F496092
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1934 | 1300 | 1057 | 408 |
Family's Representative Sequence
| Representative Sequence | 3300031239|Ga0265328_10017627|Ga0265328_100176272 |
| Length | 401 |
| Sequence | MPSFEPLRLHVPEPTGRPGHDTDFSYLPISEAGAVRRPPVDAQAAQTSDLAFTLIRVLDKDGKAVGPWAPDIGVEQLRKGMRSMLRTRAFDARMLIAQRQKKMSFYMQCLGEEAIACAHAQALVDGDMCFPTYRQQGLLLSRDDVSMVDMICQLYSNQRDPLKGRQLPVMYSSKKQGFFSISGNLATQVIQAVGWAMASAIKGDTKVASSWIGDGATAEADFHTGLTFAHVYRAPVILNVVNNQWAISTFQAIAGGEGTTFAARGVGNGIASLRVDGNDFLAVYAASQWALERARRNLGPTLIEWVTYRAGPHSTSDDPSKYRPANDAARFPLGDPIVRLKQHLMGLGAWSDAEHEATQKELEAQYGTLADGHTRSPAEMFEDVYKEMPAHLRRQRQELGI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 3 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 4 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 5 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 6 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 7 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 8 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 9 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 10 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 11 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 12 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 13 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 14 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 15 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 16 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 17 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 18 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 19 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 20 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 21 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 22 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 23 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 24 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 25 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 26 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 27 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 28 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 29 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 30 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 31 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 32 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 33 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 34 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 35 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 36 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 37 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 38 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 39 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 40 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 41 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 42 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 43 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 44 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 45 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 46 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 47 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 48 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 49 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 50 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 51 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 52 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 53 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 54 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 55 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 56 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 57 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 58 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 59 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 60 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 61 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 62 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 63 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 64 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 65 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 66 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 67 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 68 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 69 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 70 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 71 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 72 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 73 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 74 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 75 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 76 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 77 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 78 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 79 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 80 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 81 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 82 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 83 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 84 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 85 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 86 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 87 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 88 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 89 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 90 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 91 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 92 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 93 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 94 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 95 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 96 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 97 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 98 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 99 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 100 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 101 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 102 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 103 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 104 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 105 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 106 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 107 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 108 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 109 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 110 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 111 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 112 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 113 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 114 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 115 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 116 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 117 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 118 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 119 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 120 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 121 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 122 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 123 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 124 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 125 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 126 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 127 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 128 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 129 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 130 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 131 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 132 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 133 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 134 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 135 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 136 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 137 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 138 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 139 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 140 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 141 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 142 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 143 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 144 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 145 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 146 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 147 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 148 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 149 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 150 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 151 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 152 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 153 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 154 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 155 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 156 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 157 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 158 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 159 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 160 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 161 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 162 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 163 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 164 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 165 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 166 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 167 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 168 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 169 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 170 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 171 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 172 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 173 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 174 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 175 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 176 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 177 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 178 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 179 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 180 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 181 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 182 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 183 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 184 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 185 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 186 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 187 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 188 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 189 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 190 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 191 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 192 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 193 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 194 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 195 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 196 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 197 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 198 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 199 | 2791355199 | |||
| 200 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 201 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 202 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 203 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 204 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 205 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 206 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 207 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 208 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 209 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 210 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 211 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 212 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 213 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 214 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 215 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 216 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 217 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 218 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 219 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 220 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 221 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 222 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 223 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 224 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 225 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 226 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 227 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 228 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 229 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 230 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 231 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 232 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 233 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 234 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 235 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 236 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 237 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 238 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 239 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 240 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 241 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 242 | 2834578030 | Paracoccus thiocyanatus SST | Isolate | Unclassified |
| 243 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 244 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 245 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 246 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 247 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 248 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 249 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 250 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 251 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 252 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 253 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 254 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 255 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 256 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 257 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 258 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 259 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 260 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 261 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 262 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 263 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 264 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 265 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 266 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 267 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 268 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 269 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 270 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 271 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 272 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 273 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 274 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 275 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 276 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 277 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 278 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 279 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 280 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 281 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 282 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 283 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 284 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 285 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 286 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 287 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 288 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 289 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 290 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 291 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 292 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 293 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 294 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 295 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 296 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 297 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 298 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 299 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 300 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 301 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 302 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 303 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 304 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 305 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 306 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 307 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 308 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 309 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 310 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 311 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 312 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 313 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 314 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 315 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 316 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 317 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 318 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 319 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 320 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 321 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 322 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 323 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 324 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 325 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 326 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 327 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 328 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 329 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 330 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 331 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 332 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 333 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 334 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 335 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 336 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 337 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 338 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 339 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 340 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 341 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 342 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 343 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 344 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 345 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 346 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 347 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 348 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 349 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 350 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 351 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 352 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 353 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 354 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 355 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 356 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 357 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 358 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 359 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 360 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 361 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 362 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 363 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 364 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 365 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 366 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 367 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 368 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 369 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 370 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 371 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 372 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 373 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 374 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 375 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 376 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 377 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 378 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 379 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 380 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 381 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 382 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 383 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 384 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 385 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 386 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 387 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 388 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 389 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 390 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 391 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 392 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 393 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 394 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 395 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 396 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 397 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 398 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 399 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 400 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 401 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 402 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 403 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 404 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 405 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 406 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 407 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 408 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 409 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 410 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 411 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 412 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 413 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 414 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 415 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 416 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 417 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 418 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 419 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 420 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 421 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 422 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 423 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 424 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 425 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 426 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 427 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 428 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 429 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 430 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 431 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 432 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 433 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 434 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 435 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 436 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 437 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 438 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 439 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 440 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 441 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 442 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 443 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 444 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 445 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 446 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 447 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 448 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 449 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 450 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 451 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 452 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 453 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 454 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 455 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 456 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 457 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 458 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 459 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 460 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 461 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 462 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 463 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 464 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 465 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 466 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 467 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 468 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 469 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 470 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 471 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 472 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 473 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 474 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 475 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 476 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 477 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 478 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 479 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 480 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 481 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 482 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 483 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 484 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 485 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 486 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 487 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 488 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 489 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 490 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 491 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 492 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 493 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 494 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 495 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 496 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 497 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 498 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 499 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 500 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 501 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 502 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 503 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 504 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 505 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 506 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 507 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 508 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 509 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 510 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 511 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 512 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 513 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 514 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 515 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 516 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 517 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 518 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 519 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 520 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 521 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 522 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 523 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 524 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 525 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 526 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 527 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 528 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 529 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 530 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 531 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 532 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 533 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 534 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 535 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 536 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 537 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 538 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 539 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 540 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 541 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 542 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 543 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 544 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 545 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 546 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 547 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 548 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 549 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 550 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 551 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 552 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 553 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 554 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 555 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 556 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 557 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 558 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 559 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 560 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 561 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 562 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 563 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 564 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 565 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 566 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 567 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 568 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 569 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 570 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 571 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 572 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 573 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 574 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 575 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 576 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 577 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 578 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 579 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 580 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 581 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 582 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 583 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 584 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 585 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 586 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 587 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 588 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 589 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 590 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 591 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 592 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 593 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 594 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 595 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 596 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 597 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 598 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 599 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 600 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 601 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 602 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 603 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 604 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 605 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 606 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 607 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 608 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 609 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 610 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 611 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 612 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 613 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 614 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 615 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 616 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 617 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 618 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 619 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 620 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 621 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 622 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 623 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 624 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 625 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 626 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 627 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 628 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 629 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 630 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 631 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 632 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 633 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 634 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 635 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 636 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 637 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 638 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 639 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 640 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 641 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 642 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 643 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 644 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 645 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 646 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 647 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 648 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 649 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 650 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 651 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 652 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 653 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 654 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 655 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 656 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 657 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 658 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 659 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 660 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 661 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 662 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 663 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 664 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 665 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 666 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 667 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 668 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 669 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 670 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 671 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 672 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 673 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 674 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 675 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 676 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 677 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 678 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 679 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 680 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 681 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 682 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 683 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 684 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 685 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 686 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 687 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 688 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 689 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 690 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 691 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 692 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 693 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 694 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 695 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 696 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 697 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 698 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 699 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 700 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 701 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 702 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 703 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 704 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 705 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 706 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 707 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 708 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 709 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 710 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 711 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 712 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 713 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 714 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 715 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 716 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 717 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 718 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 719 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 720 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 721 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 722 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 723 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 724 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 725 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 726 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 727 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 728 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 729 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 730 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 731 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 732 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 733 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 734 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 735 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 736 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 737 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 738 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 739 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 740 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 741 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 742 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 743 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 744 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 745 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 746 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 747 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 748 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 749 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 750 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 751 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 752 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 753 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 754 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 755 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 756 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 757 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 758 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 759 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 760 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 761 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 762 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 763 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 764 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 765 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 766 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 767 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 768 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 769 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 770 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 771 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 772 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 773 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 774 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 775 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 776 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 777 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 778 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 779 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 780 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 781 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 782 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 783 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 784 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 785 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 786 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 787 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 788 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 789 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 790 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 791 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 792 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 793 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 794 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 795 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 796 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 797 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 798 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 799 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 800 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 801 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 802 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 803 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 804 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 805 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 806 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 807 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 808 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 809 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 810 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 811 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 812 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 813 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 814 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 815 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 816 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 817 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 818 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 819 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 820 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 821 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 822 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 823 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 824 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 825 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 826 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 827 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 828 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 829 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 830 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 831 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 832 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 833 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 834 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 835 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 836 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 837 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 838 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 839 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 840 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 841 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 842 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 843 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 844 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 845 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 846 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 847 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 848 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 849 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 850 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 851 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 852 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 853 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 854 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 855 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 856 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 857 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 858 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 859 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 860 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 861 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 862 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 863 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 864 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 865 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 866 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 867 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 868 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 869 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 870 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 871 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 872 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 873 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 874 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 875 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 876 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 877 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 878 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 879 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 880 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 881 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 882 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 883 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 884 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 885 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 886 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 887 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 888 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 889 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 890 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 891 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 892 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 893 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 894 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 895 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 896 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 897 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 898 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 899 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 900 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 901 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 902 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 903 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 904 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 905 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 906 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 907 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 908 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 909 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 910 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 911 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 912 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 913 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 914 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 915 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 916 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 917 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 918 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 919 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 920 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 921 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 922 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 923 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 924 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 925 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 926 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 927 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 928 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 929 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 930 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 931 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 932 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 933 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 934 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 935 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 936 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 937 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 938 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 939 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 940 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 941 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 942 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 943 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 944 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 945 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 946 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 947 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 948 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 949 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 950 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 951 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 952 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 953 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 954 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 955 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 956 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 957 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 958 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 959 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 960 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 961 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 962 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 963 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 964 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 965 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 966 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 967 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 968 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 969 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 970 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 971 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 972 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 973 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 974 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 975 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 976 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 977 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 978 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 979 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 980 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 981 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 982 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 983 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 984 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 985 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 986 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 987 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 988 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 989 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 990 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 991 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 992 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 993 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 994 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 995 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 996 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 997 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 998 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 999 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 1000 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 1001 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 1002 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 1003 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 1004 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1005 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 1006 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 1007 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 1008 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 1009 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 1010 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 1011 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 1012 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 1013 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 1014 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 1015 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 1016 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 1017 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 1018 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 1019 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 1020 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 1021 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 1022 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 1023 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 1024 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 1025 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 1026 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 1027 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 1028 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 1029 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 1030 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 1031 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 1032 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 1033 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 1034 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 1035 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 1036 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 1037 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 1038 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 1039 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 1040 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 1041 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 1042 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 1043 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 1044 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 1045 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 1046 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 1047 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 1048 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 1049 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 1050 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 1051 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 1052 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 1053 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 1054 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 1055 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 1056 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 1057 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 1058 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 1059 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 1060 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 1061 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 1062 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 1063 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 1064 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 1065 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 1066 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 1067 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 1068 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 1069 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 1070 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 1071 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 1072 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 1073 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 1074 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 1075 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 1076 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 1077 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 1078 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 1079 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 1080 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 1081 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 1082 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 1083 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 1084 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 1085 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 1086 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 1087 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 1088 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 1089 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 1090 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 1091 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 1092 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 1093 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 1094 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 1095 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 1096 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 1097 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 1098 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 1099 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 1100 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 1101 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 1102 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 1103 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 1104 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 1105 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 1106 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 1107 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 1108 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 1109 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 1110 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 1111 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 1112 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 1113 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 1114 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 1115 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 1116 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 1117 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 1118 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 1119 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 1120 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 1121 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 1122 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 1123 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 1124 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 1125 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 1126 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 1127 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 1128 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 1129 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 1130 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 1131 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 1132 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 1133 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 1134 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 1135 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 1136 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 1137 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 1138 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 1139 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 1140 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 1141 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 1142 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 1143 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 1144 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 1145 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 1146 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 1147 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 1148 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 1149 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 1150 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 1151 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 1152 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 1153 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 1154 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 1155 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 1156 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 1157 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 1158 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 1159 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 1160 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 1161 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 1162 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 1163 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 1164 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 1165 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 1166 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 1167 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 1168 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 1169 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 1170 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 1171 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1172 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1173 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1174 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1175 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1176 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1177 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1178 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1179 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1180 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1181 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1182 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1183 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1184 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1185 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1186 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1187 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1188 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1189 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1190 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1191 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1192 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1193 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1194 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1195 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 1196 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 1197 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 1198 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 1199 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 1200 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 1201 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 1202 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 1203 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 1204 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 1205 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 1206 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 1207 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 1208 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 1209 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 1210 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 1211 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 1212 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 1213 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 1214 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 1215 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 1216 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 1217 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 1218 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 1219 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 1220 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 1221 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 1222 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 1223 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 1224 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 1225 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 1226 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 1227 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 1228 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 1229 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 1230 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 1231 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 1232 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 1233 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 1234 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 1235 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 1236 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 1237 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 1238 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 1239 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1240 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 1241 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 1242 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 1243 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 1244 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 1245 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 1246 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 1247 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 1248 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 1249 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 1250 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 1251 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 1252 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 1253 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 1254 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 1255 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 1256 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 1257 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 1258 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 1259 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 1260 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 1261 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 1262 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 1263 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 1264 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 1265 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 1266 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 1267 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 1268 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 1269 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 1270 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 1271 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 1272 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 1273 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 1274 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 1275 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 1276 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 1277 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 1278 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 1279 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 1280 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 1281 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 1282 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 1283 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 1284 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1285 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 1286 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 1287 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 1288 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 1289 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 1290 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 1291 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 1292 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 1293 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 1294 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1295 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 1296 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 1297 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1298 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1299 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
| 1300 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 54.68 |
| Metatranscriptomes | 0.05 |
| Isolates | 45.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.31 |
| Bulb | 0 |
| Endosphere | 12.56 |
| Nodule | 35.01 |
| Rhizoplane | 1.71 |
| Rhizosphere | 38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1000078 | 3300002074 | Bacteria | 30305 |
| 2 | JGI24034J26672_10000047 | 3300002239 | Bacteria | 60036 |
| 3 | JGI25156J39149_1012995 | 3300002705 | Bacteria | 1795 |
| 4 | JGI25162J39368_1001999 | 3300002737 | Bacteria | 9096 |
| 5 | JGI25154J39366_1003005 | 3300002738 | Bacteria | 3840 |
| 6 | JGI25158J39367_1000211 | 3300002739 | Bacteria | 13769 |
| 7 | JGI25157J39369_1000312 | 3300002741 | Bacteria | 35057 |
| 8 | JGI25157J39369_1002353 | 3300002741 | Bacteria | 4853 |
| 9 | JGI25152J39213_1000211 | 3300002773 | Bacteria | 39403 |
| 10 | JGI25152J39213_1001114 | 3300002773 | Bacteria | 12553 |
| 11 | JGI25152J39213_1005026 | 3300002773 | Bacteria | 3989 |
| 12 | JGI25152J39213_1005046 | 3300002773 | Bacteria | 3977 |
| 13 | JGI25150J39212_1000103 | 3300002774 | Bacteria | 49029 |
| 14 | JGI25159J45721_1000106 | 3300002987 | Bacteria | 39688 |
| 15 | JGI25159J45721_1000565 | 3300002987 | Bacteria | 16646 |
| 16 | JGI25151J46595_10000015 | 3300003187 | Bacteria | 250420 |
| 17 | JGI25151J46595_10000085 | 3300003187 | Bacteria | 127212 |
| 18 | JGI25151J46595_10000303 | 3300003187 | Bacteria | 53941 |
| 19 | JGI25151J46595_10000442 | 3300003187 | Bacteria | 40576 |
| 20 | JGI25151J46595_10013448 | 3300003187 | Bacteria | 3682 |
| 21 | JGI25165J46597_1000052 | 3300003214 | Bacteria | 236064 |
| 22 | JGI25165J46597_1000225 | 3300003214 | Bacteria | 78516 |
| 23 | JGI25153J46596_10001373 | 3300003215 | Bacteria | 14572 |
| 24 | JGI25153J46596_10011178 | 3300003215 | Bacteria | 3989 |
| 25 | JGI25153J46596_10011226 | 3300003215 | Bacteria | 3977 |
| 26 | rootL2_10076941 | 3300003322 | Bacteria | 4634 |
| 27 | JGI25160J50197_1000134 | 3300003354 | Bacteria | 66627 |
| 28 | JGI25160J50197_1000357 | 3300003354 | Bacteria | 30225 |
| 29 | JGI25160J50197_1004101 | 3300003354 | Bacteria | 6348 |
| 30 | JGI25160J50197_1013969 | 3300003354 | Bacteria | 2709 |
| 31 | JGI25160J50197_1018240 | 3300003354 | Bacteria | 2193 |
| 32 | JGI25161J50226_1000116 | 3300003374 | Bacteria | 62089 |
| 33 | JGI25161J50226_1000227 | 3300003374 | Bacteria | 34620 |
| 34 | JGI25161J50226_1000272 | 3300003374 | Bacteria | 30225 |
| 35 | JGI25161J50226_1002006 | 3300003374 | Bacteria | 5558 |
| 36 | Ga0006562J51391_1009235 | 3300003578 | Bacteria | 6370 |
| 37 | Ga0055539_1000392 | 3300003752 | Bacteria | 17667 |
| 38 | Ga0055533_1000024 | 3300003756 | Bacteria | 338067 |
| 39 | Ga0055525_1000008 | 3300003759 | Bacteria | 604287 |
| 40 | Ga0055525_1000615 | 3300003759 | Bacteria | 14827 |
| 41 | Ga0055527_1000278 | 3300003760 | Bacteria | 30438 |
| 42 | Ga0055535_1000562 | 3300003761 | Bacteria | 31517 |
| 43 | Ga0055542_1000284 | 3300003762 | Bacteria | 56677 |
| 44 | Ga0055542_1000587 | 3300003762 | Bacteria | 31517 |
| 45 | Ga0055529_1000418 | 3300003763 | Bacteria | 43789 |
| 46 | Ga0055526_1000652 | 3300003771 | Bacteria | 26801 |
| 47 | Ga0055526_1001955 | 3300003771 | Bacteria | 14243 |
| 48 | Ga0055526_1002947 | 3300003771 | Bacteria | 11159 |
| 49 | Ga0055526_1009244 | 3300003771 | Bacteria | 4782 |
| 50 | Ga0055526_1010722 | 3300003771 | Bacteria | 4227 |
| 51 | Ga0055526_1011288 | 3300003771 | Bacteria | 4046 |
| 52 | Ga0055526_1012632 | 3300003771 | Bacteria | 3661 |
| 53 | Ga0055524_1000301 | 3300003775 | Bacteria | 47463 |
| 54 | Ga0055524_1000618 | 3300003775 | Bacteria | 25511 |
| 55 | Ga0055524_1001672 | 3300003775 | Bacteria | 12357 |
| 56 | Ga0055524_1001793 | 3300003775 | Bacteria | 11777 |
| 57 | Ga0055524_1010049 | 3300003775 | Bacteria | 3795 |
| 58 | Ga0055524_1013171 | 3300003775 | Bacteria | 3133 |
| 59 | Ga0055536_1005119 | 3300003781 | Bacteria | 6490 |
| 60 | Ga0055536_1015701 | 3300003781 | Bacteria | 2575 |
| 61 | Ga0055528_1000602 | 3300003790 | Bacteria | 26995 |
| 62 | Ga0055528_1000712 | 3300003790 | Bacteria | 23580 |
| 63 | Ga0055528_1000849 | 3300003790 | Bacteria | 20740 |
| 64 | Ga0055528_1002425 | 3300003790 | Bacteria | 9994 |
| 65 | Ga0055528_1008911 | 3300003790 | Bacteria | 4241 |
| 66 | Ga0055540_1000131 | 3300003792 | Bacteria | 75615 |
| 67 | Ga0055540_1005898 | 3300003792 | Bacteria | 5007 |
| 68 | Ga0055540_1007846 | 3300003792 | Bacteria | 3949 |
| 69 | Ga0055531_10005530 | 3300003794 | Bacteria | 7375 |
| 70 | Ga0055543_1000093 | 3300004625 | Bacteria | 78294 |
| 71 | Ga0055543_1000161 | 3300004625 | Bacteria | 56068 |
| 72 | Ga0055543_1000574 | 3300004625 | Bacteria | 20329 |
| 73 | Ga0065165_1000014 | 3300005262 | Bacteria | 292366 |
| 74 | Ga0065165_1000196 | 3300005262 | Bacteria | 104569 |
| 75 | Ga0065165_1000553 | 3300005262 | Bacteria | 56068 |
| 76 | Ga0065165_1000627 | 3300005262 | Bacteria | 51278 |
| 77 | Ga0070658_10134102 | 3300005327 | Bacteria | 2065 |
| 78 | Ga0070658_10210060 | 3300005327 | Bacteria | 1644 |
| 79 | Ga0070690_100043814 | 3300005330 | Bacteria | 2839 |
| 80 | Ga0068869_100128336 | 3300005334 | Bacteria | 1947 |
| 81 | Ga0070660_100044256 | 3300005339 | Bacteria | 3404 |
| 82 | Ga0070660_100122321 | 3300005339 | Bacteria | 2077 |
| 83 | Ga0070689_100030629 | 3300005340 | Bacteria | 4085 |
| 84 | Ga0070691_10004671 | 3300005341 | Bacteria | 6228 |
| 85 | Ga0070661_100210633 | 3300005344 | Bacteria | 1488 |
| 86 | Ga0070668_100133641 | 3300005347 | Bacteria | 1993 |
| 87 | Ga0070673_100171582 | 3300005364 | Bacteria | 1852 |
| 88 | Ga0070688_100000440 | 3300005365 | Bacteria | 20984 |
| 89 | Ga0070659_100085886 | 3300005366 | Bacteria | 2517 |
| 90 | Ga0070713_100047301 | 3300005436 | Bacteria | 3535 |
| 91 | Ga0070713_100365743 | 3300005436 | Bacteria | 1341 |
| 92 | Ga0070711_100098757 | 3300005439 | Bacteria | 2120 |
| 93 | Ga0070711_100150922 | 3300005439 | Bacteria | 1752 |
| 94 | Ga0070700_100079706 | 3300005441 | Bacteria | 2111 |
| 95 | Ga0070694_100030931 | 3300005444 | Bacteria | 3507 |
| 96 | Ga0070662_100054711 | 3300005457 | Bacteria | 2892 |
| 97 | Ga0070685_10000538 | 3300005466 | Bacteria | 21461 |
| 98 | Ga0070706_100175279 | 3300005467 | Bacteria | 2002 |
| 99 | Ga0070707_100157727 | 3300005468 | Bacteria | 2211 |
| 100 | Ga0070698_100005438 | 3300005471 | Bacteria | 13908 |
| 101 | Ga0070699_100127316 | 3300005518 | Bacteria | 2243 |
| 102 | Ga0070684_100019867 | 3300005535 | Bacteria | 5565 |
| 103 | Ga0068853_100039120 | 3300005539 | Bacteria | 4044 |
| 104 | Ga0068853_100097806 | 3300005539 | Bacteria | 2591 |
| 105 | Ga0070695_100003867 | 3300005545 | Bacteria | 8735 |
| 106 | Ga0070665_100000087 | 3300005548 | Bacteria | 177846 |
| 107 | Ga0070665_100112054 | 3300005548 | Bacteria | 2731 |
| 108 | Ga0070665_100257934 | 3300005548 | Bacteria | 1745 |
| 109 | Ga0068855_100002198 | 3300005563 | Bacteria | 24123 |
| 110 | Ga0068855_100010534 | 3300005563 | Bacteria | 11151 |
| 111 | Ga0068855_100267875 | 3300005563 | Bacteria | 1900 |
| 112 | Ga0068855_100315710 | 3300005563 | Bacteria | 1728 |
| 113 | Ga0070664_100024464 | 3300005564 | Bacteria | 4995 |
| 114 | Ga0070664_100078408 | 3300005564 | Bacteria | 2842 |
| 115 | Ga0068857_100025509 | 3300005577 | Bacteria | 5204 |
| 116 | Ga0068854_100010289 | 3300005578 | Bacteria | 6062 |
| 117 | Ga0068854_100026684 | 3300005578 | Bacteria | 3973 |
| 118 | Ga0068856_100001613 | 3300005614 | Bacteria | 23596 |
| 119 | Ga0068852_100030903 | 3300005616 | Bacteria | 4413 |
| 120 | Ga0068852_100051942 | 3300005616 | Bacteria | 3521 |
| 121 | Ga0068861_100068433 | 3300005719 | Bacteria | 2744 |
| 122 | Ga0068863_100000046 | 3300005841 | Bacteria | 143895 |
| 123 | Ga0081455_10000373 | 3300005937 | Bacteria | 59312 |
| 124 | Ga0081455_10000637 | 3300005937 | Bacteria | 45442 |
| 125 | Ga0081455_10002518 | 3300005937 | Bacteria | 21757 |
| 126 | Ga0081455_10003610 | 3300005937 | Bacteria | 17734 |
| 127 | Ga0081540_1000087 | 3300005983 | Bacteria | 99227 |
| 128 | Ga0081540_1033187 | 3300005983 | Bacteria | 2807 |
| 129 | Ga0081539_10000429 | 3300005985 | Bacteria | 89452 |
| 130 | Ga0081539_10004039 | 3300005985 | Bacteria | 16822 |
| 131 | Ga0075365_10000621 | 3300006038 | Bacteria | 13993 |
| 132 | Ga0075365_10034710 | 3300006038 | Bacteria | 3258 |
| 133 | Ga0075365_10043511 | 3300006038 | Bacteria | 2940 |
| 134 | Ga0075368_10040317 | 3300006042 | Bacteria | 1833 |
| 135 | Ga0075363_100016576 | 3300006048 | Bacteria | 3641 |
| 136 | Ga0075363_100026744 | 3300006048 | Bacteria | 2953 |
| 137 | Ga0075364_10012374 | 3300006051 | Bacteria | 5217 |
| 138 | Ga0075364_10020622 | 3300006051 | Bacteria | 4146 |
| 139 | Ga0075364_10022554 | 3300006051 | Bacteria | 3977 |
| 140 | Ga0075432_10030664 | 3300006058 | Bacteria | 1859 |
| 141 | Ga0070712_100023146 | 3300006175 | Bacteria | 4100 |
| 142 | Ga0070712_100079287 | 3300006175 | Bacteria | 2373 |
| 143 | Ga0075362_10000600 | 3300006177 | Bacteria | 10570 |
| 144 | Ga0075362_10008900 | 3300006177 | Bacteria | 3859 |
| 145 | Ga0075362_10061021 | 3300006177 | Bacteria | 1705 |
| 146 | Ga0075367_10004723 | 3300006178 | Bacteria | 6697 |
| 147 | Ga0075369_10000214 | 3300006186 | Bacteria | 17133 |
| 148 | Ga0075369_10003614 | 3300006186 | Bacteria | 5643 |
| 149 | Ga0075369_10012709 | 3300006186 | Bacteria | 3326 |
| 150 | Ga0075369_10022119 | 3300006186 | Bacteria | 2620 |
| 151 | Ga0075369_10028215 | 3300006186 | Bacteria | 2351 |
| 152 | Ga0075366_10070997 | 3300006195 | Bacteria | 2075 |
| 153 | Ga0075366_10111527 | 3300006195 | Bacteria | 1645 |
| 154 | Ga0075370_10002165 | 3300006353 | Bacteria | 9001 |
| 155 | Ga0075428_100045123 | 3300006844 | Bacteria | 4843 |
| 156 | Ga0075430_100023735 | 3300006846 | Bacteria | 5223 |
| 157 | Ga0075431_100006794 | 3300006847 | Bacteria | 11364 |
| 158 | Ga0075431_100025820 | 3300006847 | Bacteria | 6021 |
| 159 | Ga0075433_10144404 | 3300006852 | Bacteria | 2115 |
| 160 | Ga0075434_100014619 | 3300006871 | Bacteria | 7507 |
| 161 | Ga0075434_100188350 | 3300006871 | Bacteria | 2083 |
| 162 | Ga0075429_100040711 | 3300006880 | Bacteria | 4046 |
| 163 | Ga0079104_1000386 | 3300006946 | Bacteria | 51269 |
| 164 | Ga0099826_10000080 | 3300006948 | Bacteria | 48855 |
| 165 | Ga0075435_100010284 | 3300007076 | Bacteria | 6837 |
| 166 | Ga0099794_10071455 | 3300007265 | Bacteria | 1700 |
| 167 | Ga0105244_10024354 | 3300009036 | Bacteria | 3304 |
| 168 | Ga0105244_10047669 | 3300009036 | Bacteria | 2196 |
| 169 | Ga0111539_10055655 | 3300009094 | Bacteria | 4703 |
| 170 | Ga0114129_10043003 | 3300009147 | Bacteria | 6359 |
| 171 | Ga0105243_10044429 | 3300009148 | Bacteria | 3485 |
| 172 | Ga0105243_10235250 | 3300009148 | Bacteria | 1627 |
| 173 | Ga0105243_10341770 | 3300009148 | Bacteria | 1371 |
| 174 | Ga0105241_10003901 | 3300009174 | Bacteria | 11047 |
| 175 | Ga0105248_10067959 | 3300009177 | Bacteria | 4001 |
| 176 | Ga0105248_10141070 | 3300009177 | Bacteria | 2718 |
| 177 | Ga0105237_10061705 | 3300009545 | Bacteria | 3747 |
| 178 | Ga0105237_10235839 | 3300009545 | Bacteria | 1831 |
| 179 | Ga0105238_10009341 | 3300009551 | Bacteria | 9820 |
| 180 | Ga0105249_10116374 | 3300009553 | Bacteria | 2534 |
| 181 | Ga0123341_1000093 | 3300009765 | Bacteria | 37635 |
| 182 | Ga0123342_1017495 | 3300009766 | Bacteria | 5942 |
| 183 | Ga0105239_10158669 | 3300010375 | Bacteria | 2527 |
| 184 | Ga0157373_10055382 | 3300013100 | Bacteria | 2817 |
| 185 | Ga0157371_10000002 | 3300013102 | Bacteria | 665040 |
| 186 | Ga0157371_10000128 | 3300013102 | Bacteria | 116349 |
| 187 | Ga0157371_10058393 | 3300013102 | Bacteria | 2737 |
| 188 | Ga0157370_10000143 | 3300013104 | Bacteria | 87289 |
| 189 | Ga0157370_10010599 | 3300013104 | Bacteria | 9703 |
| 190 | Ga0157369_10006614 | 3300013105 | Bacteria | 13409 |
| 191 | Ga0157369_10020411 | 3300013105 | Bacteria | 7405 |
| 192 | Ga0157369_10064215 | 3300013105 | Bacteria | 3954 |
| 193 | Ga0157369_10291424 | 3300013105 | Bacteria | 1699 |
| 194 | Ga0171463_1014 | 3300013249 | Bacteria | 83917 |
| 195 | Ga0163163_10224123 | 3300014325 | Bacteria | 1929 |
| 196 | Ga0157380_10012206 | 3300014326 | Bacteria | 6225 |
| 197 | Ga0182006_1042460 | 3300015261 | Bacteria | 1782 |
| 198 | Ga0183363_1028 | 3300015690 | Bacteria | 50706 |
| 199 | Ga0163161_10070378 | 3300017792 | Bacteria | 2558 |
| 200 | Ga0214544_1000063 | 3300021320 | Bacteria | 129929 |
| 201 | Ga0214542_1000095 | 3300021321 | Bacteria | 116012 |
| 202 | Ga0214542_1023913 | 3300021321 | Bacteria | 3532 |
| 203 | Ga0214543_1000008 | 3300021327 | Bacteria | 385680 |
| 204 | Ga0214543_1000026 | 3300021327 | Bacteria | 220652 |
| 205 | Ga0213873_10011471 | 3300021358 | Bacteria | 1897 |
| 206 | Ga0213872_10016302 | 3300021361 | Bacteria | 3450 |
| 207 | Ga0213874_10006267 | 3300021377 | Bacteria | 2811 |
| 208 | Ga0213874_10010612 | 3300021377 | Bacteria | 2310 |
| 209 | Ga0213876_10001001 | 3300021384 | Bacteria | 18441 |
| 210 | Ga0213876_10007938 | 3300021384 | Bacteria | 5758 |
| 211 | Ga0213876_10012988 | 3300021384 | Bacteria | 4427 |
| 212 | Ga0213871_10001994 | 3300021441 | Bacteria | 3637 |
| 213 | Ga0228711_1000003 | 3300022739 | Bacteria | 258118 |
| 214 | Ga0228710_1000003 | 3300022740 | Bacteria | 262981 |
| 215 | Ga0209436_100021 | 3300025208 | Bacteria | 102115 |
| 216 | Ga0209436_101037 | 3300025208 | Bacteria | 10611 |
| 217 | Ga0209674_100007 | 3300025226 | Bacteria | 1077082 |
| 218 | Ga0209672_100069 | 3300025228 | Bacteria | 174956 |
| 219 | Ga0209147_100044 | 3300025229 | Bacteria | 300330 |
| 220 | Ga0209563_100003 | 3300025230 | Bacteria | 1932942 |
| 221 | Ga0209563_100060 | 3300025230 | Bacteria | 284876 |
| 222 | Ga0207427_100282 | 3300025231 | Bacteria | 37116 |
| 223 | Ga0207427_100659 | 3300025231 | Bacteria | 16583 |
| 224 | Ga0209437_100183 | 3300025233 | Bacteria | 129519 |
| 225 | Ga0209258_100031 | 3300025242 | Bacteria | 463572 |
| 226 | Ga0209258_101271 | 3300025242 | Bacteria | 9530 |
| 227 | Ga0207425_1000065 | 3300025245 | Bacteria | 127264 |
| 228 | Ga0207425_1000912 | 3300025245 | Bacteria | 14151 |
| 229 | Ga0207425_1002840 | 3300025245 | Bacteria | 5827 |
| 230 | Ga0207425_1008148 | 3300025245 | Bacteria | 2707 |
| 231 | Ga0209646_1000056 | 3300025246 | Bacteria | 269860 |
| 232 | Ga0209646_1010083 | 3300025246 | Bacteria | 1487 |
| 233 | Ga0209026_1000009 | 3300025250 | Bacteria | 531812 |
| 234 | Ga0209026_1000141 | 3300025250 | Bacteria | 114545 |
| 235 | Ga0209677_100088 | 3300025253 | Bacteria | 108817 |
| 236 | Ga0209677_100112 | 3300025253 | Bacteria | 85460 |
| 237 | Ga0209677_102809 | 3300025253 | Bacteria | 6164 |
| 238 | Ga0209677_104123 | 3300025253 | Bacteria | 4345 |
| 239 | Ga0209148_1000027 | 3300025254 | Bacteria | 616374 |
| 240 | Ga0209148_1000111 | 3300025254 | Bacteria | 198095 |
| 241 | Ga0209759_1000035 | 3300025256 | Bacteria | 264254 |
| 242 | Ga0209759_1001567 | 3300025256 | Bacteria | 12468 |
| 243 | Ga0209759_1005260 | 3300025256 | Bacteria | 4588 |
| 244 | Ga0209129_1000132 | 3300025258 | Bacteria | 127262 |
| 245 | Ga0209129_1001371 | 3300025258 | Bacteria | 13681 |
| 246 | Ga0209129_1001912 | 3300025258 | Bacteria | 10968 |
| 247 | Ga0209129_1002753 | 3300025258 | Bacteria | 8219 |
| 248 | Ga0209129_1003666 | 3300025258 | Bacteria | 6535 |
| 249 | Ga0209129_1003832 | 3300025258 | Bacteria | 6279 |
| 250 | Ga0209233_1000054 | 3300025261 | Bacteria | 439669 |
| 251 | Ga0209233_1000118 | 3300025261 | Bacteria | 236172 |
| 252 | Ga0209565_1013116 | 3300025263 | Bacteria | 1949 |
| 253 | Ga0209455_1000058 | 3300025272 | Bacteria | 342028 |
| 254 | Ga0209455_1000206 | 3300025272 | Bacteria | 84430 |
| 255 | Ga0209455_1000742 | 3300025272 | Bacteria | 18682 |
| 256 | Ga0209673_1000020 | 3300025273 | Bacteria | 430653 |
| 257 | Ga0209673_1000059 | 3300025273 | Bacteria | 268892 |
| 258 | Ga0209673_1000475 | 3300025273 | Bacteria | 67091 |
| 259 | Ga0209673_1003583 | 3300025273 | Bacteria | 9041 |
| 260 | Ga0209673_1006173 | 3300025273 | Bacteria | 5863 |
| 261 | Ga0209673_1006661 | 3300025273 | Bacteria | 5518 |
| 262 | Ga0209673_1008055 | 3300025273 | Bacteria | 4743 |
| 263 | Ga0209673_1009721 | 3300025273 | Bacteria | 4131 |
| 264 | Ga0209673_1018568 | 3300025273 | Bacteria | 2523 |
| 265 | Ga0209673_1028253 | 3300025273 | Bacteria | 1809 |
| 266 | Ga0209130_1000001 | 3300025284 | Bacteria | 831557 |
| 267 | Ga0209130_1000024 | 3300025284 | Bacteria | 354212 |
| 268 | Ga0209130_1000122 | 3300025284 | Bacteria | 126935 |
| 269 | Ga0209130_1000198 | 3300025284 | Bacteria | 82557 |
| 270 | Ga0209675_1000455 | 3300025291 | Bacteria | 31451 |
| 271 | Ga0209676_1020075 | 3300025292 | Bacteria | 2279 |
| 272 | Ga0209025_1000010 | 3300025294 | Bacteria | 986612 |
| 273 | Ga0209025_1000081 | 3300025294 | Bacteria | 265899 |
| 274 | Ga0209025_1000247 | 3300025294 | Bacteria | 127264 |
| 275 | Ga0209025_1000339 | 3300025294 | Bacteria | 103239 |
| 276 | Ga0209025_1004168 | 3300025294 | Bacteria | 12801 |
| 277 | Ga0209025_1004847 | 3300025294 | Bacteria | 11356 |
| 278 | Ga0209025_1007051 | 3300025294 | Bacteria | 8510 |
| 279 | Ga0209025_1026001 | 3300025294 | Bacteria | 2955 |
| 280 | Ga0209564_1000048 | 3300025295 | Bacteria | 364806 |
| 281 | Ga0209564_1000074 | 3300025295 | Bacteria | 286043 |
| 282 | Ga0209564_1000205 | 3300025295 | Bacteria | 135901 |
| 283 | Ga0209564_1000353 | 3300025295 | Bacteria | 85747 |
| 284 | Ga0209564_1000496 | 3300025295 | Bacteria | 64984 |
| 285 | Ga0209564_1001947 | 3300025295 | Bacteria | 18289 |
| 286 | Ga0209564_1002995 | 3300025295 | Bacteria | 12135 |
| 287 | Ga0209564_1003802 | 3300025295 | Bacteria | 9788 |
| 288 | Ga0209564_1006946 | 3300025295 | Bacteria | 5949 |
| 289 | Ga0209564_1012841 | 3300025295 | Bacteria | 3613 |
| 290 | Ga0209758_1000058 | 3300025297 | Bacteria | 331603 |
| 291 | Ga0209758_1000076 | 3300025297 | Bacteria | 270615 |
| 292 | Ga0209758_1000212 | 3300025297 | Bacteria | 127597 |
| 293 | Ga0209758_1000632 | 3300025297 | Bacteria | 53987 |
| 294 | Ga0209758_1001845 | 3300025297 | Bacteria | 23249 |
| 295 | Ga0209758_1001850 | 3300025297 | Bacteria | 23235 |
| 296 | Ga0209758_1009090 | 3300025297 | Bacteria | 6266 |
| 297 | Ga0209758_1009203 | 3300025297 | Bacteria | 6200 |
| 298 | Ga0209758_1012519 | 3300025297 | Bacteria | 4736 |
| 299 | Ga0209758_1014390 | 3300025297 | Bacteria | 4212 |
| 300 | Ga0209050_1023979 | 3300025298 | Bacteria | 2127 |
| 301 | Ga0209256_1000041 | 3300025299 | Bacteria | 364827 |
| 302 | Ga0209256_1000368 | 3300025299 | Bacteria | 72598 |
| 303 | Ga0209256_1000439 | 3300025299 | Bacteria | 64161 |
| 304 | Ga0209256_1000456 | 3300025299 | Bacteria | 61717 |
| 305 | Ga0209256_1000884 | 3300025299 | Bacteria | 37000 |
| 306 | Ga0209256_1001113 | 3300025299 | Bacteria | 30755 |
| 307 | Ga0209256_1002079 | 3300025299 | Bacteria | 17595 |
| 308 | Ga0209256_1006792 | 3300025299 | Bacteria | 5907 |
| 309 | Ga0209256_1007313 | 3300025299 | Bacteria | 5492 |
| 310 | Ga0209256_1009415 | 3300025299 | Bacteria | 4289 |
| 311 | Ga0209256_1010744 | 3300025299 | Bacteria | 3780 |
| 312 | Ga0207426_1000005 | 3300025302 | Bacteria | 1037188 |
| 313 | Ga0207426_1000048 | 3300025302 | Bacteria | 409127 |
| 314 | Ga0207426_1000083 | 3300025302 | Bacteria | 298770 |
| 315 | Ga0207426_1000285 | 3300025302 | Bacteria | 102879 |
| 316 | Ga0207426_1000679 | 3300025302 | Bacteria | 41188 |
| 317 | Ga0207426_1004795 | 3300025302 | Bacteria | 6425 |
| 318 | Ga0209051_1000038 | 3300025303 | Bacteria | 320926 |
| 319 | Ga0209051_1002114 | 3300025303 | Bacteria | 14862 |
| 320 | Ga0209051_1008605 | 3300025303 | Bacteria | 5381 |
| 321 | Ga0209257_1017738 | 3300025304 | Bacteria | 2786 |
| 322 | Ga0209257_1021472 | 3300025304 | Bacteria | 2343 |
| 323 | Ga0209257_1036226 | 3300025304 | Bacteria | 1518 |
| 324 | Ga0207688_10095087 | 3300025901 | Bacteria | 1715 |
| 325 | Ga0207705_10003450 | 3300025909 | Bacteria | 12028 |
| 326 | Ga0207654_10007763 | 3300025911 | Bacteria | 5414 |
| 327 | Ga0207654_10076509 | 3300025911 | Bacteria | 2004 |
| 328 | Ga0207695_10023098 | 3300025913 | Bacteria | 7038 |
| 329 | Ga0207695_10030412 | 3300025913 | Bacteria | 5943 |
| 330 | Ga0207663_10030964 | 3300025916 | Bacteria | 3161 |
| 331 | Ga0207663_10144453 | 3300025916 | Bacteria | 1661 |
| 332 | Ga0207657_10003943 | 3300025919 | Bacteria | 15759 |
| 333 | Ga0207657_10019641 | 3300025919 | Bacteria | 6408 |
| 334 | Ga0207657_10128807 | 3300025919 | Bacteria | 2076 |
| 335 | Ga0207652_10210488 | 3300025921 | Bacteria | 1751 |
| 336 | Ga0207646_10085365 | 3300025922 | Bacteria | 2824 |
| 337 | Ga0207694_10011887 | 3300025924 | Bacteria | 6566 |
| 338 | Ga0207650_10060074 | 3300025925 | Bacteria | 2836 |
| 339 | Ga0207700_10054476 | 3300025928 | Bacteria | 3002 |
| 340 | Ga0207706_10275657 | 3300025933 | Bacteria | 1467 |
| 341 | Ga0207686_10033052 | 3300025934 | Bacteria | 3084 |
| 342 | Ga0207670_10024566 | 3300025936 | Bacteria | 3768 |
| 343 | Ga0207670_10103001 | 3300025936 | Bacteria | 2042 |
| 344 | Ga0207711_10081706 | 3300025941 | Bacteria | 2824 |
| 345 | Ga0207711_10187866 | 3300025941 | Bacteria | 1882 |
| 346 | Ga0207711_10212205 | 3300025941 | Bacteria | 1768 |
| 347 | Ga0207689_10199198 | 3300025942 | Bacteria | 1653 |
| 348 | Ga0207679_10095758 | 3300025945 | Bacteria | 2308 |
| 349 | Ga0207667_10090792 | 3300025949 | Bacteria | 3156 |
| 350 | Ga0207651_10133214 | 3300025960 | Bacteria | 1906 |
| 351 | Ga0207668_10109627 | 3300025972 | Bacteria | 2068 |
| 352 | Ga0207640_10007812 | 3300025981 | Bacteria | 5906 |
| 353 | Ga0207703_10170902 | 3300026035 | Bacteria | 1912 |
| 354 | Ga0207678_10199179 | 3300026067 | Bacteria | 1712 |
| 355 | Ga0207678_10220986 | 3300026067 | Bacteria | 1621 |
| 356 | Ga0207708_10012415 | 3300026075 | Bacteria | 6350 |
| 357 | Ga0207702_10001270 | 3300026078 | Bacteria | 25363 |
| 358 | Ga0207702_10003872 | 3300026078 | Bacteria | 13486 |
| 359 | Ga0207702_10141023 | 3300026078 | Bacteria | 2181 |
| 360 | Ga0207641_10000517 | 3300026088 | Bacteria | 43309 |
| 361 | Ga0207674_10029976 | 3300026116 | Bacteria | 5723 |
| 362 | Ga0207675_100024607 | 3300026118 | Bacteria | 5598 |
| 363 | Ga0207675_100309123 | 3300026118 | Bacteria | 1541 |
| 364 | Ga0207683_10133125 | 3300026121 | Bacteria | 2237 |
| 365 | Ga0207698_10216126 | 3300026142 | Bacteria | 1729 |
| 366 | Ga0209281_1000061 | 3300027111 | Bacteria | 293814 |
| 367 | Ga0209281_1000081 | 3300027111 | Bacteria | 258084 |
| 368 | Ga0209281_1000141 | 3300027111 | Bacteria | 175634 |
| 369 | Ga0209389_1000133 | 3300027296 | Bacteria | 65939 |
| 370 | Ga0209389_1006188 | 3300027296 | Bacteria | 10358 |
| 371 | Ga0209371_1000003 | 3300027312 | Bacteria | 1122971 |
| 372 | Ga0209371_1001726 | 3300027312 | Bacteria | 13787 |
| 373 | Ga0209371_1002486 | 3300027312 | Bacteria | 10235 |
| 374 | Ga0209589_1013845 | 3300027357 | Bacteria | 10358 |
| 375 | Ga0209489_110509 | 3300027361 | Bacteria | 10358 |
| 376 | Ga0209700_100005 | 3300027363 | Bacteria | 573969 |
| 377 | Ga0209282_1000036 | 3300027666 | Bacteria | 130242 |
| 378 | Ga0207428_10004370 | 3300027907 | Bacteria | 13483 |
| 379 | Ga0268266_10000009 | 3300028379 | Bacteria | 1097737 |
| 380 | Ga0268266_10003103 | 3300028379 | Bacteria | 16929 |
| 381 | Ga0268266_10078944 | 3300028379 | Bacteria | 2865 |
| 382 | Ga0268266_10088667 | 3300028379 | Bacteria | 2707 |
| 383 | Ga0268264_10305404 | 3300028381 | Bacteria | 1499 |
| 384 | Ga0265336_10000039 | 3300028666 | Bacteria | 149376 |
| 385 | Ga0307515_10000121 | 3300028794 | Bacteria | 188657 |
| 386 | Ga0307515_10000375 | 3300028794 | Bacteria | 109285 |
| 387 | Ga0307515_10004715 | 3300028794 | Bacteria | 27940 |
| 388 | Ga0307515_10038687 | 3300028794 | Bacteria | 7619 |
| 389 | Ga0265324_10000223 | 3300029957 | Bacteria | 43654 |
| 390 | Ga0268256_1000004 | 3300030500 | Bacteria | 1122967 |
| 391 | Ga0268256_1001505 | 3300030500 | Bacteria | 13791 |
| 392 | Ga0268256_1002211 | 3300030500 | Bacteria | 10235 |
| 393 | Ga0307511_10025974 | 3300030521 | Bacteria | 5383 |
| 394 | Ga0307511_10090227 | 3300030521 | Bacteria | 2083 |
| 395 | Ga0265332_10000022 | 3300031238 | Bacteria | 213072 |
| 396 | Ga0265328_10017627 | 3300031239 | Bacteria | 2764 |
| 397 | Ga0307513_10000685 | 3300031456 | Bacteria | 48701 |
| 398 | Ga0307513_10098885 | 3300031456 | Bacteria | 2947 |
| 399 | Ga0307509_10005791 | 3300031507 | Bacteria | 16976 |
| 400 | Ga0316576_10122192 | 3300031727 | Bacteria | 1956 |
| 401 | Ga0307516_10001841 | 3300031730 | Bacteria | 29116 |
| 402 | Ga0307405_10115461 | 3300031731 | Bacteria | 1827 |
| 403 | Ga0307412_10001638 | 3300031911 | Bacteria | 12351 |
| 404 | Ga0307412_10130928 | 3300031911 | Bacteria | 1822 |
| 405 | Ga0307412_10148001 | 3300031911 | Bacteria | 1729 |
| 406 | Ga0315914_1000002 | 3300031967 | Bacteria | 365357 |
| 407 | Ga0307507_10032928 | 3300033179 | Bacteria | 5394 |
| 408 | Ga0315913_1000009 | 3300033430 | Bacteria | 149770 |
| 409 | Ga0315915_1000005 | 3300033464 | Bacteria | 397591 |
| 410 | Ga0373962_0006832 | 3300035242 | Bacteria | 2777 |
| 411 | Ga0373935_0027424 | 3300035692 | Bacteria | 3520 |
| 412 | Ga0373927_0002624 | 3300035695 | Bacteria | 13109 |
| 413 | Ga0373927_0013018 | 3300035695 | Bacteria | 5533 |
| 414 | Ga0373927_0050071 | 3300035695 | Bacteria | 2700 |
| 415 | Ga0373927_0068840 | 3300035695 | Bacteria | 2291 |
| 416 | Ga0373933_0010887 | 3300035724 | Bacteria | 4993 |
| 417 | Ga0373947_0046525 | 3300035725 | Bacteria | 2599 |
| 418 | Ga0316584_0042001 | 3300036712 | Bacteria | 3410 |
| 419 | Ga0373925_0009563 | 3300037068 | Bacteria | 7061 |
| 420 | Ga0373925_0075689 | 3300037068 | Bacteria | 2551 |
| 421 | Ga0395899_0000114 | 3300037312 | Bacteria | 134621 |
| 422 | Ga0395899_0000256 | 3300037312 | Bacteria | 70194 |
| 423 | Ga0395899_0000388 | 3300037312 | Bacteria | 52455 |
| 424 | Ga0395899_0005500 | 3300037312 | Bacteria | 9813 |
| 425 | Ga0395899_0008000 | 3300037312 | Bacteria | 8144 |
| 426 | Ga0395899_0030974 | 3300037312 | Bacteria | 4022 |
| 427 | Ga0395899_0197059 | 3300037312 | Bacteria | 1406 |
| 428 | Ga0395900_0000154 | 3300037418 | Bacteria | 113757 |
| 429 | Ga0395900_0000495 | 3300037418 | Bacteria | 55568 |
| 430 | Ga0395900_0017561 | 3300037418 | Bacteria | 7301 |
| 431 | Ga0395900_0018932 | 3300037418 | Bacteria | 7022 |
| 432 | Ga0395900_0019966 | 3300037418 | Bacteria | 6830 |
| 433 | Ga0395900_0021874 | 3300037418 | Bacteria | 6538 |
| 434 | Ga0395900_0026789 | 3300037418 | Bacteria | 5899 |
| 435 | Ga0395900_0034524 | 3300037418 | Bacteria | 5209 |
| 436 | Ga0395898_0000308 | 3300037466 | Bacteria | 113757 |
| 437 | Ga0395898_0001598 | 3300037466 | Bacteria | 30916 |
| 438 | Ga0395898_0008520 | 3300037466 | Bacteria | 10834 |
| 439 | Ga0395898_0009676 | 3300037466 | Bacteria | 10110 |
| 440 | Ga0395898_0013150 | 3300037466 | Bacteria | 8532 |
| 441 | Ga0395898_0047847 | 3300037466 | Bacteria | 4194 |
| 442 | Ga0395898_0082134 | 3300037466 | Bacteria | 3106 |
| 443 | Ga0395898_0133780 | 3300037466 | Bacteria | 2374 |
| 444 | Ga0395905_0000153 | 3300037471 | Bacteria | 113757 |
| 445 | Ga0395905_0000608 | 3300037471 | Bacteria | 47958 |
| 446 | Ga0395905_0002370 | 3300037471 | Bacteria | 20992 |
| 447 | Ga0395905_0003440 | 3300037471 | Bacteria | 16941 |
| 448 | Ga0395905_0041221 | 3300037471 | Bacteria | 4333 |
| 449 | Ga0395905_0042986 | 3300037471 | Bacteria | 4239 |
| 450 | Ga0395905_0050293 | 3300037471 | Bacteria | 3905 |
| 451 | Ga0395905_0071866 | 3300037471 | Bacteria | 3243 |
| 452 | Ga0395905_0115933 | 3300037471 | Bacteria | 2517 |
| 453 | Ga0395905_0118637 | 3300037471 | Bacteria | 2487 |
| 454 | Ga0395905_0260112 | 3300037471 | Bacteria | 1620 |
| 455 | Ga0436364_0404283 | 3300037853 | Bacteria | 3928 |
| 456 | Ga0436364_0765904 | 3300037853 | Bacteria | 2607 |
| 457 | Ga0395901_0000094 | 3300038443 | Bacteria | 120153 |
| 458 | Ga0395901_0000107 | 3300038443 | Bacteria | 113757 |
| 459 | Ga0395901_0000251 | 3300038443 | Bacteria | 66862 |
| 460 | Ga0395901_0000442 | 3300038443 | Bacteria | 48366 |
| 461 | Ga0395901_0007216 | 3300038443 | Bacteria | 11207 |
| 462 | Ga0395901_0026926 | 3300038443 | Bacteria | 5903 |
| 463 | Ga0395901_0052706 | 3300038443 | Bacteria | 4228 |
| 464 | Ga0395901_0068851 | 3300038443 | Bacteria | 3686 |
| 465 | Ga0395901_0133478 | 3300038443 | Bacteria | 2609 |
| 466 | Ga0395901_0185078 | 3300038443 | Bacteria | 2184 |
| 467 | Ga0395901_0200299 | 3300038443 | Bacteria | 2093 |
| 468 | Ga0395901_0324115 | 3300038443 | Bacteria | 1593 |
| 469 | Ga0436365_0719336 | 3300039437 | Bacteria | 4632 |
| 470 | Ga0436365_0753514 | 3300039437 | Bacteria | 3964 |
| 471 | Ga0436365_0840670 | 3300039437 | Bacteria | 47211 |
| 472 | Ga0436365_1017006 | 3300039437 | Bacteria | 12784 |
| 473 | Ga0436365_1031487 | 3300039437 | Bacteria | 5617 |
| 474 | Ga0436365_1892158 | 3300039437 | Bacteria | 2018 |
| 475 | Ga0436360_0326901 | 3300039438 | Bacteria | 5604 |
| 476 | Ga0436360_0648562 | 3300039438 | Bacteria | 3478 |
| 477 | Ga0436360_0990394 | 3300039438 | Bacteria | 1960 |
| 478 | Ga0436361_0019078 | 3300039447 | Bacteria | 4350 |
| 479 | Ga0436361_0135137 | 3300039447 | Bacteria | 2810 |
| 480 | Ga0436361_0507251 | 3300039447 | Bacteria | 2563 |
| 481 | Ga0436363_0046001 | 3300039450 | Bacteria | 12447 |
| 482 | Ga0436363_1344620 | 3300039450 | Bacteria | 14693 |
| 483 | Ga0436362_0841325 | 3300039453 | Bacteria | 5869 |
| 484 | Ga0436362_1110877 | 3300039453 | Bacteria | 2737 |
| 485 | Ga0439465_0003037 | 3300041413 | Bacteria | 5489 |
| 486 | Ga0439445_0006529 | 3300042004 | Bacteria | 2683 |
| 487 | Ga0439448_0000551 | 3300042005 | Bacteria | 8758 |
| 488 | Ga0439449_0034617 | 3300042007 | Bacteria | 1881 |
| 489 | Ga0439455_0022279 | 3300042012 | Bacteria | 1517 |
| 490 | Ga0466972_0002549 | 3300044658 | Bacteria | 9011 |
| 491 | Ga0466972_0033285 | 3300044658 | Bacteria | 2528 |
| 492 | Ga0466966_0001049 | 3300044684 | Bacteria | 17647 |
| 493 | Ga0466966_0001134 | 3300044684 | Bacteria | 17113 |
| 494 | Ga0466966_0144483 | 3300044684 | Bacteria | 1452 |
| 495 | Ga0466961_0018854 | 3300044693 | Bacteria | 4439 |
| 496 | Ga0466963_0047358 | 3300044694 | Bacteria | 2837 |
| 497 | Ga0466964_0002584 | 3300044706 | Bacteria | 6464 |
| 498 | Ga0466964_0009335 | 3300044706 | Bacteria | 3691 |
| 499 | Ga0466964_0014140 | 3300044706 | Bacteria | 3032 |
| 500 | Ga0466971_0013817 | 3300044719 | Bacteria | 3550 |
| 501 | Ga0466968_0008349 | 3300044735 | Bacteria | 3964 |
| 502 | Ga0466970_0024484 | 3300044765 | Bacteria | 3157 |
| 503 | Ga0466957_0000006 | 3300044842 | Bacteria | 85752 |
| 504 | Ga0466957_0010640 | 3300044842 | Bacteria | 5289 |
| 505 | Ga0466957_0098143 | 3300044842 | Bacteria | 1843 |
| 506 | Ga0466960_0002991 | 3300044901 | Bacteria | 6445 |
| 507 | Ga0466959_0040715 | 3300045049 | Bacteria | 3432 |
| 508 | Ga0466959_0047923 | 3300045049 | Bacteria | 3142 |
| 509 | Ga0466958_0033350 | 3300045836 | Bacteria | 3067 |
| 510 | Ga0466958_0071737 | 3300045836 | Bacteria | 2121 |
| 511 | Ga0466967_0019819 | 3300045976 | Bacteria | 5419 |
| 512 | Ga0495617_000001 | 3300046452 | Bacteria | 877032 |
| 513 | Ga0495617_000162 | 3300046452 | Bacteria | 42454 |
| 514 | Ga0495627_000026 | 3300046453 | Bacteria | 238494 |
| 515 | Ga0495592_0039380 | 3300046454 | Bacteria | 3551 |
| 516 | Ga0495603_0132796 | 3300046455 | Bacteria | 1449 |
| 517 | Ga0495590_0000042 | 3300046457 | Bacteria | 120663 |
| 518 | Ga0495590_0000224 | 3300046457 | Bacteria | 30973 |
| 519 | Ga0495590_0001365 | 3300046457 | Bacteria | 10601 |
| 520 | Ga0495591_000068 | 3300046458 | Bacteria | 117653 |
| 521 | Ga0495629_0004385 | 3300046459 | Bacteria | 10569 |
| 522 | Ga0495638_0000163 | 3300046460 | Bacteria | 103363 |
| 523 | Ga0495638_0107934 | 3300046460 | Bacteria | 1657 |
| 524 | Ga0495651_0022517 | 3300046462 | Bacteria | 4896 |
| 525 | Ga0495653_0008225 | 3300046463 | Bacteria | 8547 |
| 526 | Ga0495653_0027720 | 3300046463 | Bacteria | 4533 |
| 527 | Ga0495653_0039937 | 3300046463 | Bacteria | 3672 |
| 528 | Ga0495653_0072342 | 3300046463 | Bacteria | 2574 |
| 529 | Ga0495650_0000001 | 3300046471 | Bacteria | 1085492 |
| 530 | Ga0495650_0000089 | 3300046471 | Bacteria | 233415 |
| 531 | Ga0495650_0042514 | 3300046471 | Bacteria | 1934 |
| 532 | Ga0495580_0031612 | 3300046472 | Bacteria | 3823 |
| 533 | Ga0495582_0005844 | 3300046473 | Bacteria | 6854 |
| 534 | Ga0495605_0000058 | 3300046474 | Bacteria | 150303 |
| 535 | Ga0495605_0000084 | 3300046474 | Bacteria | 124941 |
| 536 | Ga0495605_0000623 | 3300046474 | Bacteria | 27301 |
| 537 | Ga0495605_0004673 | 3300046474 | Bacteria | 8006 |
| 538 | Ga0495605_0009542 | 3300046474 | Bacteria | 5448 |
| 539 | Ga0495605_0011941 | 3300046474 | Bacteria | 4828 |
| 540 | Ga0495605_0018157 | 3300046474 | Bacteria | 3776 |
| 541 | Ga0495605_0041941 | 3300046474 | Bacteria | 2277 |
| 542 | Ga0495605_0099864 | 3300046474 | Bacteria | 1335 |
| 543 | Ga0495664_0104900 | 3300046477 | Bacteria | 1703 |
| 544 | Ga0495584_0000002 | 3300046491 | Bacteria | 512179 |
| 545 | Ga0495584_0000041 | 3300046491 | Bacteria | 91074 |
| 546 | Ga0495584_0000646 | 3300046491 | Bacteria | 23214 |
| 547 | Ga0495584_0001080 | 3300046491 | Bacteria | 16946 |
| 548 | Ga0495584_0009158 | 3300046491 | Bacteria | 5107 |
| 549 | Ga0495584_0012261 | 3300046491 | Bacteria | 4379 |
| 550 | Ga0495584_0017063 | 3300046491 | Bacteria | 3701 |
| 551 | Ga0495584_0018451 | 3300046491 | Bacteria | 3545 |
| 552 | Ga0495584_0023602 | 3300046491 | Bacteria | 3118 |
| 553 | Ga0495584_0081236 | 3300046491 | Bacteria | 1632 |
| 554 | Ga0495584_0129257 | 3300046491 | Bacteria | 1281 |
| 555 | Ga0495585_0000003 | 3300046492 | Bacteria | 406344 |
| 556 | Ga0495585_0000032 | 3300046492 | Bacteria | 143439 |
| 557 | Ga0495585_0000321 | 3300046492 | Bacteria | 47441 |
| 558 | Ga0495585_0001376 | 3300046492 | Bacteria | 19232 |
| 559 | Ga0495585_0012725 | 3300046492 | Bacteria | 4952 |
| 560 | Ga0495585_0013397 | 3300046492 | Bacteria | 4800 |
| 561 | Ga0495585_0014426 | 3300046492 | Bacteria | 4603 |
| 562 | Ga0495585_0017671 | 3300046492 | Bacteria | 4118 |
| 563 | Ga0495585_0022287 | 3300046492 | Bacteria | 3636 |
| 564 | Ga0495585_0023845 | 3300046492 | Bacteria | 3509 |
| 565 | Ga0495585_0024094 | 3300046492 | Bacteria | 3491 |
| 566 | Ga0495585_0030544 | 3300046492 | Bacteria | 3064 |
| 567 | Ga0495585_0070281 | 3300046492 | Bacteria | 1910 |
| 568 | Ga0495585_0121941 | 3300046492 | Bacteria | 1378 |
| 569 | Ga0495585_0124879 | 3300046492 | Bacteria | 1358 |
| 570 | Ga0495594_0004974 | 3300046499 | Bacteria | 6840 |
| 571 | Ga0495594_0009107 | 3300046499 | Bacteria | 5125 |
| 572 | Ga0495594_0013296 | 3300046499 | Bacteria | 4294 |
| 573 | Ga0495594_0027514 | 3300046499 | Bacteria | 3064 |
| 574 | Ga0495594_0067694 | 3300046499 | Bacteria | 1982 |
| 575 | Ga0495596_0000584 | 3300046500 | Bacteria | 22752 |
| 576 | Ga0495596_0003265 | 3300046500 | Bacteria | 8284 |
| 577 | Ga0495596_0003747 | 3300046500 | Bacteria | 7587 |
| 578 | Ga0495596_0007288 | 3300046500 | Bacteria | 5000 |
| 579 | Ga0495596_0009002 | 3300046500 | Bacteria | 4412 |
| 580 | Ga0495596_0015259 | 3300046500 | Bacteria | 3220 |
| 581 | Ga0495596_0017390 | 3300046500 | Bacteria | 2977 |
| 582 | Ga0495607_0003427 | 3300046501 | Bacteria | 12145 |
| 583 | Ga0495607_0003766 | 3300046501 | Bacteria | 11467 |
| 584 | Ga0495607_0007099 | 3300046501 | Bacteria | 7788 |
| 585 | Ga0495607_0010428 | 3300046501 | Bacteria | 6249 |
| 586 | Ga0495607_0035976 | 3300046501 | Bacteria | 2989 |
| 587 | Ga0495607_0073463 | 3300046501 | Bacteria | 1901 |
| 588 | Ga0495607_0084222 | 3300046501 | Bacteria | 1740 |
| 589 | Ga0495583_0000082 | 3300046506 | Bacteria | 165696 |
| 590 | Ga0495583_0000170 | 3300046506 | Bacteria | 111003 |
| 591 | Ga0495583_0000190 | 3300046506 | Bacteria | 103427 |
| 592 | Ga0495583_0000200 | 3300046506 | Bacteria | 100827 |
| 593 | Ga0495583_0000496 | 3300046506 | Bacteria | 57163 |
| 594 | Ga0495583_0002859 | 3300046506 | Bacteria | 14051 |
| 595 | Ga0495583_0006919 | 3300046506 | Bacteria | 7289 |
| 596 | Ga0495583_0008181 | 3300046506 | Bacteria | 6429 |
| 597 | Ga0495583_0018037 | 3300046506 | Bacteria | 3728 |
| 598 | Ga0495606_0001544 | 3300046507 | Bacteria | 30344 |
| 599 | Ga0495606_0001795 | 3300046507 | Bacteria | 27308 |
| 600 | Ga0495606_0002165 | 3300046507 | Bacteria | 23633 |
| 601 | Ga0495606_0004946 | 3300046507 | Bacteria | 13017 |
| 602 | Ga0495606_0074720 | 3300046507 | Bacteria | 2122 |
| 603 | Ga0495608_0013532 | 3300046511 | Bacteria | 5659 |
| 604 | Ga0495610_0011466 | 3300046512 | Bacteria | 5418 |
| 605 | Ga0495610_0035355 | 3300046512 | Bacteria | 2566 |
| 606 | Ga0495616_0000096 | 3300046513 | Bacteria | 74471 |
| 607 | Ga0495616_0001466 | 3300046513 | Bacteria | 16369 |
| 608 | Ga0495616_0002443 | 3300046513 | Bacteria | 12328 |
| 609 | Ga0495616_0006483 | 3300046513 | Bacteria | 7080 |
| 610 | Ga0495616_0006689 | 3300046513 | Bacteria | 6955 |
| 611 | Ga0495616_0020237 | 3300046513 | Bacteria | 3622 |
| 612 | Ga0495616_0038676 | 3300046513 | Bacteria | 2448 |
| 613 | Ga0495616_0053853 | 3300046513 | Bacteria | 1998 |
| 614 | Ga0495616_0086701 | 3300046513 | Bacteria | 1488 |
| 615 | Ga0495616_0103371 | 3300046513 | Bacteria | 1333 |
| 616 | Ga0495618_0004380 | 3300046514 | Bacteria | 8683 |
| 617 | Ga0495620_0040439 | 3300046515 | Bacteria | 2051 |
| 618 | Ga0495628_0045699 | 3300046516 | Bacteria | 3481 |
| 619 | Ga0495631_0000012 | 3300046518 | Bacteria | 110338 |
| 620 | Ga0495631_0003450 | 3300046518 | Bacteria | 8651 |
| 621 | Ga0495631_0003486 | 3300046518 | Bacteria | 8608 |
| 622 | Ga0495631_0010450 | 3300046518 | Bacteria | 4590 |
| 623 | Ga0495631_0021102 | 3300046518 | Bacteria | 3035 |
| 624 | Ga0495631_0022130 | 3300046518 | Bacteria | 2956 |
| 625 | Ga0495631_0028653 | 3300046518 | Bacteria | 2539 |
| 626 | Ga0495632_0000028 | 3300046519 | Bacteria | 171089 |
| 627 | Ga0495632_0000377 | 3300046519 | Bacteria | 42535 |
| 628 | Ga0495632_0001515 | 3300046519 | Bacteria | 19187 |
| 629 | Ga0495632_0013879 | 3300046519 | Bacteria | 4578 |
| 630 | Ga0495632_0017639 | 3300046519 | Bacteria | 3935 |
| 631 | Ga0495632_0069723 | 3300046519 | Bacteria | 1692 |
| 632 | Ga0495637_0000002 | 3300046520 | Bacteria | 629280 |
| 633 | Ga0495637_0061761 | 3300046520 | Bacteria | 1535 |
| 634 | Ga0495643_0000910 | 3300046522 | Bacteria | 31179 |
| 635 | Ga0495643_0001124 | 3300046522 | Bacteria | 26414 |
| 636 | Ga0495643_0005591 | 3300046522 | Bacteria | 8454 |
| 637 | Ga0495643_0009852 | 3300046522 | Bacteria | 5910 |
| 638 | Ga0495643_0010166 | 3300046522 | Bacteria | 5803 |
| 639 | Ga0495643_0011275 | 3300046522 | Bacteria | 5454 |
| 640 | Ga0495643_0021651 | 3300046522 | Bacteria | 3683 |
| 641 | Ga0495643_0042100 | 3300046522 | Bacteria | 2488 |
| 642 | Ga0495644_0003802 | 3300046523 | Bacteria | 5940 |
| 643 | Ga0495644_0016494 | 3300046523 | Bacteria | 2827 |
| 644 | Ga0495644_0048588 | 3300046523 | Bacteria | 1593 |
| 645 | Ga0495648_0000011 | 3300046524 | Bacteria | 299518 |
| 646 | Ga0495648_0000307 | 3300046524 | Bacteria | 54310 |
| 647 | Ga0495648_0003980 | 3300046524 | Bacteria | 12787 |
| 648 | Ga0495648_0016383 | 3300046524 | Bacteria | 5347 |
| 649 | Ga0495648_0037801 | 3300046524 | Bacteria | 3097 |
| 650 | Ga0495648_0090647 | 3300046524 | Bacteria | 1712 |
| 651 | Ga0495663_0039715 | 3300046525 | Bacteria | 1427 |
| 652 | Ga0495666_0000154 | 3300046526 | Bacteria | 28965 |
| 653 | Ga0495666_0005895 | 3300046526 | Bacteria | 6173 |
| 654 | Ga0495666_0048437 | 3300046526 | Bacteria | 2046 |
| 655 | Ga0495642_0000001 | 3300046528 | Bacteria | 389656 |
| 656 | Ga0495642_0005085 | 3300046528 | Bacteria | 5064 |
| 657 | Ga0495642_0005453 | 3300046528 | Bacteria | 4887 |
| 658 | Ga0495642_0008384 | 3300046528 | Bacteria | 3956 |
| 659 | Ga0495652_0054795 | 3300046529 | Bacteria | 3394 |
| 660 | Ga0495652_0081300 | 3300046529 | Bacteria | 2673 |
| 661 | Ga0495654_0002880 | 3300046530 | Bacteria | 10799 |
| 662 | Ga0495654_0058906 | 3300046530 | Bacteria | 1851 |
| 663 | Ga0495665_0046784 | 3300046531 | Bacteria | 2296 |
| 664 | Ga0495640_0029895 | 3300046533 | Bacteria | 3905 |
| 665 | Ga0495640_0104362 | 3300046533 | Bacteria | 1858 |
| 666 | Ga0495587_0012781 | 3300046536 | Bacteria | 5281 |
| 667 | Ga0495587_0016775 | 3300046536 | Bacteria | 4554 |
| 668 | Ga0495609_0000001 | 3300046538 | Bacteria | 1060094 |
| 669 | Ga0495609_0004972 | 3300046538 | Bacteria | 7123 |
| 670 | Ga0495609_0005785 | 3300046538 | Bacteria | 6424 |
| 671 | Ga0495609_0037377 | 3300046538 | Bacteria | 2190 |
| 672 | Ga0495597_0000758 | 3300046542 | Bacteria | 25512 |
| 673 | Ga0495597_0000830 | 3300046542 | Bacteria | 24285 |
| 674 | Ga0495597_0003053 | 3300046542 | Bacteria | 10081 |
| 675 | Ga0495597_0007475 | 3300046542 | Bacteria | 5545 |
| 676 | Ga0495597_0008490 | 3300046542 | Bacteria | 5147 |
| 677 | Ga0495597_0017905 | 3300046542 | Bacteria | 3327 |
| 678 | Ga0495597_0020512 | 3300046542 | Bacteria | 3077 |
| 679 | Ga0495597_0041282 | 3300046542 | Bacteria | 2061 |
| 680 | Ga0495645_0001029 | 3300046543 | Bacteria | 18986 |
| 681 | Ga0495645_0068968 | 3300046543 | Bacteria | 2552 |
| 682 | Ga0495645_0075352 | 3300046543 | Bacteria | 2428 |
| 683 | Ga0495622_0010320 | 3300046557 | Bacteria | 4317 |
| 684 | Ga0495622_0022619 | 3300046557 | Bacteria | 2929 |
| 685 | Ga0495622_0050612 | 3300046557 | Bacteria | 1927 |
| 686 | Ga0495633_0001767 | 3300046558 | Bacteria | 16032 |
| 687 | Ga0495633_0015864 | 3300046558 | Bacteria | 3900 |
| 688 | Ga0495633_0029913 | 3300046558 | Bacteria | 2648 |
| 689 | Ga0495656_0011683 | 3300046615 | Bacteria | 3225 |
| 690 | Ga0495656_0028244 | 3300046615 | Bacteria | 2249 |
| 691 | Ga0495668_0000357 | 3300046616 | Bacteria | 60616 |
| 692 | Ga0495668_0001916 | 3300046616 | Bacteria | 18529 |
| 693 | Ga0495668_0003625 | 3300046616 | Bacteria | 11434 |
| 694 | Ga0495668_0007039 | 3300046616 | Bacteria | 7254 |
| 695 | Ga0495668_0012831 | 3300046616 | Bacteria | 4963 |
| 696 | Ga0495668_0016221 | 3300046616 | Bacteria | 4332 |
| 697 | Ga0495668_0035257 | 3300046616 | Bacteria | 2804 |
| 698 | Ga0495668_0037188 | 3300046616 | Bacteria | 2724 |
| 699 | Ga0495668_0059852 | 3300046616 | Bacteria | 2101 |
| 700 | Ga0495611_0002275 | 3300046648 | Bacteria | 8891 |
| 701 | Ga0495611_0007514 | 3300046648 | Bacteria | 4626 |
| 702 | Ga0495611_0018565 | 3300046648 | Bacteria | 2983 |
| 703 | Ga0495611_0037603 | 3300046648 | Bacteria | 2151 |
| 704 | Ga0495611_0057727 | 3300046648 | Bacteria | 1759 |
| 705 | Ga0495625_0002669 | 3300046660 | Bacteria | 18983 |
| 706 | Ga0495625_0020382 | 3300046660 | Bacteria | 5119 |
| 707 | Ga0495625_0034133 | 3300046660 | Bacteria | 3756 |
| 708 | Ga0495625_0128111 | 3300046660 | Bacteria | 1721 |
| 709 | Ga0495635_0002745 | 3300046663 | Bacteria | 12068 |
| 710 | Ga0495635_0008379 | 3300046663 | Bacteria | 7216 |
| 711 | Ga0495659_0014705 | 3300046664 | Bacteria | 2566 |
| 712 | Ga0495661_0000040 | 3300046665 | Bacteria | 151437 |
| 713 | Ga0495661_0000089 | 3300046665 | Bacteria | 110930 |
| 714 | Ga0495661_0000769 | 3300046665 | Bacteria | 30713 |
| 715 | Ga0495661_0001925 | 3300046665 | Bacteria | 16519 |
| 716 | Ga0495661_0041042 | 3300046665 | Bacteria | 2865 |
| 717 | Ga0495661_0044249 | 3300046665 | Bacteria | 2730 |
| 718 | Ga0495661_0073713 | 3300046665 | Bacteria | 1988 |
| 719 | Ga0495588_0000052 | 3300046674 | Bacteria | 304493 |
| 720 | Ga0495588_0000196 | 3300046674 | Bacteria | 63197 |
| 721 | Ga0495588_0016819 | 3300046674 | Bacteria | 3539 |
| 722 | Ga0495588_0038283 | 3300046674 | Bacteria | 2439 |
| 723 | Ga0495588_0063794 | 3300046674 | Bacteria | 1911 |
| 724 | Ga0495588_0134174 | 3300046674 | Bacteria | 1306 |
| 725 | Ga0495657_0049882 | 3300046675 | Bacteria | 2817 |
| 726 | Ga0495657_0055050 | 3300046675 | Bacteria | 2655 |
| 727 | Ga0495623_0005861 | 3300046679 | Bacteria | 8009 |
| 728 | Ga0495623_0029914 | 3300046679 | Bacteria | 3505 |
| 729 | Ga0495646_0023831 | 3300046680 | Bacteria | 3853 |
| 730 | Ga0495669_0000019 | 3300046684 | Bacteria | 126468 |
| 731 | Ga0495669_0000901 | 3300046684 | Bacteria | 12505 |
| 732 | Ga0495669_0003232 | 3300046684 | Bacteria | 6707 |
| 733 | Ga0495624_0102323 | 3300046690 | Bacteria | 1763 |
| 734 | Ga0495670_0015258 | 3300046691 | Bacteria | 3777 |
| 735 | Ga0495670_0041520 | 3300046691 | Bacteria | 2295 |
| 736 | Ga0495670_0060830 | 3300046691 | Bacteria | 1898 |
| 737 | Ga0495670_0072746 | 3300046691 | Bacteria | 1742 |
| 738 | Ga0495671_0000167 | 3300046692 | Bacteria | 57939 |
| 739 | Ga0495671_0001323 | 3300046692 | Bacteria | 16815 |
| 740 | Ga0495671_0065006 | 3300046692 | Bacteria | 1795 |
| 741 | Ga0495671_0075033 | 3300046692 | Bacteria | 1659 |
| 742 | Ga0495649_0000029 | 3300046694 | Bacteria | 162379 |
| 743 | Ga0495649_0000068 | 3300046694 | Bacteria | 92317 |
| 744 | Ga0495649_0024853 | 3300046694 | Bacteria | 3339 |
| 745 | Ga0495649_0033662 | 3300046694 | Bacteria | 2820 |
| 746 | Ga0495649_0036714 | 3300046694 | Bacteria | 2691 |
| 747 | Ga0495589_0000015 | 3300046794 | Bacteria | 224112 |
| 748 | Ga0495589_0000206 | 3300046794 | Bacteria | 50433 |
| 749 | Ga0495589_0000285 | 3300046794 | Bacteria | 41161 |
| 750 | Ga0495589_0001782 | 3300046794 | Bacteria | 12245 |
| 751 | Ga0495589_0013475 | 3300046794 | Bacteria | 4217 |
| 752 | Ga0495589_0030225 | 3300046794 | Bacteria | 2729 |
| 753 | Ga0495600_0052706 | 3300046809 | Bacteria | 2657 |
| 754 | Ga0495600_0075450 | 3300046809 | Bacteria | 2202 |
| 755 | Ga0495600_0098172 | 3300046809 | Bacteria | 1909 |
| 756 | Ga0495600_0102882 | 3300046809 | Bacteria | 1861 |
| 757 | Ga0495660_0000143 | 3300046810 | Bacteria | 77268 |
| 758 | Ga0495660_0008103 | 3300046810 | Bacteria | 6171 |
| 759 | Ga0495660_0015717 | 3300046810 | Bacteria | 4370 |
| 760 | Ga0495660_0023523 | 3300046810 | Bacteria | 3513 |
| 761 | Ga0495660_0028436 | 3300046810 | Bacteria | 3159 |
| 762 | Ga0495660_0050542 | 3300046810 | Bacteria | 2264 |
| 763 | Ga0495660_0057628 | 3300046810 | Bacteria | 2095 |
| 764 | Ga0495581_0022378 | 3300047315 | Bacteria | 3664 |
| 765 | Ga0495604_0024026 | 3300047317 | Bacteria | 4865 |
| 766 | Ga0495604_0061318 | 3300047317 | Bacteria | 2877 |
| 767 | Ga0495604_0129667 | 3300047317 | Bacteria | 1814 |
| 768 | Ga0495636_0000603 | 3300047318 | Bacteria | 13215 |
| 769 | Ga0495636_0005695 | 3300047318 | Bacteria | 4885 |
| 770 | Ga0495636_0008803 | 3300047318 | Bacteria | 3977 |
| 771 | Ga0495674_0002672 | 3300047319 | Bacteria | 17353 |
| 772 | Ga0495674_0113050 | 3300047319 | Bacteria | 2300 |
| 773 | Ga0495672_0000065 | 3300047320 | Bacteria | 193941 |
| 774 | Ga0495672_0000192 | 3300047320 | Bacteria | 87986 |
| 775 | Ga0495672_0001279 | 3300047320 | Bacteria | 25086 |
| 776 | Ga0495672_0008482 | 3300047320 | Bacteria | 7575 |
| 777 | Ga0495676_0000029 | 3300047321 | Bacteria | 140281 |
| 778 | Ga0495676_0121095 | 3300047321 | Bacteria | 1903 |
| 779 | Ga0495676_0202647 | 3300047321 | Bacteria | 1378 |
| 780 | Ga0495680_0005935 | 3300047322 | Bacteria | 11415 |
| 781 | Ga0495680_0048568 | 3300047322 | Bacteria | 3332 |
| 782 | Ga0495683_0000007 | 3300047323 | Bacteria | 268546 |
| 783 | Ga0495683_0000012 | 3300047323 | Bacteria | 205754 |
| 784 | Ga0495683_0005510 | 3300047323 | Bacteria | 7017 |
| 785 | Ga0495683_0066500 | 3300047323 | Bacteria | 1776 |
| 786 | Ga0495687_000002 | 3300047443 | Bacteria | 1085770 |
| 787 | Ga0495687_000003 | 3300047443 | Bacteria | 859509 |
| 788 | Ga0495687_000007 | 3300047443 | Bacteria | 552679 |
| 789 | Ga0495687_000067 | 3300047443 | Bacteria | 161372 |
| 790 | Ga0495687_000727 | 3300047443 | Bacteria | 36304 |
| 791 | Ga0495687_005475 | 3300047443 | Bacteria | 8072 |
| 792 | Ga0495675_0005060 | 3300047444 | Bacteria | 8024 |
| 793 | Ga0495675_0005287 | 3300047444 | Bacteria | 7862 |
| 794 | Ga0495675_0015675 | 3300047444 | Bacteria | 4791 |
| 795 | Ga0495677_0000001 | 3300047445 | Bacteria | 715000 |
| 796 | Ga0495677_0000076 | 3300047445 | Bacteria | 50813 |
| 797 | Ga0495677_0000331 | 3300047445 | Bacteria | 20413 |
| 798 | Ga0495677_0000805 | 3300047445 | Bacteria | 12686 |
| 799 | Ga0495677_0005733 | 3300047445 | Bacteria | 4707 |
| 800 | Ga0495677_0012901 | 3300047445 | Bacteria | 3043 |
| 801 | Ga0495677_0014238 | 3300047445 | Bacteria | 2896 |
| 802 | Ga0495677_0028771 | 3300047445 | Bacteria | 2020 |
| 803 | Ga0495679_001214 | 3300047446 | Bacteria | 15282 |
| 804 | Ga0495685_002223 | 3300047447 | Bacteria | 6043 |
| 805 | Ga0495673_0005697 | 3300047469 | Bacteria | 7482 |
| 806 | Ga0495681_0000005 | 3300047470 | Bacteria | 225279 |
| 807 | Ga0495681_0011969 | 3300047470 | Bacteria | 5124 |
| 808 | Ga0495681_0011987 | 3300047470 | Bacteria | 5120 |
| 809 | Ga0495681_0057179 | 3300047470 | Bacteria | 1812 |
| 810 | Ga0495684_0091358 | 3300047471 | Bacteria | 2306 |
| 811 | Ga0495686_0000015 | 3300047472 | Bacteria | 471703 |
| 812 | Ga0495686_0000190 | 3300047472 | Bacteria | 115114 |
| 813 | Ga0495686_0007585 | 3300047472 | Bacteria | 8107 |
| 814 | Ga0495686_0017316 | 3300047472 | Bacteria | 4858 |
| 815 | Ga0495593_0008904 | 3300047673 | Bacteria | 5826 |
| 816 | Ga0495602_0000790 | 3300048088 | Bacteria | 30230 |
| 817 | Ga0495602_0021742 | 3300048088 | Bacteria | 6303 |
| 818 | Ga0495602_0069052 | 3300048088 | Bacteria | 3031 |
| 819 | Ga0495602_0082303 | 3300048088 | Bacteria | 2702 |
| 820 | Ga0495602_0129430 | 3300048088 | Bacteria | 2016 |
| 821 | Ga0495602_0141383 | 3300048088 | Bacteria | 1905 |
| 822 | Ga0495614_0001365 | 3300048089 | Bacteria | 10532 |
| 823 | Ga0495614_0047210 | 3300048089 | Bacteria | 1847 |
| 824 | Ga0495626_0000020 | 3300048091 | Bacteria | 222537 |
| 825 | Ga0495626_0000089 | 3300048091 | Bacteria | 119565 |
| 826 | Ga0495626_0000200 | 3300048091 | Bacteria | 72580 |
| 827 | Ga0495626_0005308 | 3300048091 | Bacteria | 7599 |
| 828 | Ga0495626_0014646 | 3300048091 | Bacteria | 4036 |
| 829 | Ga0495626_0021293 | 3300048091 | Bacteria | 3218 |
| 830 | Ga0495626_0031258 | 3300048091 | Bacteria | 2564 |
| 831 | Ga0495626_0034944 | 3300048091 | Bacteria | 2401 |
| 832 | Ga0495626_0066927 | 3300048091 | Bacteria | 1623 |
| 833 | Ga0496100_0072053 | 3300048903 | Bacteria | 2308 |
| 834 | Ga0496102_0000033 | 3300048905 | Bacteria | 213952 |
| 835 | Ga0496102_0002133 | 3300048905 | Bacteria | 17003 |
| 836 | Ga0496102_0004919 | 3300048905 | Bacteria | 11319 |
| 837 | Ga0496102_0088698 | 3300048905 | Bacteria | 2860 |
| 838 | Ga0496102_0181563 | 3300048905 | Bacteria | 1983 |
| 839 | Ga0496102_0259440 | 3300048905 | Bacteria | 1638 |
| 840 | Ga0496103_0003160 | 3300048906 | Bacteria | 10122 |
| 841 | Ga0496103_0003397 | 3300048906 | Bacteria | 9734 |
| 842 | Ga0496103_0010021 | 3300048906 | Bacteria | 5603 |
| 843 | Ga0496105_0119077 | 3300048908 | Bacteria | 2178 |
| 844 | Ga0496106_0000102 | 3300048909 | Bacteria | 65345 |
| 845 | Ga0496106_0007261 | 3300048909 | Bacteria | 8184 |
| 846 | Ga0496106_0194358 | 3300048909 | Bacteria | 1614 |
| 847 | Ga0496107_0220534 | 3300048910 | Bacteria | 1411 |
| 848 | Ga0496110_0111918 | 3300048913 | Bacteria | 2454 |
| 849 | Ga0496110_0281963 | 3300048913 | Bacteria | 1513 |
| 850 | Ga0496111_0079905 | 3300048914 | Bacteria | 2386 |
| 851 | Ga0496112_0080052 | 3300048915 | Bacteria | 3231 |
| 852 | Ga0496112_0170888 | 3300048915 | Bacteria | 2139 |
| 853 | Ga0496113_0037616 | 3300048916 | Bacteria | 3553 |
| 854 | Ga0496113_0055199 | 3300048916 | Bacteria | 2977 |
| 855 | Ga0496114_0041472 | 3300048917 | Bacteria | 3815 |
| 856 | Ga0496114_0199365 | 3300048917 | Bacteria | 1753 |
| 857 | Ga0496115_0013166 | 3300048918 | Bacteria | 6248 |
| 858 | Ga0496115_0027833 | 3300048918 | Bacteria | 4425 |
| 859 | Ga0496116_0002317 | 3300048919 | Bacteria | 20186 |
| 860 | Ga0496116_0005236 | 3300048919 | Bacteria | 12127 |
| 861 | Ga0496116_0028857 | 3300048919 | Bacteria | 4011 |
| 862 | Ga0496117_0000016 | 3300048920 | Bacteria | 523642 |
| 863 | Ga0496117_0002604 | 3300048920 | Bacteria | 22423 |
| 864 | Ga0496117_0043739 | 3300048920 | Bacteria | 3252 |
| 865 | Ga0496117_0093419 | 3300048920 | Bacteria | 1929 |
| 866 | Ga0496118_0000153 | 3300048921 | Bacteria | 122419 |
| 867 | Ga0496118_0003936 | 3300048921 | Bacteria | 18163 |
| 868 | Ga0496118_0012501 | 3300048921 | Bacteria | 8139 |
| 869 | Ga0496118_0057507 | 3300048921 | Bacteria | 2914 |
| 870 | Ga0496118_0059810 | 3300048921 | Bacteria | 2834 |
| 871 | Ga0496119_0009047 | 3300048922 | Bacteria | 8631 |
| 872 | Ga0496119_0009777 | 3300048922 | Bacteria | 8161 |
| 873 | Ga0496119_0119957 | 3300048922 | Bacteria | 1447 |
| 874 | Ga0496120_0000423 | 3300048923 | Bacteria | 67509 |
| 875 | Ga0496120_0003353 | 3300048923 | Bacteria | 14696 |
| 876 | Ga0496121_0004649 | 3300048924 | Bacteria | 18257 |
| 877 | Ga0496121_0073222 | 3300048924 | Bacteria | 2746 |
| 878 | Ga0496121_0083501 | 3300048924 | Bacteria | 2521 |
| 879 | Ga0496121_0185429 | 3300048924 | Bacteria | 1497 |
| 880 | Ga0496122_0000002 | 3300048925 | Bacteria | 905834 |
| 881 | Ga0496122_0000042 | 3300048925 | Bacteria | 280482 |
| 882 | Ga0496122_0000567 | 3300048925 | Bacteria | 75763 |
| 883 | Ga0496122_0005598 | 3300048925 | Bacteria | 14868 |
| 884 | Ga0496122_0007864 | 3300048925 | Bacteria | 11713 |
| 885 | Ga0496122_0008213 | 3300048925 | Bacteria | 11340 |
| 886 | Ga0496122_0019899 | 3300048925 | Bacteria | 6103 |
| 887 | Ga0496122_0059901 | 3300048925 | Bacteria | 2808 |
| 888 | Ga0496123_0000002 | 3300048926 | Bacteria | 1811682 |
| 889 | Ga0496123_0000030 | 3300048926 | Bacteria | 291764 |
| 890 | Ga0496123_0000704 | 3300048926 | Bacteria | 54701 |
| 891 | Ga0496123_0001155 | 3300048926 | Bacteria | 39342 |
| 892 | Ga0496123_0002829 | 3300048926 | Bacteria | 20519 |
| 893 | Ga0496123_0005341 | 3300048926 | Bacteria | 12986 |
| 894 | Ga0496123_0029435 | 3300048926 | Bacteria | 4043 |
| 895 | Ga0496124_0001457 | 3300048927 | Bacteria | 34907 |
| 896 | Ga0496124_0016188 | 3300048927 | Bacteria | 7108 |
| 897 | Ga0496124_0101928 | 3300048927 | Bacteria | 2324 |
| 898 | Ga0496124_0109444 | 3300048927 | Bacteria | 2227 |
| 899 | Ga0496125_0004489 | 3300048928 | Bacteria | 16068 |
| 900 | Ga0496125_0008338 | 3300048928 | Bacteria | 10872 |
| 901 | Ga0496125_0019190 | 3300048928 | Bacteria | 6459 |
| 902 | Ga0496125_0048146 | 3300048928 | Bacteria | 3558 |
| 903 | Ga0496126_0149209 | 3300048929 | Bacteria | 2005 |
| 904 | Ga0495678_000015 | 3300049459 | Bacteria | 309544 |
| 905 | Ga0495678_000022 | 3300049459 | Bacteria | 237031 |
| 906 | Ga0495678_000452 | 3300049459 | Bacteria | 40696 |
| 907 | Ga0495678_001887 | 3300049459 | Bacteria | 15238 |
| 908 | Ga0495678_006837 | 3300049459 | Bacteria | 5998 |
| 909 | Ga0495682_0000122 | 3300049460 | Bacteria | 68172 |
| 910 | Ga0495682_0007370 | 3300049460 | Bacteria | 4384 |
| 911 | Ga0495682_0018770 | 3300049460 | Bacteria | 2604 |
| 912 | Ga0501032_0000017 | 3300049569 | Bacteria | 158303 |
| 913 | Ga0501032_0001004 | 3300049569 | Bacteria | 22749 |
| 914 | Ga0501033_0000029 | 3300049570 | Bacteria | 158294 |
| 915 | Ga0501033_0000334 | 3300049570 | Bacteria | 44929 |
| 916 | Ga0501033_0013560 | 3300049570 | Bacteria | 6204 |
| 917 | Ga0501033_0059784 | 3300049570 | Bacteria | 2814 |
| 918 | Ga0501033_0104785 | 3300049570 | Bacteria | 2062 |
| 919 | Ga0501033_0107252 | 3300049570 | Bacteria | 2034 |
| 920 | Ga0501033_0117774 | 3300049570 | Bacteria | 1929 |
| 921 | Ga0501033_0188945 | 3300049570 | Bacteria | 1475 |
| 922 | Ga0501034_0000102 | 3300049571 | Bacteria | 158302 |
| 923 | Ga0501034_0003296 | 3300049571 | Bacteria | 18444 |
| 924 | Ga0501034_0101500 | 3300049571 | Bacteria | 2870 |
| 925 | Ga0501034_0107757 | 3300049571 | Bacteria | 2778 |
| 926 | Ga0501034_0112224 | 3300049571 | Bacteria | 2716 |
| 927 | Ga0501034_0145447 | 3300049571 | Bacteria | 2348 |
| 928 | Ga0501034_0146586 | 3300049571 | Bacteria | 2337 |
| 929 | Ga0501034_0179429 | 3300049571 | Bacteria | 2083 |
| 930 | Ga0501034_0227725 | 3300049571 | Bacteria | 1814 |
| 931 | Ga0501036_0000011 | 3300049572 | Bacteria | 158302 |
| 932 | Ga0501036_0183879 | 3300049572 | Bacteria | 1759 |
| 933 | Ga0501037_0000015 | 3300049573 | Bacteria | 161311 |
| 934 | Ga0501037_0000035 | 3300049573 | Bacteria | 125589 |
| 935 | Ga0501038_0000016 | 3300049574 | Bacteria | 159150 |
| 936 | Ga0501038_0074545 | 3300049574 | Bacteria | 2870 |
| 937 | Ga0501038_0094694 | 3300049574 | Bacteria | 2496 |
| 938 | Ga0501038_0232182 | 3300049574 | Bacteria | 1468 |
| 939 | Ga0501039_0000023 | 3300049575 | Bacteria | 158026 |
| 940 | Ga0501039_0025637 | 3300049575 | Bacteria | 4531 |
| 941 | Ga0501040_0045977 | 3300049576 | Bacteria | 2979 |
| 942 | Ga0501043_0000031 | 3300049579 | Bacteria | 140707 |
| 943 | Ga0501043_0000372 | 3300049579 | Bacteria | 40661 |
| 944 | Ga0501046_0039751 | 3300049580 | Bacteria | 3764 |
| 945 | Ga0501046_0103791 | 3300049580 | Bacteria | 2179 |
| 946 | Ga0501047_0001169 | 3300049581 | Bacteria | 26022 |
| 947 | Ga0501047_0035181 | 3300049581 | Bacteria | 4838 |
| 948 | Ga0501047_0038110 | 3300049581 | Bacteria | 4649 |
| 949 | Ga0501047_0048660 | 3300049581 | Bacteria | 4094 |
| 950 | Ga0501047_0122717 | 3300049581 | Bacteria | 2479 |
| 951 | Ga0501047_0248865 | 3300049581 | Bacteria | 1626 |
| 952 | Ga0501047_0343457 | 3300049581 | Bacteria | 1330 |
| 953 | Ga0501048_0012058 | 3300049582 | Bacteria | 6442 |
| 954 | Ga0501067_0009026 | 3300049583 | Bacteria | 5522 |
| 955 | Ga0501068_0002851 | 3300049584 | Bacteria | 9196 |
| 956 | Ga0501068_0006869 | 3300049584 | Bacteria | 6291 |
| 957 | Ga0501069_0000056 | 3300049585 | Bacteria | 65784 |
| 958 | Ga0501069_0002418 | 3300049585 | Bacteria | 9493 |
| 959 | Ga0501070_0000141 | 3300049586 | Bacteria | 65875 |
| 960 | Ga0501070_0002589 | 3300049586 | Bacteria | 15814 |
| 961 | Ga0501070_0015361 | 3300049586 | Bacteria | 6441 |
| 962 | Ga0501070_0116975 | 3300049586 | Bacteria | 2202 |
| 963 | Ga0501070_0188292 | 3300049586 | Bacteria | 1697 |
| 964 | Ga0501072_0062867 | 3300049588 | Bacteria | 2928 |
| 965 | Ga0501073_0059206 | 3300049589 | Bacteria | 2676 |
| 966 | Ga0501073_0108514 | 3300049589 | Bacteria | 1926 |
| 967 | Ga0501074_0069896 | 3300049590 | Bacteria | 2524 |
| 968 | Ga0501080_0001729 | 3300049742 | Bacteria | 18680 |
| 969 | Ga0501080_0033576 | 3300049742 | Bacteria | 4789 |
| 970 | Ga0501080_0082527 | 3300049742 | Bacteria | 2985 |
| 971 | Ga0501080_0213637 | 3300049742 | Bacteria | 1767 |
| 972 | Ga0501083_0001157 | 3300049744 | Bacteria | 17771 |
| 973 | Ga0501083_0009242 | 3300049744 | Bacteria | 6959 |
| 974 | Ga0501083_0057730 | 3300049744 | Bacteria | 2598 |
| 975 | Ga0501035_0000036 | 3300049822 | Bacteria | 165008 |
| 976 | Ga0501035_0000038 | 3300049822 | Bacteria | 158818 |
| 977 | Ga0501035_0000761 | 3300049822 | Bacteria | 34698 |
| 978 | Ga0501035_0001273 | 3300049822 | Bacteria | 26052 |
| 979 | Ga0501035_0031757 | 3300049822 | Bacteria | 4810 |
| 980 | Ga0501035_0069871 | 3300049822 | Bacteria | 3111 |
| 981 | Ga0501035_0080769 | 3300049822 | Bacteria | 2870 |
| 982 | Ga0501044_0000011 | 3300049823 | Bacteria | 257385 |
| 983 | Ga0501044_0000046 | 3300049823 | Bacteria | 146812 |
| 984 | Ga0501044_0014052 | 3300049823 | Bacteria | 8646 |
| 985 | Ga0501044_0022095 | 3300049823 | Bacteria | 6784 |
| 986 | Ga0501044_0025149 | 3300049823 | Bacteria | 6313 |
| 987 | Ga0501044_0100831 | 3300049823 | Bacteria | 2905 |
| 988 | Ga0501044_0102814 | 3300049823 | Bacteria | 2872 |
| 989 | Ga0501044_0102921 | 3300049823 | Bacteria | 2870 |
| 990 | Ga0501044_0172628 | 3300049823 | Bacteria | 2132 |
| 991 | Ga0501045_0012943 | 3300049824 | Bacteria | 5880 |
| 992 | nmdc:mga03683_38362_c1 | 3300050489 | Bacteria | 1956 |
| 993 | nmdc:mga00v17_11699_c1 | 3300050491 | Bacteria | 4827 |
| 994 | nmdc:mga00v17_218_c1 | 3300050491 | Bacteria | 34620 |
| 995 | nmdc:mga00v17_25311_c1 | 3300050491 | Bacteria | 3449 |
| 996 | nmdc:mga00v17_53_c1 | 3300050491 | Bacteria | 72424 |
| 997 | nmdc:mga0yw44_1934_c1 | 3300050492 | Bacteria | 8572 |
| 998 | nmdc:mga0yw44_4057_c1 | 3300050492 | Bacteria | 6629 |
| 999 | nmdc:mga0k408_38659_c1 | 3300050493 | Bacteria | 2739 |
| 1000 | nmdc:mga0k408_75281_c1 | 3300050493 | Bacteria | 1972 |
| 1001 | nmdc:mga06z11_56792_c1 | 3300050494 | Bacteria | 2026 |
| 1002 | nmdc:mga06z11_81158_c1 | 3300050494 | Bacteria | 1740 |
| 1003 | nmdc:mga07m45_19323_c1 | 3300050496 | Bacteria | 3691 |
| 1004 | nmdc:mga05p37_56104_c1 | 3300050507 | Bacteria | 4850 |
| 1005 | nmdc:mga09592_56316_c1 | 3300050508 | Bacteria | 3323 |
| 1006 | nmdc:mga0qj67_9637_c1 | 3300050509 | Bacteria | 7197 |
| 1007 | nmdc:mga06r32_3229_c1 | 3300050510 | Bacteria | 14583 |
| 1008 | nmdc:mga08y16_83869_c1 | 3300050511 | Bacteria | 3322 |
| 1009 | nmdc:mga0n895_180434_c1 | 3300050512 | Bacteria | 2143 |
| 1010 | nmdc:mga0n895_67927_c1 | 3300050512 | Bacteria | 3531 |
| 1011 | nmdc:mga0a205_281592_c1 | 3300050515 | Bacteria | 1538 |
| 1012 | nmdc:mga0a205_5649_c1 | 3300050515 | Bacteria | 11267 |
| 1013 | nmdc:mga0sz30_26798_c1 | 3300050516 | Bacteria | 2364 |
| 1014 | nmdc:mga0sz30_95_c1 | 3300050516 | Bacteria | 33938 |
| 1015 | Ga0495601_0010434 | 3300053077 | Bacteria | 5528 |
| 1016 | Ga0495601_0116696 | 3300053077 | Bacteria | 1731 |
| 1017 | Ga0495612_0000886 | 3300053078 | Bacteria | 12227 |
| 1018 | Ga0500635_0000763 | 3300053080 | Bacteria | 8015 |
| 1019 | Ga0495595_0067772 | 3300053084 | Bacteria | 1682 |
| 1020 | Ga0500583_0007978 | 3300053092 | Bacteria | 3767 |
| 1021 | Ga0500583_0019165 | 3300053092 | Bacteria | 2799 |
| 1022 | Ga0500651_0043894 | 3300053093 | Bacteria | 2815 |
| 1023 | Ga0500651_0059032 | 3300053093 | Bacteria | 2399 |
| 1024 | Ga0500641_0044615 | 3300053096 | Bacteria | 1803 |
| 1025 | Ga0500569_000646 | 3300053109 | Bacteria | 5967 |
| 1026 | Ga0500569_001390 | 3300053109 | Bacteria | 4544 |
| 1027 | Ga0500572_015523 | 3300053111 | Bacteria | 1922 |
| 1028 | Ga0500592_002513 | 3300053116 | Bacteria | 2948 |
| 1029 | Ga0500607_000048 | 3300053121 | Bacteria | 82363 |
| 1030 | Ga0500608_053633 | 3300053122 | Bacteria | 1935 |
| 1031 | Ga0500658_0015242 | 3300053134 | Bacteria | 2851 |
| 1032 | Ga0500559_0001130 | 3300053136 | Bacteria | 16070 |
| 1033 | Ga0500559_0007985 | 3300053136 | Bacteria | 4661 |
| 1034 | Ga0500561_0000022 | 3300053137 | Bacteria | 35723 |
| 1035 | Ga0500568_0000882 | 3300053139 | Bacteria | 21057 |
| 1036 | Ga0500573_0016743 | 3300053140 | Bacteria | 4165 |
| 1037 | Ga0500577_0003953 | 3300053142 | Bacteria | 3878 |
| 1038 | Ga0500588_0001824 | 3300053146 | Bacteria | 4158 |
| 1039 | Ga0500590_002886 | 3300053148 | Bacteria | 7788 |
| 1040 | Ga0500616_0005199 | 3300053153 | Bacteria | 8914 |
| 1041 | Ga0500616_0005721 | 3300053153 | Bacteria | 8367 |
| 1042 | Ga0500616_0010525 | 3300053153 | Bacteria | 5529 |
| 1043 | Ga0500620_000423 | 3300053155 | Bacteria | 7703 |
| 1044 | Ga0500620_000465 | 3300053155 | Bacteria | 7227 |
| 1045 | Ga0500620_018905 | 3300053155 | Bacteria | 2015 |
| 1046 | Ga0500622_0000705 | 3300053156 | Bacteria | 29326 |
| 1047 | Ga0500622_0002404 | 3300053156 | Bacteria | 13531 |
| 1048 | Ga0500622_0007267 | 3300053156 | Bacteria | 6307 |
| 1049 | Ga0500624_006670 | 3300053157 | Bacteria | 1567 |
| 1050 | Ga0500627_0064157 | 3300053158 | Bacteria | 1619 |
| 1051 | Ga0500634_0021256 | 3300053161 | Bacteria | 3515 |
| 1052 | Ga0500636_0001691 | 3300053177 | Bacteria | 12082 |
| 1053 | Ga0500636_0005153 | 3300053177 | Bacteria | 7431 |
| 1054 | Ga0500637_0003907 | 3300053178 | Bacteria | 6955 |
| 1055 | Ga0500645_011509 | 3300053730 | Bacteria | 2886 |
| 1056 | Ga0500552_000622 | 3300053733 | Bacteria | 3342 |
| 1057 | Ga0501082_0077538 | 3300060353 | Bacteria | 2865 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046499 | Ga0495594_0067694 | Ga0495594_0067694_150_1223 | 356 |
| 2 | 3300046531 | Ga0495665_0046784 | Ga0495665_0046784_151_1224 | 356 |
| 3 | 3300046543 | Ga0495645_0068968 | Ga0495645_0068968_1416_2489 | 356 |
| 4 | 3300046557 | Ga0495622_0022619 | Ga0495622_0022619_617_1690 | 356 |
| 5 | 3300046674 | Ga0495588_0134174 | Ga0495588_0134174_74_1147 | 356 |
| 6 | 3300046690 | Ga0495624_0102323 | Ga0495624_0102323_112_1185 | 356 |
| 7 | 3300047321 | Ga0495676_0202647 | Ga0495676_0202647_29_1102 | 356 |
| 8 | 3300046491 | Ga0495584_0023602 | Ga0495584_0023602_1933_3048 | 359 |
| 9 | 3300047445 | Ga0495677_0005733 | Ga0495677_0005733_61_1176 | 359 |
| 10 | 3300046500 | Ga0495596_0003747 | Ga0495596_0003747_6073_7203 | 361 |
| 11 | 3300046684 | Ga0495669_0000019 | Ga0495669_0000019_56983_58113 | 361 |
| 12 | 3300046474 | Ga0495605_0009542 | Ga0495605_0009542_3644_4735 | 362 |
| 13 | 3300046474 | Ga0495605_0099864 | Ga0495605_0099864_209_1300 | 362 |
| 14 | 3300046500 | Ga0495596_0017390 | Ga0495596_0017390_193_1284 | 362 |
| 15 | 3300046501 | Ga0495607_0084222 | Ga0495607_0084222_44_1135 | 362 |
| 16 | 3300046513 | Ga0495616_0103371 | Ga0495616_0103371_58_1149 | 362 |
| 17 | 3300046518 | Ga0495631_0028653 | Ga0495631_0028653_921_2012 | 362 |
| 18 | 3300046528 | Ga0495642_0005453 | Ga0495642_0005453_2369_3460 | 362 |
| 19 | 3300046528 | Ga0495642_0008384 | Ga0495642_0008384_393_1484 | 362 |
| 20 | 3300046538 | Ga0495609_0005785 | Ga0495609_0005785_2766_3857 | 362 |
| 21 | 3300046542 | Ga0495597_0041282 | Ga0495597_0041282_727_1818 | 362 |
| 22 | 3300046660 | Ga0495625_0020382 | Ga0495625_0020382_3804_4895 | 362 |
| 23 | 3300046684 | Ga0495669_0003232 | Ga0495669_0003232_1486_2577 | 362 |
| 24 | 3300046810 | Ga0495660_0050542 | Ga0495660_0050542_984_2075 | 362 |
| 25 | 3300047323 | Ga0495683_0066500 | Ga0495683_0066500_312_1403 | 362 |
| 26 | 3300047445 | Ga0495677_0012901 | Ga0495677_0012901_1496_2587 | 362 |
| 27 | 3300047470 | Ga0495681_0057179 | Ga0495681_0057179_380_1471 | 362 |
| 28 | 3300048091 | Ga0495626_0005308 | Ga0495626_0005308_4152_5243 | 362 |
| 29 | 3300046542 | Ga0495597_0008490 | Ga0495597_0008490_3842_4972 | 364 |
| 30 | 3300046616 | Ga0495668_0035257 | Ga0495668_0035257_459_1589 | 364 |
| 31 | 3300047321 | Ga0495676_0000029 | Ga0495676_0000029_32322_33452 | 364 |
| 32 | 3300053092 | Ga0500583_0007978 | Ga0500583_0007978_1357_2460 | 364 |
| 33 | 3300053134 | Ga0500658_0015242 | Ga0500658_0015242_626_1729 | 364 |
| 34 | 3300053146 | Ga0500588_0001824 | Ga0500588_0001824_1689_2792 | 364 |
| 35 | 3300047322 | Ga0495680_0005935 | Ga0495680_0005935_2725_3855 | 365 |
| 36 | 3300049460 | Ga0495682_0007370 | Ga0495682_0007370_2637_3785 | 365 |
| 37 | 3300047472 | Ga0495686_0000015 | Ga0495686_0000015_277519_278667 | 366 |
| 38 | 3300046492 | Ga0495585_0121941 | Ga0495585_0121941_63_1169 | 367 |
| 39 | 3300046648 | Ga0495611_0002275 | Ga0495611_0002275_209_1357 | 367 |
| 40 | 3300037312 | Ga0395899_0000388 | Ga0395899_0000388_33265_34374 | 368 |
| 41 | 3300046463 | Ga0495653_0039937 | Ga0495653_0039937_1075_2184 | 368 |
| 42 | 3300046492 | Ga0495585_0001376 | Ga0495585_0001376_7852_9000 | 368 |
| 43 | 3300046492 | Ga0495585_0030544 | Ga0495585_0030544_1794_2903 | 368 |
| 44 | 3300046499 | Ga0495594_0013296 | Ga0495594_0013296_2960_4108 | 368 |
| 45 | 3300046514 | Ga0495618_0004380 | Ga0495618_0004380_4571_5680 | 368 |
| 46 | 3300046516 | Ga0495628_0045699 | Ga0495628_0045699_2302_3411 | 368 |
| 47 | 3300046684 | Ga0495669_0000901 | Ga0495669_0000901_2980_4128 | 368 |
| 48 | 3300046809 | Ga0495600_0052706 | Ga0495600_0052706_36_1145 | 368 |
| 49 | 3300047320 | Ga0495672_0000192 | Ga0495672_0000192_46013_47161 | 368 |
| 50 | 3300047443 | Ga0495687_000007 | Ga0495687_000007_213489_214637 | 368 |
| 51 | 3300048903 | Ga0496100_0072053 | Ga0496100_0072053_84_1193 | 368 |
| 52 | 3300048916 | Ga0496113_0055199 | Ga0496113_0055199_1404_2513 | 368 |
| 53 | 3300048925 | Ga0496122_0000567 | Ga0496122_0000567_63993_65102 | 368 |
| 54 | 3300048926 | Ga0496123_0000704 | Ga0496123_0000704_43015_44124 | 368 |
| 55 | 3300053077 | Ga0495601_0116696 | Ga0495601_0116696_46_1155 | 368 |
| 56 | 3300046500 | Ga0495596_0015259 | Ga0495596_0015259_1883_3031 | 370 |
| 57 | 3300046519 | Ga0495632_0069723 | Ga0495632_0069723_97_1212 | 370 |
| 58 | 3300047470 | Ga0495681_0000005 | Ga0495681_0000005_26037_27191 | 371 |
| 59 | 3300046492 | Ga0495585_0124879 | Ga0495585_0124879_19_1149 | 375 |
| 60 | 3300046513 | Ga0495616_0086701 | Ga0495616_0086701_337_1467 | 375 |
| 61 | 3300046523 | Ga0495644_0048588 | Ga0495644_0048588_442_1572 | 375 |
| 62 | 3300046557 | Ga0495622_0010320 | Ga0495622_0010320_1083_2213 | 375 |
| 63 | 3300046558 | Ga0495633_0029913 | Ga0495633_0029913_150_1280 | 375 |
| 64 | 3300046648 | Ga0495611_0057727 | Ga0495611_0057727_480_1610 | 375 |
| 65 | 3300046674 | Ga0495588_0016819 | Ga0495588_0016819_609_1739 | 375 |
| 66 | 3300048088 | Ga0495602_0069052 | Ga0495602_0069052_116_1246 | 375 |
| 67 | 3300046615 | Ga0495656_0028244 | Ga0495656_0028244_616_1749 | 376 |
| 68 | 3300046664 | Ga0495659_0014705 | Ga0495659_0014705_60_1193 | 376 |
| 69 | 3300048913 | Ga0496110_0111918 | Ga0496110_0111918_442_1575 | 376 |
| 70 | 3300006051 | Ga0075364_10012374 | Ga0075364_100123742 | 378 |
| 71 | 3300050491 | nmdc:mga00v17_218_c1 | nmdc:mga00v17_218_c1_10917_12224 | 378 |
| 72 | 3300053121 | Ga0500607_000048 | Ga0500607_000048_1646_2944 | 380 |
| 73 | 3300053136 | Ga0500559_0001130 | Ga0500559_0001130_8905_10203 | 380 |
| 74 | 3300053178 | Ga0500637_0003907 | Ga0500637_0003907_1674_3002 | 380 |
| 75 | 3300053730 | Ga0500645_011509 | Ga0500645_011509_1571_2869 | 380 |
| 76 | 3300037471 | Ga0395905_0115933 | Ga0395905_0115933_391_1539 | 381 |
| 77 | 3300046460 | Ga0495638_0107934 | Ga0495638_0107934_275_1423 | 381 |
| 78 | 3300046499 | Ga0495594_0009107 | Ga0495594_0009107_667_1815 | 381 |
| 79 | 3300046513 | Ga0495616_0038676 | Ga0495616_0038676_1082_2230 | 381 |
| 80 | 3300046518 | Ga0495631_0000012 | Ga0495631_0000012_48003_49151 | 381 |
| 81 | 3300046530 | Ga0495654_0058906 | Ga0495654_0058906_304_1452 | 381 |
| 82 | 3300046542 | Ga0495597_0000758 | Ga0495597_0000758_486_1634 | 381 |
| 83 | 3300046616 | Ga0495668_0001916 | Ga0495668_0001916_13545_14693 | 381 |
| 84 | 3300048091 | Ga0495626_0000020 | Ga0495626_0000020_41268_42416 | 381 |
| 85 | 3300048091 | Ga0495626_0021293 | Ga0495626_0021293_162_1310 | 381 |
| 86 | 3300048091 | Ga0495626_0066927 | Ga0495626_0066927_162_1310 | 381 |
| 87 | 3300049459 | Ga0495678_000022 | Ga0495678_000022_182948_184096 | 381 |
| 88 | 3300046471 | Ga0495650_0000001 | Ga0495650_0000001_601329_602507 | 382 |
| 89 | 3300048905 | Ga0496102_0000033 | Ga0496102_0000033_74984_76138 | 383 |
| 90 | 3300009148 | Ga0105243_10341770 | Ga0105243_103417701 | 390 |
| 91 | 3300049459 | Ga0495678_001887 | Ga0495678_001887_9266_10474 | 390 |
| 92 | 3300046500 | Ga0495596_0000584 | Ga0495596_0000584_583_1815 | 392 |
| 93 | 3300046500 | Ga0495596_0009002 | Ga0495596_0009002_3134_4366 | 392 |
| 94 | 3300046506 | Ga0495583_0002859 | Ga0495583_0002859_658_1890 | 392 |
| 95 | 3300046506 | Ga0495583_0018037 | Ga0495583_0018037_2287_3519 | 392 |
| 96 | 3300046525 | Ga0495663_0039715 | Ga0495663_0039715_54_1286 | 392 |
| 97 | 3300046528 | Ga0495642_0005085 | Ga0495642_0005085_1923_3155 | 392 |
| 98 | 3300046692 | Ga0495671_0001323 | Ga0495671_0001323_15329_16561 | 392 |
| 99 | 3300046694 | Ga0495649_0033662 | Ga0495649_0033662_245_1477 | 392 |
| 100 | 3300047443 | Ga0495687_005475 | Ga0495687_005475_6430_7662 | 392 |
| 101 | 3300049459 | Ga0495678_000452 | Ga0495678_000452_26846_28078 | 392 |
| 102 | 3300049460 | Ga0495682_0000122 | Ga0495682_0000122_28476_29708 | 392 |
| 103 | 3300005262 | Ga0065165_1000627 | Ga0065165_100062723 | 393 |
| 104 | 3300046457 | Ga0495590_0000224 | Ga0495590_0000224_17827_19059 | 393 |
| 105 | 3300046492 | Ga0495585_0017671 | Ga0495585_0017671_487_1761 | 393 |
| 106 | 3300046492 | Ga0495585_0022287 | Ga0495585_0022287_169_1401 | 393 |
| 107 | 3300046558 | Ga0495633_0001767 | Ga0495633_0001767_5031_6305 | 393 |
| 108 | 3300013102 | Ga0157371_10000128 | Ga0157371_100001289 | 394 |
| 109 | 3300015261 | Ga0182006_1042460 | Ga0182006_10424602 | 394 |
| 110 | 3300046471 | Ga0495650_0042514 | Ga0495650_0042514_481_1713 | 394 |
| 111 | 3300046472 | Ga0495580_0031612 | Ga0495580_0031612_1341_2573 | 394 |
| 112 | 3300046474 | Ga0495605_0041941 | Ga0495605_0041941_847_2079 | 394 |
| 113 | 3300046491 | Ga0495584_0001080 | Ga0495584_0001080_3068_4300 | 394 |
| 114 | 3300046492 | Ga0495585_0014426 | Ga0495585_0014426_547_1779 | 394 |
| 115 | 3300046499 | Ga0495594_0027514 | Ga0495594_0027514_215_1447 | 394 |
| 116 | 3300046506 | Ga0495583_0006919 | Ga0495583_0006919_1964_3196 | 394 |
| 117 | 3300046507 | Ga0495606_0074720 | Ga0495606_0074720_397_1629 | 394 |
| 118 | 3300046513 | Ga0495616_0006483 | Ga0495616_0006483_3348_4580 | 394 |
| 119 | 3300046524 | Ga0495648_0016383 | Ga0495648_0016383_3490_4722 | 394 |
| 120 | 3300046526 | Ga0495666_0000154 | Ga0495666_0000154_21857_23089 | 394 |
| 121 | 3300046526 | Ga0495666_0005895 | Ga0495666_0005895_1605_2837 | 394 |
| 122 | 3300046533 | Ga0495640_0029895 | Ga0495640_0029895_1620_2852 | 394 |
| 123 | 3300046533 | Ga0495640_0104362 | Ga0495640_0104362_253_1485 | 394 |
| 124 | 3300046674 | Ga0495588_0038283 | Ga0495588_0038283_889_2121 | 394 |
| 125 | 3300046691 | Ga0495670_0015258 | Ga0495670_0015258_1698_2930 | 394 |
| 126 | 3300046809 | Ga0495600_0075450 | Ga0495600_0075450_323_1555 | 394 |
| 127 | 3300046810 | Ga0495660_0023523 | Ga0495660_0023523_500_1732 | 394 |
| 128 | 3300047317 | Ga0495604_0024026 | Ga0495604_0024026_2560_3792 | 394 |
| 129 | 3300047317 | Ga0495604_0061318 | Ga0495604_0061318_1558_2790 | 394 |
| 130 | 3300047317 | Ga0495604_0129667 | Ga0495604_0129667_79_1311 | 394 |
| 131 | 3300047318 | Ga0495636_0005695 | Ga0495636_0005695_528_1760 | 394 |
| 132 | 3300047444 | Ga0495675_0005060 | Ga0495675_0005060_78_1310 | 394 |
| 133 | 3300047447 | Ga0495685_002223 | Ga0495685_002223_4278_5510 | 394 |
| 134 | 3300048088 | Ga0495602_0021742 | Ga0495602_0021742_1723_2955 | 394 |
| 135 | 3300048905 | Ga0496102_0259440 | Ga0496102_0259440_297_1529 | 394 |
| 136 | 3300048906 | Ga0496103_0010021 | Ga0496103_0010021_587_1819 | 394 |
| 137 | 3300049460 | Ga0495682_0018770 | Ga0495682_0018770_897_2129 | 394 |
| 138 | 3300042005 | Ga0439448_0000551 | Ga0439448_0000551_5084_6316 | 395 |
| 139 | 3300042012 | Ga0439455_0022279 | Ga0439455_0022279_158_1390 | 395 |
| 140 | 3300044658 | Ga0466972_0002549 | Ga0466972_0002549_4599_5831 | 395 |
| 141 | 3300044706 | Ga0466964_0002584 | Ga0466964_0002584_1433_2665 | 395 |
| 142 | 3300044706 | Ga0466964_0009335 | Ga0466964_0009335_828_2060 | 395 |
| 143 | 3300044735 | Ga0466968_0008349 | Ga0466968_0008349_1483_2715 | 395 |
| 144 | 3300046463 | Ga0495653_0008225 | Ga0495653_0008225_573_1805 | 395 |
| 145 | 3300046471 | Ga0495650_0000089 | Ga0495650_0000089_106215_107447 | 395 |
| 146 | 3300046491 | Ga0495584_0000041 | Ga0495584_0000041_40326_41558 | 395 |
| 147 | 3300046518 | Ga0495631_0021102 | Ga0495631_0021102_1612_2844 | 395 |
| 148 | 3300046519 | Ga0495632_0000028 | Ga0495632_0000028_43429_44661 | 395 |
| 149 | 3300046522 | Ga0495643_0009852 | Ga0495643_0009852_1288_2520 | 395 |
| 150 | 3300046524 | Ga0495648_0003980 | Ga0495648_0003980_9795_11027 | 395 |
| 151 | 3300046542 | Ga0495597_0000830 | Ga0495597_0000830_12720_13952 | 395 |
| 152 | 3300046665 | Ga0495661_0000769 | Ga0495661_0000769_1617_2849 | 395 |
| 153 | 3300046674 | Ga0495588_0000052 | Ga0495588_0000052_249504_250736 | 395 |
| 154 | 3300046694 | Ga0495649_0036714 | Ga0495649_0036714_1430_2662 | 395 |
| 155 | 3300046794 | Ga0495589_0000206 | Ga0495589_0000206_38849_40081 | 395 |
| 156 | 3300047320 | Ga0495672_0001279 | Ga0495672_0001279_10867_12099 | 395 |
| 157 | 3300047443 | Ga0495687_000067 | Ga0495687_000067_92253_93485 | 395 |
| 158 | 3300048091 | Ga0495626_0014646 | Ga0495626_0014646_2426_3658 | 395 |
| 159 | 3300048905 | Ga0496102_0181563 | Ga0496102_0181563_82_1314 | 395 |
| 160 | 3300049572 | Ga0501036_0183879 | Ga0501036_0183879_53_1285 | 395 |
| 161 | 3300037466 | Ga0395898_0013150 | Ga0395898_0013150_2911_4152 | 396 |
| 162 | 3300044684 | Ga0466966_0001134 | Ga0466966_0001134_1153_2385 | 396 |
| 163 | 3300046474 | Ga0495605_0000084 | Ga0495605_0000084_74899_76131 | 396 |
| 164 | 3300046491 | Ga0495584_0009158 | Ga0495584_0009158_2271_3503 | 396 |
| 165 | 3300046492 | Ga0495585_0023845 | Ga0495585_0023845_810_2042 | 396 |
| 166 | 3300046500 | Ga0495596_0007288 | Ga0495596_0007288_2383_3615 | 396 |
| 167 | 3300046501 | Ga0495607_0007099 | Ga0495607_0007099_1192_2424 | 396 |
| 168 | 3300046501 | Ga0495607_0010428 | Ga0495607_0010428_1550_2782 | 396 |
| 169 | 3300046506 | Ga0495583_0000190 | Ga0495583_0000190_76335_77567 | 396 |
| 170 | 3300046513 | Ga0495616_0002443 | Ga0495616_0002443_1243_2475 | 396 |
| 171 | 3300046518 | Ga0495631_0003486 | Ga0495631_0003486_4866_6098 | 396 |
| 172 | 3300046519 | Ga0495632_0017639 | Ga0495632_0017639_435_1667 | 396 |
| 173 | 3300046522 | Ga0495643_0011275 | Ga0495643_0011275_427_1659 | 396 |
| 174 | 3300046523 | Ga0495644_0003802 | Ga0495644_0003802_36_1268 | 396 |
| 175 | 3300046558 | Ga0495633_0015864 | Ga0495633_0015864_2323_3555 | 396 |
| 176 | 3300046616 | Ga0495668_0016221 | Ga0495668_0016221_1973_3205 | 396 |
| 177 | 3300046648 | Ga0495611_0018565 | Ga0495611_0018565_876_2108 | 396 |
| 178 | 3300046665 | Ga0495661_0044249 | Ga0495661_0044249_779_2011 | 396 |
| 179 | 3300046691 | Ga0495670_0041520 | Ga0495670_0041520_512_1744 | 396 |
| 180 | 3300046794 | Ga0495589_0000285 | Ga0495589_0000285_19336_20568 | 396 |
| 181 | 3300046794 | Ga0495589_0013475 | Ga0495589_0013475_1870_3102 | 396 |
| 182 | 3300046810 | Ga0495660_0000143 | Ga0495660_0000143_70158_71390 | 396 |
| 183 | 3300046810 | Ga0495660_0057628 | Ga0495660_0057628_512_1744 | 396 |
| 184 | 3300047323 | Ga0495683_0005510 | Ga0495683_0005510_1721_2953 | 396 |
| 185 | 3300047443 | Ga0495687_000727 | Ga0495687_000727_7170_8402 | 396 |
| 186 | 3300047445 | Ga0495677_0000331 | Ga0495677_0000331_1085_2317 | 396 |
| 187 | 3300047446 | Ga0495679_001214 | Ga0495679_001214_11980_13212 | 396 |
| 188 | 3300048091 | Ga0495626_0000089 | Ga0495626_0000089_69410_70642 | 396 |
| 189 | 3300048924 | Ga0496121_0185429 | Ga0496121_0185429_88_1320 | 396 |
| 190 | 3300048926 | Ga0496123_0001155 | Ga0496123_0001155_26192_27424 | 396 |
| 191 | 3300049459 | Ga0495678_006837 | Ga0495678_006837_4213_5445 | 396 |
| 192 | 3300046491 | Ga0495584_0000002 | Ga0495584_0000002_441865_443139 | 397 |
| 193 | 3300046491 | Ga0495584_0081236 | Ga0495584_0081236_372_1604 | 397 |
| 194 | 3300048917 | Ga0496114_0199365 | Ga0496114_0199365_224_1456 | 397 |
| 195 | 3300005457 | Ga0070662_100054711 | Ga0070662_1000547112 | 398 |
| 196 | 3300031238 | Ga0265332_10000022 | Ga0265332_1000002272 | 398 |
| 197 | 3300031239 | Ga0265328_10017627 | Ga0265328_100176272 | 398 |
| 198 | 3300046463 | Ga0495653_0027720 | Ga0495653_0027720_1987_3219 | 398 |
| 199 | 3300046663 | Ga0495635_0002745 | Ga0495635_0002745_1673_2905 | 398 |
| 200 | 3300047444 | Ga0495675_0005287 | Ga0495675_0005287_5389_6621 | 398 |
| 201 | 3300047673 | Ga0495593_0008904 | Ga0495593_0008904_4019_5251 | 398 |
| 202 | 3300048089 | Ga0495614_0001365 | Ga0495614_0001365_8746_9978 | 398 |
| 203 | iso_pu_bacteria | 2876369609 | 2876375942 | 400 |
| 204 | iso_pu_bacteria | 2881161766 | 2881165192 | 400 |
| 205 | iso_pu_bacteria | 2958144490 | 2958145475 | 400 |
| 206 | 3300039453 | Ga0436362_1110877 | Ga0436362_1110877_183_1439 | 401 |
| 207 | 3300053155 | Ga0500620_000423 | Ga0500620_000423_133_1371 | 401 |
| 208 | 3300053155 | Ga0500620_000465 | Ga0500620_000465_3762_5003 | 401 |
| 209 | 3300009174 | Ga0105241_10003901 | Ga0105241_100039015 | 402 |
| 210 | 3300025911 | Ga0207654_10007763 | Ga0207654_100077634 | 402 |
| 211 | 3300046660 | Ga0495625_0128111 | Ga0495625_0128111_160_1401 | 403 |
| 212 | 3300053096 | Ga0500641_0044615 | Ga0500641_0044615_577_1791 | 403 |
| 213 | iso_pu_bacteria | 2791355199 | 2793077686 | 403 |
| 214 | iso_pu_bacteria | 2841957949 | 2841960445 | 403 |
| 215 | 3300037471 | Ga0395905_0050293 | Ga0395905_0050293_1700_2917 | 404 |
| 216 | 3300038443 | Ga0395901_0200299 | Ga0395901_0200299_180_1397 | 404 |
| 217 | 3300044658 | Ga0466972_0033285 | Ga0466972_0033285_935_2152 | 404 |
| 218 | iso_pu_bacteria | 2599185236 | 2599718353 | 404 |
| 219 | iso_pu_bacteria | 2802429606 | 2805932988 | 404 |
| 220 | iso_pu_bacteria | 2808606384 | 2808968995 | 404 |
| 221 | iso_pu_bacteria | 2808606390 | 2809003826 | 404 |
| 222 | iso_pu_bacteria | 2808606391 | 2809011103 | 404 |
| 223 | 3300005262 | Ga0065165_1000014 | Ga0065165_1000014139 | 405 |
| 224 | 3300005347 | Ga0070668_100133641 | Ga0070668_1001336412 | 405 |
| 225 | 3300005719 | Ga0068861_100068433 | Ga0068861_1000684331 | 405 |
| 226 | 3300005985 | Ga0081539_10000429 | Ga0081539_100004292 | 405 |
| 227 | 3300025284 | Ga0209130_1000024 | Ga0209130_1000024135 | 405 |
| 228 | 3300025294 | Ga0209025_1004168 | Ga0209025_10041684 | 405 |
| 229 | 3300025972 | Ga0207668_10109627 | Ga0207668_101096271 | 405 |
| 230 | 3300026118 | Ga0207675_100024607 | Ga0207675_1000246074 | 405 |
| 231 | 3300044842 | Ga0466957_0098143 | Ga0466957_0098143_164_1384 | 405 |
| 232 | 3300049581 | Ga0501047_0048660 | Ga0501047_0048660_2163_3395 | 405 |
| 233 | 3300049583 | Ga0501067_0009026 | Ga0501067_0009026_2373_3605 | 405 |
| 234 | 3300049588 | Ga0501072_0062867 | Ga0501072_0062867_836_2068 | 405 |
| 235 | 3300049742 | Ga0501080_0082527 | Ga0501080_0082527_268_1500 | 405 |
| 236 | 3300053156 | Ga0500622_0007267 | Ga0500622_0007267_4882_6117 | 405 |
| 237 | 3300053177 | Ga0500636_0005153 | Ga0500636_0005153_5120_6355 | 405 |
| 238 | iso_pu_bacteria | 2503198000 | 2503198916 | 405 |
| 239 | iso_pu_bacteria | 2508501050 | 2508733976 | 405 |
| 240 | iso_pu_bacteria | 2508501114 | 2509078887 | 405 |
| 241 | iso_pu_bacteria | 2508501122 | 2509110173 | 405 |
| 242 | iso_pu_bacteria | 2508501123 | 2509119140 | 405 |
| 243 | iso_pu_bacteria | 2508501127 | 2509143090 | 405 |
| 244 | iso_pu_bacteria | 2509276019 | 2509378905 | 405 |
| 245 | iso_pu_bacteria | 2509276021 | 2509390872 | 405 |
| 246 | iso_pu_bacteria | 2509276022 | 2509393788 | 405 |
| 247 | iso_pu_bacteria | 2509276033 | 2509441955 | 405 |
| 248 | iso_pu_bacteria | 2510065019 | 2510137320 | 405 |
| 249 | iso_pu_bacteria | 2510065053 | 2510285095 | 405 |
| 250 | iso_pu_bacteria | 2510065055 | 2510294068 | 405 |
| 251 | iso_pu_bacteria | 2510065057 | 2510303782 | 405 |
| 252 | iso_pu_bacteria | 2510065058 | 2510313102 | 405 |
| 253 | iso_pu_bacteria | 2510065059 | 2510318459 | 405 |
| 254 | iso_pu_bacteria | 2510461069 | 2510842674 | 405 |
| 255 | iso_pu_bacteria | 2510461076 | 2510893706 | 405 |
| 256 | iso_pu_bacteria | 2510917028 | 2511185980 | 405 |
| 257 | iso_pu_bacteria | 2510917030 | 2511195721 | 405 |
| 258 | iso_pu_bacteria | 2511231052 | 2511503080 | 405 |
| 259 | iso_pu_bacteria | 2512047086 | 2512534343 | 405 |
| 260 | iso_pu_bacteria | 2512875016 | 2512933691 | 405 |
| 261 | iso_pu_bacteria | 2512875024 | 2512961842 | 405 |
| 262 | iso_pu_bacteria | 2513237084 | 2513571938 | 405 |
| 263 | iso_pu_bacteria | 2513237085 | 2513575879 | 405 |
| 264 | iso_pu_bacteria | 2513237086 | 2513585947 | 405 |
| 265 | iso_pu_bacteria | 2513237088 | 2513595811 | 405 |
| 266 | iso_pu_bacteria | 2513237090 | 2513614653 | 405 |
| 267 | iso_pu_bacteria | 2513237091 | 2513617249 | 405 |
| 268 | iso_pu_bacteria | 2513237093 | 2513633425 | 405 |
| 269 | iso_pu_bacteria | 2513237095 | 2513649487 | 405 |
| 270 | iso_pu_bacteria | 2513237103 | 2513712271 | 405 |
| 271 | iso_pu_bacteria | 2513237138 | 2513869690 | 405 |
| 272 | iso_pu_bacteria | 2513237140 | 2513882989 | 405 |
| 273 | iso_pu_bacteria | 2513237143 | 2513903019 | 405 |
| 274 | iso_pu_bacteria | 2513237144 | 2513912197 | 405 |
| 275 | iso_pu_bacteria | 2513237146 | 2513928702 | 405 |
| 276 | iso_pu_bacteria | 2513237159 | 2513999165 | 405 |
| 277 | iso_pu_bacteria | 2513237162 | 2514022635 | 405 |
| 278 | iso_pu_bacteria | 2513237164 | 2514035476 | 405 |
| 279 | iso_pu_bacteria | 2513237305 | 2514421925 | 405 |
| 280 | iso_pu_bacteria | 2515075009 | 2515109644 | 405 |
| 281 | iso_pu_bacteria | 2515154113 | 2515636606 | 405 |
| 282 | iso_pu_bacteria | 2515154114 | 2515644071 | 405 |
| 283 | iso_pu_bacteria | 2515154116 | 2515657884 | 405 |
| 284 | iso_pu_bacteria | 2515154134 | 2515742709 | 405 |
| 285 | iso_pu_bacteria | 2516653046 | 2516894484 | 405 |
| 286 | iso_pu_bacteria | 2516653077 | 2517042470 | 405 |
| 287 | iso_pu_bacteria | 2516653085 | 2517081334 | 405 |
| 288 | iso_pu_bacteria | 2517093000 | 2517100291 | 405 |
| 289 | iso_pu_bacteria | 2517093001 | 2517105025 | 405 |
| 290 | iso_pu_bacteria | 2517287029 | 2517411089 | 405 |
| 291 | iso_pu_bacteria | 2519899620 | 2520376908 | 405 |
| 292 | iso_pu_bacteria | 2524023207 | 2524451973 | 405 |
| 293 | iso_pu_bacteria | 2529292951 | 2530648804 | 405 |
| 294 | iso_pu_bacteria | 2534681786 | 2535486489 | 405 |
| 295 | iso_pu_bacteria | 2534681796 | 2535519778 | 405 |
| 296 | iso_pu_bacteria | 2551306084 | 2551679895 | 405 |
| 297 | iso_pu_bacteria | 2551306085 | 2551689765 | 405 |
| 298 | iso_pu_bacteria | 2551306086 | 2551692519 | 405 |
| 299 | iso_pu_bacteria | 2551306087 | 2551702543 | 405 |
| 300 | iso_pu_bacteria | 2551306090 | 2551716365 | 405 |
| 301 | iso_pu_bacteria | 2551306091 | 2551729551 | 405 |
| 302 | iso_pu_bacteria | 2551306092 | 2551737693 | 405 |
| 303 | iso_pu_bacteria | 2551306093 | 2551745625 | 405 |
| 304 | iso_pu_bacteria | 2558860100 | 2558860500 | 405 |
| 305 | iso_pu_bacteria | 2582581283 | 2585167200 | 405 |
| 306 | iso_pu_bacteria | 2582581294 | 2585200603 | 405 |
| 307 | iso_pu_bacteria | 2582581298 | 2585221829 | 405 |
| 308 | iso_pu_bacteria | 2582581299 | 2585232632 | 405 |
| 309 | iso_pu_bacteria | 2582581304 | 2585255712 | 405 |
| 310 | iso_pu_bacteria | 2582581306 | 2585270405 | 405 |
| 311 | iso_pu_bacteria | 2582581865 | 2585391574 | 405 |
| 312 | iso_pu_bacteria | 2582581866 | 2585397010 | 405 |
| 313 | iso_pu_bacteria | 2582581867 | 2585401359 | 405 |
| 314 | iso_pu_bacteria | 2585427526 | 2585526423 | 405 |
| 315 | iso_pu_bacteria | 2585427528 | 2585538983 | 405 |
| 316 | iso_pu_bacteria | 2585427529 | 2585544001 | 405 |
| 317 | iso_pu_bacteria | 2585427590 | 2585821499 | 405 |
| 318 | iso_pu_bacteria | 2585427593 | 2585836933 | 405 |
| 319 | iso_pu_bacteria | 2585427594 | 2585842439 | 405 |
| 320 | iso_pu_bacteria | 2585427633 | 2585996923 | 405 |
| 321 | iso_pu_bacteria | 2585427634 | 2586001512 | 405 |
| 322 | iso_pu_bacteria | 2588253730 | 2588519771 | 405 |
| 323 | iso_pu_bacteria | 2597489875 | 2597810839 | 405 |
| 324 | iso_pu_bacteria | 2599185170 | 2599415091 | 405 |
| 325 | iso_pu_bacteria | 2599185301 | 2599938830 | 405 |
| 326 | iso_pu_bacteria | 2599185352 | 2600194187 | 405 |
| 327 | iso_pu_bacteria | 2615840624 | 2616294164 | 405 |
| 328 | iso_pu_bacteria | 2615840698 | 2616555713 | 405 |
| 329 | iso_pu_bacteria | 2617270742 | 2617384674 | 405 |
| 330 | iso_pu_bacteria | 2643221550 | 2643771710 | 405 |
| 331 | iso_pu_bacteria | 2643221556 | 2643797417 | 405 |
| 332 | iso_pu_bacteria | 2643221557 | 2643809672 | 405 |
| 333 | iso_pu_bacteria | 2643221564 | 2643838020 | 405 |
| 334 | iso_pu_bacteria | 2643221595 | 2643985969 | 405 |
| 335 | iso_pu_bacteria | 2643221599 | 2644003528 | 405 |
| 336 | iso_pu_bacteria | 2643221607 | 2644047591 | 405 |
| 337 | iso_pu_bacteria | 2643221610 | 2644063852 | 405 |
| 338 | iso_pu_bacteria | 2643221623 | 2644130880 | 405 |
| 339 | iso_pu_bacteria | 2643221627 | 2644154456 | 405 |
| 340 | iso_pu_bacteria | 2643221634 | 2644195037 | 405 |
| 341 | iso_pu_bacteria | 2643221636 | 2644205944 | 405 |
| 342 | iso_pu_bacteria | 2643221637 | 2644210836 | 405 |
| 343 | iso_pu_bacteria | 2643221643 | 2644240866 | 405 |
| 344 | iso_pu_bacteria | 2643221655 | 2644309732 | 405 |
| 345 | iso_pu_bacteria | 2643221668 | 2644381374 | 405 |
| 346 | iso_pu_bacteria | 2643221675 | 2644415685 | 405 |
| 347 | iso_pu_bacteria | 2643221680 | 2644448725 | 405 |
| 348 | iso_pu_bacteria | 2643221684 | 2644474041 | 405 |
| 349 | iso_pu_bacteria | 2643221686 | 2644481058 | 405 |
| 350 | iso_pu_bacteria | 2643221688 | 2644496488 | 405 |
| 351 | iso_pu_bacteria | 2643221689 | 2644497430 | 405 |
| 352 | iso_pu_bacteria | 2643221698 | 2644543587 | 405 |
| 353 | iso_pu_bacteria | 2643221712 | 2644618179 | 405 |
| 354 | iso_pu_bacteria | 2643221718 | 2644654370 | 405 |
| 355 | iso_pu_bacteria | 2643221723 | 2644676646 | 405 |
| 356 | iso_pu_bacteria | 2643221726 | 2644686881 | 405 |
| 357 | iso_pu_bacteria | 2643221733 | 2644730316 | 405 |
| 358 | iso_pu_bacteria | 2643221734 | 2644736269 | 405 |
| 359 | iso_pu_bacteria | 2643221736 | 2644742878 | 405 |
| 360 | iso_pu_bacteria | 2657244999 | 2657684502 | 405 |
| 361 | iso_pu_bacteria | 2687453392 | 2688596191 | 405 |
| 362 | iso_pu_bacteria | 2693429783 | 2694627677 | 405 |
| 363 | iso_pu_bacteria | 2693429784 | 2694636788 | 405 |
| 364 | iso_pu_bacteria | 2718217882 | 2719184061 | 405 |
| 365 | iso_pu_bacteria | 2718217927 | 2719389794 | 405 |
| 366 | iso_pu_bacteria | 2718217997 | 2719669368 | 405 |
| 367 | iso_pu_bacteria | 2718218009 | 2719729634 | 405 |
| 368 | iso_pu_bacteria | 2718218199 | 2720494384 | 405 |
| 369 | iso_pu_bacteria | 2718218232 | 2720610704 | 405 |
| 370 | iso_pu_bacteria | 2718218233 | 2720616582 | 405 |
| 371 | iso_pu_bacteria | 2718218235 | 2720627938 | 405 |
| 372 | iso_pu_bacteria | 2718218269 | 2720771518 | 405 |
| 373 | iso_pu_bacteria | 2718218363 | 2721143884 | 405 |
| 374 | iso_pu_bacteria | 2718218365 | 2721156558 | 405 |
| 375 | iso_pu_bacteria | 2718218366 | 2721161259 | 405 |
| 376 | iso_pu_bacteria | 2718218423 | 2721403437 | 405 |
| 377 | iso_pu_bacteria | 2721755514 | 2722837212 | 405 |
| 378 | iso_pu_bacteria | 2721755556 | 2723030779 | 405 |
| 379 | iso_pu_bacteria | 2721755684 | 2723563280 | 405 |
| 380 | iso_pu_bacteria | 2721755685 | 2723571272 | 405 |
| 381 | iso_pu_bacteria | 2721755686 | 2723573325 | 405 |
| 382 | iso_pu_bacteria | 2721755809 | 2724035013 | 405 |
| 383 | iso_pu_bacteria | 2721755810 | 2724040788 | 405 |
| 384 | iso_pu_bacteria | 2721755819 | 2724087067 | 405 |
| 385 | iso_pu_bacteria | 2721755822 | 2724100778 | 405 |
| 386 | iso_pu_bacteria | 2721755823 | 2724108035 | 405 |
| 387 | iso_pu_bacteria | 2724679232 | 2725951926 | 405 |
| 388 | iso_pu_bacteria | 2728369352 | 2730105245 | 405 |
| 389 | iso_pu_bacteria | 2728369365 | 2730162201 | 405 |
| 390 | iso_pu_bacteria | 2728369397 | 2730295319 | 405 |
| 391 | iso_pu_bacteria | 2738541293 | 2738802575 | 405 |
| 392 | iso_pu_bacteria | 2738541333 | 2739034404 | 405 |
| 393 | iso_pu_bacteria | 2738543024 | 2739309869 | 405 |
| 394 | iso_pu_bacteria | 2739367655 | 2739612827 | 405 |
| 395 | iso_pu_bacteria | 2751185800 | 2753358243 | 405 |
| 396 | iso_pu_bacteria | 2751185821 | 2753460993 | 405 |
| 397 | iso_pu_bacteria | 2756170246 | 2756673585 | 405 |
| 398 | iso_pu_bacteria | 2758568016 | 2758638980 | 405 |
| 399 | iso_pu_bacteria | 2765235942 | 2766068154 | 405 |
| 400 | iso_pu_bacteria | 2773857672 | 2774128190 | 405 |
| 401 | iso_pu_bacteria | 2773857925 | 2774871361 | 405 |
| 402 | iso_pu_bacteria | 2775506901 | 2776258132 | 405 |
| 403 | iso_pu_bacteria | 2775507049 | 2776914982 | 405 |
| 404 | iso_pu_bacteria | 2775507266 | 2778178575 | 405 |
| 405 | iso_pu_bacteria | 2791355091 | 2792624370 | 405 |
| 406 | iso_pu_bacteria | 2791355092 | 2792625628 | 405 |
| 407 | iso_pu_bacteria | 2791355094 | 2792643705 | 405 |
| 408 | iso_pu_bacteria | 2791355123 | 2792747396 | 405 |
| 409 | iso_pu_bacteria | 2791355256 | 2793296032 | 405 |
| 410 | iso_pu_bacteria | 2791355259 | 2793312710 | 405 |
| 411 | iso_pu_bacteria | 2791355260 | 2793321764 | 405 |
| 412 | iso_pu_bacteria | 2791355261 | 2793326728 | 405 |
| 413 | iso_pu_bacteria | 2791355262 | 2793336415 | 405 |
| 414 | iso_pu_bacteria | 2791355263 | 2793340509 | 405 |
| 415 | iso_pu_bacteria | 2791355264 | 2793348455 | 405 |
| 416 | iso_pu_bacteria | 2791355265 | 2793354090 | 405 |
| 417 | iso_pu_bacteria | 2791355266 | 2793363164 | 405 |
| 418 | iso_pu_bacteria | 2791355267 | 2793367425 | 405 |
| 419 | iso_pu_bacteria | 2802429268 | 2804753403 | 405 |
| 420 | iso_pu_bacteria | 2802429605 | 2805931340 | 405 |
| 421 | iso_pu_bacteria | 2802429633 | 2806043201 | 405 |
| 422 | iso_pu_bacteria | 2802429634 | 2806051156 | 405 |
| 423 | iso_pu_bacteria | 2802429635 | 2806057672 | 405 |
| 424 | iso_pu_bacteria | 2802429636 | 2806065610 | 405 |
| 425 | iso_pu_bacteria | 2802429637 | 2806075160 | 405 |
| 426 | iso_pu_bacteria | 2808606418 | 2809143519 | 405 |
| 427 | iso_pu_bacteria | 2816332527 | 2818237957 | 405 |
| 428 | iso_pu_bacteria | 2818991467 | 2819720368 | 405 |
| 429 | iso_pu_bacteria | 2821123053 | 2821126683 | 405 |
| 430 | iso_pu_bacteria | 2824600985 | 2824601823 | 405 |
| 431 | iso_pu_bacteria | 2824609381 | 2824612863 | 405 |
| 432 | iso_pu_bacteria | 2824653114 | 2824653285 | 405 |
| 433 | iso_pu_bacteria | 2835312727 | 2835317757 | 405 |
| 434 | iso_pu_bacteria | 2837651117 | 2837653497 | 405 |
| 435 | iso_pu_bacteria | 2838016132 | 2838019777 | 405 |
| 436 | iso_pu_bacteria | 2838022645 | 2838025926 | 405 |
| 437 | iso_pu_bacteria | 2838035591 | 2838039186 | 405 |
| 438 | iso_pu_bacteria | 2838061910 | 2838067098 | 405 |
| 439 | iso_pu_bacteria | 2838068647 | 2838072631 | 405 |
| 440 | iso_pu_bacteria | 2838074704 | 2838077528 | 405 |
| 441 | iso_pu_bacteria | 2838661181 | 2838667720 | 405 |
| 442 | iso_pu_bacteria | 2838668709 | 2838669203 | 405 |
| 443 | iso_pu_bacteria | 2838680041 | 2838686336 | 405 |
| 444 | iso_pu_bacteria | 2838686498 | 2838688353 | 405 |
| 445 | iso_pu_bacteria | 2838694306 | 2838700754 | 405 |
| 446 | iso_pu_bacteria | 2838701080 | 2838701136 | 405 |
| 447 | iso_pu_bacteria | 2838707686 | 2838714087 | 405 |
| 448 | iso_pu_bacteria | 2838729681 | 2838734512 | 405 |
| 449 | iso_pu_bacteria | 2838736955 | 2838740290 | 405 |
| 450 | iso_pu_bacteria | 2838742623 | 2838746971 | 405 |
| 451 | iso_pu_bacteria | 2840878972 | 2840880508 | 405 |
| 452 | iso_pu_bacteria | 2841734538 | 2841736581 | 405 |
| 453 | iso_pu_bacteria | 2841760612 | 2841765315 | 405 |
| 454 | iso_pu_bacteria | 2841840854 | 2841843585 | 405 |
| 455 | iso_pu_bacteria | 2841851746 | 2841852094 | 405 |
| 456 | iso_pu_bacteria | 2841864319 | 2841865814 | 405 |
| 457 | iso_pu_bacteria | 2842077413 | 2842083443 | 405 |
| 458 | iso_pu_bacteria | 2842110456 | 2842111832 | 405 |
| 459 | iso_pu_bacteria | 2842118031 | 2842124404 | 405 |
| 460 | iso_pu_bacteria | 2842140634 | 2842143305 | 405 |
| 461 | iso_pu_bacteria | 2842146304 | 2842146799 | 405 |
| 462 | iso_pu_bacteria | 2842156927 | 2842158831 | 405 |
| 463 | iso_pu_bacteria | 2842163707 | 2842166261 | 405 |
| 464 | iso_pu_bacteria | 2842180545 | 2842182445 | 405 |
| 465 | iso_pu_bacteria | 2842192696 | 2842193818 | 405 |
| 466 | iso_pu_bacteria | 2842198810 | 2842200506 | 405 |
| 467 | iso_pu_bacteria | 2842205361 | 2842208685 | 405 |
| 468 | iso_pu_bacteria | 2842217011 | 2842222409 | 405 |
| 469 | iso_pu_bacteria | 2842229732 | 2842234542 | 405 |
| 470 | iso_pu_bacteria | 2842237096 | 2842243500 | 405 |
| 471 | iso_pu_bacteria | 2842243621 | 2842248275 | 405 |
| 472 | iso_pu_bacteria | 2842250916 | 2842250971 | 405 |
| 473 | iso_pu_bacteria | 2842257432 | 2842262552 | 405 |
| 474 | iso_pu_bacteria | 2842271015 | 2842272697 | 405 |
| 475 | iso_pu_bacteria | 2842278818 | 2842281970 | 405 |
| 476 | iso_pu_bacteria | 2842285085 | 2842289286 | 405 |
| 477 | iso_pu_bacteria | 2842291075 | 2842297623 | 405 |
| 478 | iso_pu_bacteria | 2842298080 | 2842303124 | 405 |
| 479 | iso_pu_bacteria | 2842304105 | 2842307861 | 405 |
| 480 | iso_pu_bacteria | 2842311132 | 2842313339 | 405 |
| 481 | iso_pu_bacteria | 2842317721 | 2842323095 | 405 |
| 482 | iso_pu_bacteria | 2842341865 | 2842347826 | 405 |
| 483 | iso_pu_bacteria | 2842357229 | 2842361414 | 405 |
| 484 | iso_pu_bacteria | 2842363717 | 2842364058 | 405 |
| 485 | iso_pu_bacteria | 2842370503 | 2842376895 | 405 |
| 486 | iso_pu_bacteria | 2842377471 | 2842384076 | 405 |
| 487 | iso_pu_bacteria | 2842384541 | 2842391176 | 405 |
| 488 | iso_pu_bacteria | 2842402390 | 2842407492 | 405 |
| 489 | iso_pu_bacteria | 2842409023 | 2842413259 | 405 |
| 490 | iso_pu_bacteria | 2842415677 | 2842419902 | 405 |
| 491 | iso_pu_bacteria | 2842422224 | 2842426271 | 405 |
| 492 | iso_pu_bacteria | 2842428310 | 2842430055 | 405 |
| 493 | iso_pu_bacteria | 2842441272 | 2842442704 | 405 |
| 494 | iso_pu_bacteria | 2842447887 | 2842453501 | 405 |
| 495 | iso_pu_bacteria | 2842462802 | 2842464580 | 405 |
| 496 | iso_pu_bacteria | 2842469257 | 2842471052 | 405 |
| 497 | iso_pu_bacteria | 2842482326 | 2842485539 | 405 |
| 498 | iso_pu_bacteria | 2842489311 | 2842490573 | 405 |
| 499 | iso_pu_bacteria | 2842495871 | 2842499024 | 405 |
| 500 | iso_pu_bacteria | 2842509118 | 2842513583 | 405 |
| 501 | iso_pu_bacteria | 2842521101 | 2842524910 | 405 |
| 502 | iso_pu_bacteria | 2844002411 | 2844003245 | 405 |
| 503 | iso_pu_bacteria | 2844009547 | 2844010995 | 405 |
| 504 | iso_pu_bacteria | 2844104063 | 2844106925 | 405 |
| 505 | iso_pu_bacteria | 2844163670 | 2844167628 | 405 |
| 506 | iso_pu_bacteria | 2844454524 | 2844461595 | 405 |
| 507 | iso_pu_bacteria | 2847417321 | 2847420539 | 405 |
| 508 | iso_pu_bacteria | 2847670302 | 2847673609 | 405 |
| 509 | iso_pu_bacteria | 2847686936 | 2847690122 | 405 |
| 510 | iso_pu_bacteria | 2847930680 | 2847936831 | 405 |
| 511 | iso_pu_bacteria | 2848992105 | 2848995412 | 405 |
| 512 | iso_pu_bacteria | 2850079185 | 2850082397 | 405 |
| 513 | iso_pu_bacteria | 2851182111 | 2851185912 | 405 |
| 514 | iso_pu_bacteria | 2851246043 | 2851248965 | 405 |
| 515 | iso_pu_bacteria | 2852387548 | 2852393787 | 405 |
| 516 | iso_pu_bacteria | 2854911287 | 2854916659 | 405 |
| 517 | iso_pu_bacteria | 2855825444 | 2855827120 | 405 |
| 518 | iso_pu_bacteria | 2855839649 | 2855842517 | 405 |
| 519 | iso_pu_bacteria | 2855872281 | 2855878333 | 405 |
| 520 | iso_pu_bacteria | 2856314179 | 2856318922 | 405 |
| 521 | iso_pu_bacteria | 2856320880 | 2856325311 | 405 |
| 522 | iso_pu_bacteria | 2856328259 | 2856329473 | 405 |
| 523 | iso_pu_bacteria | 2856334872 | 2856339766 | 405 |
| 524 | iso_pu_bacteria | 2856342000 | 2856348130 | 405 |
| 525 | iso_pu_bacteria | 2856349417 | 2856354527 | 405 |
| 526 | iso_pu_bacteria | 2856364286 | 2856367355 | 405 |
| 527 | iso_pu_bacteria | 2857349434 | 2857353132 | 405 |
| 528 | iso_pu_bacteria | 2857367948 | 2857374286 | 405 |
| 529 | iso_pu_bacteria | 2857516855 | 2857520555 | 405 |
| 530 | iso_pu_bacteria | 2857531043 | 2857535531 | 405 |
| 531 | iso_pu_bacteria | 2858800743 | 2858803333 | 405 |
| 532 | iso_pu_bacteria | 2869162929 | 2869168664 | 405 |
| 533 | iso_pu_bacteria | 2869169390 | 2869171417 | 405 |
| 534 | iso_pu_bacteria | 2869234852 | 2869240175 | 405 |
| 535 | iso_pu_bacteria | 2869242130 | 2869244960 | 405 |
| 536 | iso_pu_bacteria | 2869249662 | 2869250967 | 405 |
| 537 | iso_pu_bacteria | 2869256925 | 2869258138 | 405 |
| 538 | iso_pu_bacteria | 2869264136 | 2869265772 | 405 |
| 539 | iso_pu_bacteria | 2869271264 | 2869275285 | 405 |
| 540 | iso_pu_bacteria | 2869278585 | 2869283146 | 405 |
| 541 | iso_pu_bacteria | 2869285874 | 2869288496 | 405 |
| 542 | iso_pu_bacteria | 2871429161 | 2871431163 | 405 |
| 543 | iso_pu_bacteria | 2871435913 | 2871436371 | 405 |
| 544 | iso_pu_bacteria | 2871444079 | 2871447502 | 405 |
| 545 | iso_pu_bacteria | 2871451962 | 2871453816 | 405 |
| 546 | iso_pu_bacteria | 2871459585 | 2871460821 | 405 |
| 547 | iso_pu_bacteria | 2871466892 | 2871473501 | 405 |
| 548 | iso_pu_bacteria | 2871474448 | 2871478567 | 405 |
| 549 | iso_pu_bacteria | 2871488783 | 2871491602 | 405 |
| 550 | iso_pu_bacteria | 2871495908 | 2871498849 | 405 |
| 551 | iso_pu_bacteria | 2874109183 | 2874114202 | 405 |
| 552 | iso_pu_bacteria | 2874116593 | 2874120724 | 405 |
| 553 | iso_pu_bacteria | 2874123672 | 2874126325 | 405 |
| 554 | iso_pu_bacteria | 2874131515 | 2874132353 | 405 |
| 555 | iso_pu_bacteria | 2874139085 | 2874142730 | 405 |
| 556 | iso_pu_bacteria | 2874146452 | 2874150537 | 405 |
| 557 | iso_pu_bacteria | 2874155637 | 2874158278 | 405 |
| 558 | iso_pu_bacteria | 2874162495 | 2874163705 | 405 |
| 559 | iso_pu_bacteria | 2874168670 | 2874170564 | 405 |
| 560 | iso_pu_bacteria | 2876363079 | 2876364054 | 405 |
| 561 | iso_pu_bacteria | 2876377896 | 2876380873 | 405 |
| 562 | iso_pu_bacteria | 2876386047 | 2876387548 | 405 |
| 563 | iso_pu_bacteria | 2876392853 | 2876399091 | 405 |
| 564 | iso_pu_bacteria | 2876399893 | 2876401082 | 405 |
| 565 | iso_pu_bacteria | 2876406927 | 2876407363 | 405 |
| 566 | iso_pu_bacteria | 2876413966 | 2876416586 | 405 |
| 567 | iso_pu_bacteria | 2876420981 | 2876425385 | 405 |
| 568 | iso_pu_bacteria | 2878035449 | 2878039266 | 405 |
| 569 | iso_pu_bacteria | 2878730984 | 2878735254 | 405 |
| 570 | iso_pu_bacteria | 2878738818 | 2878739723 | 405 |
| 571 | iso_pu_bacteria | 2878745973 | 2878747767 | 405 |
| 572 | iso_pu_bacteria | 2878753008 | 2878754782 | 405 |
| 573 | iso_pu_bacteria | 2878760144 | 2878763067 | 405 |
| 574 | iso_pu_bacteria | 2878767105 | 2878770037 | 405 |
| 575 | iso_pu_bacteria | 2878774303 | 2878779547 | 405 |
| 576 | iso_pu_bacteria | 2878781027 | 2878782039 | 405 |
| 577 | iso_pu_bacteria | 2878788777 | 2878795479 | 405 |
| 578 | iso_pu_bacteria | 2879083081 | 2879087687 | 405 |
| 579 | iso_pu_bacteria | 2881147464 | 2881148403 | 405 |
| 580 | iso_pu_bacteria | 2881155292 | 2881159471 | 405 |
| 581 | iso_pu_bacteria | 2881845957 | 2881846517 | 405 |
| 582 | iso_pu_bacteria | 2881853255 | 2881859742 | 405 |
| 583 | iso_pu_bacteria | 2881861095 | 2881862049 | 405 |
| 584 | iso_pu_bacteria | 2882456835 | 2882460289 | 405 |
| 585 | iso_pu_bacteria | 2882632389 | 2882635206 | 405 |
| 586 | iso_pu_bacteria | 2882912400 | 2882914177 | 405 |
| 587 | iso_pu_bacteria | 2884298095 | 2884301242 | 405 |
| 588 | iso_pu_bacteria | 2885305155 | 2885307063 | 405 |
| 589 | iso_pu_bacteria | 2885312484 | 2885313937 | 405 |
| 590 | iso_pu_bacteria | 2885318864 | 2885325718 | 405 |
| 591 | iso_pu_bacteria | 2885326080 | 2885328740 | 405 |
| 592 | iso_pu_bacteria | 2885334103 | 2885339026 | 405 |
| 593 | iso_pu_bacteria | 2885342637 | 2885343732 | 405 |
| 594 | iso_pu_bacteria | 2885350715 | 2885352283 | 405 |
| 595 | iso_pu_bacteria | 2887375801 | 2887379317 | 405 |
| 596 | iso_pu_bacteria | 2888337043 | 2888343576 | 405 |
| 597 | iso_pu_bacteria | 2888343758 | 2888344555 | 405 |
| 598 | iso_pu_bacteria | 2888350351 | 2888353406 | 405 |
| 599 | iso_pu_bacteria | 2888378607 | 2888381725 | 405 |
| 600 | iso_pu_bacteria | 2888419890 | 2888422424 | 405 |
| 601 | iso_pu_bacteria | 2889010040 | 2889015120 | 405 |
| 602 | iso_pu_bacteria | 2889016732 | 2889019800 | 405 |
| 603 | iso_pu_bacteria | 2889306138 | 2889309820 | 405 |
| 604 | iso_pu_bacteria | 2894232714 | 2894233520 | 405 |
| 605 | iso_pu_bacteria | 2896384573 | 2896387627 | 405 |
| 606 | iso_pu_bacteria | 2899803654 | 2899807023 | 405 |
| 607 | iso_pu_bacteria | 2903448605 | 2903453846 | 405 |
| 608 | iso_pu_bacteria | 2903492973 | 2903500315 | 405 |
| 609 | iso_pu_bacteria | 2903492973 | 2903502248 | 405 |
| 610 | iso_pu_bacteria | 2903513507 | 2903518606 | 405 |
| 611 | iso_pu_bacteria | 2903521522 | 2903525786 | 405 |
| 612 | iso_pu_bacteria | 2903528002 | 2903532667 | 405 |
| 613 | iso_pu_bacteria | 2903540706 | 2903543651 | 405 |
| 614 | iso_pu_bacteria | 2904564687 | 2904566238 | 405 |
| 615 | iso_pu_bacteria | 2904571731 | 2904573282 | 405 |
| 616 | iso_pu_bacteria | 2904659560 | 2904665618 | 405 |
| 617 | iso_pu_bacteria | 2906308376 | 2906310940 | 405 |
| 618 | iso_pu_bacteria | 2906321335 | 2906323051 | 405 |
| 619 | iso_pu_bacteria | 2906328253 | 2906334019 | 405 |
| 620 | iso_pu_bacteria | 2906354277 | 2906360036 | 405 |
| 621 | iso_pu_bacteria | 2906363423 | 2906367837 | 405 |
| 622 | iso_pu_bacteria | 2906370794 | 2906373654 | 405 |
| 623 | iso_pu_bacteria | 2906378014 | 2906379162 | 405 |
| 624 | iso_pu_bacteria | 2906386501 | 2906386849 | 405 |
| 625 | iso_pu_bacteria | 2906393657 | 2906395773 | 405 |
| 626 | iso_pu_bacteria | 2906401398 | 2906402990 | 405 |
| 627 | iso_pu_bacteria | 2906408224 | 2906408957 | 405 |
| 628 | iso_pu_bacteria | 2906414383 | 2906418993 | 405 |
| 629 | iso_pu_bacteria | 2906427513 | 2906431500 | 405 |
| 630 | iso_pu_bacteria | 2906643746 | 2906647027 | 405 |
| 631 | iso_pu_bacteria | 2913295892 | 2913299920 | 405 |
| 632 | iso_pu_bacteria | 2915650412 | 2915652469 | 405 |
| 633 | iso_pu_bacteria | 2915980308 | 2915980653 | 405 |
| 634 | iso_pu_bacteria | 2915986958 | 2915991050 | 405 |
| 635 | iso_pu_bacteria | 2915993759 | 2915997706 | 405 |
| 636 | iso_pu_bacteria | 2916000859 | 2916006925 | 405 |
| 637 | iso_pu_bacteria | 2916007675 | 2916009459 | 405 |
| 638 | iso_pu_bacteria | 2916014648 | 2916019507 | 405 |
| 639 | iso_pu_bacteria | 2916021584 | 2916023313 | 405 |
| 640 | iso_pu_bacteria | 2916028427 | 2916030296 | 405 |
| 641 | iso_pu_bacteria | 2916035215 | 2916036853 | 405 |
| 642 | iso_pu_bacteria | 2916041962 | 2916044710 | 405 |
| 643 | iso_pu_bacteria | 2916048683 | 2916053911 | 405 |
| 644 | iso_pu_bacteria | 2916055098 | 2916058422 | 405 |
| 645 | iso_pu_bacteria | 2916061851 | 2916065613 | 405 |
| 646 | iso_pu_bacteria | 2916068649 | 2916073785 | 405 |
| 647 | iso_pu_bacteria | 2916076590 | 2916077927 | 405 |
| 648 | iso_pu_bacteria | 2917699015 | 2917702285 | 405 |
| 649 | iso_pu_bacteria | 2917832318 | 2917835460 | 405 |
| 650 | iso_pu_bacteria | 2919100787 | 2919103208 | 405 |
| 651 | iso_pu_bacteria | 2919125081 | 2919129208 | 405 |
| 652 | iso_pu_bacteria | 2919171160 | 2919173219 | 405 |
| 653 | iso_pu_bacteria | 2920760137 | 2920760662 | 405 |
| 654 | iso_pu_bacteria | 2920822456 | 2920828389 | 405 |
| 655 | iso_pu_bacteria | 2921201388 | 2921201426 | 405 |
| 656 | iso_pu_bacteria | 2921208531 | 2921209583 | 405 |
| 657 | iso_pu_bacteria | 2921237296 | 2921237509 | 405 |
| 658 | iso_pu_bacteria | 2921244191 | 2921244308 | 405 |
| 659 | iso_pu_bacteria | 2921250672 | 2921252592 | 405 |
| 660 | iso_pu_bacteria | 2921257292 | 2921260652 | 405 |
| 661 | iso_pu_bacteria | 2921263974 | 2921265911 | 405 |
| 662 | iso_pu_bacteria | 2921282425 | 2921286318 | 405 |
| 663 | iso_pu_bacteria | 2921289301 | 2921293339 | 405 |
| 664 | iso_pu_bacteria | 2921296804 | 2921298231 | 405 |
| 665 | iso_pu_bacteria | 2922130491 | 2922136486 | 405 |
| 666 | iso_pu_bacteria | 2922151315 | 2922153542 | 405 |
| 667 | iso_pu_bacteria | 2922172374 | 2922173229 | 405 |
| 668 | iso_pu_bacteria | 2922178524 | 2922183405 | 405 |
| 669 | iso_pu_bacteria | 2922185730 | 2922193161 | 405 |
| 670 | iso_pu_bacteria | 2923556063 | 2923560381 | 405 |
| 671 | iso_pu_bacteria | 2924144063 | 2924148729 | 405 |
| 672 | iso_pu_bacteria | 2924150972 | 2924154948 | 405 |
| 673 | iso_pu_bacteria | 2924158325 | 2924164164 | 405 |
| 674 | iso_pu_bacteria | 2924165586 | 2924166579 | 405 |
| 675 | iso_pu_bacteria | 2924172951 | 2924174368 | 405 |
| 676 | iso_pu_bacteria | 2924179722 | 2924182297 | 405 |
| 677 | iso_pu_bacteria | 2924186466 | 2924188519 | 405 |
| 678 | iso_pu_bacteria | 2924193448 | 2924193864 | 405 |
| 679 | iso_pu_bacteria | 2924200457 | 2924206609 | 405 |
| 680 | iso_pu_bacteria | 2924207177 | 2924213041 | 405 |
| 681 | iso_pu_bacteria | 2924214083 | 2924221290 | 405 |
| 682 | iso_pu_bacteria | 2924221636 | 2924226812 | 405 |
| 683 | iso_pu_bacteria | 2924228884 | 2924231991 | 405 |
| 684 | iso_pu_bacteria | 2924718760 | 2924725658 | 405 |
| 685 | iso_pu_bacteria | 2924726620 | 2924728174 | 405 |
| 686 | iso_pu_bacteria | 2924733363 | 2924740856 | 405 |
| 687 | iso_pu_bacteria | 2924741084 | 2924746619 | 405 |
| 688 | iso_pu_bacteria | 2924748358 | 2924754037 | 405 |
| 689 | iso_pu_bacteria | 2924754689 | 2924760436 | 405 |
| 690 | iso_pu_bacteria | 2924762789 | 2924767525 | 405 |
| 691 | iso_pu_bacteria | 2924776078 | 2924777252 | 405 |
| 692 | iso_pu_bacteria | 2924784321 | 2924791002 | 405 |
| 693 | iso_pu_bacteria | 2928536128 | 2928538140 | 405 |
| 694 | iso_pu_bacteria | 2933016740 | 2933023562 | 405 |
| 695 | iso_pu_bacteria | 2933570622 | 2933574312 | 405 |
| 696 | iso_pu_bacteria | 2933586486 | 2933591038 | 405 |
| 697 | iso_pu_bacteria | 2935894831 | 2935901084 | 405 |
| 698 | iso_pu_bacteria | 2935901341 | 2935907943 | 405 |
| 699 | iso_pu_bacteria | 2936367885 | 2936370742 | 405 |
| 700 | iso_pu_bacteria | 2936381700 | 2936382723 | 405 |
| 701 | iso_pu_bacteria | 2937002841 | 2937006899 | 405 |
| 702 | iso_pu_bacteria | 2937009748 | 2937015369 | 405 |
| 703 | iso_pu_bacteria | 2937016420 | 2937018088 | 405 |
| 704 | iso_pu_bacteria | 2937023124 | 2937024292 | 405 |
| 705 | iso_pu_bacteria | 2937042894 | 2937046639 | 405 |
| 706 | iso_pu_bacteria | 2937049772 | 2937052255 | 405 |
| 707 | iso_pu_bacteria | 2937056579 | 2937063064 | 405 |
| 708 | iso_pu_bacteria | 2937063883 | 2937067498 | 405 |
| 709 | iso_pu_bacteria | 2937071275 | 2937071313 | 405 |
| 710 | iso_pu_bacteria | 2937091812 | 2937092980 | 405 |
| 711 | iso_pu_bacteria | 2937098957 | 2937104802 | 405 |
| 712 | iso_pu_bacteria | 2937106411 | 2937110552 | 405 |
| 713 | iso_pu_bacteria | 2937113482 | 2937114486 | 405 |
| 714 | iso_pu_bacteria | 2937119839 | 2937123786 | 405 |
| 715 | iso_pu_bacteria | 2937126314 | 2937129236 | 405 |
| 716 | iso_pu_bacteria | 2937813078 | 2937815543 | 405 |
| 717 | iso_pu_bacteria | 2937822353 | 2937823433 | 405 |
| 718 | iso_pu_bacteria | 2937836603 | 2937838836 | 405 |
| 719 | iso_pu_bacteria | 2937843397 | 2937848448 | 405 |
| 720 | iso_pu_bacteria | 2937848649 | 2937849937 | 405 |
| 721 | iso_pu_bacteria | 2937868953 | 2937869444 | 405 |
| 722 | iso_pu_bacteria | 2937877337 | 2937880408 | 405 |
| 723 | iso_pu_bacteria | 2937891427 | 2937898366 | 405 |
| 724 | iso_pu_bacteria | 2937972304 | 2937976877 | 405 |
| 725 | iso_pu_bacteria | 2937980651 | 2937987891 | 405 |
| 726 | iso_pu_bacteria | 2937994558 | 2937997497 | 405 |
| 727 | iso_pu_bacteria | 2938014810 | 2938018856 | 405 |
| 728 | iso_pu_bacteria | 2941499720 | 2941501596 | 405 |
| 729 | iso_pu_bacteria | 2957382221 | 2957385997 | 405 |
| 730 | iso_pu_bacteria | 2957388812 | 2957390081 | 405 |
| 731 | iso_pu_bacteria | 2957395598 | 2957396855 | 405 |
| 732 | iso_pu_bacteria | 2957402308 | 2957406178 | 405 |
| 733 | iso_pu_bacteria | 2957408893 | 2957408931 | 405 |
| 734 | iso_pu_bacteria | 2957415311 | 2957421972 | 405 |
| 735 | iso_pu_bacteria | 2957422303 | 2957426900 | 405 |
| 736 | iso_pu_bacteria | 2957430029 | 2957430619 | 405 |
| 737 | iso_pu_bacteria | 2957450854 | 2957454457 | 405 |
| 738 | iso_pu_bacteria | 2957457609 | 2957459442 | 405 |
| 739 | iso_pu_bacteria | 2957464669 | 2957468283 | 405 |
| 740 | iso_pu_bacteria | 2957471148 | 2957472007 | 405 |
| 741 | iso_pu_bacteria | 2957478035 | 2957480932 | 405 |
| 742 | iso_pu_bacteria | 2957484790 | 2957485585 | 405 |
| 743 | iso_pu_bacteria | 2957491536 | 2957495185 | 405 |
| 744 | iso_pu_bacteria | 2957498199 | 2957500314 | 405 |
| 745 | iso_pu_bacteria | 2957505466 | 2957506968 | 405 |
| 746 | iso_pu_bacteria | 2958034702 | 2958035298 | 405 |
| 747 | iso_pu_bacteria | 2958041894 | 2958052497 | 405 |
| 748 | iso_pu_bacteria | 2958064165 | 2958070960 | 405 |
| 749 | iso_pu_bacteria | 2958071322 | 2958072359 | 405 |
| 750 | iso_pu_bacteria | 2958084443 | 2958087543 | 405 |
| 751 | iso_pu_bacteria | 2958092219 | 2958098973 | 405 |
| 752 | iso_pu_bacteria | 2958100919 | 2958104415 | 405 |
| 753 | iso_pu_bacteria | 2958115193 | 2958120293 | 405 |
| 754 | iso_pu_bacteria | 2958122699 | 2958126790 | 405 |
| 755 | iso_pu_bacteria | 2958130278 | 2958132898 | 405 |
| 756 | iso_pu_bacteria | 2958137437 | 2958139060 | 405 |
| 757 | iso_pu_bacteria | 2958158011 | 2958161297 | 405 |
| 758 | iso_pu_bacteria | 2958165035 | 2958167971 | 405 |
| 759 | iso_pu_bacteria | 2958179912 | 2958182600 | 405 |
| 760 | iso_pu_bacteria | 2960584000 | 2960587530 | 405 |
| 761 | iso_pu_bacteria | 2960597568 | 2960598690 | 405 |
| 762 | iso_pu_bacteria | 2960603979 | 2960605059 | 405 |
| 763 | iso_pu_bacteria | 2960610863 | 2960617337 | 405 |
| 764 | iso_pu_bacteria | 2960624210 | 2960629612 | 405 |
| 765 | iso_pu_bacteria | 2960637947 | 2960638789 | 405 |
| 766 | iso_pu_bacteria | 2960645483 | 2960646660 | 405 |
| 767 | iso_pu_bacteria | 2960652885 | 2960659722 | 405 |
| 768 | iso_pu_bacteria | 2960667422 | 2960671410 | 405 |
| 769 | iso_pu_bacteria | 2960674078 | 2960675398 | 405 |
| 770 | iso_pu_bacteria | 2960687367 | 2960687846 | 405 |
| 771 | iso_pu_bacteria | 2961077736 | 2961080448 | 405 |
| 772 | iso_pu_bacteria | 2961114664 | 2961120961 | 405 |
| 773 | iso_pu_bacteria | 2961127735 | 2961133423 | 405 |
| 774 | iso_pu_bacteria | 2961136820 | 2961138872 | 405 |
| 775 | iso_pu_bacteria | 2961163497 | 2961166439 | 405 |
| 776 | iso_pu_bacteria | 2961170736 | 2961171973 | 405 |
| 777 | iso_pu_bacteria | 2961183825 | 2961185634 | 405 |
| 778 | iso_pu_bacteria | 2963644680 | 2963645512 | 405 |
| 779 | iso_pu_bacteria | 2964607997 | 2964612357 | 405 |
| 780 | iso_pu_bacteria | 2964615318 | 2964618547 | 405 |
| 781 | iso_pu_bacteria | 2964621998 | 2964624865 | 405 |
| 782 | iso_pu_bacteria | 2964628898 | 2964631398 | 405 |
| 783 | iso_pu_bacteria | 2964636051 | 2964640526 | 405 |
| 784 | iso_pu_bacteria | 2964643177 | 2964647155 | 405 |
| 785 | iso_pu_bacteria | 2964649959 | 2964650948 | 405 |
| 786 | iso_pu_bacteria | 2964656573 | 2964659060 | 405 |
| 787 | iso_pu_bacteria | 2964663802 | 2964668771 | 405 |
| 788 | iso_pu_bacteria | 2964670856 | 2964675103 | 405 |
| 789 | iso_pu_bacteria | 2964678106 | 2964681705 | 405 |
| 790 | iso_pu_bacteria | 2964685014 | 2964689434 | 405 |
| 791 | iso_pu_bacteria | 2964691889 | 2964692657 | 405 |
| 792 | iso_pu_bacteria | 2964698721 | 2964705106 | 405 |
| 793 | iso_pu_bacteria | 2964705432 | 2964706280 | 405 |
| 794 | iso_pu_bacteria | 2964712639 | 2964719029 | 405 |
| 795 | iso_pu_bacteria | 2964719344 | 2964724308 | 405 |
| 796 | iso_pu_bacteria | 2965018300 | 2965021258 | 405 |
| 797 | iso_pu_bacteria | 2965025482 | 2965026773 | 405 |
| 798 | iso_pu_bacteria | 2965032056 | 2965039469 | 405 |
| 799 | iso_pu_bacteria | 2965040258 | 2965047373 | 405 |
| 800 | iso_pu_bacteria | 2965047637 | 2965052632 | 405 |
| 801 | iso_pu_bacteria | 2965062239 | 2965064341 | 405 |
| 802 | iso_pu_bacteria | 2965089291 | 2965096243 | 405 |
| 803 | iso_pu_bacteria | 2965110997 | 2965115366 | 405 |
| 804 | iso_pu_bacteria | 2965119406 | 2965123604 | 405 |
| 805 | iso_pu_bacteria | 2967664464 | 2967667693 | 405 |
| 806 | iso_pu_bacteria | 2967671571 | 2967673170 | 405 |
| 807 | iso_pu_bacteria | 2967678726 | 2967682969 | 405 |
| 808 | iso_pu_bacteria | 2967693043 | 2967696073 | 405 |
| 809 | iso_pu_bacteria | 2967699805 | 2967699949 | 405 |
| 810 | iso_pu_bacteria | 2967706974 | 2967708256 | 405 |
| 811 | iso_pu_bacteria | 2967714385 | 2967715867 | 405 |
| 812 | iso_pu_bacteria | 2967721400 | 2967726492 | 405 |
| 813 | iso_pu_bacteria | 2967735183 | 2967735474 | 405 |
| 814 | iso_pu_bacteria | 2967742019 | 2967743447 | 405 |
| 815 | iso_pu_bacteria | 2967748971 | 2967750180 | 405 |
| 816 | iso_pu_bacteria | 2967762386 | 2967769110 | 405 |
| 817 | iso_pu_bacteria | 2967769361 | 2967774501 | 405 |
| 818 | iso_pu_bacteria | 2967775926 | 2967777486 | 405 |
| 819 | iso_pu_bacteria | 2967996073 | 2967997453 | 405 |
| 820 | iso_pu_bacteria | 2968003550 | 2968006455 | 405 |
| 821 | iso_pu_bacteria | 2968016561 | 2968017430 | 405 |
| 822 | iso_pu_bacteria | 2968083720 | 2968085156 | 405 |
| 823 | iso_pu_bacteria | 2968091066 | 2968093404 | 405 |
| 824 | iso_pu_bacteria | 2968097103 | 2968098166 | 405 |
| 825 | iso_pu_bacteria | 2968110612 | 2968117111 | 405 |
| 826 | iso_pu_bacteria | 2968117919 | 2968122462 | 405 |
| 827 | iso_pu_bacteria | 2968128360 | 2968129528 | 405 |
| 828 | iso_pu_bacteria | 2968138860 | 2968144609 | 405 |
| 829 | iso_pu_bacteria | 2968171901 | 2968174840 | 405 |
| 830 | iso_pu_bacteria | 2970019648 | 2970025021 | 405 |
| 831 | iso_pu_bacteria | 2970033650 | 2970040703 | 405 |
| 832 | iso_pu_bacteria | 2970040964 | 2970041812 | 405 |
| 833 | iso_pu_bacteria | 2970047711 | 2970049510 | 405 |
| 834 | iso_pu_bacteria | 2970054988 | 2970061006 | 405 |
| 835 | iso_pu_bacteria | 2970061556 | 2970068097 | 405 |
| 836 | iso_pu_bacteria | 2970068827 | 2970069395 | 405 |
| 837 | iso_pu_bacteria | 2970076120 | 2970082619 | 405 |
| 838 | iso_pu_bacteria | 2970082768 | 2970084203 | 405 |
| 839 | iso_pu_bacteria | 2970088815 | 2970095451 | 405 |
| 840 | iso_pu_bacteria | 2970095765 | 2970099033 | 405 |
| 841 | iso_pu_bacteria | 2970102677 | 2970108779 | 405 |
| 842 | iso_pu_bacteria | 2970109326 | 2970115206 | 405 |
| 843 | iso_pu_bacteria | 2970116247 | 2970119268 | 405 |
| 844 | iso_pu_bacteria | 2970129317 | 2970134248 | 405 |
| 845 | iso_pu_bacteria | 2970136068 | 2970137425 | 405 |
| 846 | iso_pu_bacteria | 2970149975 | 2970155697 | 405 |
| 847 | iso_pu_bacteria | 2970156795 | 2970158285 | 405 |
| 848 | iso_pu_bacteria | 2970164137 | 2970165942 | 405 |
| 849 | iso_pu_bacteria | 2970170962 | 2970173296 | 405 |
| 850 | iso_pu_bacteria | 2970177841 | 2970179789 | 405 |
| 851 | iso_pu_bacteria | 2970184632 | 2970186475 | 405 |
| 852 | iso_pu_bacteria | 2970191845 | 2970194458 | 405 |
| 853 | iso_pu_bacteria | 2970469710 | 2970472476 | 405 |
| 854 | iso_pu_bacteria | 2970489779 | 2970493603 | 405 |
| 855 | iso_pu_bacteria | 2970503327 | 2970504570 | 405 |
| 856 | iso_pu_bacteria | 2970510686 | 2970512234 | 405 |
| 857 | iso_pu_bacteria | 2970524798 | 2970526276 | 405 |
| 858 | iso_pu_bacteria | 2970547951 | 2970550868 | 405 |
| 859 | iso_pu_bacteria | 2970554993 | 2970557922 | 405 |
| 860 | iso_pu_bacteria | 2970593180 | 2970597766 | 405 |
| 861 | iso_pu_bacteria | 2970619444 | 2970620723 | 405 |
| 862 | iso_pu_bacteria | 2970627176 | 2970628822 | 405 |
| 863 | iso_pu_bacteria | 2974298342 | 2974299654 | 405 |
| 864 | iso_pu_bacteria | 2977516862 | 2977520733 | 405 |
| 865 | iso_pu_bacteria | 2977523885 | 2977530135 | 405 |
| 866 | iso_pu_bacteria | 2977537788 | 2977540918 | 405 |
| 867 | iso_pu_bacteria | 2977551784 | 2977556798 | 405 |
| 868 | iso_pu_bacteria | 2977558990 | 2977565547 | 405 |
| 869 | iso_pu_bacteria | 2977565890 | 2977569060 | 405 |
| 870 | iso_pu_bacteria | 2977572785 | 2977578061 | 405 |
| 871 | iso_pu_bacteria | 2977579622 | 2977579661 | 405 |
| 872 | iso_pu_bacteria | 2977821940 | 2977823999 | 405 |
| 873 | iso_pu_bacteria | 2977828996 | 2977835292 | 405 |
| 874 | iso_pu_bacteria | 2977843712 | 2977846692 | 405 |
| 875 | iso_pu_bacteria | 2977851361 | 2977853271 | 405 |
| 876 | iso_pu_bacteria | 2977858184 | 2977858925 | 405 |
| 877 | iso_pu_bacteria | 2977864932 | 2977865703 | 405 |
| 878 | iso_pu_bacteria | 2977872689 | 2977875820 | 405 |
| 879 | iso_pu_bacteria | 2977898635 | 2977903481 | 405 |
| 880 | iso_pu_bacteria | 2977907340 | 2977913241 | 405 |
| 881 | iso_pu_bacteria | 2977915119 | 2977919576 | 405 |
| 882 | iso_pu_bacteria | 2977922695 | 2977924711 | 405 |
| 883 | iso_pu_bacteria | 2977935797 | 2977937990 | 405 |
| 884 | iso_pu_bacteria | 2977942078 | 2977945403 | 405 |
| 885 | iso_pu_bacteria | 2977950692 | 2977955387 | 405 |
| 886 | iso_pu_bacteria | 2977957713 | 2977959590 | 405 |
| 887 | iso_pu_bacteria | 2977971508 | 2977976226 | 405 |
| 888 | iso_pu_bacteria | 2977986579 | 2977988945 | 405 |
| 889 | iso_pu_bacteria | 2979710463 | 2979714862 | 405 |
| 890 | iso_pu_bacteria | 2979742915 | 2979748077 | 405 |
| 891 | iso_pu_bacteria | 2979772303 | 2979772497 | 405 |
| 892 | iso_pu_bacteria | 2979779861 | 2979785285 | 405 |
| 893 | iso_pu_bacteria | 2979793036 | 2979795259 | 405 |
| 894 | iso_pu_bacteria | 2979808191 | 2979809208 | 405 |
| 895 | iso_pu_bacteria | 2984499530 | 2984502014 | 405 |
| 896 | iso_pu_bacteria | 2984504281 | 2984504490 | 405 |
| 897 | iso_pu_bacteria | 2987636660 | 2987641724 | 405 |
| 898 | iso_pu_bacteria | 2987645492 | 2987645935 | 405 |
| 899 | iso_pu_bacteria | 2987652177 | 2987657630 | 405 |
| 900 | iso_pu_bacteria | 2987659509 | 2987662447 | 405 |
| 901 | iso_pu_bacteria | 2987666974 | 2987667159 | 405 |
| 902 | iso_pu_bacteria | 2987673487 | 2987675782 | 405 |
| 903 | iso_pu_bacteria | 2989349275 | 2989353517 | 405 |
| 904 | iso_pu_bacteria | 2989771324 | 2989771664 | 405 |
| 905 | iso_pu_bacteria | 2996310559 | 2996314165 | 405 |
| 906 | iso_pu_bacteria | 2996336353 | 2996338931 | 405 |
| 907 | iso_pu_bacteria | 2996341866 | 2996344893 | 405 |
| 908 | iso_pu_bacteria | 2996348954 | 2996352222 | 405 |
| 909 | iso_pu_bacteria | 2996386984 | 2996389060 | 405 |
| 910 | iso_pu_bacteria | 2996887358 | 2996891256 | 405 |
| 911 | iso_pu_bacteria | 2996893221 | 2996896534 | 405 |
| 912 | iso_pu_bacteria | 3000135777 | 3000137636 | 405 |
| 913 | iso_pu_bacteria | 3003930520 | 3003935545 | 405 |
| 914 | iso_pu_bacteria | 3004167301 | 3004173509 | 405 |
| 915 | iso_pu_bacteria | 3004188549 | 3004191498 | 405 |
| 916 | iso_pu_bacteria | 3004195979 | 3004196695 | 405 |
| 917 | iso_pu_bacteria | 3004203850 | 3004209464 | 405 |
| 918 | iso_pu_bacteria | 3004211236 | 3004218502 | 405 |
| 919 | iso_pu_bacteria | 3004218560 | 3004223652 | 405 |
| 920 | iso_pu_bacteria | 3004232784 | 3004234226 | 405 |
| 921 | iso_pu_bacteria | 3004239961 | 3004242602 | 405 |
| 922 | iso_pu_bacteria | 3004248173 | 3004250750 | 405 |
| 923 | iso_pu_bacteria | 3004268573 | 3004274325 | 405 |
| 924 | iso_pu_bacteria | 3004275668 | 3004278897 | 405 |
| 925 | iso_pu_bacteria | 3004334049 | 3004337036 | 405 |
| 926 | iso_pu_bacteria | 3005409236 | 3005413602 | 405 |
| 927 | iso_pu_bacteria | 3005445848 | 3005450808 | 405 |
| 928 | iso_pu_bacteria | 3005452660 | 3005458453 | 405 |
| 929 | iso_pu_bacteria | 637000159 | 637076804 | 405 |
| 930 | iso_pu_bacteria | 639633055 | 639650896 | 405 |
| 931 | iso_pu_bacteria | 643692032 | 643827178 | 405 |
| 932 | iso_pu_bacteria | 648276728 | 648735758 | 405 |
| 933 | iso_pu_bacteria | 649633066 | 649870750 | 405 |
| 934 | iso_pu_bacteria | 8002285264 | 8002290243 | 405 |
| 935 | iso_pu_bacteria | 8003992118 | 8003995058 | 405 |
| 936 | iso_pu_bacteria | 8004300914 | 8004303059 | 405 |
| 937 | iso_pu_bacteria | 8004312739 | 8004314550 | 405 |
| 938 | iso_pu_bacteria | 8004361976 | 8004362229 | 405 |
| 939 | iso_pu_bacteria | 8004374579 | 8004376364 | 405 |
| 940 | iso_pu_bacteria | 8004387939 | 8004390465 | 405 |
| 941 | iso_pu_bacteria | 8004395343 | 8004403000 | 405 |
| 942 | iso_pu_bacteria | 8004445564 | 8004452086 | 405 |
| 943 | iso_pu_bacteria | 8004633249 | 8004639888 | 405 |
| 944 | iso_pu_bacteria | 8004640170 | 8004641896 | 405 |
| 945 | iso_pu_bacteria | 8004695233 | 8004700612 | 405 |
| 946 | iso_pu_bacteria | 8004703790 | 8004706552 | 405 |
| 947 | iso_pu_bacteria | 8004714634 | 8004717157 | 405 |
| 948 | iso_pu_bacteria | 8005258706 | 8005263804 | 405 |
| 949 | iso_pu_bacteria | 8005275841 | 8005275916 | 405 |
| 950 | iso_pu_bacteria | 8005282627 | 8005287453 | 405 |
| 951 | iso_pu_bacteria | 8005289223 | 8005289813 | 405 |
| 952 | iso_pu_bacteria | 8005301065 | 8005307490 | 405 |
| 953 | iso_pu_bacteria | 8005307578 | 8005311935 | 405 |
| 954 | iso_pu_bacteria | 8005321885 | 8005325783 | 405 |
| 955 | iso_pu_bacteria | 8005382845 | 8005389177 | 405 |
| 956 | iso_pu_bacteria | 8005395548 | 8005396731 | 405 |
| 957 | iso_pu_bacteria | 8005430974 | 8005435856 | 405 |
| 958 | iso_pu_bacteria | 8005497431 | 8005503602 | 405 |
| 959 | iso_pu_bacteria | 8005542996 | 8005547498 | 405 |
| 960 | iso_pu_bacteria | 8005556819 | 8005563114 | 405 |
| 961 | iso_pu_bacteria | 8005563573 | 8005564947 | 405 |
| 962 | iso_pu_bacteria | 8005570704 | 8005576058 | 405 |
| 963 | iso_pu_bacteria | 8005619151 | 8005625913 | 405 |
| 964 | iso_pu_bacteria | 8005626139 | 8005632152 | 405 |
| 965 | iso_pu_bacteria | 8005668836 | 8005675480 | 405 |
| 966 | iso_pu_bacteria | 8005682033 | 8005685932 | 405 |
| 967 | iso_pu_bacteria | 8005688590 | 8005688777 | 405 |
| 968 | iso_pu_bacteria | 8005695170 | 8005695195 | 405 |
| 969 | iso_pu_bacteria | 8016728285 | 8016733708 | 405 |
| 970 | iso_pu_bacteria | 8018127388 | 8018134751 | 405 |
| 971 | iso_pu_bacteria | 8018163183 | 8018169918 | 405 |
| 972 | iso_pu_bacteria | 8018176218 | 8018180804 | 405 |
| 973 | iso_pu_bacteria | 8023680758 | 8023685925 | 405 |
| 974 | iso_pu_bacteria | 8024479707 | 8024485218 | 405 |
| 975 | iso_pu_bacteria | 8024486573 | 8024487460 | 405 |
| 976 | iso_pu_bacteria | 8024501048 | 8024506849 | 405 |
| 977 | iso_pu_bacteria | 8045864390 | 8045868619 | 405 |
| 978 | iso_pu_bacteria | 8046767195 | 8046774465 | 405 |
| 979 | iso_pu_bacteria | 8047673197 | 8047679673 | 405 |
| 980 | iso_pu_bacteria | 8054460903 | 8054464763 | 405 |
| 981 | iso_pu_bacteria | 8055617313 | 8055618133 | 405 |
| 982 | iso_pu_bacteria | 8056375014 | 8056381764 | 405 |
| 983 | iso_pu_bacteria | 8056382006 | 8056382920 | 405 |
| 984 | iso_pu_bacteria | 8057529695 | 8057532509 | 405 |
| 985 | iso_pu_bacteria | 8057874678 | 8057876160 | 405 |
| 986 | 3300005548 | Ga0070665_100257934 | Ga0070665_1002579342 | 406 |
| 987 | 3300005937 | Ga0081455_10003610 | Ga0081455_100036104 | 406 |
| 988 | 3300049571 | Ga0501034_0003296 | Ga0501034_0003296_14281_15507 | 406 |
| 989 | iso_pu_bacteria | 2537561587 | 2537877555 | 406 |
| 990 | iso_pu_bacteria | 2554235003 | 2554245418 | 406 |
| 991 | iso_pu_bacteria | 2558860242 | 2559296753 | 406 |
| 992 | iso_pu_bacteria | 2599185210 | 2599602756 | 406 |
| 993 | iso_pu_bacteria | 2600255279 | 2601610377 | 406 |
| 994 | iso_pu_bacteria | 2600255308 | 2601747293 | 406 |
| 995 | iso_pu_bacteria | 2643221582 | 2643917270 | 406 |
| 996 | iso_pu_bacteria | 2643221693 | 2644520880 | 406 |
| 997 | iso_pu_bacteria | 2808606387 | 2808987206 | 406 |
| 998 | iso_pu_bacteria | 2818991439 | 2819557457 | 406 |
| 999 | iso_pu_bacteria | 2834578030 | 2834580428 | 406 |
| 1000 | iso_pu_bacteria | 2838675328 | 2838678036 | 406 |
| 1001 | iso_pu_bacteria | 2838714209 | 2838717058 | 406 |
| 1002 | iso_pu_bacteria | 2838719591 | 2838722331 | 406 |
| 1003 | iso_pu_bacteria | 2838724970 | 2838727807 | 406 |
| 1004 | iso_pu_bacteria | 2841846520 | 2841849464 | 406 |
| 1005 | iso_pu_bacteria | 2841859092 | 2841861494 | 406 |
| 1006 | iso_pu_bacteria | 2842124991 | 2842127787 | 406 |
| 1007 | iso_pu_bacteria | 2842130223 | 2842132929 | 406 |
| 1008 | iso_pu_bacteria | 2842152218 | 2842154922 | 406 |
| 1009 | iso_pu_bacteria | 2842170452 | 2842173421 | 406 |
| 1010 | iso_pu_bacteria | 2842175837 | 2842178543 | 406 |
| 1011 | iso_pu_bacteria | 2842187318 | 2842190166 | 406 |
| 1012 | iso_pu_bacteria | 2842211629 | 2842214480 | 406 |
| 1013 | iso_pu_bacteria | 2842224351 | 2842227199 | 406 |
| 1014 | iso_pu_bacteria | 2842515876 | 2842518240 | 406 |
| 1015 | iso_pu_bacteria | 2899792073 | 2899796535 | 406 |
| 1016 | iso_pu_bacteria | 2899845264 | 2899850060 | 406 |
| 1017 | iso_pu_bacteria | 2919114240 | 2919117316 | 406 |
| 1018 | iso_pu_bacteria | 2926754445 | 2926758763 | 406 |
| 1019 | iso_pu_bacteria | 2926760298 | 2926763706 | 406 |
| 1020 | iso_pu_bacteria | 2933006813 | 2933009695 | 406 |
| 1021 | iso_pu_bacteria | 2933011516 | 2933013869 | 406 |
| 1022 | iso_pu_bacteria | 2933594066 | 2933595682 | 406 |
| 1023 | iso_pu_bacteria | 2979089926 | 2979091252 | 406 |
| 1024 | iso_pu_bacteria | 2979095461 | 2979096777 | 406 |
| 1025 | iso_pu_bacteria | 2979100975 | 2979102498 | 406 |
| 1026 | iso_pu_bacteria | 2984509177 | 2984509617 | 406 |
| 1027 | iso_pu_bacteria | 2984518228 | 2984519685 | 406 |
| 1028 | iso_pu_bacteria | 2984537506 | 2984537954 | 406 |
| 1029 | iso_pu_bacteria | 2984601300 | 2984604699 | 406 |
| 1030 | iso_pu_bacteria | 650716007 | 650843175 | 406 |
| 1031 | iso_pu_bacteria | 8003570095 | 8003572750 | 406 |
| 1032 | 3300005937 | Ga0081455_10000373 | Ga0081455_1000037315 | 407 |
| 1033 | 3300006038 | Ga0075365_10000621 | Ga0075365_100006214 | 407 |
| 1034 | 3300006177 | Ga0075362_10061021 | Ga0075362_100610211 | 407 |
| 1035 | 3300013104 | Ga0157370_10010599 | Ga0157370_100105994 | 407 |
| 1036 | 3300013105 | Ga0157369_10006614 | Ga0157369_100066144 | 407 |
| 1037 | 3300025913 | Ga0207695_10030412 | Ga0207695_100304125 | 407 |
| 1038 | 3300028794 | Ga0307515_10038687 | Ga0307515_100386876 | 407 |
| 1039 | 3300037418 | Ga0395900_0018932 | Ga0395900_0018932_2792_4066 | 407 |
| 1040 | 3300038443 | Ga0395901_0052706 | Ga0395901_0052706_2322_3596 | 407 |
| 1041 | 3300039447 | Ga0436361_0019078 | Ga0436361_0019078_1374_2600 | 407 |
| 1042 | 3300049569 | Ga0501032_0000017 | Ga0501032_0000017_55487_56911 | 407 |
| 1043 | 3300049570 | Ga0501033_0000029 | Ga0501033_0000029_55478_56902 | 407 |
| 1044 | 3300049570 | Ga0501033_0107252 | Ga0501033_0107252_437_1663 | 407 |
| 1045 | 3300049571 | Ga0501034_0000102 | Ga0501034_0000102_55486_56910 | 407 |
| 1046 | 3300049571 | Ga0501034_0101500 | Ga0501034_0101500_1273_2499 | 407 |
| 1047 | 3300049571 | Ga0501034_0146586 | Ga0501034_0146586_616_1845 | 407 |
| 1048 | 3300049572 | Ga0501036_0000011 | Ga0501036_0000011_101393_102817 | 407 |
| 1049 | 3300049573 | Ga0501037_0000015 | Ga0501037_0000015_104402_105826 | 407 |
| 1050 | 3300049574 | Ga0501038_0000016 | Ga0501038_0000016_55486_56910 | 407 |
| 1051 | 3300049574 | Ga0501038_0074545 | Ga0501038_0074545_1273_2499 | 407 |
| 1052 | 3300049575 | Ga0501039_0000023 | Ga0501039_0000023_55486_56910 | 407 |
| 1053 | 3300049575 | Ga0501039_0025637 | Ga0501039_0025637_3158_4384 | 407 |
| 1054 | 3300049576 | Ga0501040_0045977 | Ga0501040_0045977_1005_2429 | 407 |
| 1055 | 3300049579 | Ga0501043_0000372 | Ga0501043_0000372_38808_40232 | 407 |
| 1056 | 3300049580 | Ga0501046_0039751 | Ga0501046_0039751_571_1995 | 407 |
| 1057 | 3300049581 | Ga0501047_0001169 | Ga0501047_0001169_15248_16672 | 407 |
| 1058 | 3300049581 | Ga0501047_0038110 | Ga0501047_0038110_1273_2499 | 407 |
| 1059 | 3300049581 | Ga0501047_0248865 | Ga0501047_0248865_93_1322 | 407 |
| 1060 | 3300049582 | Ga0501048_0012058 | Ga0501048_0012058_2603_3829 | 407 |
| 1061 | 3300049584 | Ga0501068_0006869 | Ga0501068_0006869_767_1993 | 407 |
| 1062 | 3300049744 | Ga0501083_0057730 | Ga0501083_0057730_718_1944 | 407 |
| 1063 | 3300049822 | Ga0501035_0000038 | Ga0501035_0000038_101909_103333 | 407 |
| 1064 | 3300049822 | Ga0501035_0080769 | Ga0501035_0080769_372_1598 | 407 |
| 1065 | 3300049823 | Ga0501044_0000046 | Ga0501044_0000046_89903_91327 | 407 |
| 1066 | 3300049823 | Ga0501044_0102921 | Ga0501044_0102921_1273_2499 | 407 |
| 1067 | 3300049824 | Ga0501045_0012943 | Ga0501045_0012943_1024_2250 | 407 |
| 1068 | 3300050489 | nmdc:mga03683_38362_c1 | nmdc:mga03683_38362_c1_267_1514 | 407 |
| 1069 | 3300050491 | nmdc:mga00v17_11699_c1 | nmdc:mga00v17_11699_c1_2540_3793 | 407 |
| 1070 | 3300050492 | nmdc:mga0yw44_1934_c1 | nmdc:mga0yw44_1934_c1_1058_2305 | 407 |
| 1071 | 3300050492 | nmdc:mga0yw44_4057_c1 | nmdc:mga0yw44_4057_c1_3285_4538 | 407 |
| 1072 | 3300050516 | nmdc:mga0sz30_26798_c1 | nmdc:mga0sz30_26798_c1_1101_2327 | 407 |
| 1073 | iso_pu_bacteria | 2904578770 | 2904583347 | 407 |
| 1074 | iso_pu_bacteria | 2919119836 | 2919121033 | 407 |
| 1075 | 3300002705 | JGI25156J39149_1012995 | JGI25156J39149_10129952 | 408 |
| 1076 | 3300002737 | JGI25162J39368_1001999 | JGI25162J39368_10019997 | 408 |
| 1077 | 3300002738 | JGI25154J39366_1003005 | JGI25154J39366_10030054 | 408 |
| 1078 | 3300002739 | JGI25158J39367_1000211 | JGI25158J39367_10002113 | 408 |
| 1079 | 3300002741 | JGI25157J39369_1000312 | JGI25157J39369_100031218 | 408 |
| 1080 | 3300002741 | JGI25157J39369_1002353 | JGI25157J39369_10023534 | 408 |
| 1081 | 3300002773 | JGI25152J39213_1000211 | JGI25152J39213_100021129 | 408 |
| 1082 | 3300002773 | JGI25152J39213_1001114 | JGI25152J39213_10011148 | 408 |
| 1083 | 3300002773 | JGI25152J39213_1005026 | JGI25152J39213_10050262 | 408 |
| 1084 | 3300002773 | JGI25152J39213_1005046 | JGI25152J39213_10050462 | 408 |
| 1085 | 3300002774 | JGI25150J39212_1000103 | JGI25150J39212_10001034 | 408 |
| 1086 | 3300002987 | JGI25159J45721_1000106 | JGI25159J45721_100010631 | 408 |
| 1087 | 3300002987 | JGI25159J45721_1000565 | JGI25159J45721_100056510 | 408 |
| 1088 | 3300003187 | JGI25151J46595_10000015 | JGI25151J46595_10000015208 | 408 |
| 1089 | 3300003187 | JGI25151J46595_10000085 | JGI25151J46595_1000008579 | 408 |
| 1090 | 3300003187 | JGI25151J46595_10000303 | JGI25151J46595_1000030340 | 408 |
| 1091 | 3300003187 | JGI25151J46595_10000442 | JGI25151J46595_1000044227 | 408 |
| 1092 | 3300003187 | JGI25151J46595_10013448 | JGI25151J46595_100134482 | 408 |
| 1093 | 3300003214 | JGI25165J46597_1000052 | JGI25165J46597_100005280 | 408 |
| 1094 | 3300003214 | JGI25165J46597_1000225 | JGI25165J46597_10002252 | 408 |
| 1095 | 3300003215 | JGI25153J46596_10001373 | JGI25153J46596_100013737 | 408 |
| 1096 | 3300003215 | JGI25153J46596_10011178 | JGI25153J46596_100111782 | 408 |
| 1097 | 3300003215 | JGI25153J46596_10011226 | JGI25153J46596_100112262 | 408 |
| 1098 | 3300003322 | rootL2_10076941 | rootL2_100769412 | 408 |
| 1099 | 3300003354 | JGI25160J50197_1000134 | JGI25160J50197_100013428 | 408 |
| 1100 | 3300003354 | JGI25160J50197_1000357 | JGI25160J50197_10003575 | 408 |
| 1101 | 3300003354 | JGI25160J50197_1004101 | JGI25160J50197_10041013 | 408 |
| 1102 | 3300003354 | JGI25160J50197_1013969 | JGI25160J50197_10139692 | 408 |
| 1103 | 3300003354 | JGI25160J50197_1018240 | JGI25160J50197_10182402 | 408 |
| 1104 | 3300003374 | JGI25161J50226_1000116 | JGI25161J50226_100011642 | 408 |
| 1105 | 3300003374 | JGI25161J50226_1000227 | JGI25161J50226_100022722 | 408 |
| 1106 | 3300003374 | JGI25161J50226_1000272 | JGI25161J50226_10002725 | 408 |
| 1107 | 3300003374 | JGI25161J50226_1002006 | JGI25161J50226_10020065 | 408 |
| 1108 | 3300003578 | Ga0006562J51391_1009235 | Ga0006562J51391_10092352 | 408 |
| 1109 | 3300003752 | Ga0055539_1000392 | Ga0055539_100039217 | 408 |
| 1110 | 3300003756 | Ga0055533_1000024 | Ga0055533_1000024108 | 408 |
| 1111 | 3300003759 | Ga0055525_1000008 | Ga0055525_1000008327 | 408 |
| 1112 | 3300003759 | Ga0055525_1000615 | Ga0055525_10006159 | 408 |
| 1113 | 3300003760 | Ga0055527_1000278 | Ga0055527_10002788 | 408 |
| 1114 | 3300003761 | Ga0055535_1000562 | Ga0055535_100056223 | 408 |
| 1115 | 3300003762 | Ga0055542_1000284 | Ga0055542_100028425 | 408 |
| 1116 | 3300003762 | Ga0055542_1000587 | Ga0055542_100058723 | 408 |
| 1117 | 3300003763 | Ga0055529_1000418 | Ga0055529_100041823 | 408 |
| 1118 | 3300003771 | Ga0055526_1000652 | Ga0055526_100065215 | 408 |
| 1119 | 3300003771 | Ga0055526_1001955 | Ga0055526_10019552 | 408 |
| 1120 | 3300003771 | Ga0055526_1002947 | Ga0055526_10029479 | 408 |
| 1121 | 3300003771 | Ga0055526_1009244 | Ga0055526_10092443 | 408 |
| 1122 | 3300003771 | Ga0055526_1010722 | Ga0055526_10107223 | 408 |
| 1123 | 3300003771 | Ga0055526_1011288 | Ga0055526_10112882 | 408 |
| 1124 | 3300003771 | Ga0055526_1012632 | Ga0055526_10126324 | 408 |
| 1125 | 3300003775 | Ga0055524_1000301 | Ga0055524_100030138 | 408 |
| 1126 | 3300003775 | Ga0055524_1000618 | Ga0055524_100061820 | 408 |
| 1127 | 3300003775 | Ga0055524_1001672 | Ga0055524_100167211 | 408 |
| 1128 | 3300003775 | Ga0055524_1001793 | Ga0055524_10017939 | 408 |
| 1129 | 3300003775 | Ga0055524_1010049 | Ga0055524_10100491 | 408 |
| 1130 | 3300003775 | Ga0055524_1013171 | Ga0055524_10131712 | 408 |
| 1131 | 3300003781 | Ga0055536_1005119 | Ga0055536_10051194 | 408 |
| 1132 | 3300003781 | Ga0055536_1015701 | Ga0055536_10157012 | 408 |
| 1133 | 3300003790 | Ga0055528_1000602 | Ga0055528_10006027 | 408 |
| 1134 | 3300003790 | Ga0055528_1000712 | Ga0055528_100071213 | 408 |
| 1135 | 3300003790 | Ga0055528_1000849 | Ga0055528_10008493 | 408 |
| 1136 | 3300003790 | Ga0055528_1002425 | Ga0055528_10024257 | 408 |
| 1137 | 3300003790 | Ga0055528_1008911 | Ga0055528_10089112 | 408 |
| 1138 | 3300003792 | Ga0055540_1000131 | Ga0055540_10001313 | 408 |
| 1139 | 3300003792 | Ga0055540_1005898 | Ga0055540_10058983 | 408 |
| 1140 | 3300003792 | Ga0055540_1007846 | Ga0055540_10078463 | 408 |
| 1141 | 3300003794 | Ga0055531_10005530 | Ga0055531_100055301 | 408 |
| 1142 | 3300004625 | Ga0055543_1000093 | Ga0055543_100009361 | 408 |
| 1143 | 3300004625 | Ga0055543_1000161 | Ga0055543_100016125 | 408 |
| 1144 | 3300004625 | Ga0055543_1000574 | Ga0055543_10005742 | 408 |
| 1145 | 3300005262 | Ga0065165_1000196 | Ga0065165_100019662 | 408 |
| 1146 | 3300005262 | Ga0065165_1000553 | Ga0065165_100055325 | 408 |
| 1147 | 3300005327 | Ga0070658_10134102 | Ga0070658_101341021 | 408 |
| 1148 | 3300005327 | Ga0070658_10210060 | Ga0070658_102100602 | 408 |
| 1149 | 3300005330 | Ga0070690_100043814 | Ga0070690_1000438142 | 408 |
| 1150 | 3300005334 | Ga0068869_100128336 | Ga0068869_1001283362 | 408 |
| 1151 | 3300005339 | Ga0070660_100044256 | Ga0070660_1000442561 | 408 |
| 1152 | 3300005339 | Ga0070660_100122321 | Ga0070660_1001223212 | 408 |
| 1153 | 3300005341 | Ga0070691_10004671 | Ga0070691_100046712 | 408 |
| 1154 | 3300005344 | Ga0070661_100210633 | Ga0070661_1002106332 | 408 |
| 1155 | 3300005364 | Ga0070673_100171582 | Ga0070673_1001715821 | 408 |
| 1156 | 3300005366 | Ga0070659_100085886 | Ga0070659_1000858861 | 408 |
| 1157 | 3300005436 | Ga0070713_100047301 | Ga0070713_1000473012 | 408 |
| 1158 | 3300005436 | Ga0070713_100365743 | Ga0070713_1003657431 | 408 |
| 1159 | 3300005439 | Ga0070711_100098757 | Ga0070711_1000987571 | 408 |
| 1160 | 3300005439 | Ga0070711_100150922 | Ga0070711_1001509222 | 408 |
| 1161 | 3300005441 | Ga0070700_100079706 | Ga0070700_1000797061 | 408 |
| 1162 | 3300005444 | Ga0070694_100030931 | Ga0070694_1000309313 | 408 |
| 1163 | 3300005467 | Ga0070706_100175279 | Ga0070706_1001752792 | 408 |
| 1164 | 3300005468 | Ga0070707_100157727 | Ga0070707_1001577272 | 408 |
| 1165 | 3300005471 | Ga0070698_100005438 | Ga0070698_1000054384 | 408 |
| 1166 | 3300005518 | Ga0070699_100127316 | Ga0070699_1001273162 | 408 |
| 1167 | 3300005535 | Ga0070684_100019867 | Ga0070684_1000198674 | 408 |
| 1168 | 3300005539 | Ga0068853_100039120 | Ga0068853_1000391203 | 408 |
| 1169 | 3300005539 | Ga0068853_100097806 | Ga0068853_1000978062 | 408 |
| 1170 | 3300005545 | Ga0070695_100003867 | Ga0070695_1000038674 | 408 |
| 1171 | 3300005548 | Ga0070665_100112054 | Ga0070665_1001120542 | 408 |
| 1172 | 3300005563 | Ga0068855_100002198 | Ga0068855_1000021986 | 408 |
| 1173 | 3300005563 | Ga0068855_100010534 | Ga0068855_1000105345 | 408 |
| 1174 | 3300005563 | Ga0068855_100267875 | Ga0068855_1002678751 | 408 |
| 1175 | 3300005563 | Ga0068855_100315710 | Ga0068855_1003157101 | 408 |
| 1176 | 3300005564 | Ga0070664_100024464 | Ga0070664_1000244644 | 408 |
| 1177 | 3300005564 | Ga0070664_100078408 | Ga0070664_1000784083 | 408 |
| 1178 | 3300005577 | Ga0068857_100025509 | Ga0068857_1000255094 | 408 |
| 1179 | 3300005578 | Ga0068854_100010289 | Ga0068854_1000102895 | 408 |
| 1180 | 3300005578 | Ga0068854_100026684 | Ga0068854_1000266844 | 408 |
| 1181 | 3300005614 | Ga0068856_100001613 | Ga0068856_1000016136 | 408 |
| 1182 | 3300005616 | Ga0068852_100030903 | Ga0068852_1000309033 | 408 |
| 1183 | 3300005616 | Ga0068852_100051942 | Ga0068852_1000519424 | 408 |
| 1184 | 3300005937 | Ga0081455_10000637 | Ga0081455_100006378 | 408 |
| 1185 | 3300005937 | Ga0081455_10002518 | Ga0081455_1000251818 | 408 |
| 1186 | 3300005983 | Ga0081540_1000087 | Ga0081540_100008753 | 408 |
| 1187 | 3300005983 | Ga0081540_1033187 | Ga0081540_10331872 | 408 |
| 1188 | 3300005985 | Ga0081539_10004039 | Ga0081539_1000403916 | 408 |
| 1189 | 3300006038 | Ga0075365_10034710 | Ga0075365_100347102 | 408 |
| 1190 | 3300006038 | Ga0075365_10043511 | Ga0075365_100435113 | 408 |
| 1191 | 3300006042 | Ga0075368_10040317 | Ga0075368_100403172 | 408 |
| 1192 | 3300006048 | Ga0075363_100016576 | Ga0075363_1000165763 | 408 |
| 1193 | 3300006048 | Ga0075363_100026744 | Ga0075363_1000267442 | 408 |
| 1194 | 3300006051 | Ga0075364_10020622 | Ga0075364_100206223 | 408 |
| 1195 | 3300006051 | Ga0075364_10022554 | Ga0075364_100225543 | 408 |
| 1196 | 3300006058 | Ga0075432_10030664 | Ga0075432_100306643 | 408 |
| 1197 | 3300006175 | Ga0070712_100023146 | Ga0070712_1000231462 | 408 |
| 1198 | 3300006175 | Ga0070712_100079287 | Ga0070712_1000792873 | 408 |
| 1199 | 3300006177 | Ga0075362_10000600 | Ga0075362_100006003 | 408 |
| 1200 | 3300006177 | Ga0075362_10008900 | Ga0075362_100089002 | 408 |
| 1201 | 3300006178 | Ga0075367_10004723 | Ga0075367_100047235 | 408 |
| 1202 | 3300006186 | Ga0075369_10000214 | Ga0075369_1000021410 | 408 |
| 1203 | 3300006186 | Ga0075369_10003614 | Ga0075369_100036142 | 408 |
| 1204 | 3300006186 | Ga0075369_10012709 | Ga0075369_100127093 | 408 |
| 1205 | 3300006186 | Ga0075369_10022119 | Ga0075369_100221191 | 408 |
| 1206 | 3300006186 | Ga0075369_10028215 | Ga0075369_100282152 | 408 |
| 1207 | 3300006195 | Ga0075366_10070997 | Ga0075366_100709972 | 408 |
| 1208 | 3300006195 | Ga0075366_10111527 | Ga0075366_101115272 | 408 |
| 1209 | 3300006353 | Ga0075370_10002165 | Ga0075370_100021653 | 408 |
| 1210 | 3300006844 | Ga0075428_100045123 | Ga0075428_1000451234 | 408 |
| 1211 | 3300006846 | Ga0075430_100023735 | Ga0075430_1000237354 | 408 |
| 1212 | 3300006847 | Ga0075431_100006794 | Ga0075431_1000067948 | 408 |
| 1213 | 3300006847 | Ga0075431_100025820 | Ga0075431_1000258204 | 408 |
| 1214 | 3300006852 | Ga0075433_10144404 | Ga0075433_101444042 | 408 |
| 1215 | 3300006871 | Ga0075434_100014619 | Ga0075434_1000146192 | 408 |
| 1216 | 3300006871 | Ga0075434_100188350 | Ga0075434_1001883502 | 408 |
| 1217 | 3300006880 | Ga0075429_100040711 | Ga0075429_1000407113 | 408 |
| 1218 | 3300006946 | Ga0079104_1000386 | Ga0079104_100038640 | 408 |
| 1219 | 3300006948 | Ga0099826_10000080 | Ga0099826_1000008023 | 408 |
| 1220 | 3300007076 | Ga0075435_100010284 | Ga0075435_1000102846 | 408 |
| 1221 | 3300007265 | Ga0099794_10071455 | Ga0099794_100714551 | 408 |
| 1222 | 3300009036 | Ga0105244_10024354 | Ga0105244_100243543 | 408 |
| 1223 | 3300009036 | Ga0105244_10047669 | Ga0105244_100476692 | 408 |
| 1224 | 3300009094 | Ga0111539_10055655 | Ga0111539_100556551 | 408 |
| 1225 | 3300009147 | Ga0114129_10043003 | Ga0114129_100430031 | 408 |
| 1226 | 3300009148 | Ga0105243_10044429 | Ga0105243_100444292 | 408 |
| 1227 | 3300009148 | Ga0105243_10235250 | Ga0105243_102352502 | 408 |
| 1228 | 3300009177 | Ga0105248_10067959 | Ga0105248_100679595 | 408 |
| 1229 | 3300009177 | Ga0105248_10141070 | Ga0105248_101410702 | 408 |
| 1230 | 3300009545 | Ga0105237_10061705 | Ga0105237_100617052 | 408 |
| 1231 | 3300009545 | Ga0105237_10235839 | Ga0105237_102358391 | 408 |
| 1232 | 3300009551 | Ga0105238_10009341 | Ga0105238_100093415 | 408 |
| 1233 | 3300009553 | Ga0105249_10116374 | Ga0105249_101163743 | 408 |
| 1234 | 3300009765 | Ga0123341_1000093 | Ga0123341_100009335 | 408 |
| 1235 | 3300009766 | Ga0123342_1017495 | Ga0123342_10174953 | 408 |
| 1236 | 3300010375 | Ga0105239_10158669 | Ga0105239_101586693 | 408 |
| 1237 | 3300013100 | Ga0157373_10055382 | Ga0157373_100553822 | 408 |
| 1238 | 3300013102 | Ga0157371_10000002 | Ga0157371_10000002295 | 408 |
| 1239 | 3300013102 | Ga0157371_10058393 | Ga0157371_100583934 | 408 |
| 1240 | 3300013104 | Ga0157370_10000143 | Ga0157370_1000014349 | 408 |
| 1241 | 3300013105 | Ga0157369_10020411 | Ga0157369_100204117 | 408 |
| 1242 | 3300013105 | Ga0157369_10064215 | Ga0157369_100642153 | 408 |
| 1243 | 3300013105 | Ga0157369_10291424 | Ga0157369_102914242 | 408 |
| 1244 | 3300013249 | Ga0171463_1014 | Ga0171463_101431 | 408 |
| 1245 | 3300014326 | Ga0157380_10012206 | Ga0157380_100122063 | 408 |
| 1246 | 3300015690 | Ga0183363_1028 | Ga0183363_102818 | 408 |
| 1247 | 3300017792 | Ga0163161_10070378 | Ga0163161_100703781 | 408 |
| 1248 | 3300021320 | Ga0214544_1000063 | Ga0214544_1000063106 | 408 |
| 1249 | 3300021321 | Ga0214542_1000095 | Ga0214542_100009596 | 408 |
| 1250 | 3300021321 | Ga0214542_1023913 | Ga0214542_10239133 | 408 |
| 1251 | 3300021327 | Ga0214543_1000008 | Ga0214543_1000008309 | 408 |
| 1252 | 3300021327 | Ga0214543_1000026 | Ga0214543_100002696 | 408 |
| 1253 | 3300021358 | Ga0213873_10011471 | Ga0213873_100114712 | 408 |
| 1254 | 3300021361 | Ga0213872_10016302 | Ga0213872_100163023 | 408 |
| 1255 | 3300021377 | Ga0213874_10006267 | Ga0213874_100062672 | 408 |
| 1256 | 3300021377 | Ga0213874_10010612 | Ga0213874_100106122 | 408 |
| 1257 | 3300021384 | Ga0213876_10001001 | Ga0213876_1000100110 | 408 |
| 1258 | 3300021384 | Ga0213876_10007938 | Ga0213876_100079385 | 408 |
| 1259 | 3300021384 | Ga0213876_10012988 | Ga0213876_100129883 | 408 |
| 1260 | 3300021441 | Ga0213871_10001994 | Ga0213871_100019941 | 408 |
| 1261 | 3300022739 | Ga0228711_1000003 | Ga0228711_1000003233 | 408 |
| 1262 | 3300022740 | Ga0228710_1000003 | Ga0228710_1000003239 | 408 |
| 1263 | 3300025208 | Ga0209436_100021 | Ga0209436_10002186 | 408 |
| 1264 | 3300025208 | Ga0209436_101037 | Ga0209436_10103710 | 408 |
| 1265 | 3300025226 | Ga0209674_100007 | Ga0209674_100007153 | 408 |
| 1266 | 3300025228 | Ga0209672_100069 | Ga0209672_100069111 | 408 |
| 1267 | 3300025229 | Ga0209147_100044 | Ga0209147_100044156 | 408 |
| 1268 | 3300025230 | Ga0209563_100003 | Ga0209563_1000031410 | 408 |
| 1269 | 3300025230 | Ga0209563_100060 | Ga0209563_100060116 | 408 |
| 1270 | 3300025231 | Ga0207427_100282 | Ga0207427_10028223 | 408 |
| 1271 | 3300025231 | Ga0207427_100659 | Ga0207427_1006598 | 408 |
| 1272 | 3300025233 | Ga0209437_100183 | Ga0209437_10018368 | 408 |
| 1273 | 3300025242 | Ga0209258_100031 | Ga0209258_100031235 | 408 |
| 1274 | 3300025242 | Ga0209258_101271 | Ga0209258_1012712 | 408 |
| 1275 | 3300025245 | Ga0207425_1000065 | Ga0207425_100006576 | 408 |
| 1276 | 3300025245 | Ga0207425_1000912 | Ga0207425_100091212 | 408 |
| 1277 | 3300025245 | Ga0207425_1002840 | Ga0207425_10028403 | 408 |
| 1278 | 3300025245 | Ga0207425_1008148 | Ga0207425_10081481 | 408 |
| 1279 | 3300025246 | Ga0209646_1000056 | Ga0209646_100005672 | 408 |
| 1280 | 3300025246 | Ga0209646_1010083 | Ga0209646_10100832 | 408 |
| 1281 | 3300025250 | Ga0209026_1000009 | Ga0209026_1000009272 | 408 |
| 1282 | 3300025250 | Ga0209026_1000141 | Ga0209026_1000141123 | 408 |
| 1283 | 3300025253 | Ga0209677_100088 | Ga0209677_100088100 | 408 |
| 1284 | 3300025253 | Ga0209677_100112 | Ga0209677_10011269 | 408 |
| 1285 | 3300025253 | Ga0209677_102809 | Ga0209677_1028095 | 408 |
| 1286 | 3300025253 | Ga0209677_104123 | Ga0209677_1041233 | 408 |
| 1287 | 3300025254 | Ga0209148_1000027 | Ga0209148_1000027235 | 408 |
| 1288 | 3300025254 | Ga0209148_1000111 | Ga0209148_100011176 | 408 |
| 1289 | 3300025256 | Ga0209759_1000035 | Ga0209759_1000035191 | 408 |
| 1290 | 3300025256 | Ga0209759_1001567 | Ga0209759_10015671 | 408 |
| 1291 | 3300025256 | Ga0209759_1005260 | Ga0209759_10052604 | 408 |
| 1292 | 3300025258 | Ga0209129_1000132 | Ga0209129_100013276 | 408 |
| 1293 | 3300025258 | Ga0209129_1001371 | Ga0209129_10013713 | 408 |
| 1294 | 3300025258 | Ga0209129_1001912 | Ga0209129_10019128 | 408 |
| 1295 | 3300025258 | Ga0209129_1002753 | Ga0209129_10027536 | 408 |
| 1296 | 3300025258 | Ga0209129_1003666 | Ga0209129_10036663 | 408 |
| 1297 | 3300025258 | Ga0209129_1003832 | Ga0209129_10038323 | 408 |
| 1298 | 3300025261 | Ga0209233_1000054 | Ga0209233_1000054202 | 408 |
| 1299 | 3300025261 | Ga0209233_1000118 | Ga0209233_1000118183 | 408 |
| 1300 | 3300025263 | Ga0209565_1013116 | Ga0209565_10131162 | 408 |
| 1301 | 3300025272 | Ga0209455_1000058 | Ga0209455_1000058193 | 408 |
| 1302 | 3300025272 | Ga0209455_1000206 | Ga0209455_100020675 | 408 |
| 1303 | 3300025272 | Ga0209455_1000742 | Ga0209455_100074210 | 408 |
| 1304 | 3300025273 | Ga0209673_1000020 | Ga0209673_100002074 | 408 |
| 1305 | 3300025273 | Ga0209673_1000059 | Ga0209673_1000059174 | 408 |
| 1306 | 3300025273 | Ga0209673_1000475 | Ga0209673_10004759 | 408 |
| 1307 | 3300025273 | Ga0209673_1003583 | Ga0209673_10035833 | 408 |
| 1308 | 3300025273 | Ga0209673_1006173 | Ga0209673_10061732 | 408 |
| 1309 | 3300025273 | Ga0209673_1006661 | Ga0209673_10066615 | 408 |
| 1310 | 3300025273 | Ga0209673_1008055 | Ga0209673_10080552 | 408 |
| 1311 | 3300025273 | Ga0209673_1009721 | Ga0209673_10097212 | 408 |
| 1312 | 3300025273 | Ga0209673_1018568 | Ga0209673_10185682 | 408 |
| 1313 | 3300025273 | Ga0209673_1028253 | Ga0209673_10282531 | 408 |
| 1314 | 3300025284 | Ga0209130_1000001 | Ga0209130_10000018 | 408 |
| 1315 | 3300025284 | Ga0209130_1000122 | Ga0209130_100012212 | 408 |
| 1316 | 3300025284 | Ga0209130_1000198 | Ga0209130_100019831 | 408 |
| 1317 | 3300025291 | Ga0209675_1000455 | Ga0209675_10004554 | 408 |
| 1318 | 3300025292 | Ga0209676_1020075 | Ga0209676_10200752 | 408 |
| 1319 | 3300025294 | Ga0209025_1000010 | Ga0209025_1000010652 | 408 |
| 1320 | 3300025294 | Ga0209025_1000081 | Ga0209025_1000081215 | 408 |
| 1321 | 3300025294 | Ga0209025_1000247 | Ga0209025_100024776 | 408 |
| 1322 | 3300025294 | Ga0209025_1000339 | Ga0209025_100033960 | 408 |
| 1323 | 3300025294 | Ga0209025_1004847 | Ga0209025_10048474 | 408 |
| 1324 | 3300025294 | Ga0209025_1007051 | Ga0209025_10070513 | 408 |
| 1325 | 3300025294 | Ga0209025_1026001 | Ga0209025_10260013 | 408 |
| 1326 | 3300025295 | Ga0209564_1000048 | Ga0209564_1000048268 | 408 |
| 1327 | 3300025295 | Ga0209564_1000074 | Ga0209564_100007472 | 408 |
| 1328 | 3300025295 | Ga0209564_1000205 | Ga0209564_1000205123 | 408 |
| 1329 | 3300025295 | Ga0209564_1000353 | Ga0209564_100035343 | 408 |
| 1330 | 3300025295 | Ga0209564_1000496 | Ga0209564_100049656 | 408 |
| 1331 | 3300025295 | Ga0209564_1001947 | Ga0209564_10019475 | 408 |
| 1332 | 3300025295 | Ga0209564_1002995 | Ga0209564_10029955 | 408 |
| 1333 | 3300025295 | Ga0209564_1003802 | Ga0209564_10038022 | 408 |
| 1334 | 3300025295 | Ga0209564_1006946 | Ga0209564_10069462 | 408 |
| 1335 | 3300025295 | Ga0209564_1012841 | Ga0209564_10128411 | 408 |
| 1336 | 3300025297 | Ga0209758_1000058 | Ga0209758_1000058307 | 408 |
| 1337 | 3300025297 | Ga0209758_1000076 | Ga0209758_1000076197 | 408 |
| 1338 | 3300025297 | Ga0209758_1000212 | Ga0209758_100021276 | 408 |
| 1339 | 3300025297 | Ga0209758_1000632 | Ga0209758_100063212 | 408 |
| 1340 | 3300025297 | Ga0209758_1001845 | Ga0209758_100184512 | 408 |
| 1341 | 3300025297 | Ga0209758_1001850 | Ga0209758_100185012 | 408 |
| 1342 | 3300025297 | Ga0209758_1009090 | Ga0209758_10090903 | 408 |
| 1343 | 3300025297 | Ga0209758_1009203 | Ga0209758_10092033 | 408 |
| 1344 | 3300025297 | Ga0209758_1012519 | Ga0209758_10125194 | 408 |
| 1345 | 3300025297 | Ga0209758_1014390 | Ga0209758_10143903 | 408 |
| 1346 | 3300025298 | Ga0209050_1023979 | Ga0209050_10239792 | 408 |
| 1347 | 3300025299 | Ga0209256_1000041 | Ga0209256_1000041268 | 408 |
| 1348 | 3300025299 | Ga0209256_1000368 | Ga0209256_100036872 | 408 |
| 1349 | 3300025299 | Ga0209256_1000439 | Ga0209256_100043956 | 408 |
| 1350 | 3300025299 | Ga0209256_1000456 | Ga0209256_100045633 | 408 |
| 1351 | 3300025299 | Ga0209256_1000884 | Ga0209256_10008842 | 408 |
| 1352 | 3300025299 | Ga0209256_1001113 | Ga0209256_100111314 | 408 |
| 1353 | 3300025299 | Ga0209256_1002079 | Ga0209256_10020793 | 408 |
| 1354 | 3300025299 | Ga0209256_1006792 | Ga0209256_10067923 | 408 |
| 1355 | 3300025299 | Ga0209256_1007313 | Ga0209256_10073135 | 408 |
| 1356 | 3300025299 | Ga0209256_1009415 | Ga0209256_10094153 | 408 |
| 1357 | 3300025299 | Ga0209256_1010744 | Ga0209256_10107442 | 408 |
| 1358 | 3300025302 | Ga0207426_1000005 | Ga0207426_1000005613 | 408 |
| 1359 | 3300025302 | Ga0207426_1000048 | Ga0207426_1000048348 | 408 |
| 1360 | 3300025302 | Ga0207426_1000083 | Ga0207426_1000083295 | 408 |
| 1361 | 3300025302 | Ga0207426_1000285 | Ga0207426_100028526 | 408 |
| 1362 | 3300025302 | Ga0207426_1000679 | Ga0207426_100067933 | 408 |
| 1363 | 3300025302 | Ga0207426_1004795 | Ga0207426_10047954 | 408 |
| 1364 | 3300025303 | Ga0209051_1000038 | Ga0209051_1000038234 | 408 |
| 1365 | 3300025303 | Ga0209051_1002114 | Ga0209051_100211413 | 408 |
| 1366 | 3300025303 | Ga0209051_1008605 | Ga0209051_10086055 | 408 |
| 1367 | 3300025304 | Ga0209257_1017738 | Ga0209257_10177382 | 408 |
| 1368 | 3300025304 | Ga0209257_1021472 | Ga0209257_10214722 | 408 |
| 1369 | 3300025304 | Ga0209257_1036226 | Ga0209257_10362262 | 408 |
| 1370 | 3300025901 | Ga0207688_10095087 | Ga0207688_100950872 | 408 |
| 1371 | 3300025909 | Ga0207705_10003450 | Ga0207705_100034505 | 408 |
| 1372 | 3300025911 | Ga0207654_10076509 | Ga0207654_100765091 | 408 |
| 1373 | 3300025913 | Ga0207695_10023098 | Ga0207695_100230986 | 408 |
| 1374 | 3300025916 | Ga0207663_10030964 | Ga0207663_100309642 | 408 |
| 1375 | 3300025916 | Ga0207663_10144453 | Ga0207663_101444531 | 408 |
| 1376 | 3300025919 | Ga0207657_10003943 | Ga0207657_100039431 | 408 |
| 1377 | 3300025919 | Ga0207657_10019641 | Ga0207657_100196412 | 408 |
| 1378 | 3300025919 | Ga0207657_10128807 | Ga0207657_101288072 | 408 |
| 1379 | 3300025921 | Ga0207652_10210488 | Ga0207652_102104882 | 408 |
| 1380 | 3300025922 | Ga0207646_10085365 | Ga0207646_100853653 | 408 |
| 1381 | 3300025924 | Ga0207694_10011887 | Ga0207694_100118872 | 408 |
| 1382 | 3300025928 | Ga0207700_10054476 | Ga0207700_100544762 | 408 |
| 1383 | 3300025933 | Ga0207706_10275657 | Ga0207706_102756572 | 408 |
| 1384 | 3300025934 | Ga0207686_10033052 | Ga0207686_100330522 | 408 |
| 1385 | 3300025936 | Ga0207670_10103001 | Ga0207670_101030012 | 408 |
| 1386 | 3300025941 | Ga0207711_10187866 | Ga0207711_101878662 | 408 |
| 1387 | 3300025941 | Ga0207711_10212205 | Ga0207711_102122052 | 408 |
| 1388 | 3300025942 | Ga0207689_10199198 | Ga0207689_101991982 | 408 |
| 1389 | 3300025945 | Ga0207679_10095758 | Ga0207679_100957583 | 408 |
| 1390 | 3300025949 | Ga0207667_10090792 | Ga0207667_100907922 | 408 |
| 1391 | 3300025960 | Ga0207651_10133214 | Ga0207651_101332141 | 408 |
| 1392 | 3300025981 | Ga0207640_10007812 | Ga0207640_100078124 | 408 |
| 1393 | 3300026035 | Ga0207703_10170902 | Ga0207703_101709021 | 408 |
| 1394 | 3300026067 | Ga0207678_10199179 | Ga0207678_101991792 | 408 |
| 1395 | 3300026067 | Ga0207678_10220986 | Ga0207678_102209861 | 408 |
| 1396 | 3300026075 | Ga0207708_10012415 | Ga0207708_100124152 | 408 |
| 1397 | 3300026078 | Ga0207702_10001270 | Ga0207702_100012706 | 408 |
| 1398 | 3300026078 | Ga0207702_10003872 | Ga0207702_1000387212 | 408 |
| 1399 | 3300026116 | Ga0207674_10029976 | Ga0207674_100299764 | 408 |
| 1400 | 3300026118 | Ga0207675_100309123 | Ga0207675_1003091232 | 408 |
| 1401 | 3300026121 | Ga0207683_10133125 | Ga0207683_101331251 | 408 |
| 1402 | 3300026142 | Ga0207698_10216126 | Ga0207698_102161262 | 408 |
| 1403 | 3300027111 | Ga0209281_1000061 | Ga0209281_1000061214 | 408 |
| 1404 | 3300027111 | Ga0209281_1000081 | Ga0209281_1000081233 | 408 |
| 1405 | 3300027111 | Ga0209281_1000141 | Ga0209281_1000141122 | 408 |
| 1406 | 3300027296 | Ga0209389_1000133 | Ga0209389_10001336 | 408 |
| 1407 | 3300027296 | Ga0209389_1006188 | Ga0209389_10061887 | 408 |
| 1408 | 3300027312 | Ga0209371_1000003 | Ga0209371_1000003518 | 408 |
| 1409 | 3300027312 | Ga0209371_1001726 | Ga0209371_100172610 | 408 |
| 1410 | 3300027312 | Ga0209371_1002486 | Ga0209371_10024866 | 408 |
| 1411 | 3300027357 | Ga0209589_1013845 | Ga0209589_10138457 | 408 |
| 1412 | 3300027361 | Ga0209489_110509 | Ga0209489_1105095 | 408 |
| 1413 | 3300027363 | Ga0209700_100005 | Ga0209700_100005575 | 408 |
| 1414 | 3300027666 | Ga0209282_1000036 | Ga0209282_10000365 | 408 |
| 1415 | 3300027907 | Ga0207428_10004370 | Ga0207428_100043709 | 408 |
| 1416 | 3300028379 | Ga0268266_10003103 | Ga0268266_1000310310 | 408 |
| 1417 | 3300028379 | Ga0268266_10078944 | Ga0268266_100789442 | 408 |
| 1418 | 3300028379 | Ga0268266_10088667 | Ga0268266_100886672 | 408 |
| 1419 | 3300028381 | Ga0268264_10305404 | Ga0268264_103054041 | 408 |
| 1420 | 3300028666 | Ga0265336_10000039 | Ga0265336_1000003953 | 408 |
| 1421 | 3300028794 | Ga0307515_10000121 | Ga0307515_1000012167 | 408 |
| 1422 | 3300028794 | Ga0307515_10000375 | Ga0307515_1000037515 | 408 |
| 1423 | 3300028794 | Ga0307515_10004715 | Ga0307515_100047158 | 408 |
| 1424 | 3300029957 | Ga0265324_10000223 | Ga0265324_1000022314 | 408 |
| 1425 | 3300030500 | Ga0268256_1000004 | Ga0268256_1000004533 | 408 |
| 1426 | 3300030500 | Ga0268256_1001505 | Ga0268256_10015059 | 408 |
| 1427 | 3300030500 | Ga0268256_1002211 | Ga0268256_10022116 | 408 |
| 1428 | 3300030521 | Ga0307511_10025974 | Ga0307511_100259743 | 408 |
| 1429 | 3300030521 | Ga0307511_10090227 | Ga0307511_100902271 | 408 |
| 1430 | 3300031456 | Ga0307513_10000685 | Ga0307513_100006854 | 408 |
| 1431 | 3300031456 | Ga0307513_10098885 | Ga0307513_100988852 | 408 |
| 1432 | 3300031507 | Ga0307509_10005791 | Ga0307509_100057917 | 408 |
| 1433 | 3300031727 | Ga0316576_10122192 | Ga0316576_101221922 | 408 |
| 1434 | 3300031730 | Ga0307516_10001841 | Ga0307516_1000184121 | 408 |
| 1435 | 3300031731 | Ga0307405_10115461 | Ga0307405_101154612 | 408 |
| 1436 | 3300031911 | Ga0307412_10001638 | Ga0307412_1000163810 | 408 |
| 1437 | 3300031911 | Ga0307412_10130928 | Ga0307412_101309282 | 408 |
| 1438 | 3300031911 | Ga0307412_10148001 | Ga0307412_101480012 | 408 |
| 1439 | 3300031967 | Ga0315914_1000002 | Ga0315914_1000002339 | 408 |
| 1440 | 3300033179 | Ga0307507_10032928 | Ga0307507_100329282 | 408 |
| 1441 | 3300033430 | Ga0315913_1000009 | Ga0315913_10000095 | 408 |
| 1442 | 3300033464 | Ga0315915_1000005 | Ga0315915_1000005339 | 408 |
| 1443 | 3300035692 | Ga0373935_0027424 | Ga0373935_0027424_518_1750 | 408 |
| 1444 | 3300035695 | Ga0373927_0002624 | Ga0373927_0002624_3619_4851 | 408 |
| 1445 | 3300035695 | Ga0373927_0013018 | Ga0373927_0013018_4188_5420 | 408 |
| 1446 | 3300035695 | Ga0373927_0050071 | Ga0373927_0050071_441_1670 | 408 |
| 1447 | 3300035695 | Ga0373927_0068840 | Ga0373927_0068840_628_1860 | 408 |
| 1448 | 3300035724 | Ga0373933_0010887 | Ga0373933_0010887_1334_2566 | 408 |
| 1449 | 3300035725 | Ga0373947_0046525 | Ga0373947_0046525_226_1458 | 408 |
| 1450 | 3300036712 | Ga0316584_0042001 | Ga0316584_0042001_786_2021 | 408 |
| 1451 | 3300037068 | Ga0373925_0009563 | Ga0373925_0009563_5693_6925 | 408 |
| 1452 | 3300037068 | Ga0373925_0075689 | Ga0373925_0075689_766_1995 | 408 |
| 1453 | 3300037312 | Ga0395899_0000114 | Ga0395899_0000114_80354_81586 | 408 |
| 1454 | 3300037312 | Ga0395899_0000256 | Ga0395899_0000256_4754_5986 | 408 |
| 1455 | 3300037312 | Ga0395899_0005500 | Ga0395899_0005500_649_1881 | 408 |
| 1456 | 3300037312 | Ga0395899_0008000 | Ga0395899_0008000_4415_5647 | 408 |
| 1457 | 3300037312 | Ga0395899_0030974 | Ga0395899_0030974_753_1985 | 408 |
| 1458 | 3300037312 | Ga0395899_0197059 | Ga0395899_0197059_17_1249 | 408 |
| 1459 | 3300037418 | Ga0395900_0000154 | Ga0395900_0000154_59490_60722 | 408 |
| 1460 | 3300037418 | Ga0395900_0000495 | Ga0395900_0000495_35437_36669 | 408 |
| 1461 | 3300037418 | Ga0395900_0017561 | Ga0395900_0017561_1774_3063 | 408 |
| 1462 | 3300037418 | Ga0395900_0019966 | Ga0395900_0019966_446_1678 | 408 |
| 1463 | 3300037418 | Ga0395900_0021874 | Ga0395900_0021874_3668_4900 | 408 |
| 1464 | 3300037418 | Ga0395900_0026789 | Ga0395900_0026789_4546_5778 | 408 |
| 1465 | 3300037418 | Ga0395900_0034524 | Ga0395900_0034524_3366_4652 | 408 |
| 1466 | 3300037466 | Ga0395898_0000308 | Ga0395898_0000308_53036_54268 | 408 |
| 1467 | 3300037466 | Ga0395898_0001598 | Ga0395898_0001598_26038_27270 | 408 |
| 1468 | 3300037466 | Ga0395898_0008520 | Ga0395898_0008520_2179_3465 | 408 |
| 1469 | 3300037466 | Ga0395898_0009676 | Ga0395898_0009676_6595_7884 | 408 |
| 1470 | 3300037466 | Ga0395898_0047847 | Ga0395898_0047847_2878_4110 | 408 |
| 1471 | 3300037466 | Ga0395898_0082134 | Ga0395898_0082134_380_1612 | 408 |
| 1472 | 3300037466 | Ga0395898_0133780 | Ga0395898_0133780_473_1705 | 408 |
| 1473 | 3300037471 | Ga0395905_0000153 | Ga0395905_0000153_59490_60722 | 408 |
| 1474 | 3300037471 | Ga0395905_0000608 | Ga0395905_0000608_29458_30702 | 408 |
| 1475 | 3300037471 | Ga0395905_0002370 | Ga0395905_0002370_16134_17366 | 408 |
| 1476 | 3300037471 | Ga0395905_0003440 | Ga0395905_0003440_10650_11897 | 408 |
| 1477 | 3300037471 | Ga0395905_0041221 | Ga0395905_0041221_624_1856 | 408 |
| 1478 | 3300037471 | Ga0395905_0042986 | Ga0395905_0042986_1121_2353 | 408 |
| 1479 | 3300037471 | Ga0395905_0071866 | Ga0395905_0071866_1596_2828 | 408 |
| 1480 | 3300037471 | Ga0395905_0118637 | Ga0395905_0118637_1068_2300 | 408 |
| 1481 | 3300037471 | Ga0395905_0260112 | Ga0395905_0260112_155_1387 | 408 |
| 1482 | 3300037853 | Ga0436364_0404283 | Ga0436364_0404283_169_1401 | 408 |
| 1483 | 3300037853 | Ga0436364_0765904 | Ga0436364_0765904_572_1804 | 408 |
| 1484 | 3300038443 | Ga0395901_0000094 | Ga0395901_0000094_38481_39713 | 408 |
| 1485 | 3300038443 | Ga0395901_0000107 | Ga0395901_0000107_53036_54268 | 408 |
| 1486 | 3300038443 | Ga0395901_0000251 | Ga0395901_0000251_18295_19584 | 408 |
| 1487 | 3300038443 | Ga0395901_0000442 | Ga0395901_0000442_43276_44508 | 408 |
| 1488 | 3300038443 | Ga0395901_0007216 | Ga0395901_0007216_7604_8836 | 408 |
| 1489 | 3300038443 | Ga0395901_0026926 | Ga0395901_0026926_1257_2543 | 408 |
| 1490 | 3300038443 | Ga0395901_0068851 | Ga0395901_0068851_1529_2761 | 408 |
| 1491 | 3300038443 | Ga0395901_0133478 | Ga0395901_0133478_66_1298 | 408 |
| 1492 | 3300038443 | Ga0395901_0185078 | Ga0395901_0185078_863_2095 | 408 |
| 1493 | 3300038443 | Ga0395901_0324115 | Ga0395901_0324115_274_1506 | 408 |
| 1494 | 3300039437 | Ga0436365_0719336 | Ga0436365_0719336_2336_3568 | 408 |
| 1495 | 3300039437 | Ga0436365_0753514 | Ga0436365_0753514_2629_3861 | 408 |
| 1496 | 3300039437 | Ga0436365_0840670 | Ga0436365_0840670_15469_16701 | 408 |
| 1497 | 3300039437 | Ga0436365_1017006 | Ga0436365_1017006_9521_10801 | 408 |
| 1498 | 3300039437 | Ga0436365_1031487 | Ga0436365_1031487_2555_3787 | 408 |
| 1499 | 3300039437 | Ga0436365_1892158 | Ga0436365_1892158_20_1252 | 408 |
| 1500 | 3300039438 | Ga0436360_0326901 | Ga0436360_0326901_4214_5446 | 408 |
| 1501 | 3300039438 | Ga0436360_0648562 | Ga0436360_0648562_357_1589 | 408 |
| 1502 | 3300039438 | Ga0436360_0990394 | Ga0436360_0990394_126_1358 | 408 |
| 1503 | 3300039447 | Ga0436361_0135137 | Ga0436361_0135137_1163_2395 | 408 |
| 1504 | 3300039447 | Ga0436361_0507251 | Ga0436361_0507251_415_1647 | 408 |
| 1505 | 3300039450 | Ga0436363_0046001 | Ga0436363_0046001_9741_10973 | 408 |
| 1506 | 3300039450 | Ga0436363_1344620 | Ga0436363_1344620_5797_7029 | 408 |
| 1507 | 3300039453 | Ga0436362_0841325 | Ga0436362_0841325_372_1604 | 408 |
| 1508 | 3300041413 | Ga0439465_0003037 | Ga0439465_0003037_2625_3857 | 408 |
| 1509 | 3300042004 | Ga0439445_0006529 | Ga0439445_0006529_333_1565 | 408 |
| 1510 | 3300042007 | Ga0439449_0034617 | Ga0439449_0034617_323_1555 | 408 |
| 1511 | 3300044684 | Ga0466966_0001049 | Ga0466966_0001049_12806_14074 | 408 |
| 1512 | 3300044684 | Ga0466966_0144483 | Ga0466966_0144483_18_1250 | 408 |
| 1513 | 3300044693 | Ga0466961_0018854 | Ga0466961_0018854_148_1416 | 408 |
| 1514 | 3300044694 | Ga0466963_0047358 | Ga0466963_0047358_51_1283 | 408 |
| 1515 | 3300044706 | Ga0466964_0014140 | Ga0466964_0014140_526_1794 | 408 |
| 1516 | 3300044719 | Ga0466971_0013817 | Ga0466971_0013817_953_2221 | 408 |
| 1517 | 3300044765 | Ga0466970_0024484 | Ga0466970_0024484_1359_2591 | 408 |
| 1518 | 3300044842 | Ga0466957_0000006 | Ga0466957_0000006_71820_73052 | 408 |
| 1519 | 3300044842 | Ga0466957_0010640 | Ga0466957_0010640_230_1462 | 408 |
| 1520 | 3300044901 | Ga0466960_0002991 | Ga0466960_0002991_1750_3009 | 408 |
| 1521 | 3300045049 | Ga0466959_0040715 | Ga0466959_0040715_745_1977 | 408 |
| 1522 | 3300045049 | Ga0466959_0047923 | Ga0466959_0047923_351_1583 | 408 |
| 1523 | 3300045836 | Ga0466958_0033350 | Ga0466958_0033350_1345_2613 | 408 |
| 1524 | 3300045836 | Ga0466958_0071737 | Ga0466958_0071737_85_1317 | 408 |
| 1525 | 3300045976 | Ga0466967_0019819 | Ga0466967_0019819_2615_3847 | 408 |
| 1526 | 3300046452 | Ga0495617_000001 | Ga0495617_000001_312120_313352 | 408 |
| 1527 | 3300046452 | Ga0495617_000162 | Ga0495617_000162_35429_36703 | 408 |
| 1528 | 3300046453 | Ga0495627_000026 | Ga0495627_000026_176447_177679 | 408 |
| 1529 | 3300046454 | Ga0495592_0039380 | Ga0495592_0039380_872_2104 | 408 |
| 1530 | 3300046455 | Ga0495603_0132796 | Ga0495603_0132796_149_1381 | 408 |
| 1531 | 3300046457 | Ga0495590_0000042 | Ga0495590_0000042_53216_54448 | 408 |
| 1532 | 3300046457 | Ga0495590_0001365 | Ga0495590_0001365_1146_2378 | 408 |
| 1533 | 3300046458 | Ga0495591_000068 | Ga0495591_000068_62391_63623 | 408 |
| 1534 | 3300046459 | Ga0495629_0004385 | Ga0495629_0004385_417_1649 | 408 |
| 1535 | 3300046460 | Ga0495638_0000163 | Ga0495638_0000163_71162_72394 | 408 |
| 1536 | 3300046462 | Ga0495651_0022517 | Ga0495651_0022517_576_1808 | 408 |
| 1537 | 3300046463 | Ga0495653_0072342 | Ga0495653_0072342_41_1273 | 408 |
| 1538 | 3300046473 | Ga0495582_0005844 | Ga0495582_0005844_48_1280 | 408 |
| 1539 | 3300046474 | Ga0495605_0000058 | Ga0495605_0000058_36904_38136 | 408 |
| 1540 | 3300046474 | Ga0495605_0000623 | Ga0495605_0000623_8221_9459 | 408 |
| 1541 | 3300046474 | Ga0495605_0004673 | Ga0495605_0004673_5092_6324 | 408 |
| 1542 | 3300046474 | Ga0495605_0011941 | Ga0495605_0011941_3475_4707 | 408 |
| 1543 | 3300046474 | Ga0495605_0018157 | Ga0495605_0018157_2398_3630 | 408 |
| 1544 | 3300046477 | Ga0495664_0104900 | Ga0495664_0104900_178_1431 | 408 |
| 1545 | 3300046491 | Ga0495584_0000646 | Ga0495584_0000646_21811_23067 | 408 |
| 1546 | 3300046491 | Ga0495584_0012261 | Ga0495584_0012261_1150_2382 | 408 |
| 1547 | 3300046491 | Ga0495584_0017063 | Ga0495584_0017063_88_1320 | 408 |
| 1548 | 3300046491 | Ga0495584_0018451 | Ga0495584_0018451_2187_3419 | 408 |
| 1549 | 3300046491 | Ga0495584_0129257 | Ga0495584_0129257_33_1262 | 408 |
| 1550 | 3300046492 | Ga0495585_0000003 | Ga0495585_0000003_109692_110966 | 408 |
| 1551 | 3300046492 | Ga0495585_0000032 | Ga0495585_0000032_10169_11401 | 408 |
| 1552 | 3300046492 | Ga0495585_0000321 | Ga0495585_0000321_21426_22682 | 408 |
| 1553 | 3300046492 | Ga0495585_0012725 | Ga0495585_0012725_3382_4614 | 408 |
| 1554 | 3300046492 | Ga0495585_0013397 | Ga0495585_0013397_3280_4512 | 408 |
| 1555 | 3300046492 | Ga0495585_0024094 | Ga0495585_0024094_1747_2979 | 408 |
| 1556 | 3300046492 | Ga0495585_0070281 | Ga0495585_0070281_383_1612 | 408 |
| 1557 | 3300046499 | Ga0495594_0004974 | Ga0495594_0004974_2271_3503 | 408 |
| 1558 | 3300046500 | Ga0495596_0003265 | Ga0495596_0003265_1706_2938 | 408 |
| 1559 | 3300046501 | Ga0495607_0003427 | Ga0495607_0003427_2060_3292 | 408 |
| 1560 | 3300046501 | Ga0495607_0003766 | Ga0495607_0003766_9663_10895 | 408 |
| 1561 | 3300046501 | Ga0495607_0035976 | Ga0495607_0035976_191_1429 | 408 |
| 1562 | 3300046501 | Ga0495607_0073463 | Ga0495607_0073463_301_1533 | 408 |
| 1563 | 3300046506 | Ga0495583_0000082 | Ga0495583_0000082_91259_92491 | 408 |
| 1564 | 3300046506 | Ga0495583_0000170 | Ga0495583_0000170_70140_71372 | 408 |
| 1565 | 3300046506 | Ga0495583_0000200 | Ga0495583_0000200_51053_52285 | 408 |
| 1566 | 3300046506 | Ga0495583_0000496 | Ga0495583_0000496_51072_52346 | 408 |
| 1567 | 3300046506 | Ga0495583_0008181 | Ga0495583_0008181_2348_3580 | 408 |
| 1568 | 3300046507 | Ga0495606_0001544 | Ga0495606_0001544_8080_9312 | 408 |
| 1569 | 3300046507 | Ga0495606_0001795 | Ga0495606_0001795_6275_7507 | 408 |
| 1570 | 3300046507 | Ga0495606_0002165 | Ga0495606_0002165_11342_12574 | 408 |
| 1571 | 3300046507 | Ga0495606_0004946 | Ga0495606_0004946_3509_4747 | 408 |
| 1572 | 3300046511 | Ga0495608_0013532 | Ga0495608_0013532_3770_5002 | 408 |
| 1573 | 3300046512 | Ga0495610_0011466 | Ga0495610_0011466_697_1929 | 408 |
| 1574 | 3300046512 | Ga0495610_0035355 | Ga0495610_0035355_431_1663 | 408 |
| 1575 | 3300046513 | Ga0495616_0000096 | Ga0495616_0000096_41712_42944 | 408 |
| 1576 | 3300046513 | Ga0495616_0001466 | Ga0495616_0001466_8170_9444 | 408 |
| 1577 | 3300046513 | Ga0495616_0006689 | Ga0495616_0006689_678_1910 | 408 |
| 1578 | 3300046513 | Ga0495616_0020237 | Ga0495616_0020237_1124_2356 | 408 |
| 1579 | 3300046513 | Ga0495616_0053853 | Ga0495616_0053853_632_1864 | 408 |
| 1580 | 3300046515 | Ga0495620_0040439 | Ga0495620_0040439_653_1885 | 408 |
| 1581 | 3300046518 | Ga0495631_0003450 | Ga0495631_0003450_1926_3158 | 408 |
| 1582 | 3300046518 | Ga0495631_0010450 | Ga0495631_0010450_873_2105 | 408 |
| 1583 | 3300046518 | Ga0495631_0022130 | Ga0495631_0022130_1065_2297 | 408 |
| 1584 | 3300046519 | Ga0495632_0000377 | Ga0495632_0000377_25946_27178 | 408 |
| 1585 | 3300046519 | Ga0495632_0001515 | Ga0495632_0001515_5582_6814 | 408 |
| 1586 | 3300046519 | Ga0495632_0013879 | Ga0495632_0013879_843_2075 | 408 |
| 1587 | 3300046520 | Ga0495637_0000002 | Ga0495637_0000002_220340_221572 | 408 |
| 1588 | 3300046520 | Ga0495637_0061761 | Ga0495637_0061761_263_1495 | 408 |
| 1589 | 3300046522 | Ga0495643_0000910 | Ga0495643_0000910_2868_4100 | 408 |
| 1590 | 3300046522 | Ga0495643_0001124 | Ga0495643_0001124_141_1373 | 408 |
| 1591 | 3300046522 | Ga0495643_0005591 | Ga0495643_0005591_6268_7500 | 408 |
| 1592 | 3300046522 | Ga0495643_0010166 | Ga0495643_0010166_1067_2299 | 408 |
| 1593 | 3300046522 | Ga0495643_0021651 | Ga0495643_0021651_825_2057 | 408 |
| 1594 | 3300046522 | Ga0495643_0042100 | Ga0495643_0042100_893_2125 | 408 |
| 1595 | 3300046523 | Ga0495644_0016494 | Ga0495644_0016494_182_1414 | 408 |
| 1596 | 3300046524 | Ga0495648_0000011 | Ga0495648_0000011_34783_36057 | 408 |
| 1597 | 3300046524 | Ga0495648_0000307 | Ga0495648_0000307_18590_19822 | 408 |
| 1598 | 3300046524 | Ga0495648_0037801 | Ga0495648_0037801_128_1381 | 408 |
| 1599 | 3300046524 | Ga0495648_0090647 | Ga0495648_0090647_445_1677 | 408 |
| 1600 | 3300046526 | Ga0495666_0048437 | Ga0495666_0048437_88_1320 | 408 |
| 1601 | 3300046528 | Ga0495642_0000001 | Ga0495642_0000001_52905_54137 | 408 |
| 1602 | 3300046529 | Ga0495652_0054795 | Ga0495652_0054795_459_1691 | 408 |
| 1603 | 3300046529 | Ga0495652_0081300 | Ga0495652_0081300_547_1779 | 408 |
| 1604 | 3300046530 | Ga0495654_0002880 | Ga0495654_0002880_3330_4562 | 408 |
| 1605 | 3300046536 | Ga0495587_0012781 | Ga0495587_0012781_2962_4194 | 408 |
| 1606 | 3300046536 | Ga0495587_0016775 | Ga0495587_0016775_1456_2688 | 408 |
| 1607 | 3300046538 | Ga0495609_0000001 | Ga0495609_0000001_854954_856186 | 408 |
| 1608 | 3300046538 | Ga0495609_0004972 | Ga0495609_0004972_331_1563 | 408 |
| 1609 | 3300046538 | Ga0495609_0037377 | Ga0495609_0037377_442_1674 | 408 |
| 1610 | 3300046542 | Ga0495597_0003053 | Ga0495597_0003053_5511_6743 | 408 |
| 1611 | 3300046542 | Ga0495597_0007475 | Ga0495597_0007475_3672_4904 | 408 |
| 1612 | 3300046542 | Ga0495597_0017905 | Ga0495597_0017905_2085_3317 | 408 |
| 1613 | 3300046542 | Ga0495597_0020512 | Ga0495597_0020512_287_1519 | 408 |
| 1614 | 3300046543 | Ga0495645_0001029 | Ga0495645_0001029_7516_8748 | 408 |
| 1615 | 3300046543 | Ga0495645_0075352 | Ga0495645_0075352_383_1615 | 408 |
| 1616 | 3300046557 | Ga0495622_0050612 | Ga0495622_0050612_585_1859 | 408 |
| 1617 | 3300046615 | Ga0495656_0011683 | Ga0495656_0011683_1861_3093 | 408 |
| 1618 | 3300046616 | Ga0495668_0000357 | Ga0495668_0000357_58938_60170 | 408 |
| 1619 | 3300046616 | Ga0495668_0003625 | Ga0495668_0003625_242_1474 | 408 |
| 1620 | 3300046616 | Ga0495668_0007039 | Ga0495668_0007039_2358_3590 | 408 |
| 1621 | 3300046616 | Ga0495668_0012831 | Ga0495668_0012831_109_1341 | 408 |
| 1622 | 3300046616 | Ga0495668_0037188 | Ga0495668_0037188_921_2195 | 408 |
| 1623 | 3300046616 | Ga0495668_0059852 | Ga0495668_0059852_449_1681 | 408 |
| 1624 | 3300046648 | Ga0495611_0007514 | Ga0495611_0007514_1730_2962 | 408 |
| 1625 | 3300046648 | Ga0495611_0037603 | Ga0495611_0037603_286_1515 | 408 |
| 1626 | 3300046660 | Ga0495625_0002669 | Ga0495625_0002669_11871_13103 | 408 |
| 1627 | 3300046660 | Ga0495625_0034133 | Ga0495625_0034133_1621_2853 | 408 |
| 1628 | 3300046663 | Ga0495635_0008379 | Ga0495635_0008379_2454_3686 | 408 |
| 1629 | 3300046665 | Ga0495661_0000040 | Ga0495661_0000040_59589_60821 | 408 |
| 1630 | 3300046665 | Ga0495661_0000089 | Ga0495661_0000089_71999_73231 | 408 |
| 1631 | 3300046665 | Ga0495661_0001925 | Ga0495661_0001925_15253_16485 | 408 |
| 1632 | 3300046665 | Ga0495661_0041042 | Ga0495661_0041042_210_1442 | 408 |
| 1633 | 3300046665 | Ga0495661_0073713 | Ga0495661_0073713_544_1776 | 408 |
| 1634 | 3300046674 | Ga0495588_0000196 | Ga0495588_0000196_33920_35239 | 408 |
| 1635 | 3300046674 | Ga0495588_0063794 | Ga0495588_0063794_47_1279 | 408 |
| 1636 | 3300046675 | Ga0495657_0049882 | Ga0495657_0049882_1087_2340 | 408 |
| 1637 | 3300046675 | Ga0495657_0055050 | Ga0495657_0055050_605_1837 | 408 |
| 1638 | 3300046679 | Ga0495623_0005861 | Ga0495623_0005861_41_1273 | 408 |
| 1639 | 3300046679 | Ga0495623_0029914 | Ga0495623_0029914_95_1327 | 408 |
| 1640 | 3300046680 | Ga0495646_0023831 | Ga0495646_0023831_375_1607 | 408 |
| 1641 | 3300046691 | Ga0495670_0060830 | Ga0495670_0060830_552_1781 | 408 |
| 1642 | 3300046691 | Ga0495670_0072746 | Ga0495670_0072746_140_1372 | 408 |
| 1643 | 3300046692 | Ga0495671_0000167 | Ga0495671_0000167_4015_5247 | 408 |
| 1644 | 3300046692 | Ga0495671_0065006 | Ga0495671_0065006_93_1325 | 408 |
| 1645 | 3300046692 | Ga0495671_0075033 | Ga0495671_0075033_65_1294 | 408 |
| 1646 | 3300046694 | Ga0495649_0000029 | Ga0495649_0000029_107607_108839 | 408 |
| 1647 | 3300046694 | Ga0495649_0000068 | Ga0495649_0000068_55520_56752 | 408 |
| 1648 | 3300046694 | Ga0495649_0024853 | Ga0495649_0024853_101_1333 | 408 |
| 1649 | 3300046794 | Ga0495589_0000015 | Ga0495589_0000015_185092_186324 | 408 |
| 1650 | 3300046794 | Ga0495589_0001782 | Ga0495589_0001782_4081_5313 | 408 |
| 1651 | 3300046794 | Ga0495589_0030225 | Ga0495589_0030225_761_1993 | 408 |
| 1652 | 3300046809 | Ga0495600_0098172 | Ga0495600_0098172_65_1318 | 408 |
| 1653 | 3300046809 | Ga0495600_0102882 | Ga0495600_0102882_97_1329 | 408 |
| 1654 | 3300046810 | Ga0495660_0008103 | Ga0495660_0008103_4509_5741 | 408 |
| 1655 | 3300046810 | Ga0495660_0015717 | Ga0495660_0015717_507_1739 | 408 |
| 1656 | 3300046810 | Ga0495660_0028436 | Ga0495660_0028436_944_2176 | 408 |
| 1657 | 3300047315 | Ga0495581_0022378 | Ga0495581_0022378_2290_3522 | 408 |
| 1658 | 3300047318 | Ga0495636_0000603 | Ga0495636_0000603_10817_12049 | 408 |
| 1659 | 3300047318 | Ga0495636_0008803 | Ga0495636_0008803_2340_3572 | 408 |
| 1660 | 3300047319 | Ga0495674_0002672 | Ga0495674_0002672_1874_3106 | 408 |
| 1661 | 3300047319 | Ga0495674_0113050 | Ga0495674_0113050_1048_2280 | 408 |
| 1662 | 3300047320 | Ga0495672_0000065 | Ga0495672_0000065_135949_137181 | 408 |
| 1663 | 3300047320 | Ga0495672_0008482 | Ga0495672_0008482_944_2176 | 408 |
| 1664 | 3300047321 | Ga0495676_0121095 | Ga0495676_0121095_446_1720 | 408 |
| 1665 | 3300047322 | Ga0495680_0048568 | Ga0495680_0048568_1810_3042 | 408 |
| 1666 | 3300047323 | Ga0495683_0000007 | Ga0495683_0000007_144566_145822 | 408 |
| 1667 | 3300047323 | Ga0495683_0000012 | Ga0495683_0000012_26139_27371 | 408 |
| 1668 | 3300047443 | Ga0495687_000002 | Ga0495687_000002_167153_168385 | 408 |
| 1669 | 3300047443 | Ga0495687_000003 | Ga0495687_000003_644615_645847 | 408 |
| 1670 | 3300047444 | Ga0495675_0015675 | Ga0495675_0015675_3298_4530 | 408 |
| 1671 | 3300047445 | Ga0495677_0000001 | Ga0495677_0000001_513307_514539 | 408 |
| 1672 | 3300047445 | Ga0495677_0000076 | Ga0495677_0000076_43274_44506 | 408 |
| 1673 | 3300047445 | Ga0495677_0000805 | Ga0495677_0000805_10288_11520 | 408 |
| 1674 | 3300047445 | Ga0495677_0014238 | Ga0495677_0014238_1210_2442 | 408 |
| 1675 | 3300047445 | Ga0495677_0028771 | Ga0495677_0028771_249_1481 | 408 |
| 1676 | 3300047469 | Ga0495673_0005697 | Ga0495673_0005697_233_1465 | 408 |
| 1677 | 3300047470 | Ga0495681_0011969 | Ga0495681_0011969_1206_2444 | 408 |
| 1678 | 3300047470 | Ga0495681_0011987 | Ga0495681_0011987_31_1263 | 408 |
| 1679 | 3300047471 | Ga0495684_0091358 | Ga0495684_0091358_1044_2276 | 408 |
| 1680 | 3300047472 | Ga0495686_0000190 | Ga0495686_0000190_7823_9055 | 408 |
| 1681 | 3300047472 | Ga0495686_0007585 | Ga0495686_0007585_2631_3863 | 408 |
| 1682 | 3300047472 | Ga0495686_0017316 | Ga0495686_0017316_2464_3696 | 408 |
| 1683 | 3300048088 | Ga0495602_0000790 | Ga0495602_0000790_5855_7087 | 408 |
| 1684 | 3300048088 | Ga0495602_0082303 | Ga0495602_0082303_1066_2298 | 408 |
| 1685 | 3300048088 | Ga0495602_0129430 | Ga0495602_0129430_630_1862 | 408 |
| 1686 | 3300048088 | Ga0495602_0141383 | Ga0495602_0141383_18_1250 | 408 |
| 1687 | 3300048089 | Ga0495614_0047210 | Ga0495614_0047210_465_1697 | 408 |
| 1688 | 3300048091 | Ga0495626_0000200 | Ga0495626_0000200_30717_31949 | 408 |
| 1689 | 3300048091 | Ga0495626_0031258 | Ga0495626_0031258_1059_2291 | 408 |
| 1690 | 3300048091 | Ga0495626_0034944 | Ga0495626_0034944_1118_2350 | 408 |
| 1691 | 3300048905 | Ga0496102_0004919 | Ga0496102_0004919_3328_4560 | 408 |
| 1692 | 3300048905 | Ga0496102_0088698 | Ga0496102_0088698_620_1852 | 408 |
| 1693 | 3300048906 | Ga0496103_0003160 | Ga0496103_0003160_7301_8533 | 408 |
| 1694 | 3300048909 | Ga0496106_0000102 | Ga0496106_0000102_58465_59697 | 408 |
| 1695 | 3300048909 | Ga0496106_0007261 | Ga0496106_0007261_5719_6951 | 408 |
| 1696 | 3300048909 | Ga0496106_0194358 | Ga0496106_0194358_35_1267 | 408 |
| 1697 | 3300048910 | Ga0496107_0220534 | Ga0496107_0220534_48_1280 | 408 |
| 1698 | 3300048913 | Ga0496110_0281963 | Ga0496110_0281963_115_1347 | 408 |
| 1699 | 3300048914 | Ga0496111_0079905 | Ga0496111_0079905_711_1943 | 408 |
| 1700 | 3300048915 | Ga0496112_0080052 | Ga0496112_0080052_719_1951 | 408 |
| 1701 | 3300048915 | Ga0496112_0170888 | Ga0496112_0170888_340_1572 | 408 |
| 1702 | 3300048916 | Ga0496113_0037616 | Ga0496113_0037616_691_1923 | 408 |
| 1703 | 3300048917 | Ga0496114_0041472 | Ga0496114_0041472_285_1514 | 408 |
| 1704 | 3300048918 | Ga0496115_0013166 | Ga0496115_0013166_2223_3455 | 408 |
| 1705 | 3300048918 | Ga0496115_0027833 | Ga0496115_0027833_79_1311 | 408 |
| 1706 | 3300048919 | Ga0496116_0002317 | Ga0496116_0002317_13094_14326 | 408 |
| 1707 | 3300048919 | Ga0496116_0005236 | Ga0496116_0005236_2986_4218 | 408 |
| 1708 | 3300048919 | Ga0496116_0028857 | Ga0496116_0028857_2104_3342 | 408 |
| 1709 | 3300048920 | Ga0496117_0000016 | Ga0496117_0000016_158219_159457 | 408 |
| 1710 | 3300048920 | Ga0496117_0002604 | Ga0496117_0002604_7322_8554 | 408 |
| 1711 | 3300048920 | Ga0496117_0093419 | Ga0496117_0093419_458_1747 | 408 |
| 1712 | 3300048921 | Ga0496118_0000153 | Ga0496118_0000153_100968_102206 | 408 |
| 1713 | 3300048921 | Ga0496118_0003936 | Ga0496118_0003936_2445_3677 | 408 |
| 1714 | 3300048921 | Ga0496118_0057507 | Ga0496118_0057507_151_1383 | 408 |
| 1715 | 3300048921 | Ga0496118_0059810 | Ga0496118_0059810_670_1908 | 408 |
| 1716 | 3300048922 | Ga0496119_0009047 | Ga0496119_0009047_4427_5665 | 408 |
| 1717 | 3300048922 | Ga0496119_0009777 | Ga0496119_0009777_4775_6013 | 408 |
| 1718 | 3300048922 | Ga0496119_0119957 | Ga0496119_0119957_200_1432 | 408 |
| 1719 | 3300048923 | Ga0496120_0000423 | Ga0496120_0000423_54702_55940 | 408 |
| 1720 | 3300048923 | Ga0496120_0003353 | Ga0496120_0003353_895_2127 | 408 |
| 1721 | 3300048924 | Ga0496121_0004649 | Ga0496121_0004649_9220_10452 | 408 |
| 1722 | 3300048924 | Ga0496121_0073222 | Ga0496121_0073222_471_1703 | 408 |
| 1723 | 3300048924 | Ga0496121_0083501 | Ga0496121_0083501_324_1556 | 408 |
| 1724 | 3300048925 | Ga0496122_0000002 | Ga0496122_0000002_158880_160118 | 408 |
| 1725 | 3300048925 | Ga0496122_0000042 | Ga0496122_0000042_118000_119256 | 408 |
| 1726 | 3300048925 | Ga0496122_0005598 | Ga0496122_0005598_3889_5160 | 408 |
| 1727 | 3300048925 | Ga0496122_0007864 | Ga0496122_0007864_2956_4188 | 408 |
| 1728 | 3300048925 | Ga0496122_0008213 | Ga0496122_0008213_6943_8175 | 408 |
| 1729 | 3300048925 | Ga0496122_0019899 | Ga0496122_0019899_2199_3431 | 408 |
| 1730 | 3300048925 | Ga0496122_0059901 | Ga0496122_0059901_1343_2575 | 408 |
| 1731 | 3300048926 | Ga0496123_0000002 | Ga0496123_0000002_158880_160118 | 408 |
| 1732 | 3300048926 | Ga0496123_0000002 | Ga0496123_0000002_1651565_1652803 | 408 |
| 1733 | 3300048926 | Ga0496123_0000030 | Ga0496123_0000030_172504_173760 | 408 |
| 1734 | 3300048926 | Ga0496123_0002829 | Ga0496123_0002829_3940_5172 | 408 |
| 1735 | 3300048926 | Ga0496123_0005341 | Ga0496123_0005341_11424_12695 | 408 |
| 1736 | 3300048926 | Ga0496123_0029435 | Ga0496123_0029435_1801_3033 | 408 |
| 1737 | 3300048927 | Ga0496124_0001457 | Ga0496124_0001457_16064_17296 | 408 |
| 1738 | 3300048927 | Ga0496124_0016188 | Ga0496124_0016188_3930_5267 | 408 |
| 1739 | 3300048927 | Ga0496124_0101928 | Ga0496124_0101928_500_1738 | 408 |
| 1740 | 3300048927 | Ga0496124_0109444 | Ga0496124_0109444_720_1949 | 408 |
| 1741 | 3300048928 | Ga0496125_0004489 | Ga0496125_0004489_111_1343 | 408 |
| 1742 | 3300048928 | Ga0496125_0008338 | Ga0496125_0008338_3496_4728 | 408 |
| 1743 | 3300048928 | Ga0496125_0019190 | Ga0496125_0019190_345_1577 | 408 |
| 1744 | 3300048928 | Ga0496125_0048146 | Ga0496125_0048146_58_1290 | 408 |
| 1745 | 3300048929 | Ga0496126_0149209 | Ga0496126_0149209_271_1503 | 408 |
| 1746 | 3300049459 | Ga0495678_000015 | Ga0495678_000015_52692_53924 | 408 |
| 1747 | 3300049569 | Ga0501032_0001004 | Ga0501032_0001004_19150_20382 | 408 |
| 1748 | 3300049570 | Ga0501033_0000334 | Ga0501033_0000334_30625_31857 | 408 |
| 1749 | 3300049570 | Ga0501033_0013560 | Ga0501033_0013560_2582_3814 | 408 |
| 1750 | 3300049570 | Ga0501033_0059784 | Ga0501033_0059784_474_1706 | 408 |
| 1751 | 3300049570 | Ga0501033_0104785 | Ga0501033_0104785_760_1995 | 408 |
| 1752 | 3300049570 | Ga0501033_0117774 | Ga0501033_0117774_361_1593 | 408 |
| 1753 | 3300049570 | Ga0501033_0188945 | Ga0501033_0188945_126_1358 | 408 |
| 1754 | 3300049571 | Ga0501034_0107757 | Ga0501034_0107757_1355_2587 | 408 |
| 1755 | 3300049571 | Ga0501034_0112224 | Ga0501034_0112224_1372_2604 | 408 |
| 1756 | 3300049571 | Ga0501034_0145447 | Ga0501034_0145447_949_2181 | 408 |
| 1757 | 3300049571 | Ga0501034_0179429 | Ga0501034_0179429_244_1533 | 408 |
| 1758 | 3300049571 | Ga0501034_0227725 | Ga0501034_0227725_515_1753 | 408 |
| 1759 | 3300049573 | Ga0501037_0000035 | Ga0501037_0000035_69389_70621 | 408 |
| 1760 | 3300049574 | Ga0501038_0094694 | Ga0501038_0094694_381_1613 | 408 |
| 1761 | 3300049574 | Ga0501038_0232182 | Ga0501038_0232182_216_1448 | 408 |
| 1762 | 3300049579 | Ga0501043_0000031 | Ga0501043_0000031_45437_46669 | 408 |
| 1763 | 3300049580 | Ga0501046_0103791 | Ga0501046_0103791_297_1529 | 408 |
| 1764 | 3300049581 | Ga0501047_0035181 | Ga0501047_0035181_1194_2426 | 408 |
| 1765 | 3300049581 | Ga0501047_0122717 | Ga0501047_0122717_932_2164 | 408 |
| 1766 | 3300049581 | Ga0501047_0343457 | Ga0501047_0343457_82_1314 | 408 |
| 1767 | 3300049584 | Ga0501068_0002851 | Ga0501068_0002851_6135_7367 | 408 |
| 1768 | 3300049585 | Ga0501069_0000056 | Ga0501069_0000056_53917_55149 | 408 |
| 1769 | 3300049585 | Ga0501069_0002418 | Ga0501069_0002418_7964_9196 | 408 |
| 1770 | 3300049586 | Ga0501070_0000141 | Ga0501070_0000141_53919_55151 | 408 |
| 1771 | 3300049586 | Ga0501070_0002589 | Ga0501070_0002589_3190_4422 | 408 |
| 1772 | 3300049586 | Ga0501070_0015361 | Ga0501070_0015361_1723_2955 | 408 |
| 1773 | 3300049586 | Ga0501070_0116975 | Ga0501070_0116975_789_2021 | 408 |
| 1774 | 3300049586 | Ga0501070_0188292 | Ga0501070_0188292_310_1542 | 408 |
| 1775 | 3300049589 | Ga0501073_0059206 | Ga0501073_0059206_803_2035 | 408 |
| 1776 | 3300049589 | Ga0501073_0108514 | Ga0501073_0108514_463_1695 | 408 |
| 1777 | 3300049590 | Ga0501074_0069896 | Ga0501074_0069896_343_1575 | 408 |
| 1778 | 3300049742 | Ga0501080_0001729 | Ga0501080_0001729_15196_16428 | 408 |
| 1779 | 3300049742 | Ga0501080_0033576 | Ga0501080_0033576_379_1611 | 408 |
| 1780 | 3300049742 | Ga0501080_0213637 | Ga0501080_0213637_170_1402 | 408 |
| 1781 | 3300049744 | Ga0501083_0001157 | Ga0501083_0001157_8590_9822 | 408 |
| 1782 | 3300049744 | Ga0501083_0009242 | Ga0501083_0009242_753_1985 | 408 |
| 1783 | 3300049822 | Ga0501035_0000036 | Ga0501035_0000036_108808_110040 | 408 |
| 1784 | 3300049822 | Ga0501035_0000761 | Ga0501035_0000761_22335_23567 | 408 |
| 1785 | 3300049822 | Ga0501035_0001273 | Ga0501035_0001273_1835_3067 | 408 |
| 1786 | 3300049822 | Ga0501035_0031757 | Ga0501035_0031757_1576_2808 | 408 |
| 1787 | 3300049822 | Ga0501035_0069871 | Ga0501035_0069871_1398_2630 | 408 |
| 1788 | 3300049823 | Ga0501044_0000011 | Ga0501044_0000011_217522_218754 | 408 |
| 1789 | 3300049823 | Ga0501044_0014052 | Ga0501044_0014052_4910_6142 | 408 |
| 1790 | 3300049823 | Ga0501044_0022095 | Ga0501044_0022095_4344_5576 | 408 |
| 1791 | 3300049823 | Ga0501044_0025149 | Ga0501044_0025149_2469_3701 | 408 |
| 1792 | 3300049823 | Ga0501044_0100831 | Ga0501044_0100831_201_1433 | 408 |
| 1793 | 3300049823 | Ga0501044_0102814 | Ga0501044_0102814_465_1697 | 408 |
| 1794 | 3300049823 | Ga0501044_0172628 | Ga0501044_0172628_761_1993 | 408 |
| 1795 | 3300050491 | nmdc:mga00v17_25311_c1 | nmdc:mga00v17_25311_c1_1273_2508 | 408 |
| 1796 | 3300050491 | nmdc:mga00v17_53_c1 | nmdc:mga00v17_53_c1_29722_30960 | 408 |
| 1797 | 3300050493 | nmdc:mga0k408_38659_c1 | nmdc:mga0k408_38659_c1_1382_2611 | 408 |
| 1798 | 3300050493 | nmdc:mga0k408_75281_c1 | nmdc:mga0k408_75281_c1_279_1544 | 408 |
| 1799 | 3300050494 | nmdc:mga06z11_56792_c1 | nmdc:mga06z11_56792_c1_436_1665 | 408 |
| 1800 | 3300050494 | nmdc:mga06z11_81158_c1 | nmdc:mga06z11_81158_c1_454_1686 | 408 |
| 1801 | 3300050496 | nmdc:mga07m45_19323_c1 | nmdc:mga07m45_19323_c1_2220_3449 | 408 |
| 1802 | 3300050507 | nmdc:mga05p37_56104_c1 | nmdc:mga05p37_56104_c1_3224_4456 | 408 |
| 1803 | 3300050508 | nmdc:mga09592_56316_c1 | nmdc:mga09592_56316_c1_273_1505 | 408 |
| 1804 | 3300050509 | nmdc:mga0qj67_9637_c1 | nmdc:mga0qj67_9637_c1_4926_6158 | 408 |
| 1805 | 3300050510 | nmdc:mga06r32_3229_c1 | nmdc:mga06r32_3229_c1_9018_10250 | 408 |
| 1806 | 3300050511 | nmdc:mga08y16_83869_c1 | nmdc:mga08y16_83869_c1_273_1505 | 408 |
| 1807 | 3300050512 | nmdc:mga0n895_180434_c1 | nmdc:mga0n895_180434_c1_819_2051 | 408 |
| 1808 | 3300050512 | nmdc:mga0n895_67927_c1 | nmdc:mga0n895_67927_c1_252_1484 | 408 |
| 1809 | 3300050515 | nmdc:mga0a205_281592_c1 | nmdc:mga0a205_281592_c1_225_1457 | 408 |
| 1810 | 3300050515 | nmdc:mga0a205_5649_c1 | nmdc:mga0a205_5649_c1_5131_6363 | 408 |
| 1811 | 3300050516 | nmdc:mga0sz30_95_c1 | nmdc:mga0sz30_95_c1_21669_22934 | 408 |
| 1812 | 3300053077 | Ga0495601_0010434 | Ga0495601_0010434_192_1424 | 408 |
| 1813 | 3300053078 | Ga0495612_0000886 | Ga0495612_0000886_8362_9594 | 408 |
| 1814 | 3300053080 | Ga0500635_0000763 | Ga0500635_0000763_5470_6702 | 408 |
| 1815 | 3300053084 | Ga0495595_0067772 | Ga0495595_0067772_349_1581 | 408 |
| 1816 | 3300053092 | Ga0500583_0019165 | Ga0500583_0019165_311_1540 | 408 |
| 1817 | 3300053093 | Ga0500651_0043894 | Ga0500651_0043894_371_1636 | 408 |
| 1818 | 3300053093 | Ga0500651_0059032 | Ga0500651_0059032_93_1325 | 408 |
| 1819 | 3300053109 | Ga0500569_000646 | Ga0500569_000646_892_2124 | 408 |
| 1820 | 3300053109 | Ga0500569_001390 | Ga0500569_001390_1244_2476 | 408 |
| 1821 | 3300053111 | Ga0500572_015523 | Ga0500572_015523_121_1353 | 408 |
| 1822 | 3300053116 | Ga0500592_002513 | Ga0500592_002513_930_2159 | 408 |
| 1823 | 3300053122 | Ga0500608_053633 | Ga0500608_053633_626_1858 | 408 |
| 1824 | 3300053136 | Ga0500559_0007985 | Ga0500559_0007985_2056_3285 | 408 |
| 1825 | 3300053137 | Ga0500561_0000022 | Ga0500561_0000022_28434_29672 | 408 |
| 1826 | 3300053139 | Ga0500568_0000882 | Ga0500568_0000882_5218_6450 | 408 |
| 1827 | 3300053140 | Ga0500573_0016743 | Ga0500573_0016743_1400_2629 | 408 |
| 1828 | 3300053142 | Ga0500577_0003953 | Ga0500577_0003953_234_1463 | 408 |
| 1829 | 3300053148 | Ga0500590_002886 | Ga0500590_002886_3795_5048 | 408 |
| 1830 | 3300053153 | Ga0500616_0005199 | Ga0500616_0005199_2204_3436 | 408 |
| 1831 | 3300053153 | Ga0500616_0005721 | Ga0500616_0005721_6374_7606 | 408 |
| 1832 | 3300053153 | Ga0500616_0010525 | Ga0500616_0010525_4097_5329 | 408 |
| 1833 | 3300053155 | Ga0500620_018905 | Ga0500620_018905_165_1397 | 408 |
| 1834 | 3300053156 | Ga0500622_0000705 | Ga0500622_0000705_27964_29196 | 408 |
| 1835 | 3300053156 | Ga0500622_0002404 | Ga0500622_0002404_12255_13487 | 408 |
| 1836 | 3300053157 | Ga0500624_006670 | Ga0500624_006670_227_1465 | 408 |
| 1837 | 3300053158 | Ga0500627_0064157 | Ga0500627_0064157_130_1365 | 408 |
| 1838 | 3300053161 | Ga0500634_0021256 | Ga0500634_0021256_279_1511 | 408 |
| 1839 | 3300053177 | Ga0500636_0001691 | Ga0500636_0001691_8039_9271 | 408 |
| 1840 | 3300053733 | Ga0500552_000622 | Ga0500552_000622_1705_2937 | 408 |
| 1841 | 3300060353 | Ga0501082_0077538 | Ga0501082_0077538_767_1999 | 408 |
| 1842 | iso_pu_bacteria | 2512875026 | 2512973837 | 408 |
| 1843 | iso_pu_bacteria | 2513237089 | 2513602446 | 408 |
| 1844 | iso_pu_bacteria | 2513237092 | 2513628478 | 408 |
| 1845 | iso_pu_bacteria | 2513237104 | 2513720521 | 408 |
| 1846 | iso_pu_bacteria | 2513237156 | 2513985682 | 408 |
| 1847 | iso_pu_bacteria | 2513237160 | 2514004089 | 408 |
| 1848 | iso_pu_bacteria | 2513237161 | 2514015768 | 408 |
| 1849 | iso_pu_bacteria | 2515154107 | 2515610236 | 408 |
| 1850 | iso_pu_bacteria | 2517487022 | 2517571101 | 408 |
| 1851 | iso_pu_bacteria | 2617270735 | 2617346153 | 408 |
| 1852 | iso_pu_bacteria | 2643221551 | 2643777418 | 408 |
| 1853 | iso_pu_bacteria | 2643221555 | 2643795866 | 408 |
| 1854 | iso_pu_bacteria | 2643221626 | 2644149631 | 408 |
| 1855 | iso_pu_bacteria | 2643221659 | 2644333403 | 408 |
| 1856 | iso_pu_bacteria | 2767802442 | 2770198291 | 408 |
| 1857 | iso_pu_bacteria | 2775506902 | 2776271232 | 408 |
| 1858 | iso_pu_bacteria | 2775506904 | 2776280770 | 408 |
| 1859 | iso_pu_bacteria | 2791355082 | 2792582467 | 408 |
| 1860 | iso_pu_bacteria | 2802428858 | 2802717809 | 408 |
| 1861 | iso_pu_bacteria | 2802428859 | 2802725340 | 408 |
| 1862 | iso_pu_bacteria | 2802428860 | 2802730536 | 408 |
| 1863 | iso_pu_bacteria | 2802428861 | 2802737883 | 408 |
| 1864 | iso_pu_bacteria | 2802428862 | 2802744248 | 408 |
| 1865 | iso_pu_bacteria | 2802428863 | 2802753068 | 408 |
| 1866 | iso_pu_bacteria | 2824679649 | 2824681621 | 408 |
| 1867 | iso_pu_bacteria | 2824687955 | 2824692849 | 408 |
| 1868 | iso_pu_bacteria | 2824704595 | 2824713231 | 408 |
| 1869 | iso_pu_bacteria | 2824753945 | 2824755178 | 408 |
| 1870 | iso_pu_bacteria | 2824763712 | 2824764318 | 408 |
| 1871 | iso_pu_bacteria | 2824773399 | 2824774439 | 408 |
| 1872 | iso_pu_bacteria | 2838122688 | 2838123243 | 408 |
| 1873 | iso_pu_bacteria | 2839993093 | 2839995255 | 408 |
| 1874 | iso_pu_bacteria | 2840764183 | 2840770013 | 408 |
| 1875 | iso_pu_bacteria | 2841941048 | 2841946518 | 408 |
| 1876 | iso_pu_bacteria | 2841949485 | 2841954239 | 408 |
| 1877 | iso_pu_bacteria | 2841966195 | 2841969611 | 408 |
| 1878 | iso_pu_bacteria | 2841974524 | 2841978951 | 408 |
| 1879 | iso_pu_bacteria | 2841983080 | 2841983932 | 408 |
| 1880 | iso_pu_bacteria | 2842871566 | 2842872871 | 408 |
| 1881 | iso_pu_bacteria | 2854916844 | 2854917536 | 408 |
| 1882 | iso_pu_bacteria | 2881665667 | 2881666198 | 408 |
| 1883 | iso_pu_bacteria | 2894652903 | 2894654577 | 408 |
| 1884 | iso_pu_bacteria | 2902405164 | 2902410599 | 408 |
| 1885 | iso_pu_bacteria | 2904711408 | 2904712747 | 408 |
| 1886 | iso_pu_bacteria | 2919679072 | 2919683435 | 408 |
| 1887 | iso_pu_bacteria | 2922393267 | 2922400136 | 408 |
| 1888 | iso_pu_bacteria | 2928521798 | 2928524330 | 408 |
| 1889 | iso_pu_bacteria | 2936996657 | 2937000152 | 408 |
| 1890 | iso_pu_bacteria | 2937029754 | 2937032904 | 408 |
| 1891 | iso_pu_bacteria | 2937036028 | 2937042312 | 408 |
| 1892 | iso_pu_bacteria | 2937078374 | 2937078719 | 408 |
| 1893 | iso_pu_bacteria | 2937084907 | 2937086667 | 408 |
| 1894 | iso_pu_bacteria | 2954011201 | 2954015394 | 408 |
| 1895 | iso_pu_bacteria | 2957375807 | 2957376844 | 408 |
| 1896 | iso_pu_bacteria | 2957437181 | 2957441390 | 408 |
| 1897 | iso_pu_bacteria | 2957443900 | 2957444433 | 408 |
| 1898 | iso_pu_bacteria | 2960591022 | 2960591366 | 408 |
| 1899 | iso_pu_bacteria | 2960617483 | 2960618671 | 408 |
| 1900 | iso_pu_bacteria | 2960631154 | 2960632620 | 408 |
| 1901 | iso_pu_bacteria | 2960660292 | 2960662868 | 408 |
| 1902 | iso_pu_bacteria | 2960680706 | 2960681450 | 408 |
| 1903 | iso_pu_bacteria | 2960693952 | 2960694490 | 408 |
| 1904 | iso_pu_bacteria | 2967686174 | 2967686598 | 408 |
| 1905 | iso_pu_bacteria | 2967728569 | 2967732398 | 408 |
| 1906 | iso_pu_bacteria | 2970026789 | 2970029401 | 408 |
| 1907 | iso_pu_bacteria | 2970122695 | 2970126375 | 408 |
| 1908 | iso_pu_bacteria | 2970143518 | 2970144631 | 408 |
| 1909 | iso_pu_bacteria | 2977530762 | 2977532388 | 408 |
| 1910 | iso_pu_bacteria | 2977544691 | 2977551174 | 408 |
| 1911 | iso_pu_bacteria | 3002141150 | 3002144022 | 408 |
| 1912 | iso_pu_bacteria | 3003665799 | 3003672601 | 408 |
| 1913 | iso_pu_bacteria | 8003999396 | 8004002819 | 408 |
| 1914 | iso_pu_bacteria | 8049293176 | 8049296021 | 408 |
| 1915 | 3300002074 | JGI24748J21848_1000078 | JGI24748J21848_10000789 | 409 |
| 1916 | 3300002239 | JGI24034J26672_10000047 | JGI24034J26672_100000479 | 409 |
| 1917 | 3300005340 | Ga0070689_100030629 | Ga0070689_1000306292 | 409 |
| 1918 | 3300005365 | Ga0070688_100000440 | Ga0070688_1000004406 | 409 |
| 1919 | 3300005466 | Ga0070685_10000538 | Ga0070685_100005384 | 409 |
| 1920 | 3300005548 | Ga0070665_100000087 | Ga0070665_100000087170 | 409 |
| 1921 | 3300005841 | Ga0068863_100000046 | Ga0068863_10000004629 | 409 |
| 1922 | 3300014325 | Ga0163163_10224123 | Ga0163163_102241232 | 409 |
| 1923 | 3300025925 | Ga0207650_10060074 | Ga0207650_100600742 | 409 |
| 1924 | 3300025936 | Ga0207670_10024566 | Ga0207670_100245662 | 409 |
| 1925 | 3300025941 | Ga0207711_10081706 | Ga0207711_100817062 | 409 |
| 1926 | 3300026078 | Ga0207702_10141023 | Ga0207702_101410232 | 409 |
| 1927 | 3300026088 | Ga0207641_10000517 | Ga0207641_1000051728 | 409 |
| 1928 | 3300028379 | Ga0268266_10000009 | Ga0268266_10000009883 | 409 |
| 1929 | 3300035242 | Ga0373962_0006832 | Ga0373962_0006832_66_1301 | 409 |
| 1930 | 3300048905 | Ga0496102_0002133 | Ga0496102_0002133_1991_3220 | 409 |
| 1931 | 3300048906 | Ga0496103_0003397 | Ga0496103_0003397_5997_7226 | 409 |
| 1932 | 3300048908 | Ga0496105_0119077 | Ga0496105_0119077_77_1306 | 409 |
| 1933 | 3300048920 | Ga0496117_0043739 | Ga0496117_0043739_1161_2390 | 409 |
| 1934 | 3300048921 | Ga0496118_0012501 | Ga0496118_0012501_1991_3220 | 409 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3exi-assembly1.cif.gz_A-2 | crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex with the subunit-binding domain (sbd) of e2p, but sbd cannot be modeled into the electron density | 0.9451 | 71 | 372 |
| 1qs0-assembly1.cif.gz_A-2 | crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b) | 0.9326 | 3 | 405 |
| 1qs0-assembly1.cif.gz_A-2 | crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b) | 0.9215 | 3 | 405 |
| 6cer-assembly2.cif.gz_G | human pyruvate dehydrogenase complex e1 component v138m mutation | 0.9203 | 71 | 387 |
| 6cer-assembly1.cif.gz_A | human pyruvate dehydrogenase complex e1 component v138m mutation | 0.9155 | 71 | 387 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2bp7G00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9337 | 3 | 405 | 3.40.50.970 |
| 2bp7G00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9227 | 3 | 405 | 3.40.50.970 |
| 1um9A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8995 | 53 | 408 | 3.40.50.970 |
| af_I1N1B9_20_344_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8961 | 71 | 355 | 3.40.50.970 |
| af_B4FGJ4_23_381_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8926 | 75 | 397 | 3.40.50.970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A381XZC0-F1-model_v4 | Dehydrogenase E1 component domain-containing protein | 0.9641 | 47 | 349 |
GO:0003863
GO:0009083 |
| AF-A0A529SZ83-F1-model_v4 | 2-oxoisovalerate dehydrogenase subunit alpha (EC 1.2.4.4) (Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain) | 0.9629 | 53 | 305 |
GO:0003863
GO:0009083 |
| AF-A0A529SZ83-F1-model_v4 | 2-oxoisovalerate dehydrogenase subunit alpha (EC 1.2.4.4) (Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain) | 0.9592 | 53 | 305 |
GO:0003863
GO:0009083 |
| AF-A0A381XZC0-F1-model_v4 | Dehydrogenase E1 component domain-containing protein | 0.9579 | 47 | 349 |
GO:0003863
GO:0009083 |
| AF-A4F0C7-F1-model_v4 | 2-oxoisovalerate dehydrogenase subunit alpha (EC 1.2.4.4) (Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain) | 0.9539 | 1 | 345 |
GO:0003863
GO:0009083 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar