Bacteria 658
226 Ga0070707_101772126 3300005468 Bacteria 585
227 Ga0070707_101805743 3300005468 Unclassified 579
228 Ga0070698_100074422 3300005471 Bacteria 3402
229 Ga0070698_100284930 3300005471 Bacteria 1583
230 Ga0070698_100294761 3300005471 Bacteria 1553
231 Ga0070698_100362479 3300005471 Bacteria 1381
232 Ga0070698_100664390 3300005471 Bacteria 983
233 Ga0070698_101922499 3300005471 Unclassified 545
234 Ga0070699_100146449 3300005518 Bacteria 2087
235 Ga0070699_100259360 3300005518 Bacteria 1554
236 Ga0070699_101089913 3300005518 Bacteria 733
237 Ga0070699_102035496 3300005518 Bacteria 525
238 Ga0070699_102132555 3300005518 Bacteria 512
239 Ga0070679_100001403 3300005530 Bacteria 21260
240 Ga0070679_100116411 3300005530 Bacteria 2657
241 Ga0070679_100329864 3300005530 Bacteria 1474
242 Ga0070684_100068309 3300005535 Bacteria 3123
243 Ga0070684_100092820 3300005535 Bacteria 2686
244 Ga0070684_100132652 3300005535 Bacteria 2248
245 Ga0070684_100187851 3300005535 Bacteria 1880
246 Ga0070684_100196608 3300005535 Bacteria 1836
247 Ga0070684_100202774 3300005535 Bacteria 1807
248 Ga0070684_100216839 3300005535 Bacteria 1745
249 Ga0070684_100268161 3300005535 Bacteria 1562
250 Ga0070684_100988696 3300005535 Bacteria 790
251 Ga0070684_101012417 3300005535 Unclassified 780
252 Ga0070697_100827937 3300005536 Unclassified 819
253 Ga0070697_101151354 3300005536 Unclassified 691
254 Ga0070697_101999752 3300005536 Bacteria 519
255 Ga0068853_100002053 3300005539 Bacteria 14918
256 Ga0068853_100012231 3300005539 Bacteria 6979
257 Ga0068853_100165074 3300005539 Bacteria 2001
258 Ga0068853_101477199 3300005539 Bacteria 658
259 Ga0070672_100029658 3300005543 Bacteria 4104
260 Ga0070672_100089935 3300005543 Bacteria 2475
261 Ga0070672_100090127 3300005543 Bacteria 2472
262 Ga0070672_100093704 3300005543 Bacteria 2427
263 Ga0070672_100620362 3300005543 Bacteria 943
264 Ga0070672_101682915 3300005543 Bacteria 570
265 Ga0070686_100013865 3300005544 Bacteria 4628
266 Ga0070686_100068848 3300005544 Bacteria 2310
267 Ga0070686_100755880 3300005544 Bacteria 780
268 Ga0070686_100860353 3300005544 Bacteria 735
269 Ga0070686_101158413 3300005544 Bacteria 641
270 Ga0070686_101213581 3300005544 Bacteria 627
271 Ga0070686_101360329 3300005544 Bacteria 595
272 Ga0070695_100727527 3300005545 Bacteria 790
273 Ga0070695_100850565 3300005545 Unclassified 734
274 Ga0070695_101252121 3300005545 Bacteria 612
275 Ga0070695_101425125 3300005545 Unclassified 575
276 Ga0070696_100052553 3300005546 Bacteria 2834
277 Ga0070696_100188523 3300005546 Bacteria 1534
278 Ga0070696_100189412 3300005546 Unclassified 1530
279 Ga0070696_100414604 3300005546 Bacteria 1056
280 Ga0070696_100505644 3300005546 Bacteria 962
281 Ga0070696_100632559 3300005546 Bacteria 866
282 Ga0070693_100037999 3300005547 Bacteria 2688
283 Ga0070693_100436609 3300005547 Bacteria 916
284 Ga0070693_100455653 3300005547 Unclassified 898
285 Ga0070665_100057777 3300005548 Bacteria 3889
286 Ga0070665_100195649 3300005548 Bacteria 2023
287 Ga0070665_100349722 3300005548 Bacteria 1483
288 Ga0070665_101975877 3300005548 Bacteria 589
289 Ga0070704_100011069 3300005549 Bacteria 5508
290 Ga0070704_100041763 3300005549 Bacteria 3168
291 Ga0070704_100130883 3300005549 Bacteria 1944
292 Ga0070704_100883396 3300005549 Bacteria 803
293 Ga0068855_100070836 3300005563 Bacteria 4055
294 Ga0068855_100492816 3300005563 Bacteria 1333
295 Ga0068855_101277448 3300005563 Bacteria 761
296 Ga0070664_100015680 3300005564 Bacteria 6200
297 Ga0070664_100040958 3300005564 Bacteria 3908
298 Ga0070664_100190360 3300005564 Bacteria 1828
299 Ga0070664_100201688 3300005564 Bacteria 1775
300 Ga0070664_100450391 3300005564 Bacteria 1182
301 Ga0070664_100563873 3300005564 Bacteria 1054
302 Ga0070664_100591979 3300005564 Bacteria 1028
303 Ga0070664_100596916 3300005564 Bacteria 1024
304 Ga0068857_100086906 3300005577 Bacteria 2797
305 Ga0068857_100302560 3300005577 Bacteria 1474
306 Ga0068857_100347802 3300005577 Bacteria 1372
307 Ga0068857_100776531 3300005577 Bacteria 914
308 Ga0068854_100163424 3300005578 Bacteria 1726
309 Ga0068854_100422521 3300005578 Bacteria 1107
310 Ga0068854_101270942 3300005578 Bacteria 662
311 Ga0068856_100095770 3300005614 Bacteria 2957
312 Ga0068856_100501872 3300005614 Bacteria 1234
313 Ga0068856_100548110 3300005614 Bacteria 1178
314 Ga0070702_100004258 3300005615 Bacteria 6522
315 Ga0070702_100004263 3300005615 Bacteria 6515
316 Ga0070702_100133479 3300005615 Bacteria 1571
317 Ga0070702_100192565 3300005615 Bacteria 1343
318 Ga0070702_100309865 3300005615 Bacteria 1096
319 Ga0070702_100963269 3300005615 Bacteria 673
320 Ga0070702_101197582 3300005615 Bacteria 612
321 Ga0068852_100002371 3300005616 Bacteria 12983
322 Ga0068852_100040437 3300005616 Bacteria 3934
323 Ga0068852_100718449 3300005616 Bacteria 1010
324 Ga0068852_100807019 3300005616 Bacteria 953
325 Ga0068852_100943671 3300005616 Bacteria 881
326 Ga0068852_101497896 3300005616 Bacteria 697
327 Ga0068852_102607359 3300005616 Archaea 525
328 Ga0068859_100588919 3300005617 Bacteria 1206
329 Ga0068859_100709683 3300005617 Bacteria 1096
330 Ga0068864_100027376 3300005618 Bacteria 4814
331 Ga0068864_100143287 3300005618 Bacteria 2157
332 Ga0068864_100167875 3300005618 Bacteria 1999
333 Ga0068864_100554087 3300005618 Bacteria 1112
334 Ga0068864_100820924 3300005618 Bacteria 915
335 Ga0068864_101777116 3300005618 Bacteria 622
336 Ga0068866_10001799 3300005718 Bacteria 9030
337 Ga0068866_10091983 3300005718 Bacteria 1654
338 Ga0068866_10093140 3300005718 Bacteria 1645
339 Ga0068866_10156986 3300005718 Bacteria 1323
340 Ga0068866_10221062 3300005718 Unclassified 1143
341 Ga0068866_10854030 3300005718 Bacteria 637
342 Ga0068861_100014718 3300005719 Bacteria 5495
343 Ga0068861_100372807 3300005719 Bacteria 1258
344 Ga0068861_100435971 3300005719 Bacteria 1171
345 Ga0068861_100485676 3300005719 Bacteria 1114
346 Ga0068861_101848275 3300005719 Bacteria 600
347 Ga0068861_102006662 3300005719 Bacteria 577
348 Ga0068851_10024007 3300005834 Bacteria 2983
349 Ga0068870_10002500 3300005840 Bacteria 7669
350 Ga0068870_10003552 3300005840 Bacteria 6615
351 Ga0068870_10613563 3300005840 Bacteria 741
352 Ga0068870_11222169 3300005840 Bacteria 545
353 Ga0068863_100138507 3300005841 Bacteria 2325
354 Ga0068863_100952274 3300005841 Bacteria 860
355 Ga0068863_101058552 3300005841 Unclassified 815
356 Ga0068858_100015199 3300005842 Bacteria 7242
357 Ga0068860_100129535 3300005843 Bacteria 2420
358 Ga0068860_100223434 3300005843 Bacteria 1829
359 Ga0068860_100457186 3300005843 Bacteria 1270
360 Ga0068862_100245095 3300005844 Bacteria 1631
361 Ga0068862_100787121 3300005844 Unclassified 928
362 Ga0068862_100805977 3300005844 Bacteria 917
363 Ga0068862_100961371 3300005844 Bacteria 843
364 Ga0068862_101520990 3300005844 Unclassified 675
365 Ga0081455_10011661 3300005937 Bacteria 8815
366 Ga0081455_10024025 3300005937 Bacteria 5655
367 Ga0081455_10041491 3300005937 Bacteria 4045
368 Ga0081455_10055663 3300005937 Bacteria 3364
369 Ga0081455_10081973 3300005937 Bacteria 2640
370 Ga0081455_10618089 3300005937 Bacteria 703
371 Ga0081455_10806584 3300005937 Bacteria 589
372 Ga0081538_10110862 3300005981 Bacteria 1347
373 Ga0081538_10238767 3300005981 Bacteria 703
374 Ga0081540_1283617 3300005983 Bacteria 571
375 Ga0081539_10001263 3300005985 Bacteria 44753
376 Ga0081539_10044508 3300005985 Bacteria 2562
377 Ga0081539_10270896 3300005985 Unclassified 744
378 Ga0070717_10154436 3300006028 Bacteria 1987
379 Ga0075365_10164734 3300006038 Bacteria 1546
380 Ga0075365_10207403 3300006038 Bacteria 1374
381 Ga0075365_10275801 3300006038 Bacteria 1183
382 Ga0075365_10308570 3300006038 Bacteria 1114
383 Ga0075365_10312402 3300006038 Bacteria 1106
384 Ga0075368_10027686 3300006042 Bacteria 2188
385 Ga0075363_100120444 3300006048 Bacteria 1465
386 Ga0075363_100946299 3300006048 Bacteria 529
387 Ga0075364_10182424 3300006051 Bacteria 1421
388 Ga0075364_10203298 3300006051 Bacteria 1343
389 Ga0075432_10006412 3300006058 Bacteria 4004
390 Ga0075432_10027343 3300006058 Bacteria 1964
391 Ga0075432_10197840 3300006058 Bacteria 794
392 Ga0075432_10215153 3300006058 Bacteria 766
393 Ga0075432_10225096 3300006058 Bacteria 752
394 Ga0070715_10097896 3300006163 Bacteria 1363
395 Ga0070716_100113437 3300006173 Bacteria 1684
396 Ga0070716_100810523 3300006173 Bacteria 726
397 Ga0070712_100011677 3300006175 Bacteria 5579
398 Ga0070712_100349498 3300006175 Bacteria 1210
399 Ga0070712_100396016 3300006175 Bacteria 1139
400 Ga0070712_100726067 3300006175 Bacteria 849
401 Ga0070712_101877371 3300006175 Bacteria 525
402 Ga0075362_10420044 3300006177 Bacteria 676
403 Ga0075367_10300116 3300006178 Bacteria 1011
404 Ga0075367_10733676 3300006178 Bacteria 629
405 Ga0075367_10795318 3300006178 Bacteria 602
406 Ga0097621_100005304 3300006237 Bacteria 9078
407 Ga0097621_100091151 3300006237 Bacteria 2551
408 Ga0097621_100939578 3300006237 Bacteria 807
409 Ga0075370_10231634 3300006353 Bacteria 1093
410 Ga0068871_100003722 3300006358 Bacteria 10489
411 Ga0068871_100035544 3300006358 Bacteria 3960
412 Ga0068871_100083298 3300006358 Bacteria 2653
413 Ga0068871_100472532 3300006358 Bacteria 1127
414 Ga0068871_100488067 3300006358 Bacteria 1109
415 Ga0068871_101150220 3300006358 Bacteria 727
416 Ga0068871_101901279 3300006358 Bacteria 566
417 Ga0075428_100000369 3300006844 Bacteria 44666
418 Ga0075428_100005557 3300006844 Bacteria 14021
419 Ga0075428_100326752 3300006844 Bacteria 1648
420 Ga0075428_101036234 3300006844 Bacteria 868
421 Ga0075428_101065516 3300006844 Bacteria 854
422 Ga0075428_101383876 3300006844 Bacteria 739
423 Ga0075430_100004112 3300006846 Bacteria 12276
424 Ga0075430_100040721 3300006846 Bacteria 3932
425 Ga0075431_100012539 3300006847 Bacteria 8555
426 Ga0075431_100132018 3300006847 Bacteria 2575
427 Ga0075431_100165543 3300006847 Bacteria 2273
428 Ga0075431_101213341 3300006847 Bacteria 717
429 Ga0075431_101620792 3300006847 Unclassified 605
430 Ga0075433_10040442 3300006852 Bacteria 4036
431 Ga0075433_10438138 3300006852 Bacteria 1152
432 Ga0075433_10463648 3300006852 Bacteria 1116
433 Ga0075433_10475575 3300006852 Bacteria 1101
434 Ga0075433_10697038 3300006852 Bacteria 889
435 Ga0075433_11708315 3300006852 Unclassified 542
436 Ga0075434_100192329 3300006871 Bacteria 2061
437 Ga0075434_100205399 3300006871 Bacteria 1990
438 Ga0075434_100433538 3300006871 Bacteria 1336
439 Ga0075434_100510717 3300006871 Bacteria 1222
440 Ga0075434_100817970 3300006871 Bacteria 947
441 Ga0075434_102363588 3300006871 Bacteria 534
442 Ga0075429_100011703 3300006880 Bacteria 7608
443 Ga0075429_100030514 3300006880 Bacteria 4684
444 Ga0075429_100399516 3300006880 Bacteria 1204
445 Ga0075429_100876547 3300006880 Bacteria 786
446 Ga0068865_100000269 3300006881 Bacteria 28461
447 Ga0068865_100079561 3300006881 Bacteria 2348
448 Ga0068865_100180865 3300006881 Bacteria 1624
449 Ga0068865_100218127 3300006881 Bacteria 1490
450 Ga0068865_100371598 3300006881 Bacteria 1164
451 Ga0068865_100459129 3300006881 Bacteria 1055
452 Ga0068865_101427238 3300006881 Unclassified 619
453 Ga0068865_102047531 3300006881 Bacteria 520
454 Ga0075436_100004039 3300006914 Bacteria 10062
455 Ga0075436_100052705 3300006914 Unclassified 2809
456 Ga0075436_100193893 3300006914 Bacteria 1438
457 Ga0075436_100244410 3300006914 Bacteria 1277
458 Ga0075436_100268952 3300006914 Bacteria 1217
459 Ga0075436_100800624 3300006914 Bacteria 702
460 Ga0075436_100893725 3300006914 Bacteria 664
461 Ga0075436_101354552 3300006914 Bacteria 539
462 Ga0097620_100588925 3300006931 Bacteria 1206
463 Ga0097620_100709648 3300006931 Bacteria 1096
464 Ga0075435_100008556 3300007076 Bacteria 7355
465 Ga0075435_100069236 3300007076 Bacteria 2877
466 Ga0075435_100421232 3300007076 Bacteria 1150
467 Ga0075435_100781117 3300007076 Unclassified 831
468 Ga0075435_101804005 3300007076 Bacteria 537
469 Ga0099794_10124121 3300007265 Bacteria 1301
470 Ga0105251_10545624 3300009011 Bacteria 546
471 Ga0105244_10446431 3300009036 Bacteria 595
472 Ga0111539_10001582 3300009094 Bacteria 30297
473 Ga0111539_10019651 3300009094 Bacteria 8334
474 Ga0111539_10034653 3300009094 Bacteria 6117
475 Ga0111539_10056875 3300009094 Bacteria 4648
476 Ga0111539_10282038 3300009094 Bacteria 1933
477 Ga0111539_10336487 3300009094 Bacteria 1757
478 Ga0111539_10390216 3300009094 Bacteria 1621
479 Ga0111539_10398790 3300009094 Bacteria 1602
480 Ga0111539_10678207 3300009094 Bacteria 1200
481 Ga0111539_10886383 3300009094 Bacteria 1038
482 Ga0111539_11004528 3300009094 Bacteria 970
483 Ga0111539_11560908 3300009094 Bacteria 766
484 Ga0111539_11745516 3300009094 Archaea 722
485 Ga0111539_12578912 3300009094 Bacteria 589
486 Ga0105245_10007978 3300009098 Bacteria 9257
487 Ga0105245_10008137 3300009098 Bacteria 9169
488 Ga0105245_10027262 3300009098 Bacteria 5034
489 Ga0105245_10145927 3300009098 Bacteria 2233
490 Ga0105245_10214465 3300009098 Bacteria 1854
491 Ga0105245_10229027 3300009098 Bacteria 1797
492 Ga0105245_10232489 3300009098 Bacteria 1784
493 Ga0105245_10304818 3300009098 Bacteria 1564
494 Ga0105245_10323251 3300009098 Bacteria 1520
495 Ga0105245_10360111 3300009098 Bacteria 1443
496 Ga0105245_11451147 3300009098 Bacteria 736
497 Ga0105245_12658804 3300009098 Bacteria 554
498 Ga0105247_10022080 3300009101 Bacteria 3831
499 Ga0105247_10282546 3300009101 Unclassified 1145
500 Ga0105247_10963814 3300009101 Bacteria 663
501 Ga0105247_11673921 3300009101 Unclassified 525
502 Ga0114129_10001278 3300009147 Bacteria 33592
503 Ga0114129_10021820 3300009147 Bacteria 9089
504 Ga0114129_10029357 3300009147 Bacteria 7790
505 Ga0114129_10153264 3300009147 Bacteria 3153
506 Ga0114129_10224614 3300009147 Bacteria 2532
507 Ga0114129_10233403 3300009147 Unclassified 2477
508 Ga0114129_10249409 3300009147 Bacteria 2384
509 Ga0114129_10284065 3300009147 Unclassified 2210
510 Ga0114129_10636896 3300009147 Bacteria 1377
511 Ga0114129_11102219 3300009147 Unclassified 994
512 Ga0114129_11233221 3300009147 Bacteria 930
513 Ga0114129_11275508 3300009147 Bacteria 912
514 Ga0105243_10002162 3300009148 Bacteria 16608
515 Ga0105243_10007875 3300009148 Bacteria 8184
516 Ga0105243_10011092 3300009148 Bacteria 6818
517 Ga0105243_10016268 3300009148 Bacteria 5629
518 Ga0105243_10021934 3300009148 Bacteria 4850
519 Ga0105243_10040153 3300009148 Bacteria 3652
520 Ga0105243_10118512 3300009148 Bacteria 2228
521 Ga0105243_10264560 3300009148 Bacteria 1541
522 Ga0105243_10299862 3300009148 Bacteria 1456
523 Ga0105243_10486371 3300009148 Bacteria 1166
524 Ga0105243_10844117 3300009148 Unclassified 906
525 Ga0105243_11827459 3300009148 Bacteria 639
526 Ga0105241_10708564 3300009174 Bacteria 919
527 Ga0105241_10829708 3300009174 Bacteria 853
528 Ga0105241_11635600 3300009174 Unclassified 624
529 Ga0105241_11768283 3300009174 Bacteria 602
530 Ga0105242_10012809 3300009176 Bacteria 6460
531 Ga0105242_10077596 3300009176 Bacteria 2771
532 Ga0105242_10168633 3300009176 Bacteria 1922
533 Ga0105242_10216289 3300009176 Bacteria 1710
534 Ga0105242_10267767 3300009176 Bacteria 1546
535 Ga0105242_10360670 3300009176 Bacteria 1345
536 Ga0105242_11019777 3300009176 Unclassified 836
537 Ga0105242_11679693 3300009176 Bacteria 671
538 Ga0105242_12954459 3300009176 Bacteria 526
539 Ga0105248_10012514 3300009177 Bacteria 9357
540 Ga0105248_10045934 3300009177 Bacteria 4897
541 Ga0105248_10523449 3300009177 Unclassified 1337
542 Ga0105248_10752253 3300009177 Bacteria 1100
543 Ga0105248_10868549 3300009177 Bacteria 1018
544 Ga0105248_10913093 3300009177 Bacteria 992
545 Ga0105248_11143686 3300009177 Bacteria 880
546 Ga0105237_10053556 3300009545 Bacteria 4046
547 Ga0105237_10424321 3300009545 Bacteria 1335
548 Ga0105237_11500405 3300009545 Bacteria 681
549 Ga0105238_10022048 3300009551 Bacteria 6492
550 Ga0105238_10337223 3300009551 Bacteria 1495
551 Ga0105238_10368876 3300009551 Bacteria 1426
552 Ga0105238_10377674 3300009551 Bacteria 1408
553 Ga0105238_11062898 3300009551 Bacteria 831
554 Ga0105238_12171292 3300009551 Bacteria 590
555 Ga0105249_10019358 3300009553 Bacteria 6072
556 Ga0105249_10112581 3300009553 Bacteria 2574
557 Ga0105249_10254474 3300009553 Bacteria 1742
558 Ga0105249_10618041 3300009553 Bacteria 1139
559 Ga0105249_11072764 3300009553 Bacteria 875
560 Ga0105249_11711385 3300009553 Bacteria 701
561 Ga0105249_11843250 3300009553 Bacteria 678
562 Ga0105030_110738 3300009987 Bacteria 789
563 Ga0105239_10040773 3300010375 Bacteria 5087
564 Ga0105239_10061619 3300010375 Bacteria 4117
565 Ga0105239_10073297 3300010375 Bacteria 3764
566 Ga0105239_10095144 3300010375 Bacteria 3291
567 Ga0105239_10550067 3300010375 Bacteria 1314
568 Ga0105239_10630896 3300010375 Bacteria 1223
569 Ga0105239_10941223 3300010375 Bacteria 992
570 Ga0105239_12949968 3300010375 Unclassified 555
571 Ga0105246_10004161 3300011119 Bacteria 8793
572 Ga0105246_10022665 3300011119 Bacteria 4055
573 Ga0105246_10042946 3300011119 Bacteria 3064
574 Ga0105246_10116600 3300011119 Bacteria 1972
575 Ga0105246_10128482 3300011119 Bacteria 1889
576 Ga0105246_10319343 3300011119 Bacteria 1261
577 Ga0105246_10324430 3300011119 Bacteria 1253
578 Ga0105246_10417988 3300011119 Bacteria 1118
579 Ga0105246_10553326 3300011119 Bacteria 986
580 Ga0105246_10871806 3300011119 Unclassified 805
581 Ga0105246_11057693 3300011119 Bacteria 738
582 Ga0105246_11236398 3300011119 Bacteria 689
583 Ga0157322_1036125 3300012490 Bacteria 549
584 Ga0157313_1013634 3300012503 Bacteria 740
585 Ga0157324_1015704 3300012506 Bacteria 712
586 Ga0157373_10074264 3300013100 Unclassified 2399
587 Ga0157373_10658848 3300013100 Bacteria 765
588 Ga0157373_10863033 3300013100 Bacteria 670
589 Ga0157371_10003237 3300013102 Bacteria 14944
590 Ga0157371_10182684 3300013102 Bacteria 1500
591 Ga0157371_10373942 3300013102 Bacteria 1040
592 Ga0157371_10696651 3300013102 Bacteria 760
593 Ga0157371_10721469 3300013102 Bacteria 747
594 Ga0157370_10123060 3300013104 Bacteria 2422
595 Ga0157370_10965341 3300013104 Bacteria 772
596 Ga0157369_11533620 3300013105 Bacteria 678
597 Ga0157369_11782301 3300013105 Unclassified 625
598 Ga0157374_10059544 3300013296 Bacteria 3571
599 Ga0157374_10346258 3300013296 Bacteria 1476
600 Ga0157374_12645259 3300013296 Bacteria 529
601 Ga0157378_10011528 3300013297 Bacteria 7739
602 Ga0157378_10049175 3300013297 Bacteria 3751
603 Ga0157378_10590266 3300013297 Bacteria 1121
604 Ga0157378_10865412 3300013297 Bacteria 933
605 Ga0157378_11147329 3300013297 Unclassified 815
606 Ga0157378_11454375 3300013297 Bacteria 729
607 Ga0157378_12521010 3300013297 Bacteria 566
608 Ga0163162_10028626 3300013306 Bacteria 5514
609 Ga0163162_10136725 3300013306 Bacteria 2562
610 Ga0163162_10350658 3300013306 Bacteria 1609
611 Ga0163162_10815397 3300013306 Bacteria 1050
612 Ga0163162_11559461 3300013306 Unclassified 753
613 Ga0163162_12330449 3300013306 Bacteria 615
614 Ga0157372_10008369 3300013307 Bacteria 10997
615 Ga0157372_10394584 3300013307 Bacteria 1613
616 Ga0157372_10651077 3300013307 Bacteria 1227
617 Ga0157372_11239548 3300013307 Bacteria 861
618 Ga0157372_11275511 3300013307 Bacteria 848
619 Ga0157372_12677215 3300013307 Bacteria 572
620 Ga0157375_10012667 3300013308 Bacteria 7485
621 Ga0157375_10023843 3300013308 Bacteria 5653
622 Ga0157375_10028457 3300013308 Bacteria 5238
623 Ga0157375_10043940 3300013308 Bacteria 4336
624 Ga0157375_10049906 3300013308 Bacteria 4102
625 Ga0157375_10064424 3300013308 Bacteria 3649
626 Ga0157375_10117670 3300013308 Bacteria 2763
627 Ga0157375_10423698 3300013308 Bacteria 1497
628 Ga0157375_10430803 3300013308 Bacteria 1485
629 Ga0157375_11189805 3300013308 Bacteria 894
630 Ga0157375_11280285 3300013308 Bacteria 861
631 Ga0163163_10052644 3300014325 Bacteria 4017
632 Ga0163163_10216277 3300014325 Bacteria 1965
633 Ga0163163_10259255 3300014325 Bacteria 1789
634 Ga0163163_10293576 3300014325 Unclassified 1678
635 Ga0163163_10889711 3300014325 Bacteria 954
636 Ga0163163_11042362 3300014325 Bacteria 881
637 Ga0163163_11517716 3300014325 Bacteria 731
638 Ga0163163_11983933 3300014325 Unclassified 642
639 Ga0157380_10031445 3300014326 Bacteria 4075
640 Ga0157380_10044826 3300014326 Bacteria 3468
641 Ga0157380_10045856 3300014326 Bacteria 3433
642 Ga0157380_10088507 3300014326 Bacteria 2548
643 Ga0157380_10118482 3300014326 Bacteria 2238
644 Ga0157380_10541352 3300014326 Bacteria 1140
645 Ga0157380_10685253 3300014326 Bacteria 1028
646 Ga0157380_11583899 3300014326 Bacteria 710
647 Ga0157380_12390040 3300014326 Bacteria 594
648 Ga0157380_12857561 3300014326 Bacteria 549
649 Ga0157377_10005311 3300014745 Bacteria 6043
650 Ga0157377_10010385 3300014745 Bacteria 4604
651 Ga0157377_10021987 3300014745 Bacteria 3363
652 Ga0157377_10074303 3300014745 Bacteria 1972
653 Ga0157377_10155151 3300014745 Bacteria 1419
654 Ga0157377_10290880 3300014745 Bacteria 1074
655 Ga0157377_10367977 3300014745 Bacteria 970
656 Ga0157377_10958061 3300014745 Bacteria 644
657 Ga0157379_10216341 3300014968 Bacteria 1735
658 Ga0157379_10630421 3300014968 Bacteria 1002
659 Ga0157379_10994500 3300014968 Unclassified 799
660 Ga0157379_11793521 3300014968 Bacteria 603
661 Ga0157376_10007465 3300014969 Bacteria 7807
662 Ga0157376_10026686 3300014969 Bacteria 4567
663 Ga0157376_10134689 3300014969 Bacteria 2209
664 Ga0157376_10316018 3300014969 Bacteria 1483
665 Ga0157376_10832664 3300014969 Bacteria 937
666 Ga0157376_11302972 3300014969 Bacteria 756
667 Ga0157376_12777490 3300014969 Unclassified 529
668 Ga0163161_10141290 3300017792 Bacteria 1823
669 Ga0163161_10187100 3300017792 Bacteria 1590
670 Ga0163161_10294954 3300017792 Bacteria 1275
671 Ga0163161_10906087 3300017792 Bacteria 747
672 Ga0163161_11037735 3300017792 Unclassified 702
673 Ga0163161_11167827 3300017792 Bacteria 664
674 Ga0163161_11615187 3300017792 Bacteria 572
675 Ga0197907_10819896 3300020069 Bacteria 1084
676 Ga0206356_10492736 3300020070 Bacteria 1880
677 Ga0206354_10240647 3300020081 Bacteria 1787
678 Ga0206353_11564503 3300020082 Bacteria 642
679 Ga0206353_11939242 3300020082 Bacteria 1264
680 Ga0224712_10186629 3300022467 Bacteria 937
681 Ga0207697_10313437 3300025315 Unclassified 696
682 Ga0207653_10024307 3300025885 Bacteria 1933
683 Ga0207653_10159217 3300025885 Bacteria 835
684 Ga0207682_10287375 3300025893 Bacteria 770
685 Ga0207682_10485370 3300025893 Bacteria 585
686 Ga0207692_10120397 3300025898 Bacteria 1469
687 Ga0207692_10478755 3300025898 Bacteria 787
688 Ga0207692_10595949 3300025898 Bacteria 710
689 Ga0207642_10002284 3300025899 Bacteria 5971
690 Ga0207642_10041407 3300025899 Unclassified 2016
691 Ga0207642_10280131 3300025899 Bacteria 959
692 Ga0207642_10420466 3300025899 Unclassified 804
693 Ga0207642_10476017 3300025899 Bacteria 761
694 Ga0207710_10011778 3300025900 Bacteria 3678
695 Ga0207688_10004625 3300025901 Bacteria 7501
696 Ga0207688_10036367 3300025901 Bacteria 2729
697 Ga0207688_10082129 3300025901 Bacteria 1841
698 Ga0207688_10138723 3300025901 Unclassified 1430
699 Ga0207688_10210054 3300025901 Bacteria 1169
700 Ga0207680_10117944 3300025903 Bacteria 1732
701 Ga0207680_10121380 3300025903 Bacteria 1709
702 Ga0207680_10294909 3300025903 Bacteria 1129
703 Ga0207647_10118869 3300025904 Bacteria 1559
704 Ga0207647_10358296 3300025904 Bacteria 825
705 Ga0207685_10051713 3300025905 Bacteria 1588
706 Ga0207699_10194661 3300025906 Bacteria 1370
707 Ga0207645_10091719 3300025907 Archaea 1954
708 Ga0207645_10194195 3300025907 Bacteria 1334
709 Ga0207643_10006654 3300025908 Bacteria 6197
710 Ga0207643_10015663 3300025908 Bacteria 4129
711 Ga0207643_10158217 3300025908 Bacteria 1362
712 Ga0207643_10212126 3300025908 Bacteria 1182
713 Ga0207643_10830939 3300025908 Bacteria 599
714 Ga0207705_10184648 3300025909 Bacteria 1575
715 Ga0207705_10766480 3300025909 Bacteria 749
716 Ga0207684_10003747 3300025910 Bacteria 14694
717 Ga0207684_10511654 3300025910 Bacteria 1029
718 Ga0207684_10589783 3300025910 Bacteria 950
719 Ga0207684_10783191 3300025910 Bacteria 807
720 Ga0207684_10927556 3300025910 Bacteria 731
721 Ga0207654_10950918 3300025911 Bacteria 624
722 Ga0207707_10061685 3300025912 Bacteria 3263
723 Ga0207707_10261499 3300025912 Unclassified 1502
724 Ga0207707_10921784 3300025912 Bacteria 721
725 Ga0207671_10164000 3300025914 Bacteria 1722
726 Ga0207671_10202555 3300025914 Bacteria 1550
727 Ga0207671_10643754 3300025914 Bacteria 844
728 Ga0207693_10001049 3300025915 Bacteria 24711
729 Ga0207693_10033187 3300025915 Bacteria 4074
730 Ga0207693_10462767 3300025915 Bacteria 991
731 Ga0207663_10110772 3300025916 Bacteria 1862
732 Ga0207663_11239423 3300025916 Bacteria 601
733 Ga0207660_10218270 3300025917 Bacteria 1496
734 Ga0207660_10252878 3300025917 Bacteria 1391
735 Ga0207660_10535079 3300025917 Bacteria 952
736 Ga0207662_10007345 3300025918 Bacteria 5996
737 Ga0207662_10026650 3300025918 Bacteria 3334
738 Ga0207662_10076125 3300025918 Bacteria 2039
739 Ga0207662_10163016 3300025918 Bacteria 1425
740 Ga0207657_10005734 3300025919 Bacteria 12955
741 Ga0207657_10125198 3300025919 Bacteria 2111
742 Ga0207657_10143227 3300025919 Unclassified 1951
743 Ga0207657_10155186 3300025919 Unclassified 1862
744 Ga0207657_10370995 3300025919 Unclassified 1128
745 Ga0207649_10023736 3300025920 Bacteria 3555
746 Ga0207649_10058793 3300025920 Bacteria 2409
747 Ga0207649_11148579 3300025920 Unclassified 613
748 Ga0207649_11652916 3300025920 Bacteria 507
749 Ga0207652_10014907 3300025921 Bacteria 6302
750 Ga0207652_10190678 3300025921 Bacteria 1844
751 Ga0207646_10002084 3300025922 Bacteria 24000
752 Ga0207646_10106219 3300025922 Bacteria 2518
753 Ga0207646_10860160 3300025922 Bacteria 806
754 Ga0207646_10878439 3300025922 Bacteria 796
755 Ga0207681_10569950 3300025923 Bacteria 933
756 Ga0207681_11192999 3300025923 Bacteria 639
757 Ga0207681_11313569 3300025923 Bacteria 607
758 Ga0207694_10033429 3300025924 Bacteria 3940
759 Ga0207694_10236562 3300025924 Bacteria 1492
760 Ga0207694_10616994 3300025924 Bacteria 913
761 Ga0207650_10027425 3300025925 Bacteria 4077
762 Ga0207650_10512245 3300025925 Bacteria 1003
763 Ga0207650_11120141 3300025925 Bacteria 670
764 Ga0207650_11653268 3300025925 Bacteria 543
765 Ga0207650_11697645 3300025925 Bacteria 535
766 Ga0207659_10125186 3300025926 Bacteria 1975
767 Ga0207659_10185936 3300025926 Bacteria 1650
768 Ga0207659_10203621 3300025926 Bacteria 1582
769 Ga0207659_10725789 3300025926 Bacteria 851
770 Ga0207659_11240047 3300025926 Bacteria 641
771 Ga0207659_11454286 3300025926 Bacteria 587
772 Ga0207687_10061086 3300025927 Bacteria 2660
773 Ga0207687_10082800 3300025927 Bacteria 2322
774 Ga0207687_10084108 3300025927 Bacteria 2306
775 Ga0207687_10127390 3300025927 Bacteria 1914
776 Ga0207687_10194515 3300025927 Bacteria 1581
777 Ga0207687_10588203 3300025927 Bacteria 937
778 Ga0207687_10656036 3300025927 Bacteria 888
779 Ga0207687_10883157 3300025927 Archaea 765
780 Ga0207687_11181756 3300025927 Bacteria 657
781 Ga0207687_11446366 3300025927 Unclassified 591
782 Ga0207644_10076517 3300025931 Bacteria 2462
783 Ga0207644_10113490 3300025931 Unclassified 2052
784 Ga0207644_10303626 3300025931 Bacteria 1287
785 Ga0207644_11371718 3300025931 Bacteria 594
786 Ga0207690_10036657 3300025932 Bacteria 3177
787 Ga0207690_10047809 3300025932 Bacteria 2841
788 Ga0207690_10553397 3300025932 Bacteria 935
789 Ga0207690_11117598 3300025932 Unclassified 657
790 Ga0207706_10029290 3300025933 Bacteria 4916
791 Ga0207706_10083534 3300025933 Unclassified 2808
792 Ga0207706_10253951 3300025933 Bacteria 1535
793 Ga0207706_10965514 3300025933 Bacteria 717
794 Ga0207706_11266353 3300025933 Bacteria 610
795 Ga0207686_10018659 3300025934 Bacteria 3929
796 Ga0207686_10067059 3300025934 Bacteria 2294
797 Ga0207686_10074148 3300025934 Bacteria 2198
798 Ga0207686_10279194 3300025934 Bacteria 1232
799 Ga0207686_10306238 3300025934 Bacteria 1182
800 Ga0207686_11017245 3300025934 Unclassified 673
801 Ga0207709_10002279 3300025935 Bacteria 12176
802 Ga0207709_10005971 3300025935 Bacteria 6868
803 Ga0207709_10073974 3300025935 Bacteria 2173
804 Ga0207709_10080848 3300025935 Bacteria 2094
805 Ga0207709_10105143 3300025935 Bacteria 1875
806 Ga0207709_10300259 3300025935 Bacteria 1194
807 Ga0207709_10351343 3300025935 Bacteria 1113
808 Ga0207709_10407980 3300025935 Bacteria 1040
809 Ga0207709_10821738 3300025935 Bacteria 751
810 Ga0207709_11690015 3300025935 Unclassified 526
811 Ga0207670_10069263 3300025936 Bacteria 2433
812 Ga0207670_10482394 3300025936 Bacteria 1004
813 Ga0207670_11230475 3300025936 Bacteria 634
814 Ga0207669_10005001 3300025937 Bacteria 5897
815 Ga0207669_10145651 3300025937 Bacteria 1651
816 Ga0207669_10147643 3300025937 Bacteria 1642
817 Ga0207669_10163500 3300025937 Bacteria 1575
818 Ga0207669_10171463 3300025937 Bacteria 1545
819 Ga0207669_10230351 3300025937 Bacteria 1366
820 Ga0207669_10771895 3300025937 Unclassified 795
821 Ga0207669_11264158 3300025937 Bacteria 626
822 Ga0207669_11792750 3300025937 Bacteria 524
823 Ga0207704_10037206 3300025938 Bacteria 2810
824 Ga0207704_10115558 3300025938 Bacteria 1824
825 Ga0207704_10160711 3300025938 Bacteria 1598
826 Ga0207704_10302720 3300025938 Bacteria 1225
827 Ga0207704_10321134 3300025938 Bacteria 1194
828 Ga0207704_10396629 3300025938 Bacteria 1087
829 Ga0207704_10411941 3300025938 Bacteria 1069
830 Ga0207704_10986741 3300025938 Bacteria 712
831 Ga0207704_11011654 3300025938 Bacteria 703
832 Ga0207704_11490942 3300025938 Bacteria 580
833 Ga0207665_11166650 3300025939 Unclassified 614
834 Ga0207691_10006369 3300025940 Bacteria 11405
835 Ga0207691_10010651 3300025940 Bacteria 8824
836 Ga0207691_10089027 3300025940 Bacteria 2768
837 Ga0207691_10105454 3300025940 Bacteria 2511
838 Ga0207691_10158656 3300025940 Bacteria 1986
839 Ga0207691_10171134 3300025940 Bacteria 1902
840 Ga0207711_10048602 3300025941 Bacteria 3629
841 Ga0207711_10148242 3300025941 Bacteria 2115
842 Ga0207711_10931916 3300025941 Bacteria 807
843 Ga0207711_11039159 3300025941 Bacteria 759
844 Ga0207711_11612532 3300025941 Bacteria 592
845 Ga0207689_10029711 3300025942 Bacteria 4560
846 Ga0207689_10046032 3300025942 Bacteria 3607
847 Ga0207689_10143327 3300025942 Bacteria 1969
848 Ga0207689_10458659 3300025942 Bacteria 1066
849 Ga0207689_10620642 3300025942 Bacteria 910
850 Ga0207661_10008635 3300025944 Bacteria 7280
851 Ga0207661_10046214 3300025944 Bacteria 3452
852 Ga0207661_10074976 3300025944 Bacteria 2774
853 Ga0207661_10147981 3300025944 Bacteria 2028
854 Ga0207661_10168050 3300025944 Unclassified 1907
855 Ga0207661_10309104 3300025944 Bacteria 1419
856 Ga0207661_10734066 3300025944 Bacteria 909
857 Ga0207661_10972888 3300025944 Bacteria 782
858 Ga0207661_11540302 3300025944 Bacteria 609
859 Ga0207661_11715096 3300025944 Bacteria 573
860 Ga0207679_10122622 3300025945 Bacteria 2072
861 Ga0207679_10317269 3300025945 Bacteria 1348
862 Ga0207679_10713477 3300025945 Bacteria 911
863 Ga0207679_11142184 3300025945 Bacteria 715
864 Ga0207667_10073767 3300025949 Bacteria 3545
865 Ga0207667_10801378 3300025949 Bacteria 939
866 Ga0207667_11837225 3300025949 Bacteria 569
867 Ga0207651_10013495 3300025960 Bacteria 4677
868 Ga0207651_10051927 3300025960 Bacteria 2793
869 Ga0207651_10065590 3300025960 Unclassified 2547
870 Ga0207651_10335363 3300025960 Bacteria 1269
871 Ga0207651_10529899 3300025960 Bacteria 1022
872 Ga0207651_10677728 3300025960 Bacteria 907
873 Ga0207651_10789893 3300025960 Bacteria 841
874 Ga0207712_10017012 3300025961 Bacteria 4718
875 Ga0207712_10086834 3300025961 Bacteria 2292
876 Ga0207712_11198873 3300025961 Unclassified 677
877 Ga0207712_12111238 3300025961 Unclassified 504
878 Ga0207668_10150862 3300025972 Bacteria 1799
879 Ga0207668_10241453 3300025972 Bacteria 1462
880 Ga0207668_10665446 3300025972 Bacteria 912
881 Ga0207668_10790578 3300025972 Bacteria 839
882 Ga0207668_11352817 3300025972 Bacteria 641
883 Ga0207640_10060700 3300025981 Bacteria 2500
884 Ga0207640_10511279 3300025981 Bacteria 1002
885 Ga0207640_11673716 3300025981 Bacteria 574
886 Ga0207658_10423210 3300025986 Bacteria 1175
887 Ga0207677_10032872 3300026023 Bacteria 3339
888 Ga0207677_10068599 3300026023 Bacteria 2490
889 Ga0207677_10146194 3300026023 Bacteria 1817
890 Ga0207677_10236874 3300026023 Bacteria 1474
891 Ga0207677_10749657 3300026023 Bacteria 870
892 Ga0207677_11215515 3300026023 Bacteria 690
893 Ga0207677_11512395 3300026023 Bacteria 620
894 Ga0207677_11839284 3300026023 Bacteria 562
895 Ga0207677_12077461 3300026023 Bacteria 528
896 Ga0207703_10073898 3300026035 Bacteria 2821
897 Ga0207703_11917104 3300026035 Bacteria 569
898 Ga0207639_10036381 3300026041 Bacteria 3648
899 Ga0207639_10133405 3300026041 Unclassified 2059
900 Ga0207639_10771859 3300026041 Bacteria 895
901 Ga0207678_10040965 3300026067 Bacteria 4016
902 Ga0207678_10095360 3300026067 Unclassified 2543
903 Ga0207678_10209360 3300026067 Bacteria 1668
904 Ga0207678_10642799 3300026067 Bacteria 932
905 Ga0207678_12020859 3300026067 Bacteria 501
906 Ga0207708_10001945 3300026075 Bacteria 15228
907 Ga0207708_10012405 3300026075 Bacteria 6351
908 Ga0207708_10048411 3300026075 Bacteria 3236
909 Ga0207708_10105419 3300026075 Bacteria 2185
910 Ga0207708_10472967 3300026075 Bacteria 1047
911 Ga0207702_10155856 3300026078 Bacteria 2082
912 Ga0207702_12116570 3300026078 Bacteria 552
913 Ga0207641_10935159 3300026088 Bacteria 862
914 Ga0207641_11011420 3300026088 Unclassified 828
915 Ga0207641_11076338 3300026088 Bacteria 802
916 Ga0207648_10000729 3300026089 Bacteria 36820
917 Ga0207648_10116194 3300026089 Bacteria 2351
918 Ga0207648_10161256 3300026089 Bacteria 1980
919 Ga0207648_10411946 3300026089 Bacteria 1226
920 Ga0207648_10479189 3300026089 Bacteria 1136
921 Ga0207648_10668808 3300026089 Bacteria 961
922 Ga0207648_11361990 3300026089 Unclassified 667
923 Ga0207648_12141692 3300026089 Unclassified 520
924 Ga0207676_10038407 3300026095 Bacteria 3654
925 Ga0207676_10441727 3300026095 Bacteria 1225
926 Ga0207676_10638541 3300026095 Bacteria 1026
927 Ga0207676_10752460 3300026095 Bacteria 948
928 Ga0207676_10980317 3300026095 Bacteria 832
929 Ga0207676_11041551 3300026095 Bacteria 807
930 Ga0207676_11635092 3300026095 Bacteria 642
931 Ga0207674_10110289 3300026116 Bacteria 2727
932 Ga0207674_10144951 3300026116 Bacteria 2333
933 Ga0207674_10192944 3300026116 Bacteria 1987
934 Ga0207674_10432277 3300026116 Bacteria 1272
935 Ga0207674_10671347 3300026116 Bacteria 1001
936 Ga0207674_10731466 3300026116 Bacteria 955
937 Ga0207675_100034654 3300026118 Bacteria 4708
938 Ga0207675_100036337 3300026118 Bacteria 4596
939 Ga0207675_100226366 3300026118 Bacteria 1803
940 Ga0207675_100265151 3300026118 Unclassified 1666
941 Ga0207675_100483750 3300026118 Bacteria 1231
942 Ga0207675_100876561 3300026118 Unclassified 913
943 Ga0207675_101306771 3300026118 Bacteria 746
944 Ga0207683_10000371 3300026121 Bacteria 41225
945 Ga0207683_10003740 3300026121 Bacteria 13203
946 Ga0207683_10034751 3300026121 Bacteria 4382
947 Ga0207683_10110959 3300026121 Bacteria 2456
948 Ga0207683_10115021 3300026121 Bacteria 2411
949 Ga0207683_10142240 3300026121 Bacteria 2162
950 Ga0207683_10323703 3300026121 Bacteria 1412
951 Ga0207683_10845016 3300026121 Bacteria 850
952 Ga0207683_11113357 3300026121 Bacteria 732
953 Ga0207683_11125968 3300026121 Bacteria 728
954 Ga0207683_11165778 3300026121 Bacteria 714
955 Ga0207683_11514111 3300026121 Bacteria 619
956 Ga0207698_10018342 3300026142 Bacteria 4766
957 Ga0207698_11044906 3300026142 Bacteria 828
958 Ga0207698_11426113 3300026142 Bacteria 708
959 Ga0207698_12493590 3300026142 Unclassified 527
960 Ga0209996_1059407 3300027395 Bacteria 586
961 Ga0209970_1018370 3300027614 Bacteria 1174
962 Ga0209983_1139798 3300027665 Bacteria 554
963 Ga0209966_1074024 3300027695 Bacteria 749
964 Ga0207428_10000281 3300027907 Bacteria 68694
965 Ga0207428_10036308 3300027907 Bacteria 4021
966 Ga0207428_10123837 3300027907 Unclassified 1981
967 Ga0207428_10137240 3300027907 Viruses 1869
968 Ga0207428_10151321 3300027907 Bacteria 1766
969 Ga0207428_10153859 3300027907 Bacteria 1750
970 Ga0207428_10734482 3300027907 Bacteria 704
971 Ga0207428_10842118 3300027907 Bacteria 650
972 Ga0268266_10083927 3300028379 Bacteria 2781
973 Ga0268266_10084202 3300028379 Bacteria 2777
974 Ga0268266_10088543 3300028379 Bacteria 2709
975 Ga0268266_10302514 3300028379 Bacteria 1492
976 Ga0268266_11319796 3300028379 Bacteria 697
977 Ga0268265_10627911 3300028380 Bacteria 1030
978 Ga0268265_10944260 3300028380 Unclassified 849
979 Ga0268265_12318961 3300028380 Unclassified 543
980 Ga0268264_10249503 3300028381 Bacteria 1648
981 Ga0268264_10939491 3300028381 Bacteria 869
982 Ga0268264_11170057 3300028381 Bacteria 778
983 Ga0307408_100211308 3300031548 Bacteria 1577
984 Ga0307408_100329000 3300031548 Bacteria 1290
985 Ga0307405_11357082 3300031731 Bacteria 620
986 Ga0307413_10973168 3300031824 Unclassified 725
987 Ga0307413_11804671 3300031824 Bacteria 547
988 Ga0307410_10273843 3300031852 Bacteria 1321
989 Ga0307406_10419448 3300031901 Bacteria 1066
990 Ga0307406_10494230 3300031901 Unclassified 991
991 Ga0307406_10511425 3300031901 Bacteria 975
992 Ga0307407_10218963 3300031903 Bacteria 1286
993 Ga0307407_11339629 3300031903 Unclassified 562
994 Ga0307412_10277027 3300031911 Bacteria 1315
995 Ga0307409_100274520 3300031995 Bacteria 1554
996 Ga0307416_100002165 3300032002 Bacteria 11126
997 Ga0307416_100202071 3300032002 Bacteria 1886
998 Ga0307416_103366626 3300032002 Archaea 535
999 Ga0307414_10093969 3300032004 Bacteria 2237
1000 Ga0307411_10006254 3300032005 Bacteria 5939
1001 Ga0307411_11904928 3300032005 Bacteria 553
1002 Ga0307415_100262326 3300032126 Bacteria 1410
1003 Ga0307415_101443643 3300032126 Bacteria 656
1004 Ga0307415_102336213 3300032126 Bacteria 525
1005 Ga0373948_0075426 3300034817 Bacteria 762
1006 Ga0373958_0117564 3300034819 Bacteria 639
1007 Ga0373959_0009124 3300034820 Bacteria 1704
1008 Ga0373959_0189772 3300034820 Bacteria 538
1009 Ga0373938_0254501 3300034957 Bacteria 503
1010 Ga0373940_0083358 3300035088 Bacteria 949
1011 Ga0373944_0072385 3300035089 Bacteria 1125
1012 Ga0373951_0083106 3300035091 Bacteria 831
1013 Ga0373952_0054182 3300035092 Bacteria 964
1014 Ga0373932_0016563 3300035112 Bacteria 1883
1015 Ga0373939_0094004 3300035114 Bacteria 1018
1016 Ga0373941_0059146 3300035115 Bacteria 1242
1017 Ga0373945_0317780 3300035116 Bacteria 670
1018 Ga0373960_0181143 3300035121 Bacteria 735
1019 Ga0373960_0201523 3300035121 Bacteria 704
1020 Ga0373960_0281106 3300035121 Unclassified 613
1021 Ga0373943_0154117 3300035170 Bacteria 1247
1022 Ga0373946_0269478 3300035171 Bacteria 835
1023 Ga0373946_0478711 3300035171 Bacteria 636
1024 Ga0373942_0077560 3300035207 Bacteria 981
1025 Ga0373961_0058706 3300035241 Bacteria 1161
1026 Ga0373962_0018881 3300035242 Bacteria 1799
1027 Ga0373962_0146758 3300035242 Bacteria 770
1028 Ga0373924_0245885 3300035410 Bacteria 792
1029 Ga0373931_0117198 3300035691 Bacteria 1518
1030 Ga0373931_0121665 3300035691 Bacteria 1492
1031 Ga0373935_0454210 3300035692 Bacteria 926
1032 Ga0373935_0628699 3300035692 Bacteria 786
1033 Ga0373947_0447185 3300035725 Bacteria 875
1034 Ga0373947_0727323 3300035725 Bacteria 677
1035 Ga0373925_0787965 3300037068 Bacteria 784
1036 Ga0395899_0022531 3300037312 Bacteria 4774
1037 Ga0395899_0033165 3300037312 Bacteria 3878
1038 Ga0395899_0038343 3300037312 Bacteria 3589
1039 Ga0395899_0088914 3300037312 Bacteria 2241
1040 Ga0395899_0099786 3300037312 Bacteria 2097
1041 Ga0395899_0190534 3300037312 Bacteria 1435
1042 Ga0395899_0254580 3300037312 Bacteria 1203
1043 Ga0395899_0645185 3300037312 Bacteria 669
1044 Ga0395900_0000988 3300037418 Bacteria 36988
1045 Ga0395900_0002063 3300037418 Bacteria 22548
1046 Ga0395900_0005985 3300037418 Bacteria 12701
1047 Ga0395900_0053920 3300037418 Bacteria 4139
1048 Ga0395900_0057355 3300037418 Bacteria 4009
1049 Ga0395900_0080628 3300037418 Bacteria 3344
1050 Ga0395900_0088912 3300037418 Bacteria 3175
1051 Ga0395900_0113594 3300037418 Bacteria 2779
1052 Ga0395900_0144113 3300037418 Bacteria 2437
1053 Ga0395900_0389205 3300037418 Bacteria 1360
1054 Ga0395900_0612616 3300037418 Bacteria 1028
1055 Ga0395900_0637948 3300037418 Bacteria 1003
1056 Ga0395900_1090026 3300037418 Bacteria 716
1057 Ga0395900_1498205 3300037418 Unclassified 587
1058 Ga0395898_0002378 3300037466 Bacteria 22342
1059 Ga0395898_0008324 3300037466 Bacteria 10965
1060 Ga0395898_0013193 3300037466 Bacteria 8512
1061 Ga0395898_0013852 3300037466 Bacteria 8287
1062 Ga0395898_0017918 3300037466 Bacteria 7225
1063 Ga0395898_0032460 3300037466 Bacteria 5212
1064 Ga0395898_0035150 3300037466 Bacteria 4987
1065 Ga0395898_0106469 3300037466 Bacteria 2689
1066 Ga0395898_0409112 3300037466 Bacteria 1293
1067 Ga0395898_0478844 3300037466 Unclassified 1184
1068 Ga0395898_0619327 3300037466 Bacteria 1025
1069 Ga0395898_0640903 3300037466 Bacteria 1005
1070 Ga0395898_0743063 3300037466 Bacteria 922
1071 Ga0395898_0938463 3300037466 Bacteria 803
1072 Ga0395898_1360257 3300037466 Bacteria 638
1073 Ga0395905_0002715 3300037471 Bacteria 19391
1074 Ga0395905_0003035 3300037471 Bacteria 18184
1075 Ga0395905_0007299 3300037471 Bacteria 11015
1076 Ga0395905_0059256 3300037471 Bacteria 3579
1077 Ga0395905_0082063 3300037471 Bacteria 3021
1078 Ga0395905_0097845 3300037471 Bacteria 2755
1079 Ga0395905_0117956 3300037471 Bacteria 2494
1080 Ga0395905_0121054 3300037471 Bacteria 2460
1081 Ga0395905_0299902 3300037471 Bacteria 1494
1082 Ga0395905_0301623 3300037471 Bacteria 1489
1083 Ga0395905_0472511 3300037471 Bacteria 1153
1084 Ga0395905_0780304 3300037471 Bacteria 858
1085 Ga0395905_1033072 3300037471 Unclassified 725
1086 Ga0395905_1047519 3300037471 Unclassified 719
1087 Ga0395901_0001046 3300038443 Bacteria 29844
1088 Ga0395901_0001699 3300038443 Bacteria 22721
1089 Ga0395901_0003426 3300038443 Bacteria 15984
1090 Ga0395901_0010485 3300038443 Bacteria 9386
1091 Ga0395901_0018396 3300038443 Bacteria 7131
1092 Ga0395901_0018546 3300038443 Bacteria 7104
1093 Ga0395901_0042124 3300038443 Bacteria 4733
1094 Ga0395901_0093900 3300038443 Bacteria 3142
1095 Ga0395901_0123365 3300038443 Bacteria 2722
1096 Ga0395901_0148878 3300038443 Bacteria 2460
1097 Ga0395901_0233990 3300038443 Bacteria 1918
1098 Ga0395901_0244233 3300038443 Unclassified 1872
1099 Ga0395901_0255087 3300038443 Bacteria 1826
1100 Ga0395901_0518308 3300038443 Bacteria 1211
1101 Ga0395901_2156164 3300038443 Unclassified 502
1102 Ga0242420_040922 3300038996 Bacteria 885
1103 Ga0439438_050472 3300041405 Bacteria 1059
1104 Ga0439438_067681 3300041405 Bacteria 887
1105 Ga0439439_0007490 3300041406 Bacteria 2556
1106 Ga0439447_057347 3300041407 Bacteria 921
1107 Ga0439453_0008494 3300041408 Bacteria 1652
1108 Ga0439453_0016934 3300041408 Bacteria 1275
1109 Ga0439461_0009675 3300041410 Bacteria 1753
1110 Ga0439461_0034553 3300041410 Bacteria 1068
1111 Ga0439461_0099152 3300041410 Unclassified 707
1112 Ga0439461_0181543 3300041410 Bacteria 558
1113 Ga0439466_0017305 3300041411 Bacteria 2598
1114 Ga0439466_0093021 3300041411 Bacteria 944
1115 Ga0451787_779493 3300041441 Bacteria 543
1116 Ga0451791_0313989 3300041451 Unclassified 609
1117 Ga0451798_1038471 3300041458 Bacteria 519
1118 Ga0451804_0468228 3300041463 Bacteria 558
1119 Ga0451807_1707017 3300041486 Bacteria 862
1120 Ga0451807_2106395 3300041486 Bacteria 551
1121 Ga0451807_2349782 3300041486 Bacteria 1163
1122 Ga0451845_0055735 3300041501 Bacteria 569
1123 Ga0451845_0678149 3300041501 Bacteria 557
1124 Ga0451851_0221635 3300041507 Bacteria 566
1125 Ga0451851_0813741 3300041507 Bacteria 771
1126 Ga0451853_1211212 3300041512 Bacteria 555
1127 Ga0451853_1978009 3300041512 Unclassified 979
1128 Ga0451853_3554456 3300041512 Bacteria 1190
1129 Ga0439431_0056367 3300041997 Bacteria 1027
1130 Ga0439431_0059363 3300041997 Bacteria 1004
1131 Ga0439433_0022736 3300041999 Bacteria 1408
1132 Ga0439441_001131 3300042001 Bacteria 3345
1133 Ga0439442_008538 3300042002 Bacteria 2067
1134 Ga0439445_0050291 3300042004 Bacteria 1124
1135 Ga0439448_0091428 3300042005 Bacteria 1029
1136 Ga0439448_0265233 3300042005 Bacteria 607
1137 Ga0439432_116182 3300042006 Bacteria 794
1138 Ga0439449_0104827 3300042007 Bacteria 1046
1139 Ga0439449_0284230 3300042007 Bacteria 624
1140 Ga0439450_209476 3300042008 Bacteria 523
1141 Ga0439454_018346 3300042011 Bacteria 1008
1142 Ga0439455_0254983 3300042012 Bacteria 514
1143 Ga0439462_0170798 3300042015 Bacteria 615
1144 Ga0450917_025194 3300042120 Bacteria 548
1145 Ga0450920_014363 3300042122 Bacteria 1497
1146 Ga0450920_031056 3300042122 Bacteria 1052
1147 Ga0450920_060167 3300042122 Bacteria 767
1148 Ga0450891_006014 3300042129 Bacteria 1118
1149 Ga0450894_065904 3300042131 Bacteria 550
1150 Ga0450906_015853 3300042145 Bacteria 1368
1151 Ga0450906_027676 3300042145 Bacteria 1005
1152 Ga0450906_085820 3300042145 Bacteria 569
1153 Ga0450907_012687 3300042146 Bacteria 1403
1154 Ga0450907_013736 3300042146 Bacteria 1350
1155 Ga0450907_027345 3300042146 Bacteria 967
1156 Ga0450910_035784 3300042147 Bacteria 792
1157 Ga0439446_0001134 3300042156 Bacteria 5908
1158 Ga0439446_0012386 3300042156 Bacteria 2328
1159 Ga0439446_0022934 3300042156 Bacteria 1772
1160 Ga0439434_0008986 3300042435 Bacteria 2937
1161 Ga0439434_0024871 3300042435 Bacteria 1807
1162 Ga0439434_0040169 3300042435 Unclassified 1436
1163 Ga0439435_0053814 3300042436 Bacteria 1158
1164 Ga0439435_0102653 3300042436 Bacteria 880
1165 Ga0439435_0365965 3300042436 Unclassified 503
1166 Ga0439444_0071645 3300042437 Bacteria 743
1167 Ga0439459_0039989 3300042438 Bacteria 993
1168 Ga0439459_0174219 3300042438 Bacteria 575
1169 Ga0439460_0339529 3300042461 Bacteria 529
1170 Ga0439460_0372408 3300042461 Unclassified 505
1171 Ga0450916_006961 3300042530 Bacteria 1346
1172 Ga0450916_039231 3300042530 Bacteria 715
1173 Ga0450918_014389 3300042531 Bacteria 1375
1174 Ga0450918_108498 3300042531 Unclassified 548
1175 Ga0466968_0684648 3300044735 Bacteria 523
1176 Ga0466960_0491204 3300044901 Bacteria 718
1177 Ga0451576_1189695 3300045051 Bacteria 796
1178 Ga0451576_1770628 3300045051 Bacteria 639
1179 Ga0495617_090807 3300046452 Bacteria 997
1180 Ga0495627_175804 3300046453 Unclassified 594
1181 Ga0495603_0003598 3300046455 Bacteria 9218
1182 Ga0495603_0029698 3300046455 Bacteria 3295
1183 Ga0495603_0395392 3300046455 Bacteria 792
1184 Ga0495603_0854936 3300046455 Bacteria 518
1185 Ga0495591_076096 3300046458 Bacteria 863
1186 Ga0495629_0320215 3300046459 Bacteria 1060
1187 Ga0495629_0354558 3300046459 Bacteria 1000
1188 Ga0495641_0016694 3300046461 Bacteria 3858
1189 Ga0495641_0051667 3300046461 Bacteria 1875
1190 Ga0495650_0293912 3300046471 Bacteria 545
1191 Ga0495580_0506543 3300046472 Bacteria 805
1192 Ga0495582_0018874 3300046473 Bacteria 3771
1193 Ga0495582_0054494 3300046473 Unclassified 2205
1194 Ga0495582_0121166 3300046473 Bacteria 1474
1195 Ga0495605_0017402 3300046474 Bacteria 3872
1196 Ga0495639_0029403 3300046475 Bacteria 2439
1197 Ga0495662_0135958 3300046476 Bacteria 1209
1198 Ga0495664_0545873 3300046477 Bacteria 691
1199 Ga0495584_0138465 3300046491 Bacteria 1236
1200 Ga0495584_0299410 3300046491 Unclassified 817
1201 Ga0495584_0366049 3300046491 Bacteria 732
1202 Ga0495585_0127681 3300046492 Bacteria 1341
1203 Ga0495585_0139613 3300046492 Bacteria 1270
1204 Ga0495585_0468307 3300046492 Unclassified 601
1205 Ga0495594_0064016 3300046499 Bacteria 2038
1206 Ga0495594_0262241 3300046499 Bacteria 984
1207 Ga0495594_0403188 3300046499 Bacteria 778
1208 Ga0495594_0466877 3300046499 Bacteria 717
1209 Ga0495596_0085391 3300046500 Bacteria 1225
1210 Ga0495596_0090469 3300046500 Unclassified 1188
1211 Ga0495596_0098507 3300046500 Bacteria 1135
1212 Ga0495596_0111120 3300046500 Bacteria 1064
1213 Ga0495596_0213644 3300046500 Bacteria 749
1214 Ga0495596_0389189 3300046500 Unclassified 543
1215 Ga0495607_0353378 3300046501 Bacteria 678
1216 Ga0495607_0378449 3300046501 Bacteria 648
1217 Ga0495608_0861703 3300046511 Bacteria 532
1218 Ga0495616_0247401 3300046513 Bacteria 767
1219 Ga0495618_0634225 3300046514 Bacteria 633
1220 Ga0495620_0071375 3300046515 Bacteria 1420
1221 Ga0495630_0012009 3300046517 Bacteria 6281
1222 Ga0495630_0110219 3300046517 Bacteria 2085
1223 Ga0495630_0727134 3300046517 Bacteria 759
1224 Ga0495631_0190038 3300046518 Bacteria 879
1225 Ga0495631_0297570 3300046518 Unclassified 687
1226 Ga0495631_0315503 3300046518 Bacteria 665
1227 Ga0495637_0184951 3300046520 Bacteria 771
1228 Ga0495644_0052010 3300046523 Bacteria 1538
1229 Ga0495644_0101181 3300046523 Bacteria 1090
1230 Ga0495644_0262322 3300046523 Bacteria 672
1231 Ga0495644_0273880 3300046523 Bacteria 658
1232 Ga0495644_0346127 3300046523 Bacteria 585
1233 Ga0495644_0442032 3300046523 Unclassified 517
1234 Ga0495663_0036900 3300046525 Bacteria 1473
1235 Ga0495663_0264362 3300046525 Bacteria 613
1236 Ga0495666_0321865 3300046526 Bacteria 698
1237 Ga0495642_0034277 3300046528 Bacteria 2044
1238 Ga0495642_0037234 3300046528 Bacteria 1968
1239 Ga0495642_0554790 3300046528 Unclassified 510
1240 Ga0495654_0282489 3300046530 Bacteria 682
1241 Ga0495665_0044630 3300046531 Bacteria 2355
1242 Ga0495640_0142921 3300046533 Bacteria 1542
1243 Ga0495640_0345073 3300046533 Unclassified 920
1244 Ga0495609_0061570 3300046538 Bacteria 1658
1245 Ga0495609_0140760 3300046538 Bacteria 1030
1246 Ga0495609_0167691 3300046538 Bacteria 928
1247 Ga0495609_0364480 3300046538 Bacteria 582
1248 Ga0495621_0236033 3300046539 Bacteria 744
1249 Ga0495621_0437540 3300046539 Unclassified 558
1250 Ga0495622_0168160 3300046557 Bacteria 987
1251 Ga0495667_0256354 3300046559 Bacteria 1113
1252 Ga0495667_0371000 3300046559 Bacteria 903
1253 Ga0495656_0019782 3300046615 Bacteria 2603
1254 Ga0495656_0147414 3300046615 Bacteria 1134
1255 Ga0495656_0274774 3300046615 Bacteria 857
1256 Ga0495656_0476277 3300046615 Bacteria 660
1257 Ga0495656_0499185 3300046615 Unclassified 645
1258 Ga0495656_0792344 3300046615 Unclassified 512
1259 Ga0495656_0830679 3300046615 Bacteria 500
1260 Ga0495668_0140649 3300046616 Bacteria 1321
1261 Ga0495668_0556497 3300046616 Bacteria 633
1262 Ga0495668_0612493 3300046616 Bacteria 602
1263 Ga0495634_0187769 3300046642 Bacteria 1291
1264 Ga0495635_0105476 3300046663 Bacteria 1925
1265 Ga0495635_0182985 3300046663 Bacteria 1424
1266 Ga0495635_0649356 3300046663 Bacteria 686
1267 Ga0495659_0016908 3300046664 Unclassified 2411
1268 Ga0495659_0022431 3300046664 Bacteria 2137
1269 Ga0495661_0419653 3300046665 Bacteria 648
1270 Ga0495588_0157446 3300046674 Bacteria 1201
1271 Ga0495588_0184588 3300046674 Bacteria 1102
1272 Ga0495588_0383476 3300046674 Unclassified 738
1273 Ga0495657_0476324 3300046675 Unclassified 729
1274 Ga0495647_0132687 3300046681 Bacteria 1056
1275 Ga0495647_0319686 3300046681 Bacteria 702
1276 Ga0495647_0478649 3300046681 Bacteria 578
1277 Ga0495658_0162276 3300046683 Bacteria 1379
1278 Ga0495658_0649578 3300046683 Bacteria 676
1279 Ga0495613_0321373 3300046689 Bacteria 1068
1280 Ga0495624_0531269 3300046690 Unclassified 703
1281 Ga0495670_0660329 3300046691 Bacteria 570
1282 Ga0495589_0025438 3300046794 Bacteria 3004
1283 Ga0495589_0133469 3300046794 Unclassified 1191
1284 Ga0495589_0170355 3300046794 Bacteria 1035
1285 Ga0495589_0332904 3300046794 Bacteria 701
1286 Ga0495589_0431545 3300046794 Bacteria 604
1287 Ga0495600_0947538 3300046809 Bacteria 506
1288 Ga0495660_0211417 3300046810 Bacteria 920
1289 Ga0495660_0240265 3300046810 Bacteria 845
1290 Ga0495581_0023230 3300047315 Bacteria 3593
1291 Ga0495581_0313574 3300047315 Bacteria 916
1292 Ga0495636_0133745 3300047318 Bacteria 1104
1293 Ga0495636_0427675 3300047318 Unclassified 634
1294 Ga0495636_0548608 3300047318 Unclassified 562
1295 Ga0495636_0659017 3300047318 Bacteria 515
1296 Ga0495674_0607086 3300047319 Bacteria 866
1297 Ga0495676_0031351 3300047321 Bacteria 4498
1298 Ga0495676_0408772 3300047321 Bacteria 900
1299 Ga0495676_0465769 3300047321 Bacteria 832
1300 Ga0495676_0637282 3300047321 Unclassified 692
1301 Ga0495676_0737285 3300047321 Bacteria 636
1302 Ga0495680_0033835 3300047322 Bacteria 4135
1303 Ga0495680_0596448 3300047322 Bacteria 740
1304 Ga0495683_0317515 3300047323 Bacteria 665
1305 Ga0495683_0434252 3300047323 Bacteria 541
1306 Ga0495675_0260068 3300047444 Bacteria 1040
1307 Ga0495677_0082340 3300047445 Bacteria 1207
1308 Ga0495677_0113001 3300047445 Bacteria 1033
1309 Ga0495677_0124581 3300047445 Bacteria 984
1310 Ga0495677_0169645 3300047445 Bacteria 844
1311 Ga0495677_0306658 3300047445 Bacteria 625
1312 Ga0495679_215436 3300047446 Bacteria 503
1313 Ga0495673_0237768 3300047469 Bacteria 669
1314 Ga0495681_0380779 3300047470 Bacteria 531
1315 Ga0495684_0142056 3300047471 Bacteria 1800
1316 Ga0495684_0820438 3300047471 Bacteria 606
1317 Ga0495593_0407298 3300047673 Unclassified 680
1318 Ga0495593_0576006 3300047673 Bacteria 565
1319 Ga0495614_0033172 3300048089 Bacteria 2221
1320 Ga0495614_0154491 3300048089 Bacteria 1025
1321 Ga0495615_0184064 3300048090 Bacteria 638
1322 Ga0496100_0035339 3300048903 Bacteria 3142
1323 Ga0496100_0105983 3300048903 Bacteria 1945
1324 Ga0496100_0109827 3300048903 Bacteria 1914
1325 Ga0496100_0529955 3300048903 Unclassified 910
1326 Ga0496100_0574888 3300048903 Bacteria 873
1327 Ga0496100_0826823 3300048903 Bacteria 726
1328 Ga0496100_1098860 3300048903 Unclassified 627
1329 Ga0496100_1124085 3300048903 Bacteria 619
1330 Ga0496100_1607404 3300048903 Bacteria 514
1331 Ga0496101_0050410 3300048904 Bacteria 2996
1332 Ga0496101_0120147 3300048904 Bacteria 1986
1333 Ga0496101_0127460 3300048904 Bacteria 1930
1334 Ga0496101_0274161 3300048904 Bacteria 1317
1335 Ga0496101_0365087 3300048904 Bacteria 1135
1336 Ga0496101_0568365 3300048904 Bacteria 896
1337 Ga0496101_0727362 3300048904 Bacteria 783
1338 Ga0496101_1318314 3300048904 Bacteria 564
1339 Ga0496102_0162996 3300048905 Bacteria 2097
1340 Ga0496102_0300467 3300048905 Bacteria 1513
1341 Ga0496102_0309560 3300048905 Bacteria 1488
1342 Ga0496102_0314392 3300048905 Bacteria 1476
1343 Ga0496102_0708447 3300048905 Bacteria 929
1344 Ga0496102_0847462 3300048905 Unclassified 836
1345 Ga0496103_0003329 3300048906 Bacteria 9830
1346 Ga0496103_0170263 3300048906 Bacteria 1398
1347 Ga0496103_0737572 3300048906 Bacteria 623
1348 Ga0496104_0010781 3300048907 Bacteria 8175
1349 Ga0496104_0056192 3300048907 Bacteria 3721
1350 Ga0496104_0093973 3300048907 Bacteria 2868
1351 Ga0496104_0110759 3300048907 Bacteria 2632
1352 Ga0496104_0337652 3300048907 Bacteria 1419
1353 Ga0496104_0707269 3300048907 Bacteria 915
1354 Ga0496104_0719935 3300048907 Bacteria 905
1355 Ga0496104_0891842 3300048907 Unclassified 794
1356 Ga0496104_0964894 3300048907 Bacteria 757
1357 Ga0496105_0035782 3300048908 Bacteria 4089
1358 Ga0496105_0038830 3300048908 Bacteria 3923
1359 Ga0496105_0074441 3300048908 Bacteria 2805
1360 Ga0496105_0247255 3300048908 Bacteria 1446
1361 Ga0496105_0262070 3300048908 Bacteria 1398
1362 Ga0496105_0265897 3300048908 Bacteria 1386
1363 Ga0496105_0706999 3300048908 Bacteria 773
1364 Ga0496105_0962457 3300048908 Bacteria 640
1365 Ga0496106_0131870 3300048909 Bacteria 1960
1366 Ga0496106_0341441 3300048909 Bacteria 1203
1367 Ga0496106_0463972 3300048909 Bacteria 1017
1368 Ga0496106_0743058 3300048909 Bacteria 780
1369 Ga0496106_1454037 3300048909 Bacteria 528
1370 Ga0496107_0025226 3300048910 Bacteria 4207
1371 Ga0496107_0069669 3300048910 Bacteria 2553
1372 Ga0496107_0164978 3300048910 Bacteria 1642
1373 Ga0496107_0217003 3300048910 Bacteria 1423
1374 Ga0496107_0269462 3300048910 Bacteria 1267
1375 Ga0496107_0481286 3300048910 Bacteria 921
1376 Ga0496107_0790897 3300048910 Bacteria 695
1377 Ga0496107_0985240 3300048910 Unclassified 612
1378 Ga0496108_0000888 3300048911 Bacteria 23275
1379 Ga0496108_0021551 3300048911 Bacteria 5294
1380 Ga0496108_0023356 3300048911 Bacteria 5087
1381 Ga0496108_0029530 3300048911 Bacteria 4541
1382 Ga0496108_0037251 3300048911 Bacteria 4050
1383 Ga0496108_0079703 3300048911 Bacteria 2773
1384 Ga0496108_0361643 3300048911 Bacteria 1267
1385 Ga0496108_0556450 3300048911 Bacteria 1000
1386 Ga0496108_0928480 3300048911 Bacteria 746
1387 Ga0496108_1109214 3300048911 Bacteria 672
1388 Ga0496108_1454918 3300048911 Bacteria 571
1389 Ga0496109_0000579 3300048912 Bacteria 30650
1390 Ga0496109_0023066 3300048912 Bacteria 5519
1391 Ga0496109_0035147 3300048912 Bacteria 4519
1392 Ga0496109_0046089 3300048912 Bacteria 3958
1393 Ga0496109_0077378 3300048912 Bacteria 3061
1394 Ga0496109_0103298 3300048912 Bacteria 2645
1395 Ga0496109_0252043 3300048912 Bacteria 1662
1396 Ga0496109_0255175 3300048912 Bacteria 1651
1397 Ga0496109_0304372 3300048912 Bacteria 1503
1398 Ga0496109_0368509 3300048912 Bacteria 1357
1399 Ga0496109_0777619 3300048912 Unclassified 895
1400 Ga0496109_1418749 3300048912 Bacteria 630
1401 Ga0496109_2037791 3300048912 Bacteria 506
1402 Ga0496110_0046372 3300048913 Bacteria 3802
1403 Ga0496110_0082414 3300048913 Bacteria 2869
1404 Ga0496110_0128156 3300048913 Bacteria 2290
1405 Ga0496110_0146639 3300048913 Bacteria 2135
1406 Ga0496110_0149457 3300048913 Unclassified 2114
1407 Ga0496110_0254499 3300048913 Unclassified 1598
1408 Ga0496110_0397731 3300048913 Archaea 1256
1409 Ga0496110_0483113 3300048913 Bacteria 1128
1410 Ga0496110_0502764 3300048913 Bacteria 1103
1411 Ga0496110_1305396 3300048913 Bacteria 635
1412 Ga0496111_0000740 3300048914 Bacteria 17415
1413 Ga0496111_0010160 3300048914 Bacteria 6303
1414 Ga0496111_0104052 3300048914 Unclassified 2088
1415 Ga0496111_0110475 3300048914 Bacteria 2025
1416 Ga0496111_0128560 3300048914 Bacteria 1874
1417 Ga0496111_0132691 3300048914 Bacteria 1844
1418 Ga0496111_0147176 3300048914 Bacteria 1746
1419 Ga0496111_0173037 3300048914 Bacteria 1604
1420 Ga0496111_0300235 3300048914 Bacteria 1190
1421 Ga0496111_0511390 3300048914 Bacteria 883
1422 Ga0496111_0590572 3300048914 Bacteria 813
1423 Ga0496112_0023965 3300048915 Bacteria 5839
1424 Ga0496112_0025847 3300048915 Bacteria 5642
1425 Ga0496112_0268839 3300048915 Bacteria 1653
1426 Ga0496112_0385940 3300048915 Bacteria 1341
1427 Ga0496112_0543994 3300048915 Bacteria 1095
1428 Ga0496112_0559544 3300048915 Bacteria 1077
1429 Ga0496112_0730463 3300048915 Bacteria 917
1430 Ga0496112_1469871 3300048915 Bacteria 596
1431 Ga0496113_0002956 3300048916 Bacteria 10046
1432 Ga0496113_0027155 3300048916 Bacteria 4100
1433 Ga0496113_0109168 3300048916 Bacteria 2151
1434 Ga0496113_0601799 3300048916 Unclassified 880
1435 Ga0496113_1353574 3300048916 Unclassified 552
1436 Ga0496114_0004206 3300048917 Bacteria 11154
1437 Ga0496114_0048630 3300048917 Bacteria 3528
1438 Ga0496114_0083542 3300048917 Bacteria 2702
1439 Ga0496114_0097333 3300048917 Bacteria 2506
1440 Ga0496114_0120337 3300048917 Bacteria 2257
1441 Ga0496114_0141106 3300048917 Bacteria 2086
1442 Ga0496114_0331155 3300048917 Unclassified 1346
1443 Ga0496114_0420997 3300048917 Bacteria 1183
1444 Ga0496114_0583412 3300048917 Bacteria 986
1445 Ga0496114_1261673 3300048917 Bacteria 625
1446 Ga0496115_0025065 3300048918 Bacteria 4640
1447 Ga0496115_0090245 3300048918 Bacteria 2503
1448 Ga0495682_0354447 3300049460 Bacteria 517
1449 Ga0501299_078376 3300049522 Bacteria 730
1450 Ga0501031_0002104 3300049568 Bacteria 12555
1451 Ga0501031_0005456 3300049568 Bacteria 8274
1452 Ga0501031_0008345 3300049568 Bacteria 6738
1453 Ga0501031_0010811 3300049568 Bacteria 5944
1454 Ga0501031_0024921 3300049568 Bacteria 3902
1455 Ga0501031_0027308 3300049568 Bacteria 3722
1456 Ga0501031_0032494 3300049568 Bacteria 3403
1457 Ga0501031_0034432 3300049568 Bacteria 3305
1458 Ga0501031_0172366 3300049568 Bacteria 1414
1459 Ga0501031_0257974 3300049568 Bacteria 1133
1460 Ga0501031_0356701 3300049568 Bacteria 946
1461 Ga0501031_0460897 3300049568 Bacteria 821
1462 Ga0501031_0672637 3300049568 Bacteria 665
1463 Ga0501031_0981942 3300049568 Unclassified 540
1464 Ga0501032_0011530 3300049569 Bacteria 6347
1465 Ga0501032_0024599 3300049569 Bacteria 4156
1466 Ga0501032_0222116 3300049569 Bacteria 1229
1467 Ga0501032_0352974 3300049569 Bacteria 947
1468 Ga0501032_0878570 3300049569 Bacteria 565
1469 Ga0501033_0027249 3300049570 Bacteria 4296
1470 Ga0501033_0033545 3300049570 Bacteria 3854
1471 Ga0501033_0109978 3300049570 Bacteria 2006
1472 Ga0501033_0148355 3300049570 Bacteria 1693
1473 Ga0501033_0306205 3300049570 Bacteria 1118
1474 Ga0501033_0306530 3300049570 Bacteria 1117
1475 Ga0501033_0760350 3300049570 Bacteria 657
1476 Ga0501034_0301122 3300049571 Bacteria 1540
1477 Ga0501034_1261068 3300049571 Bacteria 616
1478 Ga0501036_0003750 3300049572 Bacteria 12175
1479 Ga0501036_0011577 3300049572 Bacteria 7309
1480 Ga0501036_0043992 3300049572 Bacteria 3781
1481 Ga0501036_0050459 3300049572 Bacteria 3523
1482 Ga0501036_0059785 3300049572 Bacteria 3229
1483 Ga0501036_0085508 3300049572 Bacteria 2666
1484 Ga0501036_0145198 3300049572 Bacteria 2001
1485 Ga0501036_0192346 3300049572 Bacteria 1716
1486 Ga0501036_0231544 3300049572 Bacteria 1550
1487 Ga0501036_0265039 3300049572 Bacteria 1439
1488 Ga0501036_0304279 3300049572 Bacteria 1333
1489 Ga0501036_0305113 3300049572 Bacteria 1331
1490 Ga0501036_0385801 3300049572 Bacteria 1169
1491 Ga0501036_0510267 3300049572 Bacteria 1000
1492 Ga0501036_0710736 3300049572 Bacteria 830
1493 Ga0501036_0817733 3300049572 Bacteria 767
1494 Ga0501037_0011191 3300049573 Bacteria 6603
1495 Ga0501037_0012070 3300049573 Bacteria 6362
1496 Ga0501037_0083516 3300049573 Bacteria 2314
1497 Ga0501037_0168864 3300049573 Bacteria 1556
1498 Ga0501037_0169349 3300049573 Bacteria 1553
1499 Ga0501037_0310841 3300049573 Bacteria 1092
1500 Ga0501038_0001738 3300049574 Bacteria 20249
1501 Ga0501038_0028181 3300049574 Bacteria 4990
1502 Ga0501038_0032597 3300049574 Bacteria 4596
1503 Ga0501038_0043032 3300049574 Bacteria 3930
1504 Ga0501038_0075933 3300049574 Bacteria 2839
1505 Ga0501038_0094034 3300049574 Bacteria 2506
1506 Ga0501038_0125566 3300049574 Bacteria 2112
1507 Ga0501038_0677153 3300049574 Bacteria 775
1508 Ga0501038_1407834 3300049574 Bacteria 501
1509 Ga0501039_0004321 3300049575 Bacteria 10713
1510 Ga0501039_0034274 3300049575 Bacteria 3918
1511 Ga0501039_0035012 3300049575 Bacteria 3875
1512 Ga0501039_0048604 3300049575 Bacteria 3279
1513 Ga0501039_0057186 3300049575 Bacteria 3020
1514 Ga0501039_0080583 3300049575 Bacteria 2533
1515 Ga0501039_0219827 3300049575 Bacteria 1493
1516 Ga0501039_0246724 3300049575 Bacteria 1404
1517 Ga0501039_0351622 3300049575 Unclassified 1158
1518 Ga0501039_0770413 3300049575 Bacteria 751
1519 Ga0501039_1418408 3300049575 Bacteria 534
1520 Ga0501039_1522167 3300049575 Archaea 514
1521 Ga0501039_1592248 3300049575 Bacteria 501
1522 Ga0501040_0018166 3300049576 Bacteria 4670
1523 Ga0501040_0020310 3300049576 Bacteria 4425
1524 Ga0501040_0021388 3300049576 Bacteria 4320
1525 Ga0501040_0024973 3300049576 Bacteria 4015
1526 Ga0501040_0025076 3300049576 Bacteria 4007
1527 Ga0501040_0096298 3300049576 Bacteria 2060
1528 Ga0501040_0138193 3300049576 Bacteria 1715
1529 Ga0501040_0147011 3300049576 Bacteria 1661
1530 Ga0501040_0161758 3300049576 Bacteria 1583
1531 Ga0501040_0199231 3300049576 Bacteria 1421
1532 Ga0501040_0220096 3300049576 Bacteria 1350
1533 Ga0501040_0375296 3300049576 Bacteria 1020
1534 Ga0501040_0535967 3300049576 Bacteria 845
1535 Ga0501040_0795733 3300049576 Bacteria 684
1536 Ga0501040_1047482 3300049576 Bacteria 592
1537 Ga0501041_0006004 3300049577 Bacteria 7105
1538 Ga0501041_0006678 3300049577 Bacteria 6759
1539 Ga0501041_0007434 3300049577 Bacteria 6433
1540 Ga0501041_0011358 3300049577 Bacteria 5262
1541 Ga0501041_0013965 3300049577 Bacteria 4764
1542 Ga0501041_0014769 3300049577 Bacteria 4637
1543 Ga0501041_0015431 3300049577 Bacteria 4535
1544 Ga0501041_0048515 3300049577 Bacteria 2586
1545 Ga0501041_0151877 3300049577 Bacteria 1446
1546 Ga0501041_0313020 3300049577 Bacteria 990
1547 Ga0501041_0465831 3300049577 Bacteria 803
1548 Ga0501041_0536590 3300049577 Bacteria 745
1549 Ga0501041_1049155 3300049577 Unclassified 525
1550 Ga0501042_0005142 3300049578 Bacteria 8397
1551 Ga0501042_0016562 3300049578 Bacteria 5063
1552 Ga0501042_0018322 3300049578 Bacteria 4845
1553 Ga0501042_0023072 3300049578 Bacteria 4349
1554 Ga0501042_0041146 3300049578 Bacteria 3285
1555 Ga0501042_0055945 3300049578 Bacteria 2815
1556 Ga0501042_0235768 3300049578 Bacteria 1320
1557 Ga0501042_0243955 3300049578 Bacteria 1296
1558 Ga0501042_0279042 3300049578 Bacteria 1207
1559 Ga0501042_0355071 3300049578 Bacteria 1060
1560 Ga0501042_0371099 3300049578 Bacteria 1035
1561 Ga0501042_0660595 3300049578 Bacteria 760
1562 Ga0501042_0695148 3300049578 Bacteria 740
1563 Ga0501042_0742441 3300049578 Bacteria 714
1564 Ga0501042_1176339 3300049578 Bacteria 559
1565 Ga0501042_1370096 3300049578 Unclassified 516
1566 Ga0501042_1417282 3300049578 Unclassified 507
1567 Ga0501043_0014994 3300049579 Bacteria 6069
1568 Ga0501043_0026222 3300049579 Bacteria 4572
1569 Ga0501043_0057037 3300049579 Bacteria 3067
1570 Ga0501043_0063719 3300049579 Bacteria 2895
1571 Ga0501043_0243417 3300049579 Bacteria 1387
1572 Ga0501043_0245300 3300049579 Bacteria 1381
1573 Ga0501043_0406575 3300049579 Bacteria 1028
1574 Ga0501046_0002143 3300049580 Bacteria 18641
1575 Ga0501046_0007988 3300049580 Bacteria 9251
1576 Ga0501046_0014203 3300049580 Bacteria 6726
1577 Ga0501046_0016257 3300049580 Bacteria 6238
1578 Ga0501046_0024687 3300049580 Bacteria 4926
1579 Ga0501046_0053029 3300049580 Bacteria 3195
1580 Ga0501046_0431535 3300049580 Bacteria 949
1581 Ga0501046_1117145 3300049580 Unclassified 544
1582 Ga0501046_1231237 3300049580 Bacteria 513
1583 Ga0501047_0283721 3300049581 Bacteria 1500
1584 Ga0501047_0422818 3300049581 Bacteria 1164
1585 Ga0501047_0520766 3300049581 Bacteria 1015
1586 Ga0501048_0012639 3300049582 Bacteria 6279
1587 Ga0501048_0014089 3300049582 Bacteria 5926
1588 Ga0501048_0015761 3300049582 Bacteria 5577
1589 Ga0501048_0068375 3300049582 Bacteria 2509
1590 Ga0501048_0082395 3300049582 Bacteria 2269
1591 Ga0501048_0096929 3300049582 Bacteria 2080
1592 Ga0501048_0097088 3300049582 Bacteria 2079
1593 Ga0501048_0128811 3300049582 Bacteria 1789
1594 Ga0501048_0506957 3300049582 Bacteria 865
1595 Ga0501048_0650410 3300049582 Bacteria 757
1596 Ga0501067_0023969 3300049583 Bacteria 3384
1597 Ga0501067_0052292 3300049583 Bacteria 2263
1598 Ga0501067_0063060 3300049583 Bacteria 2052
1599 Ga0501067_0074685 3300049583 Bacteria 1878
1600 Ga0501067_0263624 3300049583 Bacteria 959
1601 Ga0501067_0407371 3300049583 Unclassified 758
1602 Ga0501067_0551036 3300049583 Unclassified 646
1603 Ga0501067_0554346 3300049583 Bacteria 644
1604 Ga0501067_0597330 3300049583 Unclassified 619
1605 Ga0501068_0005542 3300049584 Bacteria 6915
1606 Ga0501068_0014980 3300049584 Bacteria 4443
1607 Ga0501068_0015318 3300049584 Bacteria 4400
1608 Ga0501068_0018445 3300049584 Bacteria 4041
1609 Ga0501068_0070302 3300049584 Bacteria 2135
1610 Ga0501068_0082801 3300049584 Bacteria 1971
1611 Ga0501068_0085150 3300049584 Bacteria 1945
1612 Ga0501068_0166829 3300049584 Bacteria 1389
1613 Ga0501068_0411290 3300049584 Bacteria 873
1614 Ga0501068_0758535 3300049584 Unclassified 635
1615 Ga0501068_0831475 3300049584 Unclassified 606
1616 Ga0501069_0017407 3300049585 Bacteria 3866
1617 Ga0501069_0020250 3300049585 Bacteria 3603
1618 Ga0501069_0021451 3300049585 Bacteria 3506
1619 Ga0501069_0024839 3300049585 Bacteria 3271
1620 Ga0501069_0039376 3300049585 Bacteria 2611
1621 Ga0501069_0059015 3300049585 Bacteria 2141
1622 Ga0501069_0079231 3300049585 Bacteria 1849
1623 Ga0501069_0093285 3300049585 Bacteria 1703
1624 Ga0501069_0220381 3300049585 Bacteria 1102
1625 Ga0501069_0328763 3300049585 Bacteria 899
1626 Ga0501069_0506787 3300049585 Bacteria 720
1627 Ga0501069_0865369 3300049585 Bacteria 549
1628 Ga0501069_1006694 3300049585 Bacteria 509
1629 Ga0501069_1008364 3300049585 Unclassified 509
1630 Ga0501070_0018595 3300049586 Bacteria 5829
1631 Ga0501070_0028099 3300049586 Bacteria 4717
1632 Ga0501070_0032622 3300049586 Bacteria 4359
1633 Ga0501070_0040915 3300049586 Bacteria 3862
1634 Ga0501070_0088405 3300049586 Bacteria 2564
1635 Ga0501070_0199156 3300049586 Bacteria 1645
1636 Ga0501070_0304718 3300049586 Bacteria 1297
1637 Ga0501070_0703439 3300049586 Unclassified 799
1638 Ga0501070_0838242 3300049586 Unclassified 720
1639 Ga0501071_0002739 3300049587 Bacteria 10807
1640 Ga0501071_0003010 3300049587 Bacteria 10431
1641 Ga0501071_0009045 3300049587 Bacteria 6612
1642 Ga0501071_0012703 3300049587 Bacteria 5724
1643 Ga0501071_0012914 3300049587 Bacteria 5682
1644 Ga0501071_0021703 3300049587 Bacteria 4475
1645 Ga0501071_0023319 3300049587 Bacteria 4322
1646 Ga0501071_0115195 3300049587 Bacteria 1989
1647 Ga0501071_0130774 3300049587 Bacteria 1864
1648 Ga0501071_0160448 3300049587 Bacteria 1680
1649 Ga0501071_0293794 3300049587 Bacteria 1231
1650 Ga0501071_0302394 3300049587 Bacteria 1213
1651 Ga0501071_0500831 3300049587 Bacteria 932
1652 Ga0501071_0576016 3300049587 Bacteria 865
1653 Ga0501071_0727753 3300049587 Bacteria 764
1654 Ga0501071_0826674 3300049587 Unclassified 714
1655 Ga0501071_1463059 3300049587 Bacteria 527
1656 Ga0501072_0004009 3300049588 Bacteria 11144
1657 Ga0501072_0004983 3300049588 Bacteria 10101
1658 Ga0501072_0008209 3300049588 Bacteria 7929
1659 Ga0501072_0020866 3300049588 Bacteria 5079
1660 Ga0501072_0021085 3300049588 Bacteria 5055
1661 Ga0501072_0024983 3300049588 Bacteria 4651
1662 Ga0501072_0070915 3300049588 Bacteria 2752
1663 Ga0501072_0096841 3300049588 Bacteria 2345
1664 Ga0501072_0263639 3300049588 Bacteria 1371
1665 Ga0501072_0314259 3300049588 Bacteria 1245
1666 Ga0501072_0343949 3300049588 Bacteria 1184
1667 Ga0501072_0351204 3300049588 Bacteria 1171
1668 Ga0501072_0545975 3300049588 Bacteria 915
1669 Ga0501072_0570350 3300049588 Unclassified 893
1670 Ga0501072_1326914 3300049588 Bacteria 557
1671 Ga0501073_0035084 3300049589 Bacteria 3566
1672 Ga0501073_0098919 3300049589 Bacteria 2025
1673 Ga0501073_0141889 3300049589 Bacteria 1664
1674 Ga0501073_0509781 3300049589 Unclassified 832
1675 Ga0501073_0535392 3300049589 Bacteria 809
1676 Ga0501073_0604705 3300049589 Bacteria 757
1677 Ga0501074_0007685 3300049590 Bacteria 7806
1678 Ga0501074_0021751 3300049590 Bacteria 4657
1679 Ga0501074_0032754 3300049590 Bacteria 3764
1680 Ga0501074_0042618 3300049590 Bacteria 3284
1681 Ga0501074_0229542 3300049590 Bacteria 1321
1682 Ga0501074_0324450 3300049590 Unclassified 1093
1683 Ga0501074_0602645 3300049590 Bacteria 777
1684 Ga0501074_0735337 3300049590 Unclassified 696
1685 Ga0501075_0006741 3300049591 Bacteria 7927
1686 Ga0501075_0012405 3300049591 Bacteria 6057
1687 Ga0501075_0021058 3300049591 Bacteria 4751
1688 Ga0501075_0038960 3300049591 Bacteria 3555
1689 Ga0501075_0042441 3300049591 Bacteria 3410
1690 Ga0501075_0074277 3300049591 Bacteria 2571
1691 Ga0501075_0095151 3300049591 Bacteria 2260
1692 Ga0501075_0153829 3300049591 Bacteria 1753
1693 Ga0501075_0240669 3300049591 Bacteria 1379
1694 Ga0501075_0442826 3300049591 Bacteria 991
1695 Ga0501075_0541864 3300049591 Bacteria 888
1696 Ga0501075_0796745 3300049591 Unclassified 719
1697 Ga0501075_0973044 3300049591 Bacteria 645
1698 Ga0501075_0994411 3300049591 Bacteria 637
1699 Ga0501075_1450743 3300049591 Unclassified 519
1700 Ga0501076_0014185 3300049592 Bacteria 5995
1701 Ga0501076_0014748 3300049592 Bacteria 5891
1702 Ga0501076_0015920 3300049592 Bacteria 5690
1703 Ga0501076_0022704 3300049592 Bacteria 4824
1704 Ga0501076_0025718 3300049592 Bacteria 4557
1705 Ga0501076_0026424 3300049592 Bacteria 4497
1706 Ga0501076_0040309 3300049592 Bacteria 3669
1707 Ga0501076_0059183 3300049592 Bacteria 3047
1708 Ga0501076_0063359 3300049592 Bacteria 2945
1709 Ga0501076_0103895 3300049592 Bacteria 2292
1710 Ga0501076_0139484 3300049592 Bacteria 1969
1711 Ga0501076_0148384 3300049592 Bacteria 1907
1712 Ga0501076_0181848 3300049592 Bacteria 1714
1713 Ga0501076_0199490 3300049592 Bacteria 1633
1714 Ga0501076_0673253 3300049592 Bacteria 854
1715 Ga0501076_1460587 3300049592 Bacteria 561
1716 Ga0501077_0002968 3300049593 Bacteria 10175
1717 Ga0501077_0003160 3300049593 Bacteria 9911
1718 Ga0501077_0010173 3300049593 Bacteria 5856
1719 Ga0501077_0019528 3300049593 Bacteria 4286
1720 Ga0501077_0030319 3300049593 Bacteria 3441
1721 Ga0501077_0049142 3300049593 Bacteria 2680
1722 Ga0501077_0057383 3300049593 Bacteria 2472
1723 Ga0501077_0081340 3300049593 Bacteria 2052
1724 Ga0501077_0081643 3300049593 Bacteria 2048
1725 Ga0501077_0179981 3300049593 Bacteria 1344
1726 Ga0501077_0391937 3300049593 Bacteria 887
1727 Ga0501077_0622466 3300049593 Bacteria 693
1728 Ga0501077_0987687 3300049593 Unclassified 542
1729 Ga0501077_1028909 3300049593 Bacteria 530
1730 Ga0501077_1123864 3300049593 Bacteria 506
1731 Ga0501202_115537 3300049652 Bacteria 669
1732 Ga0501208_057734 3300049655 Bacteria 754
1733 Ga0501225_0194502 3300049705 Bacteria 640
1734 Ga0501079_0013520 3300049741 Bacteria 6225
1735 Ga0501079_0015725 3300049741 Bacteria 5780
1736 Ga0501079_0018804 3300049741 Bacteria 5280
1737 Ga0501079_0027741 3300049741 Bacteria 4343
1738 Ga0501079_0033485 3300049741 Bacteria 3953
1739 Ga0501079_0035736 3300049741 Bacteria 3825
1740 Ga0501079_0037371 3300049741 Bacteria 3743
1741 Ga0501079_0052322 3300049741 Bacteria 3151
1742 Ga0501079_0085473 3300049741 Bacteria 2442
1743 Ga0501079_0108925 3300049741 Bacteria 2151
1744 Ga0501079_0220433 3300049741 Bacteria 1482
1745 Ga0501079_0317583 3300049741 Bacteria 1219
1746 Ga0501079_0427680 3300049741 Bacteria 1039
1747 Ga0501079_0551937 3300049741 Bacteria 906
1748 Ga0501079_0883556 3300049741 Bacteria 704
1749 Ga0501079_0916933 3300049741 Bacteria 690
1750 Ga0501079_1144707 3300049741 Bacteria 613
1751 Ga0501079_1261282 3300049741 Unclassified 582
1752 Ga0501079_1274959 3300049741 Bacteria 579
1753 Ga0501079_1446243 3300049741 Unclassified 541
1754 Ga0501079_1535306 3300049741 Bacteria 524
1755 Ga0501080_0005055 3300049742 Bacteria 11749
1756 Ga0501080_0029085 3300049742 Bacteria 5144
1757 Ga0501080_0039522 3300049742 Bacteria 4403
1758 Ga0501080_0041910 3300049742 Bacteria 4265
1759 Ga0501080_0043767 3300049742 Bacteria 4169
1760 Ga0501080_0049915 3300049742 Bacteria 3894
1761 Ga0501080_0068850 3300049742 Bacteria 3292
1762 Ga0501080_0077142 3300049742 Bacteria 3098
1763 Ga0501080_0144233 3300049742 Bacteria 2201
1764 Ga0501080_0226381 3300049742 Bacteria 1710
1765 Ga0501080_1549596 3300049742 Bacteria 562
1766 Ga0501080_1726736 3300049742 Bacteria 527
1767 Ga0501081_0005337 3300049743 Bacteria 8292
1768 Ga0501081_0014398 3300049743 Bacteria 5217
1769 Ga0501081_0023884 3300049743 Bacteria 4101
1770 Ga0501081_0032432 3300049743 Bacteria 3543
1771 Ga0501081_0051630 3300049743 Bacteria 2835
1772 Ga0501081_0054513 3300049743 Bacteria 2762
1773 Ga0501081_0070856 3300049743 Bacteria 2429
1774 Ga0501081_0133393 3300049743 Bacteria 1776
1775 Ga0501081_0153578 3300049743 Bacteria 1655
1776 Ga0501081_0337164 3300049743 Bacteria 1110
1777 Ga0501081_0341546 3300049743 Bacteria 1102
1778 Ga0501081_0348627 3300049743 Bacteria 1091
1779 Ga0501081_0358947 3300049743 Bacteria 1075
1780 Ga0501081_0594964 3300049743 Bacteria 828
1781 Ga0501081_0927018 3300049743 Unclassified 657
1782 Ga0501081_0934705 3300049743 Bacteria 654
1783 Ga0501081_0944927 3300049743 Bacteria 651
1784 Ga0501081_1143204 3300049743 Bacteria 589
1785 Ga0501081_1299926 3300049743 Bacteria 551
1786 Ga0501083_0011129 3300049744 Bacteria 6316
1787 Ga0501083_0018799 3300049744 Bacteria 4812
1788 Ga0501083_0025651 3300049744 Bacteria 4080
1789 Ga0501083_0056064 3300049744 Bacteria 2641
1790 Ga0501083_0098741 3300049744 Bacteria 1926
1791 Ga0501083_0134995 3300049744 Bacteria 1617
1792 Ga0501083_0173520 3300049744 Bacteria 1409
1793 Ga0501035_0020546 3300049822 Bacteria 6064
1794 Ga0501035_0036250 3300049822 Bacteria 4471
1795 Ga0501035_0062145 3300049822 Bacteria 3323
1796 Ga0501035_0105782 3300049822 Bacteria 2467
1797 Ga0501035_0192702 3300049822 Bacteria 1752
1798 Ga0501035_0212405 3300049822 Bacteria 1655
1799 Ga0501035_0254253 3300049822 Bacteria 1491
1800 Ga0501035_1196984 3300049822 Bacteria 590
1801 Ga0501044_0044590 3300049823 Bacteria 4601
1802 Ga0501044_0095048 3300049823 Bacteria 3004
1803 Ga0501044_0380562 3300049823 Bacteria 1326
1804 Ga0501044_0544094 3300049823 Bacteria 1059
1805 Ga0501045_0006136 3300049824 Bacteria 8326
1806 Ga0501045_0011541 3300049824 Bacteria 6205
1807 Ga0501045_0013577 3300049824 Bacteria 5754
1808 Ga0501045_0028313 3300049824 Bacteria 4040
1809 Ga0501045_0079570 3300049824 Bacteria 2416
1810 Ga0501045_0101768 3300049824 Bacteria 2127
1811 Ga0501045_0117005 3300049824 Bacteria 1978
1812 Ga0501045_0134203 3300049824 Bacteria 1840
1813 Ga0501045_0199348 3300049824 Bacteria 1491
1814 Ga0501045_0262624 3300049824 Bacteria 1285
1815 Ga0501045_0277090 3300049824 Bacteria 1248
1816 Ga0501045_0577096 3300049824 Bacteria 833
1817 Ga0501045_0577597 3300049824 Bacteria 833
1818 Ga0501045_0609276 3300049824 Bacteria 808
1819 Ga0501045_1030655 3300049824 Bacteria 603
1820 Ga0501045_1173605 3300049824 Bacteria 561
1821 Ga0501045_1200583 3300049824 Bacteria 553
1822 nmdc:mga03n38_119650_c1 3300050490 Bacteria 1292
1823 nmdc:mga03n38_130389_c1 3300050490 Bacteria 1245
1824 nmdc:mga00v17_1018011_c1 3300050491 Bacteria 521
1825 nmdc:mga00v17_1067420_c1 3300050491 Bacteria 506
1826 nmdc:mga0yw44_1181603_c1 3300050492 Bacteria 516
1827 nmdc:mga0yw44_176692_c1 3300050492 Bacteria 1404
1828 nmdc:mga0yw44_254684_c1 3300050492 Unclassified 1169
1829 nmdc:mga0yw44_30486_c1 3300050492 Bacteria 3126
1830 nmdc:mga0yw44_382092_c1 3300050492 Bacteria 951
1831 nmdc:mga06z11_73231_c1 3300050494 Bacteria 1818
1832 nmdc:mga06z11_953579_c1 3300050494 Bacteria 523
1833 nmdc:mga07m45_327816_c1 3300050496 Bacteria 890
1834 nmdc:mga05p37_1302037_c1 3300050507 Bacteria 741
1835 nmdc:mga05p37_143122_c1 3300050507 Bacteria 2929
1836 nmdc:mga05p37_1597122_c1 3300050507 Unclassified 643
1837 nmdc:mga05p37_2157702_c1 3300050507 Unclassified 519
1838 nmdc:mga05p37_259469_c1 3300050507 Bacteria 2081
1839 nmdc:mga05p37_366184_c1 3300050507 Bacteria 1693
1840 nmdc:mga05p37_37598_c1 3300050507 Bacteria 5936
1841 nmdc:mga05p37_6099_c1 3300050507 Bacteria 14195
1842 nmdc:mga05p37_789549_c1 3300050507 Bacteria 1040
1843 nmdc:mga05p37_846584_c1 3300050507 Unclassified 994
1844 nmdc:mga05p37_85883_c1 3300050507 Bacteria 3878
1845 nmdc:mga09592_1452417_c1 3300050508 Bacteria 559
1846 nmdc:mga09592_17464_c1 3300050508 Bacteria 5877
1847 nmdc:mga09592_258802_c1 3300050508 Bacteria 1509
1848 nmdc:mga09592_552863_c1 3300050508 Bacteria 989
1849 nmdc:mga09592_844670_c1 3300050508 Unclassified 772
1850 nmdc:mga0qj67_102436_c1 3300050509 Bacteria 2308
1851 nmdc:mga0qj67_86193_c1 3300050509 Bacteria 2520
1852 nmdc:mga06r32_157945_c1 3300050510 Bacteria 2250
1853 nmdc:mga06r32_264597_c1 3300050510 Bacteria 1707
1854 nmdc:mga06r32_531736_c1 3300050510 Bacteria 1151
1855 nmdc:mga06r32_825542_c1 3300050510 Bacteria 886
1856 nmdc:mga08y16_10863_c1 3300050511 Bacteria 9563
1857 nmdc:mga08y16_1240142_c1 3300050511 Unclassified 715
1858 nmdc:mga08y16_1400235_c1 3300050511 Bacteria 663
1859 nmdc:mga08y16_192677_c1 3300050511 Bacteria 2114
1860 nmdc:mga08y16_230320_c1 3300050511 Bacteria 1916
1861 nmdc:mga08y16_460968_c1 3300050511 Bacteria 1295
1862 nmdc:mga08y16_472875_c1 3300050511 Bacteria 1276
1863 nmdc:mga08y16_59955_c1 3300050511 Bacteria 3975
1864 nmdc:mga08y16_662693_c1 3300050511 Viruses 1047
1865 nmdc:mga08y16_994674_c1 3300050511 Bacteria 819
1866 nmdc:mga0n895_292131_c1 3300050512 Bacteria 1652
1867 nmdc:mga0n895_320963_c1 3300050512 Bacteria 1570
1868 nmdc:mga0n895_321690_c1 3300050512 Bacteria 1568
1869 nmdc:mga0n895_625350_c1 3300050512 Bacteria 1077
1870 nmdc:mga0rr50_340238_c1 3300050513 Bacteria 1261
1871 nmdc:mga0rr50_76680_c1 3300050513 Bacteria 2567
1872 nmdc:mga08x19_25564_c1 3300050514 Bacteria 3679
1873 nmdc:mga08x19_285560_c1 3300050514 Bacteria 1144
1874 nmdc:mga08x19_45484_c1 3300050514 Bacteria 2805
1875 nmdc:mga08x19_455034_c1 3300050514 Bacteria 901
1876 nmdc:mga08x19_504073_c1 3300050514 Unclassified 855
1877 nmdc:mga08x19_745889_c1 3300050514 Bacteria 695
1878 nmdc:mga08x19_79298_c1 3300050514 Bacteria 2153
1879 nmdc:mga0a205_1008824_c1 3300050515 Bacteria 679
1880 nmdc:mga0a205_108520_c1 3300050515 Bacteria 2674
1881 nmdc:mga0a205_267850_c1 3300050515 Bacteria 1586
1882 nmdc:mga0a205_4875_c1 3300050515 Bacteria 12070
1883 nmdc:mga0a205_584070_c1 3300050515 Bacteria 971
1884 nmdc:mga0a205_723269_c1 3300050515 Bacteria 845
1885 Ga0495612_0098898 3300053078 Bacteria 1241
1886 Ga0495655_0048842 3300053083 Bacteria 1112
1887 Ga0495655_0064262 3300053083 Bacteria 1010
1888 Ga0495655_0285286 3300053083 Unclassified 564
1889 Ga0495595_0195537 3300053084 Bacteria 1006
1890 Ga0495595_0526165 3300053084 Bacteria 603
1891 Ga0495619_0054047 3300053085 Bacteria 2657
1892 Ga0495619_0148941 3300053085 Bacteria 1614
1893 Ga0495619_0235038 3300053085 Bacteria 1270
1894 Ga0500628_116877 3300053129 Bacteria 721
1895 Ga0501084_0006937 3300054114 Bacteria 9329
1896 Ga0501084_0011448 3300054114 Bacteria 7346
1897 Ga0501084_0016867 3300054114 Bacteria 6068
1898 Ga0501084_0017787 3300054114 Bacteria 5915
1899 Ga0501084_0040475 3300054114 Bacteria 3898
1900 Ga0501084_0046052 3300054114 Bacteria 3652
1901 Ga0501084_0046697 3300054114 Bacteria 3627
1902 Ga0501084_0095429 3300054114 Bacteria 2498
1903 Ga0501084_0164029 3300054114 Bacteria 1875
1904 Ga0501084_0177475 3300054114 Bacteria 1798
1905 Ga0501084_0329999 3300054114 Bacteria 1288
1906 Ga0501084_0522325 3300054114 Bacteria 1003
1907 Ga0501084_0682486 3300054114 Bacteria 866
1908 Ga0501084_0962482 3300054114 Unclassified 718
1909 Ga0501084_1066294 3300054114 Unclassified 679
1910 Ga0501084_1222884 3300054114 Unclassified 630
1911 Ga0501084_1504912 3300054114 Bacteria 563
1912 Ga0501084_1640131 3300054114 Bacteria 537
1913 Ga0590071_029483 3300059421 Bacteria 1304
1914 Ga0590075_004855 3300059424 Bacteria 3180
1915 Ga0590075_033100 3300059424 Bacteria 1312
1916 Ga0587084_157993 3300059477 Unclassified 503
1917 Ga0587066_093327 3300059490 Bacteria 672
1918 Ga0587070_130812 3300059491 Bacteria 610
1919 Ga0587090_139335 3300059510 Bacteria 541
1920 Ga0587091_125332 3300059511 Bacteria 628
1921 Ga0587092_126990 3300059512 Bacteria 550
1922 Ga0587115_070084 3300059626 Unclassified 604
1923 Ga0587076_168735 3300059645 Bacteria 543
1924 Ga0587079_235290 3300059647 Bacteria 515
1925 Ga0587114_142219 3300059655 Bacteria 502
1926 Ga0501082_0009266 3300060353 Bacteria 8486
1927 Ga0501082_0025322 3300060353 Bacteria 5112
1928 Ga0501082_0029396 3300060353 Bacteria 4734
1929 Ga0501082_0030784 3300060353 Bacteria 4626
1930 Ga0501082_0033584 3300060353 Bacteria 4426
1931 Ga0501082_0071463 3300060353 Bacteria 2988
1932 Ga0501082_0075961 3300060353 Bacteria 2895
1933 Ga0501082_0107127 3300060353 Bacteria 2418
1934 Ga0501082_0174915 3300060353 Bacteria 1866
1935 Ga0501082_0217365 3300060353 Bacteria 1663
1936 Ga0501082_0256117 3300060353 Bacteria 1523
1937 Ga0501082_0669774 3300060353 Bacteria 908
1938 Ga0501082_0677469 3300060353 Bacteria 903
1939 Ga0501082_1100455 3300060353 Bacteria 695
1940 Ga0501082_1144842 3300060353 Bacteria 680
1941 Ga0501082_1369625 3300060353 Unclassified 618
1942 Ga0501082_1483412 3300060353 Bacteria 592
1943 Ga0530510_0004573 3300061734 Bacteria 9571
1944 Ga0530510_0005299 3300061734 Bacteria 8912
1945 Ga0530510_0039570 3300061734 Bacteria 3404
1946 Ga0530510_0048859 3300061734 Bacteria 3057
1947 Ga0530510_0059205 3300061734 Bacteria 2770
1948 Ga0530510_0070521 3300061734 Bacteria 2537
1949 Ga0530510_0092860 3300061734 Bacteria 2203
1950 Ga0530510_0222286 3300061734 Bacteria 1404
1951 Ga0530510_0336149 3300061734 Bacteria 1133
1952 Ga0530510_0343790 3300061734 Bacteria 1120
1953 Ga0530510_0350561 3300061734 Bacteria 1109
1954 Ga0530510_0355026 3300061734 Bacteria 1101
1955 Ga0530510_0564009 3300061734 Bacteria 865
1956 Ga0530510_0684747 3300061734 Bacteria 781
1957 Ga0530510_0960835 3300061734 Unclassified 653
1958 Ga0530510_0995624 3300061734 Bacteria 641
1959 Ga0070683_100144441
1960 ARcpr5oldR_c002177
1961 ARcpr5yngRDRAFT_c003093
1962 ARSoilOldRDRAFT_c029933
1963 ARCol0yngRDRAFT_1012314
1964 JGI24746J21847_1033644
1965 JGI24739J22299_10029318
1966 JGI24737J22298_10203090
1967 JGI24743J22301_10011312
1968 JGI24750J21931_1080031
1969 JGI24748J21848_1037401
1970 JGI24738J21930_10026763
1971 JGI24744J21845_10010582
1972 JGI24744J21845_10042346
1973 JGI24033J26618_1025498
1974 JGI24742J22300_10052558
1975 JGI24742J22300_10115031
1976 JGI24742J22300_10120749
1977 JGI24751J29686_10012957
1978 JGI24751J29686_10105521
1979 JGI25406J46586_10007814
1980 Ga0058859_11466280
1981 Ga0065712_10321828
1982 Ga0070658_10034020
1983 Ga0070658_10223620
1984 Ga0070676_10295817
1985 Ga0070676_10802745
1986 Ga0070676_11240665
1987 Ga0070683_100030559
1988 Ga0070683_100093597
1989 Ga0070683_100107520
1990 Ga0070683_100628841
1991 Ga0070683_101219148
1992 Ga0070683_101915058
1993 Ga0070690_100088437
1994 Ga0070690_100189897
1995 Ga0070690_100440579
1996 Ga0070670_100035122
1997 Ga0070670_100090955
1998 Ga0070670_101571225
1999 Ga0070677_10181722
2000 Ga0070677_10479080
2001 Ga0068869_100095555
2002 Ga0068869_100242077
2003 Ga0068869_100910443
2004 Ga0068869_101499566
2005 Ga0070666_10187625
2006 Ga0070666_10254454
2007 Ga0070666_10351510
2008 Ga0070666_10757817
2009 Ga0070680_100094191
2010 Ga0070680_100280581
2011 Ga0070682_100021835
2012 Ga0070682_100145702
2013 Ga0070682_100146983
2014 Ga0070682_100222468
2015 Ga0070682_101494996
2016 Ga0070682_101703143
2017 Ga0068868_100004645
2018 Ga0068868_100036276
2019 Ga0068868_100036558
2020 Ga0068868_100107743
2021 Ga0068868_100306229
2022 Ga0068868_100411464
2023 Ga0068868_100505075
2024 Ga0068868_100583503
2025 Ga0068868_101332347
2026 Ga0068868_101506434
2027 Ga0068868_101602335
2028 Ga0070660_100051168
2029 Ga0070660_100212716
2030 Ga0070660_100216349
2031 Ga0070660_100384759
2032 Ga0070660_101565459
2033 Ga0070660_101639298
2034 Ga0070660_101717161
2035 Ga0070689_100075585
2036 Ga0070689_100392350
2037 Ga0070689_100474709
2038 Ga0070691_10000781
2039 Ga0070691_10050107
2040 Ga0070687_100035058
2041 Ga0070687_100050997
2042 Ga0070687_100057945
2043 Ga0070687_100231667
2044 Ga0070687_100400774
2045 Ga0070661_100127493
2046 Ga0070661_100291282
2047 Ga0070661_100350634
2048 Ga0070661_100584411
2049 Ga0070661_100615685
2050 Ga0070661_101165736
2051 Ga0070692_10006436
2052 Ga0070692_10019140
2053 Ga0070692_10244186
2054 Ga0070692_10525884
2055 Ga0070668_100052043
2056 Ga0070668_100138126
2057 Ga0070668_100765461
2058 Ga0070669_100116311
2059 Ga0070669_100137167
2060 Ga0070669_101121927
2061 Ga0070669_101461091
2062 Ga0070669_101625241
2063 Ga0070669_101702887
2064 Ga0070675_100059601
2065 Ga0070675_100086477
2066 Ga0070675_100114149
2067 Ga0070675_100355596
2068 Ga0070675_100369674
2069 Ga0070671_100132893
2070 Ga0070671_100276851
2071 Ga0070671_100377988
2072 Ga0070674_100012612
2073 Ga0070674_100017188
2074 Ga0070674_100018721
2075 Ga0070674_100068919
2076 Ga0070674_100108733
2077 Ga0070674_100171519
2078 Ga0070674_100331376
2079 Ga0070674_100383673
2080 Ga0070674_100539557
2081 Ga0070674_101460090
2082 Ga0070674_101705391
2083 Ga0070673_100051568
2084 Ga0070673_100628174
2085 Ga0070673_100703896
2086 Ga0070673_101095620
2087 Ga0070673_101784467
2088 Ga0070673_102046588
2089 Ga0070688_100008188
2090 Ga0070688_100034129
2091 Ga0070688_100500419
2092 Ga0070688_100951268
2093 Ga0070688_101644248
2094 Ga0070659_100039369
2095 Ga0070659_100063946
2096 Ga0070659_100597798
2097 Ga0070659_100953356
2098 Ga0070659_101014896
2099 Ga0070659_101801151
2100 Ga0070667_100753352
2101 Ga0070667_100957960
2102 Ga0070703_10016151
2103 Ga0070703_10036500
2104 Ga0070703_10156817
2105 Ga0070709_10067280
2106 Ga0070713_100278927
2107 Ga0070713_102195319
2108 Ga0070710_10009995
2109 Ga0070710_11051265
2110 Ga0070701_10011271
2111 Ga0070701_10075200
2112 Ga0070701_10177726
2113 Ga0070701_10227411
2114 Ga0070701_10343113
2115 Ga0070701_10514926
2116 Ga0070701_10690002
2117 Ga0070701_11357721
2118 Ga0070711_100017725
2119 Ga0070711_100052554
2120 Ga0070711_101542818
2121 Ga0070705_100128329
2122 Ga0070705_100186589
2123 Ga0070705_100273433
2124 Ga0070705_100557331
2125 Ga0070700_100008857
2126 Ga0070700_100015485
2127 Ga0070700_100021254
2128 Ga0070700_100078357
2129 Ga0070700_100241941
2130 Ga0070700_100332074
2131 Ga0070700_100827844
2132 Ga0070700_101834976
2133 Ga0070694_100006011
2134 Ga0070694_100072927
2135 Ga0070694_100469242
2136 Ga0070694_100579264
2137 Ga0070708_100023029
2138 Ga0070708_100440174
2139 Ga0070663_100129955
2140 Ga0070663_100131454
2141 Ga0070663_101422877
2142 Ga0070678_100001665
2143 Ga0070678_100004139
2144 Ga0070678_100099170
2145 Ga0070678_100424304
2146 Ga0070678_100571999
2147 Ga0070678_100862365
2148 Ga0070678_101258248
2149 Ga0070678_101717593
2150 Ga0070678_102226809
2151 Ga0070662_100022184
2152 Ga0070662_100164014
2153 Ga0070662_100431495
2154 Ga0070662_100737896
2155 Ga0070662_101062150
2156 Ga0070681_10086083
2157 Ga0070681_10538165
2158 Ga0070681_10776921
2159 Ga0070681_10825285
2160 Ga0070681_11359076
2161 Ga0068867_100000419
2162 Ga0068867_100082047
2163 Ga0068867_100226075
2164 Ga0068867_100411630
2165 Ga0068867_100431975
2166 Ga0068867_100863571
2167 Ga0068867_101211148
2168 Ga0068867_101351710
2169 Ga0068867_101450244
2170 Ga0068867_101822016
2171 Ga0070685_10003141
2172 Ga0070685_10009061
2173 Ga0070685_10012527
2174 Ga0070685_10024284
2175 Ga0070685_10115620
2176 Ga0070685_10295037
2177 Ga0070685_11595472
2178 Ga0070706_100007379
2179 Ga0070706_100085948
2180 Ga0070706_100524596
2181 Ga0070707_100000635
2182 Ga0070707_100042074
2183 Ga0070707_101431018
2184 Ga0070707_101772126
2185 Ga0070707_101805743
2186 Ga0070698_100074422
2187 Ga0070698_100284930
2188 Ga0070698_100294761
2189 Ga0070698_100362479
2190 Ga0070698_100664390
2191 Ga0070698_101922499
2192 Ga0070699_100146449
2193 Ga0070699_100259360
2194 Ga0070699_101089913
2195 Ga0070699_102035496
2196 Ga0070699_102132555
2197 Ga0070679_100001403
2198 Ga0070679_100116411
2199 Ga0070679_100329864
2200 Ga0070684_100068309
2201 Ga0070684_100092820
2202 Ga0070684_100132652
2203 Ga0070684_100187851
2204 Ga0070684_100196608
2205 Ga0070684_100202774
2206 Ga0070684_100216839
2207 Ga0070684_100268161
2208 Ga0070684_100988696
2209 Ga0070684_101012417
2210 Ga0070697_100827937
2211 Ga0070697_101151354
2212 Ga0070697_101999752
2213 Ga0068853_100002053
2214 Ga0068853_100012231
2215 Ga0068853_100165074
2216 Ga0068853_101477199
2217 Ga0070672_100029658
2218 Ga0070672_100089935
2219 Ga0070672_100090127
2220 Ga0070672_100093704
2221 Ga0070672_100620362
2222 Ga0070672_101682915
2223 Ga0070686_100013865
2224 Ga0070686_100068848
2225 Ga0070686_100755880
2226 Ga0070686_100860353
2227 Ga0070686_101158413
2228 Ga0070686_101213581
2229 Ga0070686_101360329
2230 Ga0070695_100727527
2231 Ga0070695_100850565
2232 Ga0070695_101252121
2233 Ga0070695_101425125
2234 Ga0070696_100052553
2235 Ga0070696_100188523
2236 Ga0070696_100189412
2237 Ga0070696_100414604
2238 Ga0070696_100505644
2239 Ga0070696_100632559
2240 Ga0070693_100037999
2241 Ga0070693_100436609
2242 Ga0070693_100455653
2243 Ga0070665_100057777
2244 Ga0070665_100195649
2245 Ga0070665_100349722
2246 Ga0070665_101975877
2247 Ga0070704_100011069
2248 Ga0070704_100041763
2249 Ga0070704_100130883
2250 Ga0070704_100883396
2251 Ga0068855_100070836
2252 Ga0068855_100492816
2253 Ga0068855_101277448
2254 Ga0070664_100015680
2255 Ga0070664_100040958
2256 Ga0070664_100190360
2257 Ga0070664_100201688
2258 Ga0070664_100450391
2259 Ga0070664_100563873
2260 Ga0070664_100591979
2261 Ga0070664_100596916
2262 Ga0068857_100086906
2263 Ga0068857_100302560
2264 Ga0068857_100347802
2265 Ga0068857_100776531
2266 Ga0068854_100163424
2267 Ga0068854_100422521
2268 Ga0068854_101270942
2269 Ga0068856_100095770
2270 Ga0068856_100501872
2271 Ga0068856_100548110
2272 Ga0070702_100004258
2273 Ga0070702_100004263
2274 Ga0070702_100133479
2275 Ga0070702_100192565
2276 Ga0070702_100309865
2277 Ga0070702_100963269
2278 Ga0070702_101197582
2279 Ga0068852_100002371
2280 Ga0068852_100040437
2281 Ga0068852_100718449
2282 Ga0068852_100807019
2283 Ga0068852_100943671
2284 Ga0068852_101497896
2285 Ga0068852_102607359
2286 Ga0068859_100588919
2287 Ga0068859_100709683
2288 Ga0068864_100027376
2289 Ga0068864_100143287
2290 Ga0068864_100167875
2291 Ga0068864_100554087
2292 Ga0068864_100820924
2293 Ga0068864_101777116
2294 Ga0068866_10001799
2295 Ga0068866_10091983
2296 Ga0068866_10093140
2297 Ga0068866_10156986
2298 Ga0068866_10221062
2299 Ga0068866_10854030
2300 Ga0068861_100014718
2301 Ga0068861_100372807
2302 Ga0068861_100435971
2303 Ga0068861_100485676
2304 Ga0068861_101848275
2305 Ga0068861_102006662
2306 Ga0068851_10024007
2307 Ga0068870_10002500
2308 Ga0068870_10003552
2309 Ga0068870_10613563
2310 Ga0068870_11222169
2311 Ga0068863_100138507
2312 Ga0068863_100952274
2313 Ga0068863_101058552
2314 Ga0068858_100015199
2315 Ga0068860_100129535
2316 Ga0068860_100223434
2317 Ga0068860_100457186
2318 Ga0068862_100245095
2319 Ga0068862_100787121
2320 Ga0068862_100805977
2321 Ga0068862_100961371
2322 Ga0068862_101520990
2323 Ga0081455_10011661
2324 Ga0081455_10024025
2325 Ga0081455_10041491
2326 Ga0081455_10055663
2327 Ga0081455_10081973
2328 Ga0081455_10618089
2329 Ga0081455_10806584
2330 Ga0081538_10110862
2331 Ga0081538_10238767
2332 Ga0081540_1283617
2333 Ga0081539_10001263
2334 Ga0081539_10044508
2335 Ga0081539_10270896
2336 Ga0070717_10154436
2337 Ga0075365_10164734
2338 Ga0075365_10207403
2339 Ga0075365_10275801
2340 Ga0075365_10308570
2341 Ga0075365_10312402
2342 Ga0075368_10027686
2343 Ga0075363_100120444
2344 Ga0075363_100946299
2345 Ga0075364_10182424
2346 Ga0075364_10203298
2347 Ga0075432_10006412
2348 Ga0075432_10027343
2349 Ga0075432_10197840
2350 Ga0075432_10215153
2351 Ga0075432_10225096
2352 Ga0070715_10097896
2353 Ga0070716_100113437
2354 Ga0070716_100810523
2355 Ga0070712_100011677
2356 Ga0070712_100349498
2357 Ga0070712_100396016
2358 Ga0070712_100726067
2359 Ga0070712_101877371
2360 Ga0075362_10420044
2361 Ga0075367_10300116
2362 Ga0075367_10733676
2363 Ga0075367_10795318
2364 Ga0097621_100005304
2365 Ga0097621_100091151
2366 Ga0097621_100939578
2367 Ga0075370_10231634
2368 Ga0068871_100003722
2369 Ga0068871_100035544
2370 Ga0068871_100083298
2371 Ga0068871_100472532
2372 Ga0068871_100488067
2373 Ga0068871_101150220
2374 Ga0068871_101901279
2375 Ga0075428_100000369
2376 Ga0075428_100005557
2377 Ga0075428_100326752
2378 Ga0075428_101036234
2379 Ga0075428_101065516
2380 Ga0075428_101383876
2381 Ga0075430_100004112
2382 Ga0075430_100040721
2383 Ga0075431_100012539
2384 Ga0075431_100132018
2385 Ga0075431_100165543
2386 Ga0075431_101213341
2387 Ga0075431_101620792
2388 Ga0075433_10040442
2389 Ga0075433_10438138
2390 Ga0075433_10463648
2391 Ga0075433_10475575
2392 Ga0075433_10697038
2393 Ga0075433_11708315
2394 Ga0075434_100192329
2395 Ga0075434_100205399
2396 Ga0075434_100433538
2397 Ga0075434_100510717
2398 Ga0075434_100817970
2399 Ga0075434_102363588
2400 Ga0075429_100011703
2401 Ga0075429_100030514
2402 Ga0075429_100399516
2403 Ga0075429_100876547
2404 Ga0068865_100000269
2405 Ga0068865_100079561
2406 Ga0068865_100180865
2407 Ga0068865_100218127
2408 Ga0068865_100371598
2409 Ga0068865_100459129
2410 Ga0068865_101427238
2411 Ga0068865_102047531
2412 Ga0075436_100004039
2413 Ga0075436_100052705
2414 Ga0075436_100193893
2415 Ga0075436_100244410
2416 Ga0075436_100268952
2417 Ga0075436_100800624
2418 Ga0075436_100893725
2419 Ga0075436_101354552
2420 Ga0097620_100588925
2421 Ga0097620_100709648
2422 Ga0075435_100008556
2423 Ga0075435_100069236
2424 Ga0075435_100421232
2425 Ga0075435_100781117
2426 Ga0075435_101804005
2427 Ga0099794_10124121
2428 Ga0105251_10545624
2429 Ga0105244_10446431
2430 Ga0111539_10001582
2431 Ga0111539_10019651
2432 Ga0111539_10034653
2433 Ga0111539_10056875
2434 Ga0111539_10282038
2435 Ga0111539_10336487
2436 Ga0111539_10390216
2437 Ga0111539_10398790
2438 Ga0111539_10678207
2439 Ga0111539_10886383
2440 Ga0111539_11004528
2441 Ga0111539_11560908
2442 Ga0111539_11745516
2443 Ga0111539_12578912
2444 Ga0105245_10007978
2445 Ga0105245_10008137
2446 Ga0105245_10027262
2447 Ga0105245_10145927
2448 Ga0105245_10214465
2449 Ga0105245_10229027
2450 Ga0105245_10232489
2451 Ga0105245_10304818
2452 Ga0105245_10323251
2453 Ga0105245_10360111
2454 Ga0105245_11451147
2455 Ga0105245_12658804
2456 Ga0105247_10022080
2457 Ga0105247_10282546
2458 Ga0105247_10963814
2459 Ga0105247_11673921
2460 Ga0114129_10001278
2461 Ga0114129_10021820
2462 Ga0114129_10029357
2463 Ga0114129_10153264
2464 Ga0114129_10224614
2465 Ga0114129_10233403
2466 Ga0114129_10249409
2467 Ga0114129_10284065
2468 Ga0114129_10636896
2469 Ga0114129_11102219
2470 Ga0114129_11233221
2471 Ga0114129_11275508
2472 Ga0105243_10002162
2473 Ga0105243_10007875
2474 Ga0105243_10011092
2475 Ga0105243_10016268
2476 Ga0105243_10021934
2477 Ga0105243_10040153
2478 Ga0105243_10118512
2479 Ga0105243_10264560
2480 Ga0105243_10299862
2481 Ga0105243_10486371
2482 Ga0105243_10844117
2483 Ga0105243_11827459
2484 Ga0105241_10708564
2485 Ga0105241_10829708
2486 Ga0105241_11635600
2487 Ga0105241_11768283
2488 Ga0105242_10012809
2489 Ga0105242_10077596
2490 Ga0105242_10168633
2491 Ga0105242_10216289
2492 Ga0105242_10267767
2493 Ga0105242_10360670
2494 Ga0105242_11019777
2495 Ga0105242_11679693
2496 Ga0105242_12954459
2497 Ga0105248_10012514
2498 Ga0105248_10045934
2499 Ga0105248_10523449
2500 Ga0105248_10752253
2501 Ga0105248_10868549
2502 Ga0105248_10913093
2503 Ga0105248_11143686
2504 Ga0105237_10053556
2505 Ga0105237_10424321
2506 Ga0105237_11500405
2507 Ga0105238_10022048
2508 Ga0105238_10337223
2509 Ga0105238_10368876
2510 Ga0105238_10377674
2511 Ga0105238_11062898
2512 Ga0105238_12171292
2513 Ga0105249_10019358
2514 Ga0105249_10112581
2515 Ga0105249_10254474
2516 Ga0105249_10618041
2517 Ga0105249_11072764
2518 Ga0105249_11711385
2519 Ga0105249_11843250
2520 Ga0105030_110738
2521 Ga0105239_10040773
2522 Ga0105239_10061619
2523 Ga0105239_10073297
2524 Ga0105239_10095144
2525 Ga0105239_10550067
2526 Ga0105239_10630896
2527 Ga0105239_10941223
2528 Ga0105239_12949968
2529 Ga0105246_10004161
2530 Ga0105246_10022665
2531 Ga0105246_10042946
2532 Ga0105246_10116600
2533 Ga0105246_10128482
2534 Ga0105246_10319343
2535 Ga0105246_10324430
2536 Ga0105246_10417988
2537 Ga0105246_10553326
2538 Ga0105246_10871806
2539 Ga0105246_11057693
2540 Ga0105246_11236398
2541 Ga0157322_1036125
2542 Ga0157313_1013634
2543 Ga0157324_1015704
2544 Ga0157373_10074264
2545 Ga0157373_10658848
2546 Ga0157373_10863033
2547 Ga0157371_10003237
2548 Ga0157371_10182684
2549 Ga0157371_10373942
2550 Ga0157371_10696651
2551 Ga0157371_10721469
2552 Ga0157370_10123060
2553 Ga0157370_10965341
2554 Ga0157369_11533620
2555 Ga0157369_11782301
2556 Ga0157374_10059544
2557 Ga0157374_10346258
2558 Ga0157374_12645259
2559 Ga0157378_10011528
2560 Ga0157378_10049175
2561 Ga0157378_10590266
2562 Ga0157378_10865412
2563 Ga0157378_11147329
2564 Ga0157378_11454375
2565 Ga0157378_12521010
2566 Ga0163162_10028626
2567 Ga0163162_10136725
2568 Ga0163162_10350658
2569 Ga0163162_10815397
2570 Ga0163162_11559461
2571 Ga0163162_12330449
2572 Ga0157372_10008369
2573 Ga0157372_10394584
2574 Ga0157372_10651077
2575 Ga0157372_11239548
2576 Ga0157372_11275511
2577 Ga0157372_12677215
2578 Ga0157375_10012667
2579 Ga0157375_10023843
2580 Ga0157375_10028457
2581 Ga0157375_10043940
2582 Ga0157375_10049906
2583 Ga0157375_10064424
2584 Ga0157375_10117670
2585 Ga0157375_10423698
2586 Ga0157375_10430803
2587 Ga0157375_11189805
2588 Ga0157375_11280285
2589 Ga0163163_10052644
2590 Ga0163163_10216277
2591 Ga0163163_10259255
2592 Ga0163163_10293576
2593 Ga0163163_10889711
2594 Ga0163163_11042362
2595 Ga0163163_11517716
2596 Ga0163163_11983933
2597 Ga0157380_10031445
2598 Ga0157380_10044826
2599 Ga0157380_10045856
2600 Ga0157380_10088507
2601 Ga0157380_10118482
2602 Ga0157380_10541352
2603 Ga0157380_10685253
2604 Ga0157380_11583899
2605 Ga0157380_12390040
2606 Ga0157380_12857561
2607 Ga0157377_10005311
2608 Ga0157377_10010385
2609 Ga0157377_10021987
2610 Ga0157377_10074303
2611 Ga0157377_10155151
2612 Ga0157377_10290880
2613 Ga0157377_10367977
2614 Ga0157377_10958061
2615 Ga0157379_10216341
2616 Ga0157379_10630421
2617 Ga0157379_10994500
2618 Ga0157379_11793521
2619 Ga0157376_10007465
2620 Ga0157376_10026686
2621 Ga0157376_10134689
2622 Ga0157376_10316018
2623 Ga0157376_10832664
2624 Ga0157376_11302972
2625 Ga0157376_12777490
2626 Ga0163161_10141290
2627 Ga0163161_10187100
2628 Ga0163161_10294954
2629 Ga0163161_10906087
2630 Ga0163161_11037735
2631 Ga0163161_11167827
2632 Ga0163161_11615187
2633 Ga0197907_10819896
2634 Ga0206356_10492736
2635 Ga0206354_10240647
2636 Ga0206353_11564503
2637 Ga0206353_11939242
2638 Ga0224712_10186629
2639 Ga0207697_10313437
2640 Ga0207653_10024307
2641 Ga0207653_10159217
2642 Ga0207682_10287375
2643 Ga0207682_10485370
2644 Ga0207692_10120397
2645 Ga0207692_10478755
2646 Ga0207692_10595949
2647 Ga0207642_10002284
2648 Ga0207642_10041407
2649 Ga0207642_10280131
2650 Ga0207642_10420466
2651 Ga0207642_10476017
2652 Ga0207710_10011778
2653 Ga0207688_10004625
2654 Ga0207688_10036367
2655 Ga0207688_10082129
2656 Ga0207688_10138723
2657 Ga0207688_10210054
2658 Ga0207680_10117944
2659 Ga0207680_10121380
2660 Ga0207680_10294909
2661 Ga0207647_10118869
2662 Ga0207647_10358296
2663 Ga0207685_10051713
2664 Ga0207699_10194661
2665 Ga0207645_10091719
2666 Ga0207645_10194195
2667 Ga0207643_10006654
2668 Ga0207643_10015663
2669 Ga0207643_10158217
2670 Ga0207643_10212126
2671 Ga0207643_10830939
2672 Ga0207705_10184648
2673 Ga0207705_10766480
2674 Ga0207684_10003747
2675 Ga0207684_10511654
2676 Ga0207684_10589783
2677 Ga0207684_10783191
2678 Ga0207684_10927556
2679 Ga0207654_10950918
2680 Ga0207707_10061685
2681 Ga0207707_10261499
2682 Ga0207707_10921784
2683 Ga0207671_10164000
2684 Ga0207671_10202555
2685 Ga0207671_10643754
2686 Ga0207693_10001049
2687 Ga0207693_10033187
2688 Ga0207693_10462767
2689 Ga0207663_10110772
2690 Ga0207663_11239423
2691 Ga0207660_10218270
2692 Ga0207660_10252878
2693 Ga0207660_10535079
2694 Ga0207662_10007345
2695 Ga0207662_10026650
2696 Ga0207662_10076125
2697 Ga0207662_10163016
2698 Ga0207657_10005734
2699 Ga0207657_10125198
2700 Ga0207657_10143227
2701 Ga0207657_10155186
2702 Ga0207657_10370995
2703 Ga0207649_10023736
2704 Ga0207649_10058793
2705 Ga0207649_11148579
2706 Ga0207649_11652916
2707 Ga0207652_10014907
2708 Ga0207652_10190678
2709 Ga0207646_10002084
2710 Ga0207646_10106219
2711 Ga0207646_10860160
2712 Ga0207646_10878439
2713 Ga0207681_10569950
2714 Ga0207681_11192999
2715 Ga0207681_11313569
2716 Ga0207694_10033429
2717 Ga0207694_10236562
2718 Ga0207694_10616994
2719 Ga0207650_10027425
2720 Ga0207650_10512245
2721 Ga0207650_11120141
2722 Ga0207650_11653268
2723 Ga0207650_11697645
2724 Ga0207659_10125186
2725 Ga0207659_10185936
2726 Ga0207659_10203621
2727 Ga0207659_10725789
2728 Ga0207659_11240047
2729 Ga0207659_11454286
2730 Ga0207687_10061086
2731 Ga0207687_10082800
2732 Ga0207687_10084108
2733 Ga0207687_10127390
2734 Ga0207687_10194515
2735 Ga0207687_10588203
2736 Ga0207687_10656036
2737 Ga0207687_10883157
2738 Ga0207687_11181756
2739 Ga0207687_11446366
2740 Ga0207644_10076517
2741 Ga0207644_10113490
2742 Ga0207644_10303626
2743 Ga0207644_11371718
2744 Ga0207690_10036657
2745 Ga0207690_10047809
2746 Ga0207690_10553397
2747 Ga0207690_11117598
2748 Ga0207706_10029290
2749 Ga0207706_10083534
2750 Ga0207706_10253951
2751 Ga0207706_10965514
2752 Ga0207706_11266353
2753 Ga0207686_10018659
2754 Ga0207686_10067059
2755 Ga0207686_10074148
2756 Ga0207686_10279194
2757 Ga0207686_10306238
2758 Ga0207686_11017245
2759 Ga0207709_10002279
2760 Ga0207709_10005971
2761 Ga0207709_10073974
2762 Ga0207709_10080848
2763 Ga0207709_10105143
2764 Ga0207709_10300259
2765 Ga0207709_10351343
2766 Ga0207709_10407980
2767 Ga0207709_10821738
2768 Ga0207709_11690015
2769 Ga0207670_10069263
2770 Ga0207670_10482394
2771 Ga0207670_11230475
2772 Ga0207669_10005001
2773 Ga0207669_10145651
2774 Ga0207669_10147643
2775 Ga0207669_10163500
2776 Ga0207669_10171463
2777 Ga0207669_10230351
2778 Ga0207669_10771895
2779 Ga0207669_11264158
2780 Ga0207669_11792750
2781 Ga0207704_10037206
2782 Ga0207704_10115558
2783 Ga0207704_10160711
2784 Ga0207704_10302720
2785 Ga0207704_10321134
2786 Ga0207704_10396629
2787 Ga0207704_10411941
2788 Ga0207704_10986741
2789 Ga0207704_11011654
2790 Ga0207704_11490942
2791 Ga0207665_11166650
2792 Ga0207691_10006369
2793 Ga0207691_10010651
2794 Ga0207691_10089027
2795 Ga0207691_10105454
2796 Ga0207691_10158656
2797 Ga0207691_10171134
2798 Ga0207711_10048602
2799 Ga0207711_10148242
2800 Ga0207711_10931916
2801 Ga0207711_11039159
2802 Ga0207711_11612532
2803 Ga0207689_10029711
2804 Ga0207689_10046032
2805 Ga0207689_10143327
2806 Ga0207689_10458659
2807 Ga0207689_10620642
2808 Ga0207661_10008635
2809 Ga0207661_10046214
2810 Ga0207661_10074976
2811 Ga0207661_10147981
2812 Ga0207661_10168050
2813 Ga0207661_10309104
2814 Ga0207661_10734066
2815 Ga0207661_10972888
2816 Ga0207661_11540302
2817 Ga0207661_11715096
2818 Ga0207679_10122622
2819 Ga0207679_10317269
2820 Ga0207679_10713477
2821 Ga0207679_11142184
2822 Ga0207667_10073767
2823 Ga0207667_10801378
2824 Ga0207667_11837225
2825 Ga0207651_10013495
2826 Ga0207651_10051927
2827 Ga0207651_10065590
2828 Ga0207651_10335363
2829 Ga0207651_10529899
2830 Ga0207651_10677728
2831 Ga0207651_10789893
2832 Ga0207712_10017012
2833 Ga0207712_10086834
2834 Ga0207712_11198873
2835 Ga0207712_12111238
2836 Ga0207668_10150862
2837 Ga0207668_10241453
2838 Ga0207668_10665446
2839 Ga0207668_10790578
2840 Ga0207668_11352817
2841 Ga0207640_10060700
2842 Ga0207640_10511279
2843 Ga0207640_11673716
2844 Ga0207658_10423210
2845 Ga0207677_10032872
2846 Ga0207677_10068599
2847 Ga0207677_10146194
2848 Ga0207677_10236874
2849 Ga0207677_10749657
2850 Ga0207677_11215515
2851 Ga0207677_11512395
2852 Ga0207677_11839284
2853 Ga0207677_12077461
2854 Ga0207703_10073898
2855 Ga0207703_11917104
2856 Ga0207639_10036381
2857 Ga0207639_10133405
2858 Ga0207639_10771859
2859 Ga0207678_10040965
2860 Ga0207678_10095360
2861 Ga0207678_10209360
2862 Ga0207678_10642799
2863 Ga0207678_12020859
2864 Ga0207708_10001945
2865 Ga0207708_10012405
2866 Ga0207708_10048411
2867 Ga0207708_10105419
2868 Ga0207708_10472967
2869 Ga0207702_10155856
2870 Ga0207702_12116570
2871 Ga0207641_10935159
2872 Ga0207641_11011420
2873 Ga0207641_11076338
2874 Ga0207648_10000729
2875 Ga0207648_10116194
2876 Ga0207648_10161256
2877 Ga0207648_10411946
2878 Ga0207648_10479189
2879 Ga0207648_10668808
2880 Ga0207648_11361990
2881 Ga0207648_12141692
2882 Ga0207676_10038407
2883 Ga0207676_10441727
2884 Ga0207676_10638541
2885 Ga0207676_10752460
2886 Ga0207676_10980317
2887 Ga0207676_11041551
2888 Ga0207676_11635092
2889 Ga0207674_10110289
2890 Ga0207674_10144951
2891 Ga0207674_10192944
2892 Ga0207674_10432277
2893 Ga0207674_10671347
2894 Ga0207674_10731466
2895 Ga0207675_100034654
2896 Ga0207675_100036337
2897 Ga0207675_100226366
2898 Ga0207675_100265151
2899 Ga0207675_100483750
2900 Ga0207675_100876561
2901 Ga0207675_101306771
2902 Ga0207683_10000371
2903 Ga0207683_10003740
2904 Ga0207683_10034751
2905 Ga0207683_10110959
2906 Ga0207683_10115021
2907 Ga0207683_10142240
2908 Ga0207683_10323703
2909 Ga0207683_10845016
2910 Ga0207683_11113357
2911 Ga0207683_11125968
2912 Ga0207683_11165778
2913 Ga0207683_11514111
2914 Ga0207698_10018342
2915 Ga0207698_11044906
2916 Ga0207698_11426113
2917 Ga0207698_12493590
2918 Ga0209996_1059407
2919 Ga0209970_1018370
2920 Ga0209983_1139798
2921 Ga0209966_1074024
2922 Ga0207428_10000281
2923 Ga0207428_10036308
2924 Ga0207428_10123837
2925 Ga0207428_10137240
2926 Ga0207428_10151321
2927 Ga0207428_10153859
2928 Ga0207428_10734482
2929 Ga0207428_10842118
2930 Ga0268266_10083927
2931 Ga0268266_10084202
2932 Ga0268266_10088543
2933 Ga0268266_10302514
2934 Ga0268266_11319796
2935 Ga0268265_10627911
2936 Ga0268265_10944260
2937 Ga0268265_12318961
2938 Ga0268264_10249503
2939 Ga0268264_10939491
2940 Ga0268264_11170057
2941 Ga0307408_100211308
2942 Ga0307408_100329000
2943 Ga0307405_11357082
2944 Ga0307413_10973168
2945 Ga0307413_11804671
2946 Ga0307410_10273843
2947 Ga0307406_10419448
2948 Ga0307406_10494230
2949 Ga0307406_10511425
2950 Ga0307407_10218963
2951 Ga0307407_11339629
2952 Ga0307412_10277027
2953 Ga0307409_100274520
2954 Ga0307416_100002165
2955 Ga0307416_100202071
2956 Ga0307416_103366626
2957 Ga0307414_10093969
2958 Ga0307411_10006254
2959 Ga0307411_11904928
2960 Ga0307415_100262326
2961 Ga0307415_101443643
2962 Ga0307415_102336213
2963 Ga0373948_0075426
2964 Ga0373958_0117564
2965 Ga0373959_0009124
2966 Ga0373959_0189772
2967 Ga0373938_0254501
2968 Ga0373940_0083358
2969 Ga0373944_0072385
2970 Ga0373951_0083106
2971 Ga0373952_0054182
2972 Ga0373932_0016563
2973 Ga0373939_0094004
2974 Ga0373941_0059146
2975 Ga0373945_0317780
2976 Ga0373960_0181143
2977 Ga0373960_0201523
2978 Ga0373960_0281106
2979 Ga0373943_0154117
2980 Ga0373946_0269478
2981 Ga0373946_0478711
2982 Ga0373942_0077560
2983 Ga0373961_0058706
2984 Ga0373962_0018881
2985 Ga0373962_0146758
2986 Ga0373924_0245885
2987 Ga0373931_0117198
2988 Ga0373931_0121665
2989 Ga0373935_0454210
2990 Ga0373935_0628699
2991 Ga0373947_0447185
2992 Ga0373947_0727323
2993 Ga0373925_0787965
2994 Ga0395899_0022531
2995 Ga0395899_0033165
2996 Ga0395899_0038343
2997 Ga0395899_0088914
2998 Ga0395899_0099786
2999 Ga0395899_0190534
3000 Ga0395899_0254580
3001 Ga0395899_0645185
3002 Ga0395900_0000988
3003 Ga0395900_0002063
3004 Ga0395900_0005985
3005 Ga0395900_0053920
3006 Ga0395900_0057355
3007 Ga0395900_0080628
3008 Ga0395900_0088912
3009 Ga0395900_0113594
3010 Ga0395900_0144113
3011 Ga0395900_0389205
3012 Ga0395900_0612616
3013 Ga0395900_0637948
3014 Ga0395900_1090026
3015 Ga0395900_1498205
3016 Ga0395898_0002378
3017 Ga0395898_0008324
3018 Ga0395898_0013193
3019 Ga0395898_0013852
3020 Ga0395898_0017918
3021 Ga0395898_0032460
3022 Ga0395898_0035150
3023 Ga0395898_0106469
3024 Ga0395898_0409112
3025 Ga0395898_0478844
3026 Ga0395898_0619327
3027 Ga0395898_0640903
3028 Ga0395898_0743063
3029 Ga0395898_0938463
3030 Ga0395898_1360257
3031 Ga0395905_0002715
3032 Ga0395905_0003035
3033 Ga0395905_0007299
3034 Ga0395905_0059256
3035 Ga0395905_0082063
3036 Ga0395905_0097845
3037 Ga0395905_0117956
3038 Ga0395905_0121054
3039 Ga0395905_0299902
3040 Ga0395905_0301623
3041 Ga0395905_0472511
3042 Ga0395905_0780304
3043 Ga0395905_1033072
3044 Ga0395905_1047519
3045 Ga0395901_0001046
3046 Ga0395901_0001699
3047 Ga0395901_0003426
3048 Ga0395901_0010485
3049 Ga0395901_0018396
3050 Ga0395901_0018546
3051 Ga0395901_0042124
3052 Ga0395901_0093900
3053 Ga0395901_0123365
3054 Ga0395901_0148878
3055 Ga0395901_0233990
3056 Ga0395901_0244233
3057 Ga0395901_0255087
3058 Ga0395901_0518308
3059 Ga0395901_2156164
3060 Ga0242420_040922
3061 Ga0439438_050472
3062 Ga0439438_067681
3063 Ga0439439_0007490
3064 Ga0439447_057347
3065 Ga0439453_0008494
3066 Ga0439453_0016934
3067 Ga0439461_0009675
3068 Ga0439461_0034553
3069 Ga0439461_0099152
3070 Ga0439461_0181543
3071 Ga0439466_0017305
3072 Ga0439466_0093021
3073 Ga0451787_779493
3074 Ga0451791_0313989
3075 Ga0451798_1038471
3076 Ga0451804_0468228
3077 Ga0451807_1707017
3078 Ga0451807_2106395
3079 Ga0451807_2349782
3080 Ga0451845_0055735
3081 Ga0451845_0678149
3082 Ga0451851_0221635
3083 Ga0451851_0813741
3084 Ga0451853_1211212
3085 Ga0451853_1978009
3086 Ga0451853_3554456
3087 Ga0439431_0056367
3088 Ga0439431_0059363
3089 Ga0439433_0022736
3090 Ga0439441_001131
3091 Ga0439442_008538
3092 Ga0439445_0050291
3093 Ga0439448_0091428
3094 Ga0439448_0265233
3095 Ga0439432_116182
3096 Ga0439449_0104827
3097 Ga0439449_0284230
3098 Ga0439450_209476
3099 Ga0439454_018346
3100 Ga0439455_0254983
3101 Ga0439462_0170798
3102 Ga0450917_025194
3103 Ga0450920_014363
3104 Ga0450920_031056
3105 Ga0450920_060167
3106 Ga0450891_006014
3107 Ga0450894_065904
3108 Ga0450906_015853
3109 Ga0450906_027676
3110 Ga0450906_085820
3111 Ga0450907_012687
3112 Ga0450907_013736
3113 Ga0450907_027345
3114 Ga0450910_035784
3115 Ga0439446_0001134
3116 Ga0439446_0012386
3117 Ga0439446_0022934
3118 Ga0439434_0008986
3119 Ga0439434_0024871
3120 Ga0439434_0040169
3121 Ga0439435_0053814
3122 Ga0439435_0102653
3123 Ga0439435_0365965
3124 Ga0439444_0071645
3125 Ga0439459_0039989
3126 Ga0439459_0174219
3127 Ga0439460_0339529
3128 Ga0439460_0372408
3129 Ga0450916_006961
3130 Ga0450916_039231
3131 Ga0450918_014389
3132 Ga0450918_108498
3133 Ga0466968_0684648
3134 Ga0466960_0491204
3135 Ga0451576_1189695
3136 Ga0451576_1770628
3137 Ga0495617_090807
3138 Ga0495627_175804
3139 Ga0495603_0003598
3140 Ga0495603_0029698
3141 Ga0495603_0395392
3142 Ga0495603_0854936
3143 Ga0495591_076096
3144 Ga0495629_0320215
3145 Ga0495629_0354558
3146 Ga0495641_0016694
3147 Ga0495641_0051667
3148 Ga0495650_0293912
3149 Ga0495580_0506543
3150 Ga0495582_0018874
3151 Ga0495582_0054494
3152 Ga0495582_0121166
3153 Ga0495605_0017402
3154 Ga0495639_0029403
3155 Ga0495662_0135958
3156 Ga0495664_0545873
3157 Ga0495584_0138465
3158 Ga0495584_0299410
3159 Ga0495584_0366049
3160 Ga0495585_0127681
3161 Ga0495585_0139613
3162 Ga0495585_0468307
3163 Ga0495594_0064016
3164 Ga0495594_0262241
3165 Ga0495594_0403188
3166 Ga0495594_0466877
3167 Ga0495596_0085391
3168 Ga0495596_0090469
3169 Ga0495596_0098507
3170 Ga0495596_0111120
3171 Ga0495596_0213644
3172 Ga0495596_0389189
3173 Ga0495607_0353378
3174 Ga0495607_0378449
3175 Ga0495608_0861703
3176 Ga0495616_0247401
3177 Ga0495618_0634225
3178 Ga0495620_0071375
3179 Ga0495630_0012009
3180 Ga0495630_0110219
3181 Ga0495630_0727134
3182 Ga0495631_0190038
3183 Ga0495631_0297570
3184 Ga0495631_0315503
3185 Ga0495637_0184951
3186 Ga0495644_0052010
3187 Ga0495644_0101181
3188 Ga0495644_0262322
3189 Ga0495644_0273880
3190 Ga0495644_0346127
3191 Ga0495644_0442032
3192 Ga0495663_0036900
3193 Ga0495663_0264362
3194 Ga0495666_0321865
3195 Ga0495642_0034277
3196 Ga0495642_0037234
3197 Ga0495642_0554790
3198 Ga0495654_0282489
3199 Ga0495665_0044630
3200 Ga0495640_0142921
3201 Ga0495640_0345073
3202 Ga0495609_0061570
3203 Ga0495609_0140760
3204 Ga0495609_0167691
3205 Ga0495609_0364480
3206 Ga0495621_0236033
3207 Ga0495621_0437540
3208 Ga0495622_0168160
3209 Ga0495667_0256354
3210 Ga0495667_0371000
3211 Ga0495656_0019782
3212 Ga0495656_0147414
3213 Ga0495656_0274774
3214 Ga0495656_0476277
3215 Ga0495656_0499185
3216 Ga0495656_0792344
3217 Ga0495656_0830679
3218 Ga0495668_0140649
3219 Ga0495668_0556497
3220 Ga0495668_0612493
3221 Ga0495634_0187769
3222 Ga0495635_0105476
3223 Ga0495635_0182985
3224 Ga0495635_0649356
3225 Ga0495659_0016908
3226 Ga0495659_0022431
3227 Ga0495661_0419653
3228 Ga0495588_0157446
3229 Ga0495588_0184588
3230 Ga0495588_0383476
3231 Ga0495657_0476324
3232 Ga0495647_0132687
3233 Ga0495647_0319686
3234 Ga0495647_0478649
3235 Ga0495658_0162276
3236 Ga0495658_0649578
3237 Ga0495613_0321373
3238 Ga0495624_0531269
3239 Ga0495670_0660329
3240 Ga0495589_0025438
3241 Ga0495589_0133469
3242 Ga0495589_0170355
3243 Ga0495589_0332904
3244 Ga0495589_0431545
3245 Ga0495600_0947538
3246 Ga0495660_0211417
3247 Ga0495660_0240265
3248 Ga0495581_0023230
3249 Ga0495581_0313574
3250 Ga0495636_0133745
3251 Ga0495636_0427675
3252 Ga0495636_0548608
3253 Ga0495636_0659017
3254 Ga0495674_0607086
3255 Ga0495676_0031351
3256 Ga0495676_0408772
3257 Ga0495676_0465769
3258 Ga0495676_0637282
3259 Ga0495676_0737285
3260 Ga0495680_0033835
3261 Ga0495680_0596448
3262 Ga0495683_0317515
3263 Ga0495683_0434252
3264 Ga0495675_0260068
3265 Ga0495677_0082340
3266 Ga0495677_0113001
3267 Ga0495677_0124581
3268 Ga0495677_0169645
3269 Ga0495677_0306658
3270 Ga0495679_215436
3271 Ga0495673_0237768
3272 Ga0495681_0380779
3273 Ga0495684_0142056
3274 Ga0495684_0820438
3275 Ga0495593_0407298
3276 Ga0495593_0576006
3277 Ga0495614_0033172
3278 Ga0495614_0154491
3279 Ga0495615_0184064
3280 Ga0496100_0035339
3281 Ga0496100_0105983
3282 Ga0496100_0109827
3283 Ga0496100_0529955
3284 Ga0496100_0574888
3285 Ga0496100_0826823
3286 Ga0496100_1098860
3287 Ga0496100_1124085
3288 Ga0496100_1607404
3289 Ga0496101_0050410
3290 Ga0496101_0120147
3291 Ga0496101_0127460
3292 Ga0496101_0274161
3293 Ga0496101_0365087
3294 Ga0496101_0568365
3295 Ga0496101_0727362
3296 Ga0496101_1318314
3297 Ga0496102_0162996
3298 Ga0496102_0300467
3299 Ga0496102_0309560
3300 Ga0496102_0314392
3301 Ga0496102_0708447
3302 Ga0496102_0847462
3303 Ga0496103_0003329
3304 Ga0496103_0170263
3305 Ga0496103_0737572
3306 Ga0496104_0010781
3307 Ga0496104_0056192
3308 Ga0496104_0093973
3309 Ga0496104_0110759
3310 Ga0496104_0337652
3311 Ga0496104_0707269
3312 Ga0496104_0719935
3313 Ga0496104_0891842
3314 Ga0496104_0964894
3315 Ga0496105_0035782
3316 Ga0496105_0038830
3317 Ga0496105_0074441
3318 Ga0496105_0247255
3319 Ga0496105_0262070
3320 Ga0496105_0265897
3321 Ga0496105_0706999
3322 Ga0496105_0962457
3323 Ga0496106_0131870
3324 Ga0496106_0341441
3325 Ga0496106_0463972
3326 Ga0496106_0743058
3327 Ga0496106_1454037
3328 Ga0496107_0025226
3329 Ga0496107_0069669
3330 Ga0496107_0164978
3331 Ga0496107_0217003
3332 Ga0496107_0269462
3333 Ga0496107_0481286
3334 Ga0496107_0790897
3335 Ga0496107_0985240
3336 Ga0496108_0000888
3337 Ga0496108_0021551
3338 Ga0496108_0023356
3339 Ga0496108_0029530
3340 Ga0496108_0037251
3341 Ga0496108_0079703
3342 Ga0496108_0361643
3343 Ga0496108_0556450
3344 Ga0496108_0928480
3345 Ga0496108_1109214
3346 Ga0496108_1454918
3347 Ga0496109_0000579
3348 Ga0496109_0023066
3349 Ga0496109_0035147
3350 Ga0496109_0046089
3351 Ga0496109_0077378
3352 Ga0496109_0103298
3353 Ga0496109_0252043
3354 Ga0496109_0255175
3355 Ga0496109_0304372
3356 Ga0496109_0368509
3357 Ga0496109_0777619
3358 Ga0496109_1418749
3359 Ga0496109_2037791
3360 Ga0496110_0046372
3361 Ga0496110_0082414
3362 Ga0496110_0128156
3363 Ga0496110_0146639
3364 Ga0496110_0149457
3365 Ga0496110_0254499
3366 Ga0496110_0397731
3367 Ga0496110_0483113
3368 Ga0496110_0502764
3369 Ga0496110_1305396
3370 Ga0496111_0000740
3371 Ga0496111_0010160
3372 Ga0496111_0104052
3373 Ga0496111_0110475
3374 Ga0496111_0128560
3375 Ga0496111_0132691
3376 Ga0496111_0147176
3377 Ga0496111_0173037
3378 Ga0496111_0300235
3379 Ga0496111_0511390
3380 Ga0496111_0590572
3381 Ga0496112_0023965
3382 Ga0496112_0025847
3383 Ga0496112_0268839
3384 Ga0496112_0385940
3385 Ga0496112_0543994
3386 Ga0496112_0559544
3387 Ga0496112_0730463
3388 Ga0496112_1469871
3389 Ga0496113_0002956
3390 Ga0496113_0027155
3391 Ga0496113_0109168
3392 Ga0496113_0601799
3393 Ga0496113_1353574
3394 Ga0496114_0004206
3395 Ga0496114_0048630
3396 Ga0496114_0083542
3397 Ga0496114_0097333
3398 Ga0496114_0120337
3399 Ga0496114_0141106
3400 Ga0496114_0331155
3401 Ga0496114_0420997
3402 Ga0496114_0583412
3403 Ga0496114_1261673
3404 Ga0496115_0025065
3405 Ga0496115_0090245
3406 Ga0495682_0354447
3407 Ga0501299_078376
3408 Ga0501031_0002104
3409 Ga0501031_0005456
3410 Ga0501031_0008345
3411 Ga0501031_0010811
3412 Ga0501031_0024921
3413 Ga0501031_0027308
3414 Ga0501031_0032494
3415 Ga0501031_0034432
3416 Ga0501031_0172366
3417 Ga0501031_0257974
3418 Ga0501031_0356701
3419 Ga0501031_0460897
3420 Ga0501031_0672637
3421 Ga0501031_0981942
3422 Ga0501032_0011530
3423 Ga0501032_0024599
3424 Ga0501032_0222116
3425 Ga0501032_0352974
3426 Ga0501032_0878570
3427 Ga0501033_0027249
3428 Ga0501033_0033545
3429 Ga0501033_0109978
3430 Ga0501033_0148355
3431 Ga0501033_0306205
3432 Ga0501033_0306530
3433 Ga0501033_0760350
3434 Ga0501034_0301122
3435 Ga0501034_1261068
3436 Ga0501036_0003750
3437 Ga0501036_0011577
3438 Ga0501036_0043992
3439 Ga0501036_0050459
3440 Ga0501036_0059785
3441 Ga0501036_0085508
3442 Ga0501036_0145198
3443 Ga0501036_0192346
3444 Ga0501036_0231544
3445 Ga0501036_0265039
3446 Ga0501036_0304279
3447 Ga0501036_0305113
3448 Ga0501036_0385801
3449 Ga0501036_0510267
3450 Ga0501036_0710736
3451 Ga0501036_0817733
3452 Ga0501037_0011191
3453 Ga0501037_0012070
3454 Ga0501037_0083516
3455 Ga0501037_0168864
3456 Ga0501037_0169349
3457 Ga0501037_0310841
3458 Ga0501038_0001738
3459 Ga0501038_0028181
3460 Ga0501038_0032597
3461 Ga0501038_0043032
3462 Ga0501038_0075933
3463 Ga0501038_0094034
3464 Ga0501038_0125566
3465 Ga0501038_0677153
3466 Ga0501038_1407834
3467 Ga0501039_0004321
3468 Ga0501039_0034274
3469 Ga0501039_0035012
3470 Ga0501039_0048604
3471 Ga0501039_0057186
3472 Ga0501039_0080583
3473 Ga0501039_0219827
3474 Ga0501039_0246724
3475 Ga0501039_0351622
3476 Ga0501039_0770413
3477 Ga0501039_1418408
3478 Ga0501039_1522167
3479 Ga0501039_1592248
3480 Ga0501040_0018166
3481 Ga0501040_0020310
3482 Ga0501040_0021388
3483 Ga0501040_0024973
3484 Ga0501040_0025076
3485 Ga0501040_0096298
3486 Ga0501040_0138193
3487 Ga0501040_0147011
3488 Ga0501040_0161758
3489 Ga0501040_0199231
3490 Ga0501040_0220096
3491 Ga0501040_0375296
3492 Ga0501040_0535967
3493 Ga0501040_0795733
3494 Ga0501040_1047482
3495 Ga0501041_0006004
3496 Ga0501041_0006678
3497 Ga0501041_0007434
3498 Ga0501041_0011358
3499 Ga0501041_0013965
3500 Ga0501041_0014769
3501 Ga0501041_0015431
3502 Ga0501041_0048515
3503 Ga0501041_0151877
3504 Ga0501041_0313020
3505 Ga0501041_0465831
3506 Ga0501041_0536590
3507 Ga0501041_1049155
3508 Ga0501042_0005142
3509 Ga0501042_0016562
3510 Ga0501042_0018322
3511 Ga0501042_0023072
3512 Ga0501042_0041146
3513 Ga0501042_0055945
3514 Ga0501042_0235768
3515 Ga0501042_0243955
3516 Ga0501042_0279042
3517 Ga0501042_0355071
3518 Ga0501042_0371099
3519 Ga0501042_0660595
3520 Ga0501042_0695148
3521 Ga0501042_0742441
3522 Ga0501042_1176339
3523 Ga0501042_1370096
3524 Ga0501042_1417282
3525 Ga0501043_0014994
3526 Ga0501043_0026222
3527 Ga0501043_0057037
3528 Ga0501043_0063719
3529 Ga0501043_0243417
3530 Ga0501043_0245300
3531 Ga0501043_0406575
3532 Ga0501046_0002143
3533 Ga0501046_0007988
3534 Ga0501046_0014203
3535 Ga0501046_0016257
3536 Ga0501046_0024687
3537 Ga0501046_0053029
3538 Ga0501046_0431535
3539 Ga0501046_1117145
3540 Ga0501046_1231237
3541 Ga0501047_0283721
3542 Ga0501047_0422818
3543 Ga0501047_0520766
3544 Ga0501048_0012639
3545 Ga0501048_0014089
3546 Ga0501048_0015761
3547 Ga0501048_0068375
3548 Ga0501048_0082395
3549 Ga0501048_0096929
3550 Ga0501048_0097088
3551 Ga0501048_0128811
3552 Ga0501048_0506957
3553 Ga0501048_0650410
3554 Ga0501067_0023969
3555 Ga0501067_0052292
3556 Ga0501067_0063060
3557 Ga0501067_0074685
3558 Ga0501067_0263624
3559 Ga0501067_0407371
3560 Ga0501067_0551036
3561 Ga0501067_0554346
3562 Ga0501067_0597330
3563 Ga0501068_0005542
3564 Ga0501068_0014980
3565 Ga0501068_0015318
3566 Ga0501068_0018445
3567 Ga0501068_0070302
3568 Ga0501068_0082801
3569 Ga0501068_0085150
3570 Ga0501068_0166829
3571 Ga0501068_0411290
3572 Ga0501068_0758535
3573 Ga0501068_0831475
3574 Ga0501069_0017407
3575 Ga0501069_0020250
3576 Ga0501069_0021451
3577 Ga0501069_0024839
3578 Ga0501069_0039376
3579 Ga0501069_0059015
3580 Ga0501069_0079231
3581 Ga0501069_0093285
3582 Ga0501069_0220381
3583 Ga0501069_0328763
3584 Ga0501069_0506787
3585 Ga0501069_0865369
3586 Ga0501069_1006694
3587 Ga0501069_1008364
3588 Ga0501070_0018595
3589 Ga0501070_0028099
3590 Ga0501070_0032622
3591 Ga0501070_0040915
3592 Ga0501070_0088405
3593 Ga0501070_0199156
3594 Ga0501070_0304718
3595 Ga0501070_0703439
3596 Ga0501070_0838242
3597 Ga0501071_0002739
3598 Ga0501071_0003010
3599 Ga0501071_0009045
3600 Ga0501071_0012703
3601 Ga0501071_0012914
3602 Ga0501071_0021703
3603 Ga0501071_0023319
3604 Ga0501071_0115195
3605 Ga0501071_0130774
3606 Ga0501071_0160448
3607 Ga0501071_0293794
3608 Ga0501071_0302394
3609 Ga0501071_0500831
3610 Ga0501071_0576016
3611 Ga0501071_0727753
3612 Ga0501071_0826674
3613 Ga0501071_1463059
3614 Ga0501072_0004009
3615 Ga0501072_0004983
3616 Ga0501072_0008209
3617 Ga0501072_0020866
3618 Ga0501072_0021085
3619 Ga0501072_0024983
3620 Ga0501072_0070915
3621 Ga0501072_0096841
3622 Ga0501072_0263639
3623 Ga0501072_0314259
3624 Ga0501072_0343949
3625 Ga0501072_0351204
3626 Ga0501072_0545975
3627 Ga0501072_0570350
3628 Ga0501072_1326914
3629 Ga0501073_0035084
3630 Ga0501073_0098919
3631 Ga0501073_0141889
3632 Ga0501073_0509781
3633 Ga0501073_0535392
3634 Ga0501073_0604705
3635 Ga0501074_0007685
3636 Ga0501074_0021751
3637 Ga0501074_0032754
3638 Ga0501074_0042618
3639 Ga0501074_0229542
3640 Ga0501074_0324450
3641 Ga0501074_0602645
3642 Ga0501074_0735337
3643 Ga0501075_0006741
3644 Ga0501075_0012405
3645 Ga0501075_0021058
3646 Ga0501075_0038960
3647 Ga0501075_0042441
3648 Ga0501075_0074277
3649 Ga0501075_0095151
3650 Ga0501075_0153829
3651 Ga0501075_0240669
3652 Ga0501075_0442826
3653 Ga0501075_0541864
3654 Ga0501075_0796745
3655 Ga0501075_0973044
3656 Ga0501075_0994411
3657 Ga0501075_1450743
3658 Ga0501076_0014185
3659 Ga0501076_0014748
3660 Ga0501076_0015920
3661 Ga0501076_0022704
3662 Ga0501076_0025718
3663 Ga0501076_0026424
3664 Ga0501076_0040309
3665 Ga0501076_0059183
3666 Ga0501076_0063359
3667 Ga0501076_0103895
3668 Ga0501076_0139484
3669 Ga0501076_0148384
3670 Ga0501076_0181848
3671 Ga0501076_0199490
3672 Ga0501076_0673253
3673 Ga0501076_1460587
3674 Ga0501077_0002968
3675 Ga0501077_0003160
3676 Ga0501077_0010173
3677 Ga0501077_0019528
3678 Ga0501077_0030319
3679 Ga0501077_0049142
3680 Ga0501077_0057383
3681 Ga0501077_0081340
3682 Ga0501077_0081643
3683 Ga0501077_0179981
3684 Ga0501077_0391937
3685 Ga0501077_0622466
3686 Ga0501077_0987687
3687 Ga0501077_1028909
3688 Ga0501077_1123864
3689 Ga0501202_115537
3690 Ga0501208_057734
3691 Ga0501225_0194502
3692 Ga0501079_0013520
3693 Ga0501079_0015725
3694 Ga0501079_0018804
3695 Ga0501079_0027741
3696 Ga0501079_0033485
3697 Ga0501079_0035736
3698 Ga0501079_0037371
3699 Ga0501079_0052322
3700 Ga0501079_0085473
3701 Ga0501079_0108925
3702 Ga0501079_0220433
3703 Ga0501079_0317583
3704 Ga0501079_0427680
3705 Ga0501079_0551937
3706 Ga0501079_0883556
3707 Ga0501079_0916933
3708 Ga0501079_1144707
3709 Ga0501079_1261282
3710 Ga0501079_1274959
3711 Ga0501079_1446243
3712 Ga0501079_1535306
3713 Ga0501080_0005055
3714 Ga0501080_0029085
3715 Ga0501080_0039522
3716 Ga0501080_0041910
3717 Ga0501080_0043767
3718 Ga0501080_0049915
3719 Ga0501080_0068850
3720 Ga0501080_0077142
3721 Ga0501080_0144233
3722 Ga0501080_0226381
3723 Ga0501080_1549596
3724 Ga0501080_1726736
3725 Ga0501081_0005337
3726 Ga0501081_0014398
3727 Ga0501081_0023884
3728 Ga0501081_0032432
3729 Ga0501081_0051630
3730 Ga0501081_0054513
3731 Ga0501081_0070856
3732 Ga0501081_0133393
3733 Ga0501081_0153578
3734 Ga0501081_0337164
3735 Ga0501081_0341546
3736 Ga0501081_0348627
3737 Ga0501081_0358947
3738 Ga0501081_0594964
3739 Ga0501081_0927018
3740 Ga0501081_0934705
3741 Ga0501081_0944927
3742 Ga0501081_1143204
3743 Ga0501081_1299926
3744 Ga0501083_0011129
3745 Ga0501083_0018799
3746 Ga0501083_0025651
3747 Ga0501083_0056064
3748 Ga0501083_0098741
3749 Ga0501083_0134995
3750 Ga0501083_0173520
3751 Ga0501035_0020546
3752 Ga0501035_0036250
3753 Ga0501035_0062145
3754 Ga0501035_0105782
3755 Ga0501035_0192702
3756 Ga0501035_0212405
3757 Ga0501035_0254253
3758 Ga0501035_1196984
3759 Ga0501044_0044590
3760 Ga0501044_0095048
3761 Ga0501044_0380562
3762 Ga0501044_0544094
3763 Ga0501045_0006136
3764 Ga0501045_0011541
3765 Ga0501045_0013577
3766 Ga0501045_0028313
3767 Ga0501045_0079570
3768 Ga0501045_0101768
3769 Ga0501045_0117005
3770 Ga0501045_0134203
3771 Ga0501045_0199348
3772 Ga0501045_0262624
3773 Ga0501045_0277090
3774 Ga0501045_0577096
3775 Ga0501045_0577597
3776 Ga0501045_0609276
3777 Ga0501045_1030655
3778 Ga0501045_1173605
3779 Ga0501045_1200583
3780 nmdc:mga03n38_119650_c1
3781 nmdc:mga03n38_130389_c1
3782 nmdc:mga00v17_1018011_c1
3783 nmdc:mga00v17_1067420_c1
3784 nmdc:mga0yw44_1181603_c1
3785 nmdc:mga0yw44_176692_c1
3786 nmdc:mga0yw44_254684_c1
3787 nmdc:mga0yw44_30486_c1
3788 nmdc:mga0yw44_382092_c1
3789 nmdc:mga06z11_73231_c1
3790 nmdc:mga06z11_953579_c1
3791 nmdc:mga07m45_327816_c1
3792 nmdc:mga05p37_1302037_c1
3793 nmdc:mga05p37_143122_c1
3794 nmdc:mga05p37_1597122_c1
3795 nmdc:mga05p37_2157702_c1
3796 nmdc:mga05p37_259469_c1
3797 nmdc:mga05p37_366184_c1
3798 nmdc:mga05p37_37598_c1
3799 nmdc:mga05p37_6099_c1
3800 nmdc:mga05p37_789549_c1
3801 nmdc:mga05p37_846584_c1
3802 nmdc:mga05p37_85883_c1
3803 nmdc:mga09592_1452417_c1
3804 nmdc:mga09592_17464_c1
3805 nmdc:mga09592_258802_c1
3806 nmdc:mga09592_552863_c1
3807 nmdc:mga09592_844670_c1
3808 nmdc:mga0qj67_102436_c1
3809 nmdc:mga0qj67_86193_c1
3810 nmdc:mga06r32_157945_c1
3811 nmdc:mga06r32_264597_c1
3812 nmdc:mga06r32_531736_c1
3813 nmdc:mga06r32_825542_c1
3814 nmdc:mga08y16_10863_c1
3815 nmdc:mga08y16_1240142_c1
3816 nmdc:mga08y16_1400235_c1
3817 nmdc:mga08y16_192677_c1
3818 nmdc:mga08y16_230320_c1
3819 nmdc:mga08y16_460968_c1
3820 nmdc:mga08y16_472875_c1
3821 nmdc:mga08y16_59955_c1
3822 nmdc:mga08y16_662693_c1
3823 nmdc:mga08y16_994674_c1
3824 nmdc:mga0n895_292131_c1
3825 nmdc:mga0n895_320963_c1
3826 nmdc:mga0n895_321690_c1
3827 nmdc:mga0n895_625350_c1
3828 nmdc:mga0rr50_340238_c1
3829 nmdc:mga0rr50_76680_c1
3830 nmdc:mga08x19_25564_c1
3831 nmdc:mga08x19_285560_c1
3832 nmdc:mga08x19_45484_c1
3833 nmdc:mga08x19_455034_c1
3834 nmdc:mga08x19_504073_c1
3835 nmdc:mga08x19_745889_c1
3836 nmdc:mga08x19_79298_c1
3837 nmdc:mga0a205_1008824_c1
3838 nmdc:mga0a205_108520_c1
3839 nmdc:mga0a205_267850_c1
3840 nmdc:mga0a205_4875_c1
3841 nmdc:mga0a205_584070_c1
3842 nmdc:mga0a205_723269_c1
3843 Ga0495612_0098898
3844 Ga0495655_0048842
3845 Ga0495655_0064262
3846 Ga0495655_0285286
3847 Ga0495595_0195537
3848 Ga0495595_0526165
3849 Ga0495619_0054047
3850 Ga0495619_0148941
3851 Ga0495619_0235038
3852 Ga0500628_116877
3853 Ga0501084_0006937
3854 Ga0501084_0011448
3855 Ga0501084_0016867
3856 Ga0501084_0017787
3857 Ga0501084_0040475
3858 Ga0501084_0046052
3859 Ga0501084_0046697
3860 Ga0501084_0095429
3861 Ga0501084_0164029
3862 Ga0501084_0177475
3863 Ga0501084_0329999
3864 Ga0501084_0522325
3865 Ga0501084_0682486
3866 Ga0501084_0962482
3867 Ga0501084_1066294
3868 Ga0501084_1222884
3869 Ga0501084_1504912
3870 Ga0501084_1640131
3871 Ga0590071_029483
3872 Ga0590075_004855
3873 Ga0590075_033100
3874 Ga0587084_157993
3875 Ga0587066_093327
3876 Ga0587070_130812
3877 Ga0587090_139335
3878 Ga0587091_125332
3879 Ga0587092_126990
3880 Ga0587115_070084
3881 Ga0587076_168735
3882 Ga0587079_235290
3883 Ga0587114_142219
3884 Ga0501082_0009266
3885 Ga0501082_0025322
3886 Ga0501082_0029396
3887 Ga0501082_0030784
3888 Ga0501082_0033584
3889 Ga0501082_0071463
3890 Ga0501082_0075961
3891 Ga0501082_0107127
3892 Ga0501082_0174915
3893 Ga0501082_0217365
3894 Ga0501082_0256117
3895 Ga0501082_0669774
3896 Ga0501082_0677469
3897 Ga0501082_1100455
3898 Ga0501082_1144842
3899 Ga0501082_1369625
3900 Ga0501082_1483412
3901 Ga0530510_0004573
3902 Ga0530510_0005299
3903 Ga0530510_0039570
3904 Ga0530510_0048859
3905 Ga0530510_0059205
3906 Ga0530510_0070521
3907 Ga0530510_0092860
3908 Ga0530510_0222286
3909 Ga0530510_0336149
3910 Ga0530510_0343790
3911 Ga0530510_0350561
3912 Ga0530510_0355026
3913 Ga0530510_0564009
3914 Ga0530510_0684747
3915 Ga0530510_0960835
3916 Ga0530510_0995624

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01192

RNA_pol_Rpb6

RNA polymerase Rpb6

20

79

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6yxu-assembly1.cif.gz_E structure of mycobacterium smegmatis held protein in complex with rna polymerase core - state i, primary channel engaged 0.8739 3 82
5zx3-assembly1.cif.gz_E mycobacterium tuberculosis rna polymerase holoenzyme with ecf sigma factor sigma h 0.8692 1 80
8dy9-assembly1.cif.gz_E streptomyces venezuelae rnap unconstrained open promoter complex with whia and whib transcription factors 0.8526 1 80
6cce-assembly1.cif.gz_E crystal structure of a mycobacterium smegmatis rna polymerase transcription initiation complex with inhibitor kanglemycin a 0.8514 1 82
8dy7-assembly1.cif.gz_E streptomyces venezuelae rnap transcription open promoter complex with whia and whib transcription factors 0.849 1 80
ID Description Score Start End Superfamily
4llgK00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.825 5 79 3.90.940.10
5nwtE00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.81 5 78 3.90.940.10
4ljzE00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.8097 4 79 3.90.940.10
6gfwE00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.804 3 77 3.90.940.10
6algK00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.7996 5 75 3.90.940.10
ID Description Score Start End GO Terms
AF-A0A349B4J6-F1-model_v4 DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) 0.8804 1 83 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677
AF-A0A1V5IRP6-F1-model_v4 DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) 0.8714 1 80 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677
AF-A0A0M4GC47-F1-model_v4 DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) 0.8706 1 82 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677
AF-A0A6I3B900-F1-model_v4 DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) 0.8697 1 84 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677
AF-A0A538G1Q5-F1-model_v4 DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) 0.8678 7 82 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677

Map