F496092

General Info

Members Datasets Scaffolds Average Seq Length
1934 1300 1057 408

Family's Representative Sequence

Representative Sequence 3300031239|Ga0265328_10017627|Ga0265328_100176272
Length 401
Sequence MPSFEPLRLHVPEPTGRPGHDTDFSYLPISEAGAVRRPPVDAQAAQTSDLAFTLIRVLDKDGKAVGPWAPDIGVEQLRKGMRSMLRTRAFDARMLIAQRQKKMSFYMQCLGEEAIACAHAQALVDGDMCFPTYRQQGLLLSRDDVSMVDMICQLYSNQRDPLKGRQLPVMYSSKKQGFFSISGNLATQVIQAVGWAMASAIKGDTKVASSWIGDGATAEADFHTGLTFAHVYRAPVILNVVNNQWAISTFQAIAGGEGTTFAARGVGNGIASLRVDGNDFLAVYAASQWALERARRNLGPTLIEWVTYRAGPHSTSDDPSKYRPANDAARFPLGDPIVRLKQHLMGLGAWSDAEHEATQKELEAQYGTLADGHTRSPAEMFEDVYKEMPAHLRRQRQELGI

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501050 Microvirga lupini Lut6 Isolate Nodule
3 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
4 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
5 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
6 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
7 2509276019 Ensifer aridi TW10 Isolate Nodule
8 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
9 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
10 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
11 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
12 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
13 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
14 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
15 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
16 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
17 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
18 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
19 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
20 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
21 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
22 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
23 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
24 2512875024 Mesorhizobium loti R88b Isolate Nodule
25 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
26 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
27 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
28 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
29 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
30 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
31 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
32 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
33 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
34 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
35 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
36 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
37 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
38 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
39 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
40 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
41 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
42 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
43 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
44 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
45 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
46 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
47 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
48 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
49 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
50 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
51 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
52 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
53 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
54 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
55 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
56 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
57 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
58 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
59 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
60 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
61 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
62 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
63 2519899620 Rhizobium sp. Pop5 Isolate Nodule
64 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
65 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
66 2534681786 Brucella suis 92/29 Isolate Unclassified
67 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
68 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
69 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
70 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
71 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
72 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
73 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
74 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
75 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
76 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
77 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
78 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
79 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
80 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
81 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
82 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
83 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
84 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
85 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
86 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
87 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
88 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
89 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
90 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
91 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
92 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
93 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
94 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
95 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
96 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
97 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
98 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
99 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
100 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
101 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
102 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
103 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
104 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
105 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
106 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
107 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
108 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
109 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
110 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
111 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
112 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
113 2643221556 Massilia sp. Root1485 Isolate Unclassified
114 2643221557 Ensifer sp. Root558 Isolate Unclassified
115 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
116 2643221582 Rhizobium sp. Root651 Isolate Unclassified
117 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
118 2643221599 Rhizobium sp. Root708 Isolate Unclassified
119 2643221607 Rhizobium sp. Root73 Isolate Unclassified
120 2643221610 Ensifer sp. Root74 Isolate Unclassified
121 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
122 2643221626 Ensifer sp. Root31 Isolate Unclassified
123 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
124 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
125 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
126 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
127 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
128 2643221655 Ensifer sp. Root1252 Isolate Unclassified
129 2643221659 Ensifer sp. Root127 Isolate Unclassified
130 2643221668 Ensifer sp. Root423 Isolate Unclassified
131 2643221675 Ensifer sp. Root1298 Isolate Unclassified
132 2643221680 Ensifer sp. Root1312 Isolate Unclassified
133 2643221684 Massilia sp. Root133 Isolate Unclassified
134 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
135 2643221688 Rhizobium sp. Root482 Isolate Unclassified
136 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
137 2643221693 Rhizobium sp. Root491 Isolate Unclassified
138 2643221698 Ensifer sp. Root142 Isolate Unclassified
139 2643221712 Ensifer sp. Root258 Isolate Unclassified
140 2643221718 Rhizobium sp. Root268 Isolate Unclassified
141 2643221723 Ensifer sp. Root278 Isolate Unclassified
142 2643221726 Ensifer sp. Root954 Isolate Unclassified
143 2643221733 Bosea sp. Root381 Isolate Unclassified
144 2643221734 Bosea sp. Root670 Isolate Unclassified
145 2643221736 Bosea sp. Root483D1 Isolate Unclassified
146 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
147 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
148 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
149 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
150 2718217882 Rhizobium sp. N741 Isolate Nodule
151 2718217927 Rhizobium sp. N324 Isolate Nodule
152 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
153 2718218009 Rhizobium sp. N561 Isolate Nodule
154 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
155 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
156 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
157 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
158 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
159 2718218363 Rhizobium sp. N113 Isolate Nodule
160 2718218365 Rhizobium sp. N731 Isolate Nodule
161 2718218366 Rhizobium sp. N621 Isolate Nodule
162 2718218423 Rhizobium sp. N941 Isolate Nodule
163 2721755514 Rhizobium sp. N6212 Isolate Nodule
164 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
165 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
166 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
167 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
168 2721755809 Rhizobium sp. N541 Isolate Nodule
169 2721755810 Rhizobium sp. N871 Isolate Nodule
170 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
171 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
172 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
173 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
174 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
175 2728369365 Rhizobium sp. N1341 Isolate Nodule
176 2728369397 Rhizobium sp. N1314 Isolate Nodule
177 2738541293 Rhizobium sp. GV031 Isolate Unclassified
178 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
179 2738543024 Aminobacter sp. AP02 Isolate Unclassified
180 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
181 2751185800 Brucella pituitosa AA2 Isolate Unclassified
182 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
183 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
184 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
185 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
186 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
187 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
188 2773857925 Microvirga vignae BR3299 Isolate Unclassified
189 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
190 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
191 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
192 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
193 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
194 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
195 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
196 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
197 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
198 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
199 2791355199
200 2791355256 Rhizobium sp. M10 Isolate Nodule
201 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
202 2791355260 Rhizobium sp. L9 Isolate Nodule
203 2791355261 Rhizobium sp. J15 Isolate Nodule
204 2791355262 Rhizobium sp. M1 Isolate Nodule
205 2791355263 Rhizobium chutanense C5 Isolate Nodule
206 2791355264 Rhizobium sp. S9 Isolate Nodule
207 2791355265 Rhizobium sp. H4 Isolate Nodule
208 2791355266 Rhizobium sp. L43 Isolate Nodule
209 2791355267 Rhizobium sp. L18 Isolate Nodule
210 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
211 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
212 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
213 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
214 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
215 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
216 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
217 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
218 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
219 2802429633 Rhizobium anhuiense J3 Isolate Nodule
220 2802429634 Rhizobium anhuiense S10 Isolate Nodule
221 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
222 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
223 2802429637 Rhizobium anhuiense C15 Isolate Nodule
224 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
225 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
226 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
227 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
228 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
229 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
230 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
231 2818991467 Bosea vestrisii 3192 Isolate Unclassified
232 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
233 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
234 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
235 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
236 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
237 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
238 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
239 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
240 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
241 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
242 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
243 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
244 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
245 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
246 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
247 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
248 2838061910 Rhizobium phaseoli L15 Isolate Nodule
249 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
250 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
251 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
252 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
253 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
254 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
255 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
256 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
257 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
258 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
259 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
260 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
261 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
262 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
263 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
264 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
265 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
266 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
267 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
268 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
269 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
270 2841760612 Bosea sp. Tri-49 Isolate Nodule
271 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
272 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
273 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
274 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
275 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
276 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
277 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
278 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
279 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
280 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
281 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
282 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
283 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
284 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
285 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
286 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
287 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
288 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
289 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
290 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
291 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
292 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
293 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
294 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
295 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
296 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
297 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
298 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
299 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
300 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
301 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
302 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
303 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
304 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
305 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
306 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
307 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
308 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
309 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
310 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
311 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
312 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
313 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
314 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
315 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
316 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
317 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
318 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
319 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
320 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
321 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
322 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
323 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
324 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
325 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
326 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
327 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
328 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
329 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
330 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
331 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
332 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
333 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
334 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
335 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
336 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
337 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
338 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
339 2844104063 Bosea sp. Tri-39 Isolate Nodule
340 2844163670 Ensifer sp. 1H6 Isolate Unclassified
341 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
342 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
343 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
344 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
345 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
346 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
347 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
348 2851182111 Bosea sp. Tri-44 Isolate Nodule
349 2851246043 Bosea sp. Tri-54 Isolate Nodule
350 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
351 2854911287 Brucella lupini LUP21 Isolate Unclassified
352 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
353 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
354 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
355 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
356 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
357 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
358 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
359 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
360 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
361 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
362 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
363 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
364 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
365 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
366 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
367 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
368 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
369 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
370 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
371 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
372 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
373 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
374 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
375 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
376 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
377 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
378 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
379 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
380 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
381 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
382 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
383 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
384 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
385 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
386 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
387 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
388 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
389 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
390 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
391 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
392 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
393 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
394 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
395 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
396 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
397 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
398 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
399 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
400 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
401 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
402 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
403 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
404 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
405 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
406 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
407 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
408 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
409 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
410 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
411 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
412 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
413 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
414 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
415 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
416 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
417 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
418 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
419 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
420 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
421 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
422 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
423 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
424 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
425 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
426 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
427 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
428 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
429 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
430 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
431 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
432 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
433 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
434 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
435 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
436 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
437 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
438 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
439 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
440 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
441 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
442 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
443 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
444 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
445 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
446 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
447 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
448 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
449 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
450 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
451 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
452 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
453 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
454 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
455 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
456 2904564687 Burkholderia sp. 571 Isolate Unclassified
457 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
458 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
459 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
460 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
461 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
462 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
463 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
464 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
465 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
466 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
467 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
468 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
469 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
470 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
471 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
472 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
473 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
474 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
475 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
476 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
477 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
478 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
479 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
480 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
481 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
482 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
483 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
484 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
485 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
486 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
487 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
488 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
489 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
490 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
491 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
492 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
493 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
494 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
495 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
496 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
497 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
498 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
499 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
500 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
501 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
502 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
503 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
504 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
505 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
506 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
507 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
508 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
509 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
510 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
511 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
512 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
513 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
514 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
515 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
516 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
517 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
518 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
519 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
520 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
521 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
522 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
523 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
524 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
525 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
526 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
527 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
528 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
529 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
530 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
531 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
532 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
533 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
534 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
535 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
536 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
537 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
538 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
539 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
540 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
541 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
542 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
543 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
544 2928536128 Burkholderia sola 565 Isolate Unclassified
545 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
546 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
547 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
548 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
549 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
550 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
551 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
552 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
553 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
554 2936381700 Rhizobium chutanense C16 Isolate Unclassified
555 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
556 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
557 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
558 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
559 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
560 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
561 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
562 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
563 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
564 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
565 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
566 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
567 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
568 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
569 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
570 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
571 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
572 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
573 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
574 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
575 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
576 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
577 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
578 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
579 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
580 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
581 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
582 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
583 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
584 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
585 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
586 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
587 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
588 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
589 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
590 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
591 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
592 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
593 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
594 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
595 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
596 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
597 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
598 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
599 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
600 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
601 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
602 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
603 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
604 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
605 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
606 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
607 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
608 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
609 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
610 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
611 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
612 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
613 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
614 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
615 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
616 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
617 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
618 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
619 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
620 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
621 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
622 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
623 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
624 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
625 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
626 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
627 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
628 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
629 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
630 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
631 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
632 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
633 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
634 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
635 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
636 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
637 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
638 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
639 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
640 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
641 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
642 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
643 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
644 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
645 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
646 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
647 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
648 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
649 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
650 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
651 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
652 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
653 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
654 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
655 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
656 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
657 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
658 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
659 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
660 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
661 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
662 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
663 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
664 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
665 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
666 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
667 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
668 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
669 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
670 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
671 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
672 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
673 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
674 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
675 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
676 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
677 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
678 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
679 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
680 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
681 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
682 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
683 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
684 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
685 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
686 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
687 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
688 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
689 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
690 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
691 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
692 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
693 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
694 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
695 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
696 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
697 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
698 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
699 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
700 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
701 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
702 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
703 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
704 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
705 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
706 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
707 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
708 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
709 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
710 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
711 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
712 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
713 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
714 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
715 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
716 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
717 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
718 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
719 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
720 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
721 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
722 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
723 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
724 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
725 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
726 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
727 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
728 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
729 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
730 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
731 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
732 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
733 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
734 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
735 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
736 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
737 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
738 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
739 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
740 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
741 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
742 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
743 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
744 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
745 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
746 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
747 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
748 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
749 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
750 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
751 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
752 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
753 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
754 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
755 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
756 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
757 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
758 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
759 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
760 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
761 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
762 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
763 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
764 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
765 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
766 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
767 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
768 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
769 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
770 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
771 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
772 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
773 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
774 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
775 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
776 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
777 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
778 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
779 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
780 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
781 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
782 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
783 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
784 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
785 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
786 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
787 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
788 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
789 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
790 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
791 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
792 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
793 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
794 2996887358 Rhizobium sp. R711 Isolate Nodule
795 2996893221 Rhizobium sp. R635 Isolate Nodule
796 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
797 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
798 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
799 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
800 3004167301 Mesorhizobium loti 582 Isolate Unclassified
801 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
802 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
803 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
804 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
805 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
806 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
807 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
808 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
809 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
810 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
811 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
812 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
813 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
814 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
815 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
816 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
817 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
818 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
819 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
820 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
821 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
822 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
823 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
824 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
825 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
826 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
827 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
828 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
829 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
830 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
831 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
832 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
833 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
834 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
835 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
836 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
837 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
838 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
839 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
840 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
841 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
842 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
843 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
844 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
845 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
846 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
847 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
848 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
849 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
850 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
851 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
852 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
853 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
854 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
855 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
856 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
857 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
858 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
859 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
860 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
861 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
862 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
863 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
864 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
865 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
866 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
867 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
868 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
869 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
870 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
871 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
872 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
873 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
874 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
875 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
876 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
877 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
878 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
879 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
880 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
881 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
882 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
883 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
884 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
885 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
886 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
887 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
888 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
889 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
890 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
891 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
892 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
893 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
894 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
895 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
896 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
897 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
898 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
899 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
900 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
901 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
902 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
903 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
904 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
905 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
906 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
907 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
908 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
909 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
910 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
911 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
912 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
913 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
914 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
915 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
916 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
917 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
918 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
919 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
920 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
921 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
922 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
923 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
924 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
925 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
926 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
927 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
928 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
929 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
930 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
931 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
932 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
933 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
934 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
935 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
936 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
937 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
938 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
939 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
940 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
941 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
942 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
943 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
944 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
945 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
946 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
947 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
948 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
949 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
950 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
951 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
952 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
953 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
954 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
955 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
956 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
957 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
958 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
959 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
960 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
961 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
962 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
963 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
964 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
965 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
966 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
967 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
968 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
969 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
970 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
971 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
972 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
973 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
974 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
975 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
976 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
977 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
978 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
979 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
980 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
981 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
982 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
983 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
984 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
985 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
986 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
987 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
988 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
989 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
990 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
991 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
992 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
993 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
994 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
995 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
996 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
997 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
998 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
999 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
1000 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
1001 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
1002 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
1003 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
1004 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1005 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1006 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
1007 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
1008 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
1009 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
1010 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
1011 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
1012 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
1013 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
1014 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
1015 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
1016 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
1017 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
1018 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
1019 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
1020 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
1021 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
1022 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
1023 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
1024 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
1025 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
1026 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
1027 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
1028 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
1029 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
1030 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
1031 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
1032 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
1033 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
1034 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
1035 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
1036 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
1037 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
1038 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
1039 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
1040 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
1041 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
1042 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
1043 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
1044 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
1045 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
1046 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
1047 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
1048 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
1049 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
1050 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
1051 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
1052 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
1053 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
1054 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
1055 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
1056 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
1057 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
1058 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
1059 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
1060 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
1061 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
1062 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
1063 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
1064 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
1065 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
1066 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
1067 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
1068 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
1069 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
1070 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
1071 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
1072 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
1073 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
1074 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
1075 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
1076 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
1077 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
1078 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
1079 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
1080 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
1081 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
1082 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
1083 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
1084 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
1085 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
1086 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
1087 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
1088 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
1089 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
1090 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
1091 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
1092 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
1093 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
1094 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
1095 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
1096 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
1097 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
1098 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
1099 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
1100 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
1101 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
1102 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
1103 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
1104 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
1105 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
1106 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
1107 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
1108 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
1109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
1110 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
1111 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
1112 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
1113 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
1114 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
1115 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
1116 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
1117 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
1118 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
1119 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
1120 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
1121 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
1122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
1123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
1124 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
1125 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
1126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
1127 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
1128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
1129 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
1130 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
1131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
1132 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
1133 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
1134 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
1135 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
1136 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
1137 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
1138 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
1139 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
1140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
1141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
1142 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
1143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
1144 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
1145 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
1146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
1147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
1149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
1152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
1154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
1156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1158 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1159 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1160 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1161 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1162 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1164 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1169 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
1170 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
1171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
1183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
1188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1195 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1196 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1197 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1199 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1200 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
1202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
1203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
1204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
1205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
1206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
1207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
1208 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1209 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
1210 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
1211 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
1212 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
1213 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
1214 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
1215 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
1216 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
1217 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
1218 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
1219 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
1220 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
1221 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1222 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
1223 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
1224 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1225 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
1226 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
1227 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
1228 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
1229 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1230 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
1231 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1232 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
1233 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
1234 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1235 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1236 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
1237 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
1238 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
1239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1240 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1241 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1242 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1243 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1244 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1245 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1246 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1247 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1248 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1249 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1250 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1251 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1252 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1253 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1254 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1255 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1256 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1257 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1258 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1259 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1260 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1261 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1262 8005258706 Rhizobium sp. R693 Isolate Nodule
1263 8005275841 Rhizobium sp. N4311 Isolate Nodule
1264 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1265 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1266 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1267 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1268 8005321885 Rhizobium sp. R72 Isolate Nodule
1269 8005382845 Rhizobium sp. R634 Isolate Nodule
1270 8005395548 Rhizobium sp. R339 Isolate Nodule
1271 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1272 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1273 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1274 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1275 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1276 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1277 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1278 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1279 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1280 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1281 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1282 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1283 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
1284 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1285 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1286 8018176218 Rhizobium sp. N122 Isolate Nodule
1287 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1288 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1289 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1290 8024501048 Rhizobium sp. H4 Isolate Nodule
1291 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
1292 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1293 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
1294 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1295 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1296 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1297 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1298 8056382006 Rhizobium croatiense 13T Isolate Nodule
1299 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
1300 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 54.68
Metatranscriptomes 0.05
Isolates 45.27

Biome Distribution

Category Percentage (%)
Aerial Root 0.31
Bulb 0
Endosphere 12.56
Nodule 35.01
Rhizoplane 1.71
Rhizosphere 38
Stem 0
Stem Tuber 0
Unclassified 12.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000078 3300002074 Bacteria 30305
2 JGI24034J26672_10000047 3300002239 Bacteria 60036
3 JGI25156J39149_1012995 3300002705 Bacteria 1795
4 JGI25162J39368_1001999 3300002737 Bacteria 9096
5 JGI25154J39366_1003005 3300002738 Bacteria 3840
6 JGI25158J39367_1000211 3300002739 Bacteria 13769
7 JGI25157J39369_1000312 3300002741 Bacteria 35057
8 JGI25157J39369_1002353 3300002741 Bacteria 4853
9 JGI25152J39213_1000211 3300002773 Bacteria 39403
10 JGI25152J39213_1001114 3300002773 Bacteria 12553
11 JGI25152J39213_1005026 3300002773 Bacteria 3989
12 JGI25152J39213_1005046 3300002773 Bacteria 3977
13 JGI25150J39212_1000103 3300002774 Bacteria 49029
14 JGI25159J45721_1000106 3300002987 Bacteria 39688
15 JGI25159J45721_1000565 3300002987 Bacteria 16646
16 JGI25151J46595_10000015 3300003187 Bacteria 250420
17 JGI25151J46595_10000085 3300003187 Bacteria 127212
18 JGI25151J46595_10000303 3300003187 Bacteria 53941
19 JGI25151J46595_10000442 3300003187 Bacteria 40576
20 JGI25151J46595_10013448 3300003187 Bacteria 3682
21 JGI25165J46597_1000052 3300003214 Bacteria 236064
22 JGI25165J46597_1000225 3300003214 Bacteria 78516
23 JGI25153J46596_10001373 3300003215 Bacteria 14572
24 JGI25153J46596_10011178 3300003215 Bacteria 3989
25 JGI25153J46596_10011226 3300003215 Bacteria 3977
26 rootL2_10076941 3300003322 Bacteria 4634
27 JGI25160J50197_1000134 3300003354 Bacteria 66627
28 JGI25160J50197_1000357 3300003354 Bacteria 30225
29 JGI25160J50197_1004101 3300003354 Bacteria 6348
30 JGI25160J50197_1013969 3300003354 Bacteria 2709
31 JGI25160J50197_1018240 3300003354 Bacteria 2193
32 JGI25161J50226_1000116 3300003374 Bacteria 62089
33 JGI25161J50226_1000227 3300003374 Bacteria 34620
34 JGI25161J50226_1000272 3300003374 Bacteria 30225
35 JGI25161J50226_1002006 3300003374 Bacteria 5558
36 Ga0006562J51391_1009235 3300003578 Bacteria 6370
37 Ga0055539_1000392 3300003752 Bacteria 17667
38 Ga0055533_1000024 3300003756 Bacteria 338067
39 Ga0055525_1000008 3300003759 Bacteria 604287
40 Ga0055525_1000615 3300003759 Bacteria 14827
41 Ga0055527_1000278 3300003760 Bacteria 30438
42 Ga0055535_1000562 3300003761 Bacteria 31517
43 Ga0055542_1000284 3300003762 Bacteria 56677
44 Ga0055542_1000587 3300003762 Bacteria 31517
45 Ga0055529_1000418 3300003763 Bacteria 43789
46 Ga0055526_1000652 3300003771 Bacteria 26801
47 Ga0055526_1001955 3300003771 Bacteria 14243
48 Ga0055526_1002947 3300003771 Bacteria 11159
49 Ga0055526_1009244 3300003771 Bacteria 4782
50 Ga0055526_1010722 3300003771 Bacteria 4227
51 Ga0055526_1011288 3300003771 Bacteria 4046
52 Ga0055526_1012632 3300003771 Bacteria 3661
53 Ga0055524_1000301 3300003775 Bacteria 47463
54 Ga0055524_1000618 3300003775 Bacteria 25511
55 Ga0055524_1001672 3300003775 Bacteria 12357
56 Ga0055524_1001793 3300003775 Bacteria 11777
57 Ga0055524_1010049 3300003775 Bacteria 3795
58 Ga0055524_1013171 3300003775 Bacteria 3133
59 Ga0055536_1005119 3300003781 Bacteria 6490
60 Ga0055536_1015701 3300003781 Bacteria 2575
61 Ga0055528_1000602 3300003790 Bacteria 26995
62 Ga0055528_1000712 3300003790 Bacteria 23580
63 Ga0055528_1000849 3300003790 Bacteria 20740
64 Ga0055528_1002425 3300003790 Bacteria 9994
65 Ga0055528_1008911 3300003790 Bacteria 4241
66 Ga0055540_1000131 3300003792 Bacteria 75615
67 Ga0055540_1005898 3300003792 Bacteria 5007
68 Ga0055540_1007846 3300003792 Bacteria 3949
69 Ga0055531_10005530 3300003794 Bacteria 7375
70 Ga0055543_1000093 3300004625 Bacteria 78294
71 Ga0055543_1000161 3300004625 Bacteria 56068
72 Ga0055543_1000574 3300004625 Bacteria 20329
73 Ga0065165_1000014 3300005262 Bacteria 292366
74 Ga0065165_1000196 3300005262 Bacteria 104569
75 Ga0065165_1000553 3300005262 Bacteria 56068
76 Ga0065165_1000627 3300005262 Bacteria 51278
77 Ga0070658_10134102 3300005327 Bacteria 2065
78 Ga0070658_10210060 3300005327 Bacteria 1644
79 Ga0070690_100043814 3300005330 Bacteria 2839
80 Ga0068869_100128336 3300005334 Bacteria 1947
81 Ga0070660_100044256 3300005339 Bacteria 3404
82 Ga0070660_100122321 3300005339 Bacteria 2077
83 Ga0070689_100030629 3300005340 Bacteria 4085
84 Ga0070691_10004671 3300005341 Bacteria 6228
85 Ga0070661_100210633 3300005344 Bacteria 1488
86 Ga0070668_100133641 3300005347 Bacteria 1993
87 Ga0070673_100171582 3300005364 Bacteria 1852
88 Ga0070688_100000440 3300005365 Bacteria 20984
89 Ga0070659_100085886 3300005366 Bacteria 2517
90 Ga0070713_100047301 3300005436 Bacteria 3535
91 Ga0070713_100365743 3300005436 Bacteria 1341
92 Ga0070711_100098757 3300005439 Bacteria 2120
93 Ga0070711_100150922 3300005439 Bacteria 1752
94 Ga0070700_100079706 3300005441 Bacteria 2111
95 Ga0070694_100030931 3300005444 Bacteria 3507
96 Ga0070662_100054711 3300005457 Bacteria 2892
97 Ga0070685_10000538 3300005466 Bacteria 21461
98 Ga0070706_100175279 3300005467 Bacteria 2002
99 Ga0070707_100157727 3300005468 Bacteria 2211
100 Ga0070698_100005438 3300005471 Bacteria 13908
101 Ga0070699_100127316 3300005518 Bacteria 2243
102 Ga0070684_100019867 3300005535 Bacteria 5565
103 Ga0068853_100039120 3300005539 Bacteria 4044
104 Ga0068853_100097806 3300005539 Bacteria 2591
105 Ga0070695_100003867 3300005545 Bacteria 8735
106 Ga0070665_100000087 3300005548 Bacteria 177846
107 Ga0070665_100112054 3300005548 Bacteria 2731
108 Ga0070665_100257934 3300005548 Bacteria 1745
109 Ga0068855_100002198 3300005563 Bacteria 24123
110 Ga0068855_100010534 3300005563 Bacteria 11151
111 Ga0068855_100267875 3300005563 Bacteria 1900
112 Ga0068855_100315710 3300005563 Bacteria 1728
113 Ga0070664_100024464 3300005564 Bacteria 4995
114 Ga0070664_100078408 3300005564 Bacteria 2842
115 Ga0068857_100025509 3300005577 Bacteria 5204
116 Ga0068854_100010289 3300005578 Bacteria 6062
117 Ga0068854_100026684 3300005578 Bacteria 3973
118 Ga0068856_100001613 3300005614 Bacteria 23596
119 Ga0068852_100030903 3300005616 Bacteria 4413
120 Ga0068852_100051942 3300005616 Bacteria 3521
121 Ga0068861_100068433 3300005719 Bacteria 2744
122 Ga0068863_100000046 3300005841 Bacteria 143895
123 Ga0081455_10000373 3300005937 Bacteria 59312
124 Ga0081455_10000637 3300005937 Bacteria 45442
125 Ga0081455_10002518 3300005937 Bacteria 21757
126 Ga0081455_10003610 3300005937 Bacteria 17734
127 Ga0081540_1000087 3300005983 Bacteria 99227
128 Ga0081540_1033187 3300005983 Bacteria 2807
129 Ga0081539_10000429 3300005985 Bacteria 89452
130 Ga0081539_10004039 3300005985 Bacteria 16822
131 Ga0075365_10000621 3300006038 Bacteria 13993
132 Ga0075365_10034710 3300006038 Bacteria 3258
133 Ga0075365_10043511 3300006038 Bacteria 2940
134 Ga0075368_10040317 3300006042 Bacteria 1833
135 Ga0075363_100016576 3300006048 Bacteria 3641
136 Ga0075363_100026744 3300006048 Bacteria 2953
137 Ga0075364_10012374 3300006051 Bacteria 5217
138 Ga0075364_10020622 3300006051 Bacteria 4146
139 Ga0075364_10022554 3300006051 Bacteria 3977
140 Ga0075432_10030664 3300006058 Bacteria 1859
141 Ga0070712_100023146 3300006175 Bacteria 4100
142 Ga0070712_100079287 3300006175 Bacteria 2373
143 Ga0075362_10000600 3300006177 Bacteria 10570
144 Ga0075362_10008900 3300006177 Bacteria 3859
145 Ga0075362_10061021 3300006177 Bacteria 1705
146 Ga0075367_10004723 3300006178 Bacteria 6697
147 Ga0075369_10000214 3300006186 Bacteria 17133
148 Ga0075369_10003614 3300006186 Bacteria 5643
149 Ga0075369_10012709 3300006186 Bacteria 3326
150 Ga0075369_10022119 3300006186 Bacteria 2620
151 Ga0075369_10028215 3300006186 Bacteria 2351
152 Ga0075366_10070997 3300006195 Bacteria 2075
153 Ga0075366_10111527 3300006195 Bacteria 1645
154 Ga0075370_10002165 3300006353 Bacteria 9001
155 Ga0075428_100045123 3300006844 Bacteria 4843
156 Ga0075430_100023735 3300006846 Bacteria 5223
157 Ga0075431_100006794 3300006847 Bacteria 11364
158 Ga0075431_100025820 3300006847 Bacteria 6021
159 Ga0075433_10144404 3300006852 Bacteria 2115
160 Ga0075434_100014619 3300006871 Bacteria 7507
161 Ga0075434_100188350 3300006871 Bacteria 2083
162 Ga0075429_100040711 3300006880 Bacteria 4046
163 Ga0079104_1000386 3300006946 Bacteria 51269
164 Ga0099826_10000080 3300006948 Bacteria 48855
165 Ga0075435_100010284 3300007076 Bacteria 6837
166 Ga0099794_10071455 3300007265 Bacteria 1700
167 Ga0105244_10024354 3300009036 Bacteria 3304
168 Ga0105244_10047669 3300009036 Bacteria 2196
169 Ga0111539_10055655 3300009094 Bacteria 4703
170 Ga0114129_10043003 3300009147 Bacteria 6359
171 Ga0105243_10044429 3300009148 Bacteria 3485
172 Ga0105243_10235250 3300009148 Bacteria 1627
173 Ga0105243_10341770 3300009148 Bacteria 1371
174 Ga0105241_10003901 3300009174 Bacteria 11047
175 Ga0105248_10067959 3300009177 Bacteria 4001
176 Ga0105248_10141070 3300009177 Bacteria 2718
177 Ga0105237_10061705 3300009545 Bacteria 3747
178 Ga0105237_10235839 3300009545 Bacteria 1831
179 Ga0105238_10009341 3300009551 Bacteria 9820
180 Ga0105249_10116374 3300009553 Bacteria 2534
181 Ga0123341_1000093 3300009765 Bacteria 37635
182 Ga0123342_1017495 3300009766 Bacteria 5942
183 Ga0105239_10158669 3300010375 Bacteria 2527
184 Ga0157373_10055382 3300013100 Bacteria 2817
185 Ga0157371_10000002 3300013102 Bacteria 665040
186 Ga0157371_10000128 3300013102 Bacteria 116349
187 Ga0157371_10058393 3300013102 Bacteria 2737
188 Ga0157370_10000143 3300013104 Bacteria 87289
189 Ga0157370_10010599 3300013104 Bacteria 9703
190 Ga0157369_10006614 3300013105 Bacteria 13409
191 Ga0157369_10020411 3300013105 Bacteria 7405
192 Ga0157369_10064215 3300013105 Bacteria 3954
193 Ga0157369_10291424 3300013105 Bacteria 1699
194 Ga0171463_1014 3300013249 Bacteria 83917
195 Ga0163163_10224123 3300014325 Bacteria 1929
196 Ga0157380_10012206 3300014326 Bacteria 6225
197 Ga0182006_1042460 3300015261 Bacteria 1782
198 Ga0183363_1028 3300015690 Bacteria 50706
199 Ga0163161_10070378 3300017792 Bacteria 2558
200 Ga0214544_1000063 3300021320 Bacteria 129929
201 Ga0214542_1000095 3300021321 Bacteria 116012
202 Ga0214542_1023913 3300021321 Bacteria 3532
203 Ga0214543_1000008 3300021327 Bacteria 385680
204 Ga0214543_1000026 3300021327 Bacteria 220652
205 Ga0213873_10011471 3300021358 Bacteria 1897
206 Ga0213872_10016302 3300021361 Bacteria 3450
207 Ga0213874_10006267 3300021377 Bacteria 2811
208 Ga0213874_10010612 3300021377 Bacteria 2310
209 Ga0213876_10001001 3300021384 Bacteria 18441
210 Ga0213876_10007938 3300021384 Bacteria 5758
211 Ga0213876_10012988 3300021384 Bacteria 4427
212 Ga0213871_10001994 3300021441 Bacteria 3637
213 Ga0228711_1000003 3300022739 Bacteria 258118
214 Ga0228710_1000003 3300022740 Bacteria 262981
215 Ga0209436_100021 3300025208 Bacteria 102115
216 Ga0209436_101037 3300025208 Bacteria 10611
217 Ga0209674_100007 3300025226 Bacteria 1077082
218 Ga0209672_100069 3300025228 Bacteria 174956
219 Ga0209147_100044 3300025229 Bacteria 300330
220 Ga0209563_100003 3300025230 Bacteria 1932942
221 Ga0209563_100060 3300025230 Bacteria 284876
222 Ga0207427_100282 3300025231 Bacteria 37116
223 Ga0207427_100659 3300025231 Bacteria 16583
224 Ga0209437_100183 3300025233 Bacteria 129519
225 Ga0209258_100031 3300025242 Bacteria 463572
226 Ga0209258_101271 3300025242 Bacteria 9530
227 Ga0207425_1000065 3300025245 Bacteria 127264
228 Ga0207425_1000912 3300025245 Bacteria 14151
229 Ga0207425_1002840 3300025245 Bacteria 5827
230 Ga0207425_1008148 3300025245 Bacteria 2707
231 Ga0209646_1000056 3300025246 Bacteria 269860
232 Ga0209646_1010083 3300025246 Bacteria 1487
233 Ga0209026_1000009 3300025250 Bacteria 531812
234 Ga0209026_1000141 3300025250 Bacteria 114545
235 Ga0209677_100088 3300025253 Bacteria 108817
236 Ga0209677_100112 3300025253 Bacteria 85460
237 Ga0209677_102809 3300025253 Bacteria 6164
238 Ga0209677_104123 3300025253 Bacteria 4345
239 Ga0209148_1000027 3300025254 Bacteria 616374
240 Ga0209148_1000111 3300025254 Bacteria 198095
241 Ga0209759_1000035 3300025256 Bacteria 264254
242 Ga0209759_1001567 3300025256 Bacteria 12468
243 Ga0209759_1005260 3300025256 Bacteria 4588
244 Ga0209129_1000132 3300025258 Bacteria 127262
245 Ga0209129_1001371 3300025258 Bacteria 13681
246 Ga0209129_1001912 3300025258 Bacteria 10968
247 Ga0209129_1002753 3300025258 Bacteria 8219
248 Ga0209129_1003666 3300025258 Bacteria 6535
249 Ga0209129_1003832 3300025258 Bacteria 6279
250 Ga0209233_1000054 3300025261 Bacteria 439669
251 Ga0209233_1000118 3300025261 Bacteria 236172
252 Ga0209565_1013116 3300025263 Bacteria 1949
253 Ga0209455_1000058 3300025272 Bacteria 342028
254 Ga0209455_1000206 3300025272 Bacteria 84430
255 Ga0209455_1000742 3300025272 Bacteria 18682
256 Ga0209673_1000020 3300025273 Bacteria 430653
257 Ga0209673_1000059 3300025273 Bacteria 268892
258 Ga0209673_1000475 3300025273 Bacteria 67091
259 Ga0209673_1003583 3300025273 Bacteria 9041
260 Ga0209673_1006173 3300025273 Bacteria 5863
261 Ga0209673_1006661 3300025273 Bacteria 5518
262 Ga0209673_1008055 3300025273 Bacteria 4743
263 Ga0209673_1009721 3300025273 Bacteria 4131
264 Ga0209673_1018568 3300025273 Bacteria 2523
265 Ga0209673_1028253 3300025273 Bacteria 1809
266 Ga0209130_1000001 3300025284 Bacteria 831557
267 Ga0209130_1000024 3300025284 Bacteria 354212
268 Ga0209130_1000122 3300025284 Bacteria 126935
269 Ga0209130_1000198 3300025284 Bacteria 82557
270 Ga0209675_1000455 3300025291 Bacteria 31451
271 Ga0209676_1020075 3300025292 Bacteria 2279
272 Ga0209025_1000010 3300025294 Bacteria 986612
273 Ga0209025_1000081 3300025294 Bacteria 265899
274 Ga0209025_1000247 3300025294 Bacteria 127264
275 Ga0209025_1000339 3300025294 Bacteria 103239
276 Ga0209025_1004168 3300025294 Bacteria 12801
277 Ga0209025_1004847 3300025294 Bacteria 11356
278 Ga0209025_1007051 3300025294 Bacteria 8510
279 Ga0209025_1026001 3300025294 Bacteria 2955
280 Ga0209564_1000048 3300025295 Bacteria 364806
281 Ga0209564_1000074 3300025295 Bacteria 286043
282 Ga0209564_1000205 3300025295 Bacteria 135901
283 Ga0209564_1000353 3300025295 Bacteria 85747
284 Ga0209564_1000496 3300025295 Bacteria 64984
285 Ga0209564_1001947 3300025295 Bacteria 18289
286 Ga0209564_1002995 3300025295 Bacteria 12135
287 Ga0209564_1003802 3300025295 Bacteria 9788
288 Ga0209564_1006946 3300025295 Bacteria 5949
289 Ga0209564_1012841 3300025295 Bacteria 3613
290 Ga0209758_1000058 3300025297 Bacteria 331603
291 Ga0209758_1000076 3300025297 Bacteria 270615
292 Ga0209758_1000212 3300025297 Bacteria 127597
293 Ga0209758_1000632 3300025297 Bacteria 53987
294 Ga0209758_1001845 3300025297 Bacteria 23249
295 Ga0209758_1001850 3300025297 Bacteria 23235
296 Ga0209758_1009090 3300025297 Bacteria 6266
297 Ga0209758_1009203 3300025297 Bacteria 6200
298 Ga0209758_1012519 3300025297 Bacteria 4736
299 Ga0209758_1014390 3300025297 Bacteria 4212
300 Ga0209050_1023979 3300025298 Bacteria 2127
301 Ga0209256_1000041 3300025299 Bacteria 364827
302 Ga0209256_1000368 3300025299 Bacteria 72598
303 Ga0209256_1000439 3300025299 Bacteria 64161
304 Ga0209256_1000456 3300025299 Bacteria 61717
305 Ga0209256_1000884 3300025299 Bacteria 37000
306 Ga0209256_1001113 3300025299 Bacteria 30755
307 Ga0209256_1002079 3300025299 Bacteria 17595
308 Ga0209256_1006792 3300025299 Bacteria 5907
309 Ga0209256_1007313 3300025299 Bacteria 5492
310 Ga0209256_1009415 3300025299 Bacteria 4289
311 Ga0209256_1010744 3300025299 Bacteria 3780
312 Ga0207426_1000005 3300025302 Bacteria 1037188
313 Ga0207426_1000048 3300025302 Bacteria 409127
314 Ga0207426_1000083 3300025302 Bacteria 298770
315 Ga0207426_1000285 3300025302 Bacteria 102879
316 Ga0207426_1000679 3300025302 Bacteria 41188
317 Ga0207426_1004795 3300025302 Bacteria 6425
318 Ga0209051_1000038 3300025303 Bacteria 320926
319 Ga0209051_1002114 3300025303 Bacteria 14862
320 Ga0209051_1008605 3300025303 Bacteria 5381
321 Ga0209257_1017738 3300025304 Bacteria 2786
322 Ga0209257_1021472 3300025304 Bacteria 2343
323 Ga0209257_1036226 3300025304 Bacteria 1518
324 Ga0207688_10095087 3300025901 Bacteria 1715
325 Ga0207705_10003450 3300025909 Bacteria 12028
326 Ga0207654_10007763 3300025911 Bacteria 5414
327 Ga0207654_10076509 3300025911 Bacteria 2004
328 Ga0207695_10023098 3300025913 Bacteria 7038
329 Ga0207695_10030412 3300025913 Bacteria 5943
330 Ga0207663_10030964 3300025916 Bacteria 3161
331 Ga0207663_10144453 3300025916 Bacteria 1661
332 Ga0207657_10003943 3300025919 Bacteria 15759
333 Ga0207657_10019641 3300025919 Bacteria 6408
334 Ga0207657_10128807 3300025919 Bacteria 2076
335 Ga0207652_10210488 3300025921 Bacteria 1751
336 Ga0207646_10085365 3300025922 Bacteria 2824
337 Ga0207694_10011887 3300025924 Bacteria 6566
338 Ga0207650_10060074 3300025925 Bacteria 2836
339 Ga0207700_10054476 3300025928 Bacteria 3002
340 Ga0207706_10275657 3300025933 Bacteria 1467
341 Ga0207686_10033052 3300025934 Bacteria 3084
342 Ga0207670_10024566 3300025936 Bacteria 3768
343 Ga0207670_10103001 3300025936 Bacteria 2042
344 Ga0207711_10081706 3300025941 Bacteria 2824
345 Ga0207711_10187866 3300025941 Bacteria 1882
346 Ga0207711_10212205 3300025941 Bacteria 1768
347 Ga0207689_10199198 3300025942 Bacteria 1653
348 Ga0207679_10095758 3300025945 Bacteria 2308
349 Ga0207667_10090792 3300025949 Bacteria 3156
350 Ga0207651_10133214 3300025960 Bacteria 1906
351 Ga0207668_10109627 3300025972 Bacteria 2068
352 Ga0207640_10007812 3300025981 Bacteria 5906
353 Ga0207703_10170902 3300026035 Bacteria 1912
354 Ga0207678_10199179 3300026067 Bacteria 1712
355 Ga0207678_10220986 3300026067 Bacteria 1621
356 Ga0207708_10012415 3300026075 Bacteria 6350
357 Ga0207702_10001270 3300026078 Bacteria 25363
358 Ga0207702_10003872 3300026078 Bacteria 13486
359 Ga0207702_10141023 3300026078 Bacteria 2181
360 Ga0207641_10000517 3300026088 Bacteria 43309
361 Ga0207674_10029976 3300026116 Bacteria 5723
362 Ga0207675_100024607 3300026118 Bacteria 5598
363 Ga0207675_100309123 3300026118 Bacteria 1541
364 Ga0207683_10133125 3300026121 Bacteria 2237
365 Ga0207698_10216126 3300026142 Bacteria 1729
366 Ga0209281_1000061 3300027111 Bacteria 293814
367 Ga0209281_1000081 3300027111 Bacteria 258084
368 Ga0209281_1000141 3300027111 Bacteria 175634
369 Ga0209389_1000133 3300027296 Bacteria 65939
370 Ga0209389_1006188 3300027296 Bacteria 10358
371 Ga0209371_1000003 3300027312 Bacteria 1122971
372 Ga0209371_1001726 3300027312 Bacteria 13787
373 Ga0209371_1002486 3300027312 Bacteria 10235
374 Ga0209589_1013845 3300027357 Bacteria 10358
375 Ga0209489_110509 3300027361 Bacteria 10358
376 Ga0209700_100005 3300027363 Bacteria 573969
377 Ga0209282_1000036 3300027666 Bacteria 130242
378 Ga0207428_10004370 3300027907 Bacteria 13483
379 Ga0268266_10000009 3300028379 Bacteria 1097737
380 Ga0268266_10003103 3300028379 Bacteria 16929
381 Ga0268266_10078944 3300028379 Bacteria 2865
382 Ga0268266_10088667 3300028379 Bacteria 2707
383 Ga0268264_10305404 3300028381 Bacteria 1499
384 Ga0265336_10000039 3300028666 Bacteria 149376
385 Ga0307515_10000121 3300028794 Bacteria 188657
386 Ga0307515_10000375 3300028794 Bacteria 109285
387 Ga0307515_10004715 3300028794 Bacteria 27940
388 Ga0307515_10038687 3300028794 Bacteria 7619
389 Ga0265324_10000223 3300029957 Bacteria 43654
390 Ga0268256_1000004 3300030500 Bacteria 1122967
391 Ga0268256_1001505 3300030500 Bacteria 13791
392 Ga0268256_1002211 3300030500 Bacteria 10235
393 Ga0307511_10025974 3300030521 Bacteria 5383
394 Ga0307511_10090227 3300030521 Bacteria 2083
395 Ga0265332_10000022 3300031238 Bacteria 213072
396 Ga0265328_10017627 3300031239 Bacteria 2764
397 Ga0307513_10000685 3300031456 Bacteria 48701
398 Ga0307513_10098885 3300031456 Bacteria 2947
399 Ga0307509_10005791 3300031507 Bacteria 16976
400 Ga0316576_10122192 3300031727 Bacteria 1956
401 Ga0307516_10001841 3300031730 Bacteria 29116
402 Ga0307405_10115461 3300031731 Bacteria 1827
403 Ga0307412_10001638 3300031911 Bacteria 12351
404 Ga0307412_10130928 3300031911 Bacteria 1822
405 Ga0307412_10148001 3300031911 Bacteria 1729
406 Ga0315914_1000002 3300031967 Bacteria 365357
407 Ga0307507_10032928 3300033179 Bacteria 5394
408 Ga0315913_1000009 3300033430 Bacteria 149770
409 Ga0315915_1000005 3300033464 Bacteria 397591
410 Ga0373962_0006832 3300035242 Bacteria 2777
411 Ga0373935_0027424 3300035692 Bacteria 3520
412 Ga0373927_0002624 3300035695 Bacteria 13109
413 Ga0373927_0013018 3300035695 Bacteria 5533
414 Ga0373927_0050071 3300035695 Bacteria 2700
415 Ga0373927_0068840 3300035695 Bacteria 2291
416 Ga0373933_0010887 3300035724 Bacteria 4993
417 Ga0373947_0046525 3300035725 Bacteria 2599
418 Ga0316584_0042001 3300036712 Bacteria 3410
419 Ga0373925_0009563 3300037068 Bacteria 7061
420 Ga0373925_0075689 3300037068 Bacteria 2551
421 Ga0395899_0000114 3300037312 Bacteria 134621
422 Ga0395899_0000256 3300037312 Bacteria 70194
423 Ga0395899_0000388 3300037312 Bacteria 52455
424 Ga0395899_0005500 3300037312 Bacteria 9813
425 Ga0395899_0008000 3300037312 Bacteria 8144
426 Ga0395899_0030974 3300037312 Bacteria 4022
427 Ga0395899_0197059 3300037312 Bacteria 1406
428 Ga0395900_0000154 3300037418 Bacteria 113757
429 Ga0395900_0000495 3300037418 Bacteria 55568
430 Ga0395900_0017561 3300037418 Bacteria 7301
431 Ga0395900_0018932 3300037418 Bacteria 7022
432 Ga0395900_0019966 3300037418 Bacteria 6830
433 Ga0395900_0021874 3300037418 Bacteria 6538
434 Ga0395900_0026789 3300037418 Bacteria 5899
435 Ga0395900_0034524 3300037418 Bacteria 5209
436 Ga0395898_0000308 3300037466 Bacteria 113757
437 Ga0395898_0001598 3300037466 Bacteria 30916
438 Ga0395898_0008520 3300037466 Bacteria 10834
439 Ga0395898_0009676 3300037466 Bacteria 10110
440 Ga0395898_0013150 3300037466 Bacteria 8532
441 Ga0395898_0047847 3300037466 Bacteria 4194
442 Ga0395898_0082134 3300037466 Bacteria 3106
443 Ga0395898_0133780 3300037466 Bacteria 2374
444 Ga0395905_0000153 3300037471 Bacteria 113757
445 Ga0395905_0000608 3300037471 Bacteria 47958
446 Ga0395905_0002370 3300037471 Bacteria 20992
447 Ga0395905_0003440 3300037471 Bacteria 16941
448 Ga0395905_0041221 3300037471 Bacteria 4333
449 Ga0395905_0042986 3300037471 Bacteria 4239
450 Ga0395905_0050293 3300037471 Bacteria 3905
451 Ga0395905_0071866 3300037471 Bacteria 3243
452 Ga0395905_0115933 3300037471 Bacteria 2517
453 Ga0395905_0118637 3300037471 Bacteria 2487
454 Ga0395905_0260112 3300037471 Bacteria 1620
455 Ga0436364_0404283 3300037853 Bacteria 3928
456 Ga0436364_0765904 3300037853 Bacteria 2607
457 Ga0395901_0000094 3300038443 Bacteria 120153
458 Ga0395901_0000107 3300038443 Bacteria 113757
459 Ga0395901_0000251 3300038443 Bacteria 66862
460 Ga0395901_0000442 3300038443 Bacteria 48366
461 Ga0395901_0007216 3300038443 Bacteria 11207
462 Ga0395901_0026926 3300038443 Bacteria 5903
463 Ga0395901_0052706 3300038443 Bacteria 4228
464 Ga0395901_0068851 3300038443 Bacteria 3686
465 Ga0395901_0133478 3300038443 Bacteria 2609
466 Ga0395901_0185078 3300038443 Bacteria 2184
467 Ga0395901_0200299 3300038443 Bacteria 2093
468 Ga0395901_0324115 3300038443 Bacteria 1593
469 Ga0436365_0719336 3300039437 Bacteria 4632
470 Ga0436365_0753514 3300039437 Bacteria 3964
471 Ga0436365_0840670 3300039437 Bacteria 47211
472 Ga0436365_1017006 3300039437 Bacteria 12784
473 Ga0436365_1031487 3300039437 Bacteria 5617
474 Ga0436365_1892158 3300039437 Bacteria 2018
475 Ga0436360_0326901 3300039438 Bacteria 5604
476 Ga0436360_0648562 3300039438 Bacteria 3478
477 Ga0436360_0990394 3300039438 Bacteria 1960
478 Ga0436361_0019078 3300039447 Bacteria 4350
479 Ga0436361_0135137 3300039447 Bacteria 2810
480 Ga0436361_0507251 3300039447 Bacteria 2563
481 Ga0436363_0046001 3300039450 Bacteria 12447
482 Ga0436363_1344620 3300039450 Bacteria 14693
483 Ga0436362_0841325 3300039453 Bacteria 5869
484 Ga0436362_1110877 3300039453 Bacteria 2737
485 Ga0439465_0003037 3300041413 Bacteria 5489
486 Ga0439445_0006529 3300042004 Bacteria 2683
487 Ga0439448_0000551 3300042005 Bacteria 8758
488 Ga0439449_0034617 3300042007 Bacteria 1881
489 Ga0439455_0022279 3300042012 Bacteria 1517
490 Ga0466972_0002549 3300044658 Bacteria 9011
491 Ga0466972_0033285 3300044658 Bacteria 2528
492 Ga0466966_0001049 3300044684 Bacteria 17647
493 Ga0466966_0001134 3300044684 Bacteria 17113
494 Ga0466966_0144483 3300044684 Bacteria 1452
495 Ga0466961_0018854 3300044693 Bacteria 4439
496 Ga0466963_0047358 3300044694 Bacteria 2837
497 Ga0466964_0002584 3300044706 Bacteria 6464
498 Ga0466964_0009335 3300044706 Bacteria 3691
499 Ga0466964_0014140 3300044706 Bacteria 3032
500 Ga0466971_0013817 3300044719 Bacteria 3550
501 Ga0466968_0008349 3300044735 Bacteria 3964
502 Ga0466970_0024484 3300044765 Bacteria 3157
503 Ga0466957_0000006 3300044842 Bacteria 85752
504 Ga0466957_0010640 3300044842 Bacteria 5289
505 Ga0466957_0098143 3300044842 Bacteria 1843
506 Ga0466960_0002991 3300044901 Bacteria 6445
507 Ga0466959_0040715 3300045049 Bacteria 3432
508 Ga0466959_0047923 3300045049 Bacteria 3142
509 Ga0466958_0033350 3300045836 Bacteria 3067
510 Ga0466958_0071737 3300045836 Bacteria 2121
511 Ga0466967_0019819 3300045976 Bacteria 5419
512 Ga0495617_000001 3300046452 Bacteria 877032
513 Ga0495617_000162 3300046452 Bacteria 42454
514 Ga0495627_000026 3300046453 Bacteria 238494
515 Ga0495592_0039380 3300046454 Bacteria 3551
516 Ga0495603_0132796 3300046455 Bacteria 1449
517 Ga0495590_0000042 3300046457 Bacteria 120663
518 Ga0495590_0000224 3300046457 Bacteria 30973
519 Ga0495590_0001365 3300046457 Bacteria 10601
520 Ga0495591_000068 3300046458 Bacteria 117653
521 Ga0495629_0004385 3300046459 Bacteria 10569
522 Ga0495638_0000163 3300046460 Bacteria 103363
523 Ga0495638_0107934 3300046460 Bacteria 1657
524 Ga0495651_0022517 3300046462 Bacteria 4896
525 Ga0495653_0008225 3300046463 Bacteria 8547
526 Ga0495653_0027720 3300046463 Bacteria 4533
527 Ga0495653_0039937 3300046463 Bacteria 3672
528 Ga0495653_0072342 3300046463 Bacteria 2574
529 Ga0495650_0000001 3300046471 Bacteria 1085492
530 Ga0495650_0000089 3300046471 Bacteria 233415
531 Ga0495650_0042514 3300046471 Bacteria 1934
532 Ga0495580_0031612 3300046472 Bacteria 3823
533 Ga0495582_0005844 3300046473 Bacteria 6854
534 Ga0495605_0000058 3300046474 Bacteria 150303
535 Ga0495605_0000084 3300046474 Bacteria 124941
536 Ga0495605_0000623 3300046474 Bacteria 27301
537 Ga0495605_0004673 3300046474 Bacteria 8006
538 Ga0495605_0009542 3300046474 Bacteria 5448
539 Ga0495605_0011941 3300046474 Bacteria 4828
540 Ga0495605_0018157 3300046474 Bacteria 3776
541 Ga0495605_0041941 3300046474 Bacteria 2277
542 Ga0495605_0099864 3300046474 Bacteria 1335
543 Ga0495664_0104900 3300046477 Bacteria 1703
544 Ga0495584_0000002 3300046491 Bacteria 512179
545 Ga0495584_0000041 3300046491 Bacteria 91074
546 Ga0495584_0000646 3300046491 Bacteria 23214
547 Ga0495584_0001080 3300046491 Bacteria 16946
548 Ga0495584_0009158 3300046491 Bacteria 5107
549 Ga0495584_0012261 3300046491 Bacteria 4379
550 Ga0495584_0017063 3300046491 Bacteria 3701
551 Ga0495584_0018451 3300046491 Bacteria 3545
552 Ga0495584_0023602 3300046491 Bacteria 3118
553 Ga0495584_0081236 3300046491 Bacteria 1632
554 Ga0495584_0129257 3300046491 Bacteria 1281
555 Ga0495585_0000003 3300046492 Bacteria 406344
556 Ga0495585_0000032 3300046492 Bacteria 143439
557 Ga0495585_0000321 3300046492 Bacteria 47441
558 Ga0495585_0001376 3300046492 Bacteria 19232
559 Ga0495585_0012725 3300046492 Bacteria 4952
560 Ga0495585_0013397 3300046492 Bacteria 4800
561 Ga0495585_0014426 3300046492 Bacteria 4603
562 Ga0495585_0017671 3300046492 Bacteria 4118
563 Ga0495585_0022287 3300046492 Bacteria 3636
564 Ga0495585_0023845 3300046492 Bacteria 3509
565 Ga0495585_0024094 3300046492 Bacteria 3491
566 Ga0495585_0030544 3300046492 Bacteria 3064
567 Ga0495585_0070281 3300046492 Bacteria 1910
568 Ga0495585_0121941 3300046492 Bacteria 1378
569 Ga0495585_0124879 3300046492 Bacteria 1358
570 Ga0495594_0004974 3300046499 Bacteria 6840
571 Ga0495594_0009107 3300046499 Bacteria 5125
572 Ga0495594_0013296 3300046499 Bacteria 4294
573 Ga0495594_0027514 3300046499 Bacteria 3064
574 Ga0495594_0067694 3300046499 Bacteria 1982
575 Ga0495596_0000584 3300046500 Bacteria 22752
576 Ga0495596_0003265 3300046500 Bacteria 8284
577 Ga0495596_0003747 3300046500 Bacteria 7587
578 Ga0495596_0007288 3300046500 Bacteria 5000
579 Ga0495596_0009002 3300046500 Bacteria 4412
580 Ga0495596_0015259 3300046500 Bacteria 3220
581 Ga0495596_0017390 3300046500 Bacteria 2977
582 Ga0495607_0003427 3300046501 Bacteria 12145
583 Ga0495607_0003766 3300046501 Bacteria 11467
584 Ga0495607_0007099 3300046501 Bacteria 7788
585 Ga0495607_0010428 3300046501 Bacteria 6249
586 Ga0495607_0035976 3300046501 Bacteria 2989
587 Ga0495607_0073463 3300046501 Bacteria 1901
588 Ga0495607_0084222 3300046501 Bacteria 1740
589 Ga0495583_0000082 3300046506 Bacteria 165696
590 Ga0495583_0000170 3300046506 Bacteria 111003
591 Ga0495583_0000190 3300046506 Bacteria 103427
592 Ga0495583_0000200 3300046506 Bacteria 100827
593 Ga0495583_0000496 3300046506 Bacteria 57163
594 Ga0495583_0002859 3300046506 Bacteria 14051
595 Ga0495583_0006919 3300046506 Bacteria 7289
596 Ga0495583_0008181 3300046506 Bacteria 6429
597 Ga0495583_0018037 3300046506 Bacteria 3728
598 Ga0495606_0001544 3300046507 Bacteria 30344
599 Ga0495606_0001795 3300046507 Bacteria 27308
600 Ga0495606_0002165 3300046507 Bacteria 23633
601 Ga0495606_0004946 3300046507 Bacteria 13017
602 Ga0495606_0074720 3300046507 Bacteria 2122
603 Ga0495608_0013532 3300046511 Bacteria 5659
604 Ga0495610_0011466 3300046512 Bacteria 5418
605 Ga0495610_0035355 3300046512 Bacteria 2566
606 Ga0495616_0000096 3300046513 Bacteria 74471
607 Ga0495616_0001466 3300046513 Bacteria 16369
608 Ga0495616_0002443 3300046513 Bacteria 12328
609 Ga0495616_0006483 3300046513 Bacteria 7080
610 Ga0495616_0006689 3300046513 Bacteria 6955
611 Ga0495616_0020237 3300046513 Bacteria 3622
612 Ga0495616_0038676 3300046513 Bacteria 2448
613 Ga0495616_0053853 3300046513 Bacteria 1998
614 Ga0495616_0086701 3300046513 Bacteria 1488
615 Ga0495616_0103371 3300046513 Bacteria 1333
616 Ga0495618_0004380 3300046514 Bacteria 8683
617 Ga0495620_0040439 3300046515 Bacteria 2051
618 Ga0495628_0045699 3300046516 Bacteria 3481
619 Ga0495631_0000012 3300046518 Bacteria 110338
620 Ga0495631_0003450 3300046518 Bacteria 8651
621 Ga0495631_0003486 3300046518 Bacteria 8608
622 Ga0495631_0010450 3300046518 Bacteria 4590
623 Ga0495631_0021102 3300046518 Bacteria 3035
624 Ga0495631_0022130 3300046518 Bacteria 2956
625 Ga0495631_0028653 3300046518 Bacteria 2539
626 Ga0495632_0000028 3300046519 Bacteria 171089
627 Ga0495632_0000377 3300046519 Bacteria 42535
628 Ga0495632_0001515 3300046519 Bacteria 19187
629 Ga0495632_0013879 3300046519 Bacteria 4578
630 Ga0495632_0017639 3300046519 Bacteria 3935
631 Ga0495632_0069723 3300046519 Bacteria 1692
632 Ga0495637_0000002 3300046520 Bacteria 629280
633 Ga0495637_0061761 3300046520 Bacteria 1535
634 Ga0495643_0000910 3300046522 Bacteria 31179
635 Ga0495643_0001124 3300046522 Bacteria 26414
636 Ga0495643_0005591 3300046522 Bacteria 8454
637 Ga0495643_0009852 3300046522 Bacteria 5910
638 Ga0495643_0010166 3300046522 Bacteria 5803
639 Ga0495643_0011275 3300046522 Bacteria 5454
640 Ga0495643_0021651 3300046522 Bacteria 3683
641 Ga0495643_0042100 3300046522 Bacteria 2488
642 Ga0495644_0003802 3300046523 Bacteria 5940
643 Ga0495644_0016494 3300046523 Bacteria 2827
644 Ga0495644_0048588 3300046523 Bacteria 1593
645 Ga0495648_0000011 3300046524 Bacteria 299518
646 Ga0495648_0000307 3300046524 Bacteria 54310
647 Ga0495648_0003980 3300046524 Bacteria 12787
648 Ga0495648_0016383 3300046524 Bacteria 5347
649 Ga0495648_0037801 3300046524 Bacteria 3097
650 Ga0495648_0090647 3300046524 Bacteria 1712
651 Ga0495663_0039715 3300046525 Bacteria 1427
652 Ga0495666_0000154 3300046526 Bacteria 28965
653 Ga0495666_0005895 3300046526 Bacteria 6173
654 Ga0495666_0048437 3300046526 Bacteria 2046
655 Ga0495642_0000001 3300046528 Bacteria 389656
656 Ga0495642_0005085 3300046528 Bacteria 5064
657 Ga0495642_0005453 3300046528 Bacteria 4887
658 Ga0495642_0008384 3300046528 Bacteria 3956
659 Ga0495652_0054795 3300046529 Bacteria 3394
660 Ga0495652_0081300 3300046529 Bacteria 2673
661 Ga0495654_0002880 3300046530 Bacteria 10799
662 Ga0495654_0058906 3300046530 Bacteria 1851
663 Ga0495665_0046784 3300046531 Bacteria 2296
664 Ga0495640_0029895 3300046533 Bacteria 3905
665 Ga0495640_0104362 3300046533 Bacteria 1858
666 Ga0495587_0012781 3300046536 Bacteria 5281
667 Ga0495587_0016775 3300046536 Bacteria 4554
668 Ga0495609_0000001 3300046538 Bacteria 1060094
669 Ga0495609_0004972 3300046538 Bacteria 7123
670 Ga0495609_0005785 3300046538 Bacteria 6424
671 Ga0495609_0037377 3300046538 Bacteria 2190
672 Ga0495597_0000758 3300046542 Bacteria 25512
673 Ga0495597_0000830 3300046542 Bacteria 24285
674 Ga0495597_0003053 3300046542 Bacteria 10081
675 Ga0495597_0007475 3300046542 Bacteria 5545
676 Ga0495597_0008490 3300046542 Bacteria 5147
677 Ga0495597_0017905 3300046542 Bacteria 3327
678 Ga0495597_0020512 3300046542 Bacteria 3077
679 Ga0495597_0041282 3300046542 Bacteria 2061
680 Ga0495645_0001029 3300046543 Bacteria 18986
681 Ga0495645_0068968 3300046543 Bacteria 2552
682 Ga0495645_0075352 3300046543 Bacteria 2428
683 Ga0495622_0010320 3300046557 Bacteria 4317
684 Ga0495622_0022619 3300046557 Bacteria 2929
685 Ga0495622_0050612 3300046557 Bacteria 1927
686 Ga0495633_0001767 3300046558 Bacteria 16032
687 Ga0495633_0015864 3300046558 Bacteria 3900
688 Ga0495633_0029913 3300046558 Bacteria 2648
689 Ga0495656_0011683 3300046615 Bacteria 3225
690 Ga0495656_0028244 3300046615 Bacteria 2249
691 Ga0495668_0000357 3300046616 Bacteria 60616
692 Ga0495668_0001916 3300046616 Bacteria 18529
693 Ga0495668_0003625 3300046616 Bacteria 11434
694 Ga0495668_0007039 3300046616 Bacteria 7254
695 Ga0495668_0012831 3300046616 Bacteria 4963
696 Ga0495668_0016221 3300046616 Bacteria 4332
697 Ga0495668_0035257 3300046616 Bacteria 2804
698 Ga0495668_0037188 3300046616 Bacteria 2724
699 Ga0495668_0059852 3300046616 Bacteria 2101
700 Ga0495611_0002275 3300046648 Bacteria 8891
701 Ga0495611_0007514 3300046648 Bacteria 4626
702 Ga0495611_0018565 3300046648 Bacteria 2983
703 Ga0495611_0037603 3300046648 Bacteria 2151
704 Ga0495611_0057727 3300046648 Bacteria 1759
705 Ga0495625_0002669 3300046660 Bacteria 18983
706 Ga0495625_0020382 3300046660 Bacteria 5119
707 Ga0495625_0034133 3300046660 Bacteria 3756
708 Ga0495625_0128111 3300046660 Bacteria 1721
709 Ga0495635_0002745 3300046663 Bacteria 12068
710 Ga0495635_0008379 3300046663 Bacteria 7216
711 Ga0495659_0014705 3300046664 Bacteria 2566
712 Ga0495661_0000040 3300046665 Bacteria 151437
713 Ga0495661_0000089 3300046665 Bacteria 110930
714 Ga0495661_0000769 3300046665 Bacteria 30713
715 Ga0495661_0001925 3300046665 Bacteria 16519
716 Ga0495661_0041042 3300046665 Bacteria 2865
717 Ga0495661_0044249 3300046665 Bacteria 2730
718 Ga0495661_0073713 3300046665 Bacteria 1988
719 Ga0495588_0000052 3300046674 Bacteria 304493
720 Ga0495588_0000196 3300046674 Bacteria 63197
721 Ga0495588_0016819 3300046674 Bacteria 3539
722 Ga0495588_0038283 3300046674 Bacteria 2439
723 Ga0495588_0063794 3300046674 Bacteria 1911
724 Ga0495588_0134174 3300046674 Bacteria 1306
725 Ga0495657_0049882 3300046675 Bacteria 2817
726 Ga0495657_0055050 3300046675 Bacteria 2655
727 Ga0495623_0005861 3300046679 Bacteria 8009
728 Ga0495623_0029914 3300046679 Bacteria 3505
729 Ga0495646_0023831 3300046680 Bacteria 3853
730 Ga0495669_0000019 3300046684 Bacteria 126468
731 Ga0495669_0000901 3300046684 Bacteria 12505
732 Ga0495669_0003232 3300046684 Bacteria 6707
733 Ga0495624_0102323 3300046690 Bacteria 1763
734 Ga0495670_0015258 3300046691 Bacteria 3777
735 Ga0495670_0041520 3300046691 Bacteria 2295
736 Ga0495670_0060830 3300046691 Bacteria 1898
737 Ga0495670_0072746 3300046691 Bacteria 1742
738 Ga0495671_0000167 3300046692 Bacteria 57939
739 Ga0495671_0001323 3300046692 Bacteria 16815
740 Ga0495671_0065006 3300046692 Bacteria 1795
741 Ga0495671_0075033 3300046692 Bacteria 1659
742 Ga0495649_0000029 3300046694 Bacteria 162379
743 Ga0495649_0000068 3300046694 Bacteria 92317
744 Ga0495649_0024853 3300046694 Bacteria 3339
745 Ga0495649_0033662 3300046694 Bacteria 2820
746 Ga0495649_0036714 3300046694 Bacteria 2691
747 Ga0495589_0000015 3300046794 Bacteria 224112
748 Ga0495589_0000206 3300046794 Bacteria 50433
749 Ga0495589_0000285 3300046794 Bacteria 41161
750 Ga0495589_0001782 3300046794 Bacteria 12245
751 Ga0495589_0013475 3300046794 Bacteria 4217
752 Ga0495589_0030225 3300046794 Bacteria 2729
753 Ga0495600_0052706 3300046809 Bacteria 2657
754 Ga0495600_0075450 3300046809 Bacteria 2202
755 Ga0495600_0098172 3300046809 Bacteria 1909
756 Ga0495600_0102882 3300046809 Bacteria 1861
757 Ga0495660_0000143 3300046810 Bacteria 77268
758 Ga0495660_0008103 3300046810 Bacteria 6171
759 Ga0495660_0015717 3300046810 Bacteria 4370
760 Ga0495660_0023523 3300046810 Bacteria 3513
761 Ga0495660_0028436 3300046810 Bacteria 3159
762 Ga0495660_0050542 3300046810 Bacteria 2264
763 Ga0495660_0057628 3300046810 Bacteria 2095
764 Ga0495581_0022378 3300047315 Bacteria 3664
765 Ga0495604_0024026 3300047317 Bacteria 4865
766 Ga0495604_0061318 3300047317 Bacteria 2877
767 Ga0495604_0129667 3300047317 Bacteria 1814
768 Ga0495636_0000603 3300047318 Bacteria 13215
769 Ga0495636_0005695 3300047318 Bacteria 4885
770 Ga0495636_0008803 3300047318 Bacteria 3977
771 Ga0495674_0002672 3300047319 Bacteria 17353
772 Ga0495674_0113050 3300047319 Bacteria 2300
773 Ga0495672_0000065 3300047320 Bacteria 193941
774 Ga0495672_0000192 3300047320 Bacteria 87986
775 Ga0495672_0001279 3300047320 Bacteria 25086
776 Ga0495672_0008482 3300047320 Bacteria 7575
777 Ga0495676_0000029 3300047321 Bacteria 140281
778 Ga0495676_0121095 3300047321 Bacteria 1903
779 Ga0495676_0202647 3300047321 Bacteria 1378
780 Ga0495680_0005935 3300047322 Bacteria 11415
781 Ga0495680_0048568 3300047322 Bacteria 3332
782 Ga0495683_0000007 3300047323 Bacteria 268546
783 Ga0495683_0000012 3300047323 Bacteria 205754
784 Ga0495683_0005510 3300047323 Bacteria 7017
785 Ga0495683_0066500 3300047323 Bacteria 1776
786 Ga0495687_000002 3300047443 Bacteria 1085770
787 Ga0495687_000003 3300047443 Bacteria 859509
788 Ga0495687_000007 3300047443 Bacteria 552679
789 Ga0495687_000067 3300047443 Bacteria 161372
790 Ga0495687_000727 3300047443 Bacteria 36304
791 Ga0495687_005475 3300047443 Bacteria 8072
792 Ga0495675_0005060 3300047444 Bacteria 8024
793 Ga0495675_0005287 3300047444 Bacteria 7862
794 Ga0495675_0015675 3300047444 Bacteria 4791
795 Ga0495677_0000001 3300047445 Bacteria 715000
796 Ga0495677_0000076 3300047445 Bacteria 50813
797 Ga0495677_0000331 3300047445 Bacteria 20413
798 Ga0495677_0000805 3300047445 Bacteria 12686
799 Ga0495677_0005733 3300047445 Bacteria 4707
800 Ga0495677_0012901 3300047445 Bacteria 3043
801 Ga0495677_0014238 3300047445 Bacteria 2896
802 Ga0495677_0028771 3300047445 Bacteria 2020
803 Ga0495679_001214 3300047446 Bacteria 15282
804 Ga0495685_002223 3300047447 Bacteria 6043
805 Ga0495673_0005697 3300047469 Bacteria 7482
806 Ga0495681_0000005 3300047470 Bacteria 225279
807 Ga0495681_0011969 3300047470 Bacteria 5124
808 Ga0495681_0011987 3300047470 Bacteria 5120
809 Ga0495681_0057179 3300047470 Bacteria 1812
810 Ga0495684_0091358 3300047471 Bacteria 2306
811 Ga0495686_0000015 3300047472 Bacteria 471703
812 Ga0495686_0000190 3300047472 Bacteria 115114
813 Ga0495686_0007585 3300047472 Bacteria 8107
814 Ga0495686_0017316 3300047472 Bacteria 4858
815 Ga0495593_0008904 3300047673 Bacteria 5826
816 Ga0495602_0000790 3300048088 Bacteria 30230
817 Ga0495602_0021742 3300048088 Bacteria 6303
818 Ga0495602_0069052 3300048088 Bacteria 3031
819 Ga0495602_0082303 3300048088 Bacteria 2702
820 Ga0495602_0129430 3300048088 Bacteria 2016
821 Ga0495602_0141383 3300048088 Bacteria 1905
822 Ga0495614_0001365 3300048089 Bacteria 10532
823 Ga0495614_0047210 3300048089 Bacteria 1847
824 Ga0495626_0000020 3300048091 Bacteria 222537
825 Ga0495626_0000089 3300048091 Bacteria 119565
826 Ga0495626_0000200 3300048091 Bacteria 72580
827 Ga0495626_0005308 3300048091 Bacteria 7599
828 Ga0495626_0014646 3300048091 Bacteria 4036
829 Ga0495626_0021293 3300048091 Bacteria 3218
830 Ga0495626_0031258 3300048091 Bacteria 2564
831 Ga0495626_0034944 3300048091 Bacteria 2401
832 Ga0495626_0066927 3300048091 Bacteria 1623
833 Ga0496100_0072053 3300048903 Bacteria 2308
834 Ga0496102_0000033 3300048905 Bacteria 213952
835 Ga0496102_0002133 3300048905 Bacteria 17003
836 Ga0496102_0004919 3300048905 Bacteria 11319
837 Ga0496102_0088698 3300048905 Bacteria 2860
838 Ga0496102_0181563 3300048905 Bacteria 1983
839 Ga0496102_0259440 3300048905 Bacteria 1638
840 Ga0496103_0003160 3300048906 Bacteria 10122
841 Ga0496103_0003397 3300048906 Bacteria 9734
842 Ga0496103_0010021 3300048906 Bacteria 5603
843 Ga0496105_0119077 3300048908 Bacteria 2178
844 Ga0496106_0000102 3300048909 Bacteria 65345
845 Ga0496106_0007261 3300048909 Bacteria 8184
846 Ga0496106_0194358 3300048909 Bacteria 1614
847 Ga0496107_0220534 3300048910 Bacteria 1411
848 Ga0496110_0111918 3300048913 Bacteria 2454
849 Ga0496110_0281963 3300048913 Bacteria 1513
850 Ga0496111_0079905 3300048914 Bacteria 2386
851 Ga0496112_0080052 3300048915 Bacteria 3231
852 Ga0496112_0170888 3300048915 Bacteria 2139
853 Ga0496113_0037616 3300048916 Bacteria 3553
854 Ga0496113_0055199 3300048916 Bacteria 2977
855 Ga0496114_0041472 3300048917 Bacteria 3815
856 Ga0496114_0199365 3300048917 Bacteria 1753
857 Ga0496115_0013166 3300048918 Bacteria 6248
858 Ga0496115_0027833 3300048918 Bacteria 4425
859 Ga0496116_0002317 3300048919 Bacteria 20186
860 Ga0496116_0005236 3300048919 Bacteria 12127
861 Ga0496116_0028857 3300048919 Bacteria 4011
862 Ga0496117_0000016 3300048920 Bacteria 523642
863 Ga0496117_0002604 3300048920 Bacteria 22423
864 Ga0496117_0043739 3300048920 Bacteria 3252
865 Ga0496117_0093419 3300048920 Bacteria 1929
866 Ga0496118_0000153 3300048921 Bacteria 122419
867 Ga0496118_0003936 3300048921 Bacteria 18163
868 Ga0496118_0012501 3300048921 Bacteria 8139
869 Ga0496118_0057507 3300048921 Bacteria 2914
870 Ga0496118_0059810 3300048921 Bacteria 2834
871 Ga0496119_0009047 3300048922 Bacteria 8631
872 Ga0496119_0009777 3300048922 Bacteria 8161
873 Ga0496119_0119957 3300048922 Bacteria 1447
874 Ga0496120_0000423 3300048923 Bacteria 67509
875 Ga0496120_0003353 3300048923 Bacteria 14696
876 Ga0496121_0004649 3300048924 Bacteria 18257
877 Ga0496121_0073222 3300048924 Bacteria 2746
878 Ga0496121_0083501 3300048924 Bacteria 2521
879 Ga0496121_0185429 3300048924 Bacteria 1497
880 Ga0496122_0000002 3300048925 Bacteria 905834
881 Ga0496122_0000042 3300048925 Bacteria 280482
882 Ga0496122_0000567 3300048925 Bacteria 75763
883 Ga0496122_0005598 3300048925 Bacteria 14868
884 Ga0496122_0007864 3300048925 Bacteria 11713
885 Ga0496122_0008213 3300048925 Bacteria 11340
886 Ga0496122_0019899 3300048925 Bacteria 6103
887 Ga0496122_0059901 3300048925 Bacteria 2808
888 Ga0496123_0000002 3300048926 Bacteria 1811682
889 Ga0496123_0000030 3300048926 Bacteria 291764
890 Ga0496123_0000704 3300048926 Bacteria 54701
891 Ga0496123_0001155 3300048926 Bacteria 39342
892 Ga0496123_0002829 3300048926 Bacteria 20519
893 Ga0496123_0005341 3300048926 Bacteria 12986
894 Ga0496123_0029435 3300048926 Bacteria 4043
895 Ga0496124_0001457 3300048927 Bacteria 34907
896 Ga0496124_0016188 3300048927 Bacteria 7108
897 Ga0496124_0101928 3300048927 Bacteria 2324
898 Ga0496124_0109444 3300048927 Bacteria 2227
899 Ga0496125_0004489 3300048928 Bacteria 16068
900 Ga0496125_0008338 3300048928 Bacteria 10872
901 Ga0496125_0019190 3300048928 Bacteria 6459
902 Ga0496125_0048146 3300048928 Bacteria 3558
903 Ga0496126_0149209 3300048929 Bacteria 2005
904 Ga0495678_000015 3300049459 Bacteria 309544
905 Ga0495678_000022 3300049459 Bacteria 237031
906 Ga0495678_000452 3300049459 Bacteria 40696
907 Ga0495678_001887 3300049459 Bacteria 15238
908 Ga0495678_006837 3300049459 Bacteria 5998
909 Ga0495682_0000122 3300049460 Bacteria 68172
910 Ga0495682_0007370 3300049460 Bacteria 4384
911 Ga0495682_0018770 3300049460 Bacteria 2604
912 Ga0501032_0000017 3300049569 Bacteria 158303
913 Ga0501032_0001004 3300049569 Bacteria 22749
914 Ga0501033_0000029 3300049570 Bacteria 158294
915 Ga0501033_0000334 3300049570 Bacteria 44929
916 Ga0501033_0013560 3300049570 Bacteria 6204
917 Ga0501033_0059784 3300049570 Bacteria 2814
918 Ga0501033_0104785 3300049570 Bacteria 2062
919 Ga0501033_0107252 3300049570 Bacteria 2034
920 Ga0501033_0117774 3300049570 Bacteria 1929
921 Ga0501033_0188945 3300049570 Bacteria 1475
922 Ga0501034_0000102 3300049571 Bacteria 158302
923 Ga0501034_0003296 3300049571 Bacteria 18444
924 Ga0501034_0101500 3300049571 Bacteria 2870
925 Ga0501034_0107757 3300049571 Bacteria 2778
926 Ga0501034_0112224 3300049571 Bacteria 2716
927 Ga0501034_0145447 3300049571 Bacteria 2348
928 Ga0501034_0146586 3300049571 Bacteria 2337
929 Ga0501034_0179429 3300049571 Bacteria 2083
930 Ga0501034_0227725 3300049571 Bacteria 1814
931 Ga0501036_0000011 3300049572 Bacteria 158302
932 Ga0501036_0183879 3300049572 Bacteria 1759
933 Ga0501037_0000015 3300049573 Bacteria 161311
934 Ga0501037_0000035 3300049573 Bacteria 125589
935 Ga0501038_0000016 3300049574 Bacteria 159150
936 Ga0501038_0074545 3300049574 Bacteria 2870
937 Ga0501038_0094694 3300049574 Bacteria 2496
938 Ga0501038_0232182 3300049574 Bacteria 1468
939 Ga0501039_0000023 3300049575 Bacteria 158026
940 Ga0501039_0025637 3300049575 Bacteria 4531
941 Ga0501040_0045977 3300049576 Bacteria 2979
942 Ga0501043_0000031 3300049579 Bacteria 140707
943 Ga0501043_0000372 3300049579 Bacteria 40661
944 Ga0501046_0039751 3300049580 Bacteria 3764
945 Ga0501046_0103791 3300049580 Bacteria 2179
946 Ga0501047_0001169 3300049581 Bacteria 26022
947 Ga0501047_0035181 3300049581 Bacteria 4838
948 Ga0501047_0038110 3300049581 Bacteria 4649
949 Ga0501047_0048660 3300049581 Bacteria 4094
950 Ga0501047_0122717 3300049581 Bacteria 2479
951 Ga0501047_0248865 3300049581 Bacteria 1626
952 Ga0501047_0343457 3300049581 Bacteria 1330
953 Ga0501048_0012058 3300049582 Bacteria 6442
954 Ga0501067_0009026 3300049583 Bacteria 5522
955 Ga0501068_0002851 3300049584 Bacteria 9196
956 Ga0501068_0006869 3300049584 Bacteria 6291
957 Ga0501069_0000056 3300049585 Bacteria 65784
958 Ga0501069_0002418 3300049585 Bacteria 9493
959 Ga0501070_0000141 3300049586 Bacteria 65875
960 Ga0501070_0002589 3300049586 Bacteria 15814
961 Ga0501070_0015361 3300049586 Bacteria 6441
962 Ga0501070_0116975 3300049586 Bacteria 2202
963 Ga0501070_0188292 3300049586 Bacteria 1697
964 Ga0501072_0062867 3300049588 Bacteria 2928
965 Ga0501073_0059206 3300049589 Bacteria 2676
966 Ga0501073_0108514 3300049589 Bacteria 1926
967 Ga0501074_0069896 3300049590 Bacteria 2524
968 Ga0501080_0001729 3300049742 Bacteria 18680
969 Ga0501080_0033576 3300049742 Bacteria 4789
970 Ga0501080_0082527 3300049742 Bacteria 2985
971 Ga0501080_0213637 3300049742 Bacteria 1767
972 Ga0501083_0001157 3300049744 Bacteria 17771
973 Ga0501083_0009242 3300049744 Bacteria 6959
974 Ga0501083_0057730 3300049744 Bacteria 2598
975 Ga0501035_0000036 3300049822 Bacteria 165008
976 Ga0501035_0000038 3300049822 Bacteria 158818
977 Ga0501035_0000761 3300049822 Bacteria 34698
978 Ga0501035_0001273 3300049822 Bacteria 26052
979 Ga0501035_0031757 3300049822 Bacteria 4810
980 Ga0501035_0069871 3300049822 Bacteria 3111
981 Ga0501035_0080769 3300049822 Bacteria 2870
982 Ga0501044_0000011 3300049823 Bacteria 257385
983 Ga0501044_0000046 3300049823 Bacteria 146812
984 Ga0501044_0014052 3300049823 Bacteria 8646
985 Ga0501044_0022095 3300049823 Bacteria 6784
986 Ga0501044_0025149 3300049823 Bacteria 6313
987 Ga0501044_0100831 3300049823 Bacteria 2905
988 Ga0501044_0102814 3300049823 Bacteria 2872
989 Ga0501044_0102921 3300049823 Bacteria 2870
990 Ga0501044_0172628 3300049823 Bacteria 2132
991 Ga0501045_0012943 3300049824 Bacteria 5880
992 nmdc:mga03683_38362_c1 3300050489 Bacteria 1956
993 nmdc:mga00v17_11699_c1 3300050491 Bacteria 4827
994 nmdc:mga00v17_218_c1 3300050491 Bacteria 34620
995 nmdc:mga00v17_25311_c1 3300050491 Bacteria 3449
996 nmdc:mga00v17_53_c1 3300050491 Bacteria 72424
997 nmdc:mga0yw44_1934_c1 3300050492 Bacteria 8572
998 nmdc:mga0yw44_4057_c1 3300050492 Bacteria 6629
999 nmdc:mga0k408_38659_c1 3300050493 Bacteria 2739
1000 nmdc:mga0k408_75281_c1 3300050493 Bacteria 1972
1001 nmdc:mga06z11_56792_c1 3300050494 Bacteria 2026
1002 nmdc:mga06z11_81158_c1 3300050494 Bacteria 1740
1003 nmdc:mga07m45_19323_c1 3300050496 Bacteria 3691
1004 nmdc:mga05p37_56104_c1 3300050507 Bacteria 4850
1005 nmdc:mga09592_56316_c1 3300050508 Bacteria 3323
1006 nmdc:mga0qj67_9637_c1 3300050509 Bacteria 7197
1007 nmdc:mga06r32_3229_c1 3300050510 Bacteria 14583
1008 nmdc:mga08y16_83869_c1 3300050511 Bacteria 3322
1009 nmdc:mga0n895_180434_c1 3300050512 Bacteria 2143
1010 nmdc:mga0n895_67927_c1 3300050512 Bacteria 3531
1011 nmdc:mga0a205_281592_c1 3300050515 Bacteria 1538
1012 nmdc:mga0a205_5649_c1 3300050515 Bacteria 11267
1013 nmdc:mga0sz30_26798_c1 3300050516 Bacteria 2364
1014 nmdc:mga0sz30_95_c1 3300050516 Bacteria 33938
1015 Ga0495601_0010434 3300053077 Bacteria 5528
1016 Ga0495601_0116696 3300053077 Bacteria 1731
1017 Ga0495612_0000886 3300053078 Bacteria 12227
1018 Ga0500635_0000763 3300053080 Bacteria 8015
1019 Ga0495595_0067772 3300053084 Bacteria 1682
1020 Ga0500583_0007978 3300053092 Bacteria 3767
1021 Ga0500583_0019165 3300053092 Bacteria 2799
1022 Ga0500651_0043894 3300053093 Bacteria 2815
1023 Ga0500651_0059032 3300053093 Bacteria 2399
1024 Ga0500641_0044615 3300053096 Bacteria 1803
1025 Ga0500569_000646 3300053109 Bacteria 5967
1026 Ga0500569_001390 3300053109 Bacteria 4544
1027 Ga0500572_015523 3300053111 Bacteria 1922
1028 Ga0500592_002513 3300053116 Bacteria 2948
1029 Ga0500607_000048 3300053121 Bacteria 82363
1030 Ga0500608_053633 3300053122 Bacteria 1935
1031 Ga0500658_0015242 3300053134 Bacteria 2851
1032 Ga0500559_0001130 3300053136 Bacteria 16070
1033 Ga0500559_0007985 3300053136 Bacteria 4661
1034 Ga0500561_0000022 3300053137 Bacteria 35723
1035 Ga0500568_0000882 3300053139 Bacteria 21057
1036 Ga0500573_0016743 3300053140 Bacteria 4165
1037 Ga0500577_0003953 3300053142 Bacteria 3878
1038 Ga0500588_0001824 3300053146 Bacteria 4158
1039 Ga0500590_002886 3300053148 Bacteria 7788
1040 Ga0500616_0005199 3300053153 Bacteria 8914
1041 Ga0500616_0005721 3300053153 Bacteria 8367
1042 Ga0500616_0010525 3300053153 Bacteria 5529
1043 Ga0500620_000423 3300053155 Bacteria 7703
1044 Ga0500620_000465 3300053155 Bacteria 7227
1045 Ga0500620_018905 3300053155 Bacteria 2015
1046 Ga0500622_0000705 3300053156 Bacteria 29326
1047 Ga0500622_0002404 3300053156 Bacteria 13531
1048 Ga0500622_0007267 3300053156 Bacteria 6307
1049 Ga0500624_006670 3300053157 Bacteria 1567
1050 Ga0500627_0064157 3300053158 Bacteria 1619
1051 Ga0500634_0021256 3300053161 Bacteria 3515
1052 Ga0500636_0001691 3300053177 Bacteria 12082
1053 Ga0500636_0005153 3300053177 Bacteria 7431
1054 Ga0500637_0003907 3300053178 Bacteria 6955
1055 Ga0500645_011509 3300053730 Bacteria 2886
1056 Ga0500552_000622 3300053733 Bacteria 3342
1057 Ga0501082_0077538 3300060353 Bacteria 2865

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046499 Ga0495594_0067694 Ga0495594_0067694_150_1223 356
2 3300046531 Ga0495665_0046784 Ga0495665_0046784_151_1224 356
3 3300046543 Ga0495645_0068968 Ga0495645_0068968_1416_2489 356
4 3300046557 Ga0495622_0022619 Ga0495622_0022619_617_1690 356
5 3300046674 Ga0495588_0134174 Ga0495588_0134174_74_1147 356
6 3300046690 Ga0495624_0102323 Ga0495624_0102323_112_1185 356
7 3300047321 Ga0495676_0202647 Ga0495676_0202647_29_1102 356
8 3300046491 Ga0495584_0023602 Ga0495584_0023602_1933_3048 359
9 3300047445 Ga0495677_0005733 Ga0495677_0005733_61_1176 359
10 3300046500 Ga0495596_0003747 Ga0495596_0003747_6073_7203 361
11 3300046684 Ga0495669_0000019 Ga0495669_0000019_56983_58113 361
12 3300046474 Ga0495605_0009542 Ga0495605_0009542_3644_4735 362
13 3300046474 Ga0495605_0099864 Ga0495605_0099864_209_1300 362
14 3300046500 Ga0495596_0017390 Ga0495596_0017390_193_1284 362
15 3300046501 Ga0495607_0084222 Ga0495607_0084222_44_1135 362
16 3300046513 Ga0495616_0103371 Ga0495616_0103371_58_1149 362
17 3300046518 Ga0495631_0028653 Ga0495631_0028653_921_2012 362
18 3300046528 Ga0495642_0005453 Ga0495642_0005453_2369_3460 362
19 3300046528 Ga0495642_0008384 Ga0495642_0008384_393_1484 362
20 3300046538 Ga0495609_0005785 Ga0495609_0005785_2766_3857 362
21 3300046542 Ga0495597_0041282 Ga0495597_0041282_727_1818 362
22 3300046660 Ga0495625_0020382 Ga0495625_0020382_3804_4895 362
23 3300046684 Ga0495669_0003232 Ga0495669_0003232_1486_2577 362
24 3300046810 Ga0495660_0050542 Ga0495660_0050542_984_2075 362
25 3300047323 Ga0495683_0066500 Ga0495683_0066500_312_1403 362
26 3300047445 Ga0495677_0012901 Ga0495677_0012901_1496_2587 362
27 3300047470 Ga0495681_0057179 Ga0495681_0057179_380_1471 362
28 3300048091 Ga0495626_0005308 Ga0495626_0005308_4152_5243 362
29 3300046542 Ga0495597_0008490 Ga0495597_0008490_3842_4972 364
30 3300046616 Ga0495668_0035257 Ga0495668_0035257_459_1589 364
31 3300047321 Ga0495676_0000029 Ga0495676_0000029_32322_33452 364
32 3300053092 Ga0500583_0007978 Ga0500583_0007978_1357_2460 364
33 3300053134 Ga0500658_0015242 Ga0500658_0015242_626_1729 364
34 3300053146 Ga0500588_0001824 Ga0500588_0001824_1689_2792 364
35 3300047322 Ga0495680_0005935 Ga0495680_0005935_2725_3855 365
36 3300049460 Ga0495682_0007370 Ga0495682_0007370_2637_3785 365
37 3300047472 Ga0495686_0000015 Ga0495686_0000015_277519_278667 366
38 3300046492 Ga0495585_0121941 Ga0495585_0121941_63_1169 367
39 3300046648 Ga0495611_0002275 Ga0495611_0002275_209_1357 367
40 3300037312 Ga0395899_0000388 Ga0395899_0000388_33265_34374 368
41 3300046463 Ga0495653_0039937 Ga0495653_0039937_1075_2184 368
42 3300046492 Ga0495585_0001376 Ga0495585_0001376_7852_9000 368
43 3300046492 Ga0495585_0030544 Ga0495585_0030544_1794_2903 368
44 3300046499 Ga0495594_0013296 Ga0495594_0013296_2960_4108 368
45 3300046514 Ga0495618_0004380 Ga0495618_0004380_4571_5680 368
46 3300046516 Ga0495628_0045699 Ga0495628_0045699_2302_3411 368
47 3300046684 Ga0495669_0000901 Ga0495669_0000901_2980_4128 368
48 3300046809 Ga0495600_0052706 Ga0495600_0052706_36_1145 368
49 3300047320 Ga0495672_0000192 Ga0495672_0000192_46013_47161 368
50 3300047443 Ga0495687_000007 Ga0495687_000007_213489_214637 368
51 3300048903 Ga0496100_0072053 Ga0496100_0072053_84_1193 368
52 3300048916 Ga0496113_0055199 Ga0496113_0055199_1404_2513 368
53 3300048925 Ga0496122_0000567 Ga0496122_0000567_63993_65102 368
54 3300048926 Ga0496123_0000704 Ga0496123_0000704_43015_44124 368
55 3300053077 Ga0495601_0116696 Ga0495601_0116696_46_1155 368
56 3300046500 Ga0495596_0015259 Ga0495596_0015259_1883_3031 370
57 3300046519 Ga0495632_0069723 Ga0495632_0069723_97_1212 370
58 3300047470 Ga0495681_0000005 Ga0495681_0000005_26037_27191 371
59 3300046492 Ga0495585_0124879 Ga0495585_0124879_19_1149 375
60 3300046513 Ga0495616_0086701 Ga0495616_0086701_337_1467 375
61 3300046523 Ga0495644_0048588 Ga0495644_0048588_442_1572 375
62 3300046557 Ga0495622_0010320 Ga0495622_0010320_1083_2213 375
63 3300046558 Ga0495633_0029913 Ga0495633_0029913_150_1280 375
64 3300046648 Ga0495611_0057727 Ga0495611_0057727_480_1610 375
65 3300046674 Ga0495588_0016819 Ga0495588_0016819_609_1739 375
66 3300048088 Ga0495602_0069052 Ga0495602_0069052_116_1246 375
67 3300046615 Ga0495656_0028244 Ga0495656_0028244_616_1749 376
68 3300046664 Ga0495659_0014705 Ga0495659_0014705_60_1193 376
69 3300048913 Ga0496110_0111918 Ga0496110_0111918_442_1575 376
70 3300006051 Ga0075364_10012374 Ga0075364_100123742 378
71 3300050491 nmdc:mga00v17_218_c1 nmdc:mga00v17_218_c1_10917_12224 378
72 3300053121 Ga0500607_000048 Ga0500607_000048_1646_2944 380
73 3300053136 Ga0500559_0001130 Ga0500559_0001130_8905_10203 380
74 3300053178 Ga0500637_0003907 Ga0500637_0003907_1674_3002 380
75 3300053730 Ga0500645_011509 Ga0500645_011509_1571_2869 380
76 3300037471 Ga0395905_0115933 Ga0395905_0115933_391_1539 381
77 3300046460 Ga0495638_0107934 Ga0495638_0107934_275_1423 381
78 3300046499 Ga0495594_0009107 Ga0495594_0009107_667_1815 381
79 3300046513 Ga0495616_0038676 Ga0495616_0038676_1082_2230 381
80 3300046518 Ga0495631_0000012 Ga0495631_0000012_48003_49151 381
81 3300046530 Ga0495654_0058906 Ga0495654_0058906_304_1452 381
82 3300046542 Ga0495597_0000758 Ga0495597_0000758_486_1634 381
83 3300046616 Ga0495668_0001916 Ga0495668_0001916_13545_14693 381
84 3300048091 Ga0495626_0000020 Ga0495626_0000020_41268_42416 381
85 3300048091 Ga0495626_0021293 Ga0495626_0021293_162_1310 381
86 3300048091 Ga0495626_0066927 Ga0495626_0066927_162_1310 381
87 3300049459 Ga0495678_000022 Ga0495678_000022_182948_184096 381
88 3300046471 Ga0495650_0000001 Ga0495650_0000001_601329_602507 382
89 3300048905 Ga0496102_0000033 Ga0496102_0000033_74984_76138 383
90 3300009148 Ga0105243_10341770 Ga0105243_103417701 390
91 3300049459 Ga0495678_001887 Ga0495678_001887_9266_10474 390
92 3300046500 Ga0495596_0000584 Ga0495596_0000584_583_1815 392
93 3300046500 Ga0495596_0009002 Ga0495596_0009002_3134_4366 392
94 3300046506 Ga0495583_0002859 Ga0495583_0002859_658_1890 392
95 3300046506 Ga0495583_0018037 Ga0495583_0018037_2287_3519 392
96 3300046525 Ga0495663_0039715 Ga0495663_0039715_54_1286 392
97 3300046528 Ga0495642_0005085 Ga0495642_0005085_1923_3155 392
98 3300046692 Ga0495671_0001323 Ga0495671_0001323_15329_16561 392
99 3300046694 Ga0495649_0033662 Ga0495649_0033662_245_1477 392
100 3300047443 Ga0495687_005475 Ga0495687_005475_6430_7662 392
101 3300049459 Ga0495678_000452 Ga0495678_000452_26846_28078 392
102 3300049460 Ga0495682_0000122 Ga0495682_0000122_28476_29708 392
103 3300005262 Ga0065165_1000627 Ga0065165_100062723 393
104 3300046457 Ga0495590_0000224 Ga0495590_0000224_17827_19059 393
105 3300046492 Ga0495585_0017671 Ga0495585_0017671_487_1761 393
106 3300046492 Ga0495585_0022287 Ga0495585_0022287_169_1401 393
107 3300046558 Ga0495633_0001767 Ga0495633_0001767_5031_6305 393
108 3300013102 Ga0157371_10000128 Ga0157371_100001289 394
109 3300015261 Ga0182006_1042460 Ga0182006_10424602 394
110 3300046471 Ga0495650_0042514 Ga0495650_0042514_481_1713 394
111 3300046472 Ga0495580_0031612 Ga0495580_0031612_1341_2573 394
112 3300046474 Ga0495605_0041941 Ga0495605_0041941_847_2079 394
113 3300046491 Ga0495584_0001080 Ga0495584_0001080_3068_4300 394
114 3300046492 Ga0495585_0014426 Ga0495585_0014426_547_1779 394
115 3300046499 Ga0495594_0027514 Ga0495594_0027514_215_1447 394
116 3300046506 Ga0495583_0006919 Ga0495583_0006919_1964_3196 394
117 3300046507 Ga0495606_0074720 Ga0495606_0074720_397_1629 394
118 3300046513 Ga0495616_0006483 Ga0495616_0006483_3348_4580 394
119 3300046524 Ga0495648_0016383 Ga0495648_0016383_3490_4722 394
120 3300046526 Ga0495666_0000154 Ga0495666_0000154_21857_23089 394
121 3300046526 Ga0495666_0005895 Ga0495666_0005895_1605_2837 394
122 3300046533 Ga0495640_0029895 Ga0495640_0029895_1620_2852 394
123 3300046533 Ga0495640_0104362 Ga0495640_0104362_253_1485 394
124 3300046674 Ga0495588_0038283 Ga0495588_0038283_889_2121 394
125 3300046691 Ga0495670_0015258 Ga0495670_0015258_1698_2930 394
126 3300046809 Ga0495600_0075450 Ga0495600_0075450_323_1555 394
127 3300046810 Ga0495660_0023523 Ga0495660_0023523_500_1732 394
128 3300047317 Ga0495604_0024026 Ga0495604_0024026_2560_3792 394
129 3300047317 Ga0495604_0061318 Ga0495604_0061318_1558_2790 394
130 3300047317 Ga0495604_0129667 Ga0495604_0129667_79_1311 394
131 3300047318 Ga0495636_0005695 Ga0495636_0005695_528_1760 394
132 3300047444 Ga0495675_0005060 Ga0495675_0005060_78_1310 394
133 3300047447 Ga0495685_002223 Ga0495685_002223_4278_5510 394
134 3300048088 Ga0495602_0021742 Ga0495602_0021742_1723_2955 394
135 3300048905 Ga0496102_0259440 Ga0496102_0259440_297_1529 394
136 3300048906 Ga0496103_0010021 Ga0496103_0010021_587_1819 394
137 3300049460 Ga0495682_0018770 Ga0495682_0018770_897_2129 394
138 3300042005 Ga0439448_0000551 Ga0439448_0000551_5084_6316 395
139 3300042012 Ga0439455_0022279 Ga0439455_0022279_158_1390 395
140 3300044658 Ga0466972_0002549 Ga0466972_0002549_4599_5831 395
141 3300044706 Ga0466964_0002584 Ga0466964_0002584_1433_2665 395
142 3300044706 Ga0466964_0009335 Ga0466964_0009335_828_2060 395
143 3300044735 Ga0466968_0008349 Ga0466968_0008349_1483_2715 395
144 3300046463 Ga0495653_0008225 Ga0495653_0008225_573_1805 395
145 3300046471 Ga0495650_0000089 Ga0495650_0000089_106215_107447 395
146 3300046491 Ga0495584_0000041 Ga0495584_0000041_40326_41558 395
147 3300046518 Ga0495631_0021102 Ga0495631_0021102_1612_2844 395
148 3300046519 Ga0495632_0000028 Ga0495632_0000028_43429_44661 395
149 3300046522 Ga0495643_0009852 Ga0495643_0009852_1288_2520 395
150 3300046524 Ga0495648_0003980 Ga0495648_0003980_9795_11027 395
151 3300046542 Ga0495597_0000830 Ga0495597_0000830_12720_13952 395
152 3300046665 Ga0495661_0000769 Ga0495661_0000769_1617_2849 395
153 3300046674 Ga0495588_0000052 Ga0495588_0000052_249504_250736 395
154 3300046694 Ga0495649_0036714 Ga0495649_0036714_1430_2662 395
155 3300046794 Ga0495589_0000206 Ga0495589_0000206_38849_40081 395
156 3300047320 Ga0495672_0001279 Ga0495672_0001279_10867_12099 395
157 3300047443 Ga0495687_000067 Ga0495687_000067_92253_93485 395
158 3300048091 Ga0495626_0014646 Ga0495626_0014646_2426_3658 395
159 3300048905 Ga0496102_0181563 Ga0496102_0181563_82_1314 395
160 3300049572 Ga0501036_0183879 Ga0501036_0183879_53_1285 395
161 3300037466 Ga0395898_0013150 Ga0395898_0013150_2911_4152 396
162 3300044684 Ga0466966_0001134 Ga0466966_0001134_1153_2385 396
163 3300046474 Ga0495605_0000084 Ga0495605_0000084_74899_76131 396
164 3300046491 Ga0495584_0009158 Ga0495584_0009158_2271_3503 396
165 3300046492 Ga0495585_0023845 Ga0495585_0023845_810_2042 396
166 3300046500 Ga0495596_0007288 Ga0495596_0007288_2383_3615 396
167 3300046501 Ga0495607_0007099 Ga0495607_0007099_1192_2424 396
168 3300046501 Ga0495607_0010428 Ga0495607_0010428_1550_2782 396
169 3300046506 Ga0495583_0000190 Ga0495583_0000190_76335_77567 396
170 3300046513 Ga0495616_0002443 Ga0495616_0002443_1243_2475 396
171 3300046518 Ga0495631_0003486 Ga0495631_0003486_4866_6098 396
172 3300046519 Ga0495632_0017639 Ga0495632_0017639_435_1667 396
173 3300046522 Ga0495643_0011275 Ga0495643_0011275_427_1659 396
174 3300046523 Ga0495644_0003802 Ga0495644_0003802_36_1268 396
175 3300046558 Ga0495633_0015864 Ga0495633_0015864_2323_3555 396
176 3300046616 Ga0495668_0016221 Ga0495668_0016221_1973_3205 396
177 3300046648 Ga0495611_0018565 Ga0495611_0018565_876_2108 396
178 3300046665 Ga0495661_0044249 Ga0495661_0044249_779_2011 396
179 3300046691 Ga0495670_0041520 Ga0495670_0041520_512_1744 396
180 3300046794 Ga0495589_0000285 Ga0495589_0000285_19336_20568 396
181 3300046794 Ga0495589_0013475 Ga0495589_0013475_1870_3102 396
182 3300046810 Ga0495660_0000143 Ga0495660_0000143_70158_71390 396
183 3300046810 Ga0495660_0057628 Ga0495660_0057628_512_1744 396
184 3300047323 Ga0495683_0005510 Ga0495683_0005510_1721_2953 396
185 3300047443 Ga0495687_000727 Ga0495687_000727_7170_8402 396
186 3300047445 Ga0495677_0000331 Ga0495677_0000331_1085_2317 396
187 3300047446 Ga0495679_001214 Ga0495679_001214_11980_13212 396
188 3300048091 Ga0495626_0000089 Ga0495626_0000089_69410_70642 396
189 3300048924 Ga0496121_0185429 Ga0496121_0185429_88_1320 396
190 3300048926 Ga0496123_0001155 Ga0496123_0001155_26192_27424 396
191 3300049459 Ga0495678_006837 Ga0495678_006837_4213_5445 396
192 3300046491 Ga0495584_0000002 Ga0495584_0000002_441865_443139 397
193 3300046491 Ga0495584_0081236 Ga0495584_0081236_372_1604 397
194 3300048917 Ga0496114_0199365 Ga0496114_0199365_224_1456 397
195 3300005457 Ga0070662_100054711 Ga0070662_1000547112 398
196 3300031238 Ga0265332_10000022 Ga0265332_1000002272 398
197 3300031239 Ga0265328_10017627 Ga0265328_100176272 398
198 3300046463 Ga0495653_0027720 Ga0495653_0027720_1987_3219 398
199 3300046663 Ga0495635_0002745 Ga0495635_0002745_1673_2905 398
200 3300047444 Ga0495675_0005287 Ga0495675_0005287_5389_6621 398
201 3300047673 Ga0495593_0008904 Ga0495593_0008904_4019_5251 398
202 3300048089 Ga0495614_0001365 Ga0495614_0001365_8746_9978 398
203 iso_pu_bacteria 2876369609 2876375942 400
204 iso_pu_bacteria 2881161766 2881165192 400
205 iso_pu_bacteria 2958144490 2958145475 400
206 3300039453 Ga0436362_1110877 Ga0436362_1110877_183_1439 401
207 3300053155 Ga0500620_000423 Ga0500620_000423_133_1371 401
208 3300053155 Ga0500620_000465 Ga0500620_000465_3762_5003 401
209 3300009174 Ga0105241_10003901 Ga0105241_100039015 402
210 3300025911 Ga0207654_10007763 Ga0207654_100077634 402
211 3300046660 Ga0495625_0128111 Ga0495625_0128111_160_1401 403
212 3300053096 Ga0500641_0044615 Ga0500641_0044615_577_1791 403
213 iso_pu_bacteria 2791355199 2793077686 403
214 iso_pu_bacteria 2841957949 2841960445 403
215 3300037471 Ga0395905_0050293 Ga0395905_0050293_1700_2917 404
216 3300038443 Ga0395901_0200299 Ga0395901_0200299_180_1397 404
217 3300044658 Ga0466972_0033285 Ga0466972_0033285_935_2152 404
218 iso_pu_bacteria 2599185236 2599718353 404
219 iso_pu_bacteria 2802429606 2805932988 404
220 iso_pu_bacteria 2808606384 2808968995 404
221 iso_pu_bacteria 2808606390 2809003826 404
222 iso_pu_bacteria 2808606391 2809011103 404
223 3300005262 Ga0065165_1000014 Ga0065165_1000014139 405
224 3300005347 Ga0070668_100133641 Ga0070668_1001336412 405
225 3300005719 Ga0068861_100068433 Ga0068861_1000684331 405
226 3300005985 Ga0081539_10000429 Ga0081539_100004292 405
227 3300025284 Ga0209130_1000024 Ga0209130_1000024135 405
228 3300025294 Ga0209025_1004168 Ga0209025_10041684 405
229 3300025972 Ga0207668_10109627 Ga0207668_101096271 405
230 3300026118 Ga0207675_100024607 Ga0207675_1000246074 405
231 3300044842 Ga0466957_0098143 Ga0466957_0098143_164_1384 405
232 3300049581 Ga0501047_0048660 Ga0501047_0048660_2163_3395 405
233 3300049583 Ga0501067_0009026 Ga0501067_0009026_2373_3605 405
234 3300049588 Ga0501072_0062867 Ga0501072_0062867_836_2068 405
235 3300049742 Ga0501080_0082527 Ga0501080_0082527_268_1500 405
236 3300053156 Ga0500622_0007267 Ga0500622_0007267_4882_6117 405
237 3300053177 Ga0500636_0005153 Ga0500636_0005153_5120_6355 405
238 iso_pu_bacteria 2503198000 2503198916 405
239 iso_pu_bacteria 2508501050 2508733976 405
240 iso_pu_bacteria 2508501114 2509078887 405
241 iso_pu_bacteria 2508501122 2509110173 405
242 iso_pu_bacteria 2508501123 2509119140 405
243 iso_pu_bacteria 2508501127 2509143090 405
244 iso_pu_bacteria 2509276019 2509378905 405
245 iso_pu_bacteria 2509276021 2509390872 405
246 iso_pu_bacteria 2509276022 2509393788 405
247 iso_pu_bacteria 2509276033 2509441955 405
248 iso_pu_bacteria 2510065019 2510137320 405
249 iso_pu_bacteria 2510065053 2510285095 405
250 iso_pu_bacteria 2510065055 2510294068 405
251 iso_pu_bacteria 2510065057 2510303782 405
252 iso_pu_bacteria 2510065058 2510313102 405
253 iso_pu_bacteria 2510065059 2510318459 405
254 iso_pu_bacteria 2510461069 2510842674 405
255 iso_pu_bacteria 2510461076 2510893706 405
256 iso_pu_bacteria 2510917028 2511185980 405
257 iso_pu_bacteria 2510917030 2511195721 405
258 iso_pu_bacteria 2511231052 2511503080 405
259 iso_pu_bacteria 2512047086 2512534343 405
260 iso_pu_bacteria 2512875016 2512933691 405
261 iso_pu_bacteria 2512875024 2512961842 405
262 iso_pu_bacteria 2513237084 2513571938 405
263 iso_pu_bacteria 2513237085 2513575879 405
264 iso_pu_bacteria 2513237086 2513585947 405
265 iso_pu_bacteria 2513237088 2513595811 405
266 iso_pu_bacteria 2513237090 2513614653 405
267 iso_pu_bacteria 2513237091 2513617249 405
268 iso_pu_bacteria 2513237093 2513633425 405
269 iso_pu_bacteria 2513237095 2513649487 405
270 iso_pu_bacteria 2513237103 2513712271 405
271 iso_pu_bacteria 2513237138 2513869690 405
272 iso_pu_bacteria 2513237140 2513882989 405
273 iso_pu_bacteria 2513237143 2513903019 405
274 iso_pu_bacteria 2513237144 2513912197 405
275 iso_pu_bacteria 2513237146 2513928702 405
276 iso_pu_bacteria 2513237159 2513999165 405
277 iso_pu_bacteria 2513237162 2514022635 405
278 iso_pu_bacteria 2513237164 2514035476 405
279 iso_pu_bacteria 2513237305 2514421925 405
280 iso_pu_bacteria 2515075009 2515109644 405
281 iso_pu_bacteria 2515154113 2515636606 405
282 iso_pu_bacteria 2515154114 2515644071 405
283 iso_pu_bacteria 2515154116 2515657884 405
284 iso_pu_bacteria 2515154134 2515742709 405
285 iso_pu_bacteria 2516653046 2516894484 405
286 iso_pu_bacteria 2516653077 2517042470 405
287 iso_pu_bacteria 2516653085 2517081334 405
288 iso_pu_bacteria 2517093000 2517100291 405
289 iso_pu_bacteria 2517093001 2517105025 405
290 iso_pu_bacteria 2517287029 2517411089 405
291 iso_pu_bacteria 2519899620 2520376908 405
292 iso_pu_bacteria 2524023207 2524451973 405
293 iso_pu_bacteria 2529292951 2530648804 405
294 iso_pu_bacteria 2534681786 2535486489 405
295 iso_pu_bacteria 2534681796 2535519778 405
296 iso_pu_bacteria 2551306084 2551679895 405
297 iso_pu_bacteria 2551306085 2551689765 405
298 iso_pu_bacteria 2551306086 2551692519 405
299 iso_pu_bacteria 2551306087 2551702543 405
300 iso_pu_bacteria 2551306090 2551716365 405
301 iso_pu_bacteria 2551306091 2551729551 405
302 iso_pu_bacteria 2551306092 2551737693 405
303 iso_pu_bacteria 2551306093 2551745625 405
304 iso_pu_bacteria 2558860100 2558860500 405
305 iso_pu_bacteria 2582581283 2585167200 405
306 iso_pu_bacteria 2582581294 2585200603 405
307 iso_pu_bacteria 2582581298 2585221829 405
308 iso_pu_bacteria 2582581299 2585232632 405
309 iso_pu_bacteria 2582581304 2585255712 405
310 iso_pu_bacteria 2582581306 2585270405 405
311 iso_pu_bacteria 2582581865 2585391574 405
312 iso_pu_bacteria 2582581866 2585397010 405
313 iso_pu_bacteria 2582581867 2585401359 405
314 iso_pu_bacteria 2585427526 2585526423 405
315 iso_pu_bacteria 2585427528 2585538983 405
316 iso_pu_bacteria 2585427529 2585544001 405
317 iso_pu_bacteria 2585427590 2585821499 405
318 iso_pu_bacteria 2585427593 2585836933 405
319 iso_pu_bacteria 2585427594 2585842439 405
320 iso_pu_bacteria 2585427633 2585996923 405
321 iso_pu_bacteria 2585427634 2586001512 405
322 iso_pu_bacteria 2588253730 2588519771 405
323 iso_pu_bacteria 2597489875 2597810839 405
324 iso_pu_bacteria 2599185170 2599415091 405
325 iso_pu_bacteria 2599185301 2599938830 405
326 iso_pu_bacteria 2599185352 2600194187 405
327 iso_pu_bacteria 2615840624 2616294164 405
328 iso_pu_bacteria 2615840698 2616555713 405
329 iso_pu_bacteria 2617270742 2617384674 405
330 iso_pu_bacteria 2643221550 2643771710 405
331 iso_pu_bacteria 2643221556 2643797417 405
332 iso_pu_bacteria 2643221557 2643809672 405
333 iso_pu_bacteria 2643221564 2643838020 405
334 iso_pu_bacteria 2643221595 2643985969 405
335 iso_pu_bacteria 2643221599 2644003528 405
336 iso_pu_bacteria 2643221607 2644047591 405
337 iso_pu_bacteria 2643221610 2644063852 405
338 iso_pu_bacteria 2643221623 2644130880 405
339 iso_pu_bacteria 2643221627 2644154456 405
340 iso_pu_bacteria 2643221634 2644195037 405
341 iso_pu_bacteria 2643221636 2644205944 405
342 iso_pu_bacteria 2643221637 2644210836 405
343 iso_pu_bacteria 2643221643 2644240866 405
344 iso_pu_bacteria 2643221655 2644309732 405
345 iso_pu_bacteria 2643221668 2644381374 405
346 iso_pu_bacteria 2643221675 2644415685 405
347 iso_pu_bacteria 2643221680 2644448725 405
348 iso_pu_bacteria 2643221684 2644474041 405
349 iso_pu_bacteria 2643221686 2644481058 405
350 iso_pu_bacteria 2643221688 2644496488 405
351 iso_pu_bacteria 2643221689 2644497430 405
352 iso_pu_bacteria 2643221698 2644543587 405
353 iso_pu_bacteria 2643221712 2644618179 405
354 iso_pu_bacteria 2643221718 2644654370 405
355 iso_pu_bacteria 2643221723 2644676646 405
356 iso_pu_bacteria 2643221726 2644686881 405
357 iso_pu_bacteria 2643221733 2644730316 405
358 iso_pu_bacteria 2643221734 2644736269 405
359 iso_pu_bacteria 2643221736 2644742878 405
360 iso_pu_bacteria 2657244999 2657684502 405
361 iso_pu_bacteria 2687453392 2688596191 405
362 iso_pu_bacteria 2693429783 2694627677 405
363 iso_pu_bacteria 2693429784 2694636788 405
364 iso_pu_bacteria 2718217882 2719184061 405
365 iso_pu_bacteria 2718217927 2719389794 405
366 iso_pu_bacteria 2718217997 2719669368 405
367 iso_pu_bacteria 2718218009 2719729634 405
368 iso_pu_bacteria 2718218199 2720494384 405
369 iso_pu_bacteria 2718218232 2720610704 405
370 iso_pu_bacteria 2718218233 2720616582 405
371 iso_pu_bacteria 2718218235 2720627938 405
372 iso_pu_bacteria 2718218269 2720771518 405
373 iso_pu_bacteria 2718218363 2721143884 405
374 iso_pu_bacteria 2718218365 2721156558 405
375 iso_pu_bacteria 2718218366 2721161259 405
376 iso_pu_bacteria 2718218423 2721403437 405
377 iso_pu_bacteria 2721755514 2722837212 405
378 iso_pu_bacteria 2721755556 2723030779 405
379 iso_pu_bacteria 2721755684 2723563280 405
380 iso_pu_bacteria 2721755685 2723571272 405
381 iso_pu_bacteria 2721755686 2723573325 405
382 iso_pu_bacteria 2721755809 2724035013 405
383 iso_pu_bacteria 2721755810 2724040788 405
384 iso_pu_bacteria 2721755819 2724087067 405
385 iso_pu_bacteria 2721755822 2724100778 405
386 iso_pu_bacteria 2721755823 2724108035 405
387 iso_pu_bacteria 2724679232 2725951926 405
388 iso_pu_bacteria 2728369352 2730105245 405
389 iso_pu_bacteria 2728369365 2730162201 405
390 iso_pu_bacteria 2728369397 2730295319 405
391 iso_pu_bacteria 2738541293 2738802575 405
392 iso_pu_bacteria 2738541333 2739034404 405
393 iso_pu_bacteria 2738543024 2739309869 405
394 iso_pu_bacteria 2739367655 2739612827 405
395 iso_pu_bacteria 2751185800 2753358243 405
396 iso_pu_bacteria 2751185821 2753460993 405
397 iso_pu_bacteria 2756170246 2756673585 405
398 iso_pu_bacteria 2758568016 2758638980 405
399 iso_pu_bacteria 2765235942 2766068154 405
400 iso_pu_bacteria 2773857672 2774128190 405
401 iso_pu_bacteria 2773857925 2774871361 405
402 iso_pu_bacteria 2775506901 2776258132 405
403 iso_pu_bacteria 2775507049 2776914982 405
404 iso_pu_bacteria 2775507266 2778178575 405
405 iso_pu_bacteria 2791355091 2792624370 405
406 iso_pu_bacteria 2791355092 2792625628 405
407 iso_pu_bacteria 2791355094 2792643705 405
408 iso_pu_bacteria 2791355123 2792747396 405
409 iso_pu_bacteria 2791355256 2793296032 405
410 iso_pu_bacteria 2791355259 2793312710 405
411 iso_pu_bacteria 2791355260 2793321764 405
412 iso_pu_bacteria 2791355261 2793326728 405
413 iso_pu_bacteria 2791355262 2793336415 405
414 iso_pu_bacteria 2791355263 2793340509 405
415 iso_pu_bacteria 2791355264 2793348455 405
416 iso_pu_bacteria 2791355265 2793354090 405
417 iso_pu_bacteria 2791355266 2793363164 405
418 iso_pu_bacteria 2791355267 2793367425 405
419 iso_pu_bacteria 2802429268 2804753403 405
420 iso_pu_bacteria 2802429605 2805931340 405
421 iso_pu_bacteria 2802429633 2806043201 405
422 iso_pu_bacteria 2802429634 2806051156 405
423 iso_pu_bacteria 2802429635 2806057672 405
424 iso_pu_bacteria 2802429636 2806065610 405
425 iso_pu_bacteria 2802429637 2806075160 405
426 iso_pu_bacteria 2808606418 2809143519 405
427 iso_pu_bacteria 2816332527 2818237957 405
428 iso_pu_bacteria 2818991467 2819720368 405
429 iso_pu_bacteria 2821123053 2821126683 405
430 iso_pu_bacteria 2824600985 2824601823 405
431 iso_pu_bacteria 2824609381 2824612863 405
432 iso_pu_bacteria 2824653114 2824653285 405
433 iso_pu_bacteria 2835312727 2835317757 405
434 iso_pu_bacteria 2837651117 2837653497 405
435 iso_pu_bacteria 2838016132 2838019777 405
436 iso_pu_bacteria 2838022645 2838025926 405
437 iso_pu_bacteria 2838035591 2838039186 405
438 iso_pu_bacteria 2838061910 2838067098 405
439 iso_pu_bacteria 2838068647 2838072631 405
440 iso_pu_bacteria 2838074704 2838077528 405
441 iso_pu_bacteria 2838661181 2838667720 405
442 iso_pu_bacteria 2838668709 2838669203 405
443 iso_pu_bacteria 2838680041 2838686336 405
444 iso_pu_bacteria 2838686498 2838688353 405
445 iso_pu_bacteria 2838694306 2838700754 405
446 iso_pu_bacteria 2838701080 2838701136 405
447 iso_pu_bacteria 2838707686 2838714087 405
448 iso_pu_bacteria 2838729681 2838734512 405
449 iso_pu_bacteria 2838736955 2838740290 405
450 iso_pu_bacteria 2838742623 2838746971 405
451 iso_pu_bacteria 2840878972 2840880508 405
452 iso_pu_bacteria 2841734538 2841736581 405
453 iso_pu_bacteria 2841760612 2841765315 405
454 iso_pu_bacteria 2841840854 2841843585 405
455 iso_pu_bacteria 2841851746 2841852094 405
456 iso_pu_bacteria 2841864319 2841865814 405
457 iso_pu_bacteria 2842077413 2842083443 405
458 iso_pu_bacteria 2842110456 2842111832 405
459 iso_pu_bacteria 2842118031 2842124404 405
460 iso_pu_bacteria 2842140634 2842143305 405
461 iso_pu_bacteria 2842146304 2842146799 405
462 iso_pu_bacteria 2842156927 2842158831 405
463 iso_pu_bacteria 2842163707 2842166261 405
464 iso_pu_bacteria 2842180545 2842182445 405
465 iso_pu_bacteria 2842192696 2842193818 405
466 iso_pu_bacteria 2842198810 2842200506 405
467 iso_pu_bacteria 2842205361 2842208685 405
468 iso_pu_bacteria 2842217011 2842222409 405
469 iso_pu_bacteria 2842229732 2842234542 405
470 iso_pu_bacteria 2842237096 2842243500 405
471 iso_pu_bacteria 2842243621 2842248275 405
472 iso_pu_bacteria 2842250916 2842250971 405
473 iso_pu_bacteria 2842257432 2842262552 405
474 iso_pu_bacteria 2842271015 2842272697 405
475 iso_pu_bacteria 2842278818 2842281970 405
476 iso_pu_bacteria 2842285085 2842289286 405
477 iso_pu_bacteria 2842291075 2842297623 405
478 iso_pu_bacteria 2842298080 2842303124 405
479 iso_pu_bacteria 2842304105 2842307861 405
480 iso_pu_bacteria 2842311132 2842313339 405
481 iso_pu_bacteria 2842317721 2842323095 405
482 iso_pu_bacteria 2842341865 2842347826 405
483 iso_pu_bacteria 2842357229 2842361414 405
484 iso_pu_bacteria 2842363717 2842364058 405
485 iso_pu_bacteria 2842370503 2842376895 405
486 iso_pu_bacteria 2842377471 2842384076 405
487 iso_pu_bacteria 2842384541 2842391176 405
488 iso_pu_bacteria 2842402390 2842407492 405
489 iso_pu_bacteria 2842409023 2842413259 405
490 iso_pu_bacteria 2842415677 2842419902 405
491 iso_pu_bacteria 2842422224 2842426271 405
492 iso_pu_bacteria 2842428310 2842430055 405
493 iso_pu_bacteria 2842441272 2842442704 405
494 iso_pu_bacteria 2842447887 2842453501 405
495 iso_pu_bacteria 2842462802 2842464580 405
496 iso_pu_bacteria 2842469257 2842471052 405
497 iso_pu_bacteria 2842482326 2842485539 405
498 iso_pu_bacteria 2842489311 2842490573 405
499 iso_pu_bacteria 2842495871 2842499024 405
500 iso_pu_bacteria 2842509118 2842513583 405
501 iso_pu_bacteria 2842521101 2842524910 405
502 iso_pu_bacteria 2844002411 2844003245 405
503 iso_pu_bacteria 2844009547 2844010995 405
504 iso_pu_bacteria 2844104063 2844106925 405
505 iso_pu_bacteria 2844163670 2844167628 405
506 iso_pu_bacteria 2844454524 2844461595 405
507 iso_pu_bacteria 2847417321 2847420539 405
508 iso_pu_bacteria 2847670302 2847673609 405
509 iso_pu_bacteria 2847686936 2847690122 405
510 iso_pu_bacteria 2847930680 2847936831 405
511 iso_pu_bacteria 2848992105 2848995412 405
512 iso_pu_bacteria 2850079185 2850082397 405
513 iso_pu_bacteria 2851182111 2851185912 405
514 iso_pu_bacteria 2851246043 2851248965 405
515 iso_pu_bacteria 2852387548 2852393787 405
516 iso_pu_bacteria 2854911287 2854916659 405
517 iso_pu_bacteria 2855825444 2855827120 405
518 iso_pu_bacteria 2855839649 2855842517 405
519 iso_pu_bacteria 2855872281 2855878333 405
520 iso_pu_bacteria 2856314179 2856318922 405
521 iso_pu_bacteria 2856320880 2856325311 405
522 iso_pu_bacteria 2856328259 2856329473 405
523 iso_pu_bacteria 2856334872 2856339766 405
524 iso_pu_bacteria 2856342000 2856348130 405
525 iso_pu_bacteria 2856349417 2856354527 405
526 iso_pu_bacteria 2856364286 2856367355 405
527 iso_pu_bacteria 2857349434 2857353132 405
528 iso_pu_bacteria 2857367948 2857374286 405
529 iso_pu_bacteria 2857516855 2857520555 405
530 iso_pu_bacteria 2857531043 2857535531 405
531 iso_pu_bacteria 2858800743 2858803333 405
532 iso_pu_bacteria 2869162929 2869168664 405
533 iso_pu_bacteria 2869169390 2869171417 405
534 iso_pu_bacteria 2869234852 2869240175 405
535 iso_pu_bacteria 2869242130 2869244960 405
536 iso_pu_bacteria 2869249662 2869250967 405
537 iso_pu_bacteria 2869256925 2869258138 405
538 iso_pu_bacteria 2869264136 2869265772 405
539 iso_pu_bacteria 2869271264 2869275285 405
540 iso_pu_bacteria 2869278585 2869283146 405
541 iso_pu_bacteria 2869285874 2869288496 405
542 iso_pu_bacteria 2871429161 2871431163 405
543 iso_pu_bacteria 2871435913 2871436371 405
544 iso_pu_bacteria 2871444079 2871447502 405
545 iso_pu_bacteria 2871451962 2871453816 405
546 iso_pu_bacteria 2871459585 2871460821 405
547 iso_pu_bacteria 2871466892 2871473501 405
548 iso_pu_bacteria 2871474448 2871478567 405
549 iso_pu_bacteria 2871488783 2871491602 405
550 iso_pu_bacteria 2871495908 2871498849 405
551 iso_pu_bacteria 2874109183 2874114202 405
552 iso_pu_bacteria 2874116593 2874120724 405
553 iso_pu_bacteria 2874123672 2874126325 405
554 iso_pu_bacteria 2874131515 2874132353 405
555 iso_pu_bacteria 2874139085 2874142730 405
556 iso_pu_bacteria 2874146452 2874150537 405
557 iso_pu_bacteria 2874155637 2874158278 405
558 iso_pu_bacteria 2874162495 2874163705 405
559 iso_pu_bacteria 2874168670 2874170564 405
560 iso_pu_bacteria 2876363079 2876364054 405
561 iso_pu_bacteria 2876377896 2876380873 405
562 iso_pu_bacteria 2876386047 2876387548 405
563 iso_pu_bacteria 2876392853 2876399091 405
564 iso_pu_bacteria 2876399893 2876401082 405
565 iso_pu_bacteria 2876406927 2876407363 405
566 iso_pu_bacteria 2876413966 2876416586 405
567 iso_pu_bacteria 2876420981 2876425385 405
568 iso_pu_bacteria 2878035449 2878039266 405
569 iso_pu_bacteria 2878730984 2878735254 405
570 iso_pu_bacteria 2878738818 2878739723 405
571 iso_pu_bacteria 2878745973 2878747767 405
572 iso_pu_bacteria 2878753008 2878754782 405
573 iso_pu_bacteria 2878760144 2878763067 405
574 iso_pu_bacteria 2878767105 2878770037 405
575 iso_pu_bacteria 2878774303 2878779547 405
576 iso_pu_bacteria 2878781027 2878782039 405
577 iso_pu_bacteria 2878788777 2878795479 405
578 iso_pu_bacteria 2879083081 2879087687 405
579 iso_pu_bacteria 2881147464 2881148403 405
580 iso_pu_bacteria 2881155292 2881159471 405
581 iso_pu_bacteria 2881845957 2881846517 405
582 iso_pu_bacteria 2881853255 2881859742 405
583 iso_pu_bacteria 2881861095 2881862049 405
584 iso_pu_bacteria 2882456835 2882460289 405
585 iso_pu_bacteria 2882632389 2882635206 405
586 iso_pu_bacteria 2882912400 2882914177 405
587 iso_pu_bacteria 2884298095 2884301242 405
588 iso_pu_bacteria 2885305155 2885307063 405
589 iso_pu_bacteria 2885312484 2885313937 405
590 iso_pu_bacteria 2885318864 2885325718 405
591 iso_pu_bacteria 2885326080 2885328740 405
592 iso_pu_bacteria 2885334103 2885339026 405
593 iso_pu_bacteria 2885342637 2885343732 405
594 iso_pu_bacteria 2885350715 2885352283 405
595 iso_pu_bacteria 2887375801 2887379317 405
596 iso_pu_bacteria 2888337043 2888343576 405
597 iso_pu_bacteria 2888343758 2888344555 405
598 iso_pu_bacteria 2888350351 2888353406 405
599 iso_pu_bacteria 2888378607 2888381725 405
600 iso_pu_bacteria 2888419890 2888422424 405
601 iso_pu_bacteria 2889010040 2889015120 405
602 iso_pu_bacteria 2889016732 2889019800 405
603 iso_pu_bacteria 2889306138 2889309820 405
604 iso_pu_bacteria 2894232714 2894233520 405
605 iso_pu_bacteria 2896384573 2896387627 405
606 iso_pu_bacteria 2899803654 2899807023 405
607 iso_pu_bacteria 2903448605 2903453846 405
608 iso_pu_bacteria 2903492973 2903500315 405
609 iso_pu_bacteria 2903492973 2903502248 405
610 iso_pu_bacteria 2903513507 2903518606 405
611 iso_pu_bacteria 2903521522 2903525786 405
612 iso_pu_bacteria 2903528002 2903532667 405
613 iso_pu_bacteria 2903540706 2903543651 405
614 iso_pu_bacteria 2904564687 2904566238 405
615 iso_pu_bacteria 2904571731 2904573282 405
616 iso_pu_bacteria 2904659560 2904665618 405
617 iso_pu_bacteria 2906308376 2906310940 405
618 iso_pu_bacteria 2906321335 2906323051 405
619 iso_pu_bacteria 2906328253 2906334019 405
620 iso_pu_bacteria 2906354277 2906360036 405
621 iso_pu_bacteria 2906363423 2906367837 405
622 iso_pu_bacteria 2906370794 2906373654 405
623 iso_pu_bacteria 2906378014 2906379162 405
624 iso_pu_bacteria 2906386501 2906386849 405
625 iso_pu_bacteria 2906393657 2906395773 405
626 iso_pu_bacteria 2906401398 2906402990 405
627 iso_pu_bacteria 2906408224 2906408957 405
628 iso_pu_bacteria 2906414383 2906418993 405
629 iso_pu_bacteria 2906427513 2906431500 405
630 iso_pu_bacteria 2906643746 2906647027 405
631 iso_pu_bacteria 2913295892 2913299920 405
632 iso_pu_bacteria 2915650412 2915652469 405
633 iso_pu_bacteria 2915980308 2915980653 405
634 iso_pu_bacteria 2915986958 2915991050 405
635 iso_pu_bacteria 2915993759 2915997706 405
636 iso_pu_bacteria 2916000859 2916006925 405
637 iso_pu_bacteria 2916007675 2916009459 405
638 iso_pu_bacteria 2916014648 2916019507 405
639 iso_pu_bacteria 2916021584 2916023313 405
640 iso_pu_bacteria 2916028427 2916030296 405
641 iso_pu_bacteria 2916035215 2916036853 405
642 iso_pu_bacteria 2916041962 2916044710 405
643 iso_pu_bacteria 2916048683 2916053911 405
644 iso_pu_bacteria 2916055098 2916058422 405
645 iso_pu_bacteria 2916061851 2916065613 405
646 iso_pu_bacteria 2916068649 2916073785 405
647 iso_pu_bacteria 2916076590 2916077927 405
648 iso_pu_bacteria 2917699015 2917702285 405
649 iso_pu_bacteria 2917832318 2917835460 405
650 iso_pu_bacteria 2919100787 2919103208 405
651 iso_pu_bacteria 2919125081 2919129208 405
652 iso_pu_bacteria 2919171160 2919173219 405
653 iso_pu_bacteria 2920760137 2920760662 405
654 iso_pu_bacteria 2920822456 2920828389 405
655 iso_pu_bacteria 2921201388 2921201426 405
656 iso_pu_bacteria 2921208531 2921209583 405
657 iso_pu_bacteria 2921237296 2921237509 405
658 iso_pu_bacteria 2921244191 2921244308 405
659 iso_pu_bacteria 2921250672 2921252592 405
660 iso_pu_bacteria 2921257292 2921260652 405
661 iso_pu_bacteria 2921263974 2921265911 405
662 iso_pu_bacteria 2921282425 2921286318 405
663 iso_pu_bacteria 2921289301 2921293339 405
664 iso_pu_bacteria 2921296804 2921298231 405
665 iso_pu_bacteria 2922130491 2922136486 405
666 iso_pu_bacteria 2922151315 2922153542 405
667 iso_pu_bacteria 2922172374 2922173229 405
668 iso_pu_bacteria 2922178524 2922183405 405
669 iso_pu_bacteria 2922185730 2922193161 405
670 iso_pu_bacteria 2923556063 2923560381 405
671 iso_pu_bacteria 2924144063 2924148729 405
672 iso_pu_bacteria 2924150972 2924154948 405
673 iso_pu_bacteria 2924158325 2924164164 405
674 iso_pu_bacteria 2924165586 2924166579 405
675 iso_pu_bacteria 2924172951 2924174368 405
676 iso_pu_bacteria 2924179722 2924182297 405
677 iso_pu_bacteria 2924186466 2924188519 405
678 iso_pu_bacteria 2924193448 2924193864 405
679 iso_pu_bacteria 2924200457 2924206609 405
680 iso_pu_bacteria 2924207177 2924213041 405
681 iso_pu_bacteria 2924214083 2924221290 405
682 iso_pu_bacteria 2924221636 2924226812 405
683 iso_pu_bacteria 2924228884 2924231991 405
684 iso_pu_bacteria 2924718760 2924725658 405
685 iso_pu_bacteria 2924726620 2924728174 405
686 iso_pu_bacteria 2924733363 2924740856 405
687 iso_pu_bacteria 2924741084 2924746619 405
688 iso_pu_bacteria 2924748358 2924754037 405
689 iso_pu_bacteria 2924754689 2924760436 405
690 iso_pu_bacteria 2924762789 2924767525 405
691 iso_pu_bacteria 2924776078 2924777252 405
692 iso_pu_bacteria 2924784321 2924791002 405
693 iso_pu_bacteria 2928536128 2928538140 405
694 iso_pu_bacteria 2933016740 2933023562 405
695 iso_pu_bacteria 2933570622 2933574312 405
696 iso_pu_bacteria 2933586486 2933591038 405
697 iso_pu_bacteria 2935894831 2935901084 405
698 iso_pu_bacteria 2935901341 2935907943 405
699 iso_pu_bacteria 2936367885 2936370742 405
700 iso_pu_bacteria 2936381700 2936382723 405
701 iso_pu_bacteria 2937002841 2937006899 405
702 iso_pu_bacteria 2937009748 2937015369 405
703 iso_pu_bacteria 2937016420 2937018088 405
704 iso_pu_bacteria 2937023124 2937024292 405
705 iso_pu_bacteria 2937042894 2937046639 405
706 iso_pu_bacteria 2937049772 2937052255 405
707 iso_pu_bacteria 2937056579 2937063064 405
708 iso_pu_bacteria 2937063883 2937067498 405
709 iso_pu_bacteria 2937071275 2937071313 405
710 iso_pu_bacteria 2937091812 2937092980 405
711 iso_pu_bacteria 2937098957 2937104802 405
712 iso_pu_bacteria 2937106411 2937110552 405
713 iso_pu_bacteria 2937113482 2937114486 405
714 iso_pu_bacteria 2937119839 2937123786 405
715 iso_pu_bacteria 2937126314 2937129236 405
716 iso_pu_bacteria 2937813078 2937815543 405
717 iso_pu_bacteria 2937822353 2937823433 405
718 iso_pu_bacteria 2937836603 2937838836 405
719 iso_pu_bacteria 2937843397 2937848448 405
720 iso_pu_bacteria 2937848649 2937849937 405
721 iso_pu_bacteria 2937868953 2937869444 405
722 iso_pu_bacteria 2937877337 2937880408 405
723 iso_pu_bacteria 2937891427 2937898366 405
724 iso_pu_bacteria 2937972304 2937976877 405
725 iso_pu_bacteria 2937980651 2937987891 405
726 iso_pu_bacteria 2937994558 2937997497 405
727 iso_pu_bacteria 2938014810 2938018856 405
728 iso_pu_bacteria 2941499720 2941501596 405
729 iso_pu_bacteria 2957382221 2957385997 405
730 iso_pu_bacteria 2957388812 2957390081 405
731 iso_pu_bacteria 2957395598 2957396855 405
732 iso_pu_bacteria 2957402308 2957406178 405
733 iso_pu_bacteria 2957408893 2957408931 405
734 iso_pu_bacteria 2957415311 2957421972 405
735 iso_pu_bacteria 2957422303 2957426900 405
736 iso_pu_bacteria 2957430029 2957430619 405
737 iso_pu_bacteria 2957450854 2957454457 405
738 iso_pu_bacteria 2957457609 2957459442 405
739 iso_pu_bacteria 2957464669 2957468283 405
740 iso_pu_bacteria 2957471148 2957472007 405
741 iso_pu_bacteria 2957478035 2957480932 405
742 iso_pu_bacteria 2957484790 2957485585 405
743 iso_pu_bacteria 2957491536 2957495185 405
744 iso_pu_bacteria 2957498199 2957500314 405
745 iso_pu_bacteria 2957505466 2957506968 405
746 iso_pu_bacteria 2958034702 2958035298 405
747 iso_pu_bacteria 2958041894 2958052497 405
748 iso_pu_bacteria 2958064165 2958070960 405
749 iso_pu_bacteria 2958071322 2958072359 405
750 iso_pu_bacteria 2958084443 2958087543 405
751 iso_pu_bacteria 2958092219 2958098973 405
752 iso_pu_bacteria 2958100919 2958104415 405
753 iso_pu_bacteria 2958115193 2958120293 405
754 iso_pu_bacteria 2958122699 2958126790 405
755 iso_pu_bacteria 2958130278 2958132898 405
756 iso_pu_bacteria 2958137437 2958139060 405
757 iso_pu_bacteria 2958158011 2958161297 405
758 iso_pu_bacteria 2958165035 2958167971 405
759 iso_pu_bacteria 2958179912 2958182600 405
760 iso_pu_bacteria 2960584000 2960587530 405
761 iso_pu_bacteria 2960597568 2960598690 405
762 iso_pu_bacteria 2960603979 2960605059 405
763 iso_pu_bacteria 2960610863 2960617337 405
764 iso_pu_bacteria 2960624210 2960629612 405
765 iso_pu_bacteria 2960637947 2960638789 405
766 iso_pu_bacteria 2960645483 2960646660 405
767 iso_pu_bacteria 2960652885 2960659722 405
768 iso_pu_bacteria 2960667422 2960671410 405
769 iso_pu_bacteria 2960674078 2960675398 405
770 iso_pu_bacteria 2960687367 2960687846 405
771 iso_pu_bacteria 2961077736 2961080448 405
772 iso_pu_bacteria 2961114664 2961120961 405
773 iso_pu_bacteria 2961127735 2961133423 405
774 iso_pu_bacteria 2961136820 2961138872 405
775 iso_pu_bacteria 2961163497 2961166439 405
776 iso_pu_bacteria 2961170736 2961171973 405
777 iso_pu_bacteria 2961183825 2961185634 405
778 iso_pu_bacteria 2963644680 2963645512 405
779 iso_pu_bacteria 2964607997 2964612357 405
780 iso_pu_bacteria 2964615318 2964618547 405
781 iso_pu_bacteria 2964621998 2964624865 405
782 iso_pu_bacteria 2964628898 2964631398 405
783 iso_pu_bacteria 2964636051 2964640526 405
784 iso_pu_bacteria 2964643177 2964647155 405
785 iso_pu_bacteria 2964649959 2964650948 405
786 iso_pu_bacteria 2964656573 2964659060 405
787 iso_pu_bacteria 2964663802 2964668771 405
788 iso_pu_bacteria 2964670856 2964675103 405
789 iso_pu_bacteria 2964678106 2964681705 405
790 iso_pu_bacteria 2964685014 2964689434 405
791 iso_pu_bacteria 2964691889 2964692657 405
792 iso_pu_bacteria 2964698721 2964705106 405
793 iso_pu_bacteria 2964705432 2964706280 405
794 iso_pu_bacteria 2964712639 2964719029 405
795 iso_pu_bacteria 2964719344 2964724308 405
796 iso_pu_bacteria 2965018300 2965021258 405
797 iso_pu_bacteria 2965025482 2965026773 405
798 iso_pu_bacteria 2965032056 2965039469 405
799 iso_pu_bacteria 2965040258 2965047373 405
800 iso_pu_bacteria 2965047637 2965052632 405
801 iso_pu_bacteria 2965062239 2965064341 405
802 iso_pu_bacteria 2965089291 2965096243 405
803 iso_pu_bacteria 2965110997 2965115366 405
804 iso_pu_bacteria 2965119406 2965123604 405
805 iso_pu_bacteria 2967664464 2967667693 405
806 iso_pu_bacteria 2967671571 2967673170 405
807 iso_pu_bacteria 2967678726 2967682969 405
808 iso_pu_bacteria 2967693043 2967696073 405
809 iso_pu_bacteria 2967699805 2967699949 405
810 iso_pu_bacteria 2967706974 2967708256 405
811 iso_pu_bacteria 2967714385 2967715867 405
812 iso_pu_bacteria 2967721400 2967726492 405
813 iso_pu_bacteria 2967735183 2967735474 405
814 iso_pu_bacteria 2967742019 2967743447 405
815 iso_pu_bacteria 2967748971 2967750180 405
816 iso_pu_bacteria 2967762386 2967769110 405
817 iso_pu_bacteria 2967769361 2967774501 405
818 iso_pu_bacteria 2967775926 2967777486 405
819 iso_pu_bacteria 2967996073 2967997453 405
820 iso_pu_bacteria 2968003550 2968006455 405
821 iso_pu_bacteria 2968016561 2968017430 405
822 iso_pu_bacteria 2968083720 2968085156 405
823 iso_pu_bacteria 2968091066 2968093404 405
824 iso_pu_bacteria 2968097103 2968098166 405
825 iso_pu_bacteria 2968110612 2968117111 405
826 iso_pu_bacteria 2968117919 2968122462 405
827 iso_pu_bacteria 2968128360 2968129528 405
828 iso_pu_bacteria 2968138860 2968144609 405
829 iso_pu_bacteria 2968171901 2968174840 405
830 iso_pu_bacteria 2970019648 2970025021 405
831 iso_pu_bacteria 2970033650 2970040703 405
832 iso_pu_bacteria 2970040964 2970041812 405
833 iso_pu_bacteria 2970047711 2970049510 405
834 iso_pu_bacteria 2970054988 2970061006 405
835 iso_pu_bacteria 2970061556 2970068097 405
836 iso_pu_bacteria 2970068827 2970069395 405
837 iso_pu_bacteria 2970076120 2970082619 405
838 iso_pu_bacteria 2970082768 2970084203 405
839 iso_pu_bacteria 2970088815 2970095451 405
840 iso_pu_bacteria 2970095765 2970099033 405
841 iso_pu_bacteria 2970102677 2970108779 405
842 iso_pu_bacteria 2970109326 2970115206 405
843 iso_pu_bacteria 2970116247 2970119268 405
844 iso_pu_bacteria 2970129317 2970134248 405
845 iso_pu_bacteria 2970136068 2970137425 405
846 iso_pu_bacteria 2970149975 2970155697 405
847 iso_pu_bacteria 2970156795 2970158285 405
848 iso_pu_bacteria 2970164137 2970165942 405
849 iso_pu_bacteria 2970170962 2970173296 405
850 iso_pu_bacteria 2970177841 2970179789 405
851 iso_pu_bacteria 2970184632 2970186475 405
852 iso_pu_bacteria 2970191845 2970194458 405
853 iso_pu_bacteria 2970469710 2970472476 405
854 iso_pu_bacteria 2970489779 2970493603 405
855 iso_pu_bacteria 2970503327 2970504570 405
856 iso_pu_bacteria 2970510686 2970512234 405
857 iso_pu_bacteria 2970524798 2970526276 405
858 iso_pu_bacteria 2970547951 2970550868 405
859 iso_pu_bacteria 2970554993 2970557922 405
860 iso_pu_bacteria 2970593180 2970597766 405
861 iso_pu_bacteria 2970619444 2970620723 405
862 iso_pu_bacteria 2970627176 2970628822 405
863 iso_pu_bacteria 2974298342 2974299654 405
864 iso_pu_bacteria 2977516862 2977520733 405
865 iso_pu_bacteria 2977523885 2977530135 405
866 iso_pu_bacteria 2977537788 2977540918 405
867 iso_pu_bacteria 2977551784 2977556798 405
868 iso_pu_bacteria 2977558990 2977565547 405
869 iso_pu_bacteria 2977565890 2977569060 405
870 iso_pu_bacteria 2977572785 2977578061 405
871 iso_pu_bacteria 2977579622 2977579661 405
872 iso_pu_bacteria 2977821940 2977823999 405
873 iso_pu_bacteria 2977828996 2977835292 405
874 iso_pu_bacteria 2977843712 2977846692 405
875 iso_pu_bacteria 2977851361 2977853271 405
876 iso_pu_bacteria 2977858184 2977858925 405
877 iso_pu_bacteria 2977864932 2977865703 405
878 iso_pu_bacteria 2977872689 2977875820 405
879 iso_pu_bacteria 2977898635 2977903481 405
880 iso_pu_bacteria 2977907340 2977913241 405
881 iso_pu_bacteria 2977915119 2977919576 405
882 iso_pu_bacteria 2977922695 2977924711 405
883 iso_pu_bacteria 2977935797 2977937990 405
884 iso_pu_bacteria 2977942078 2977945403 405
885 iso_pu_bacteria 2977950692 2977955387 405
886 iso_pu_bacteria 2977957713 2977959590 405
887 iso_pu_bacteria 2977971508 2977976226 405
888 iso_pu_bacteria 2977986579 2977988945 405
889 iso_pu_bacteria 2979710463 2979714862 405
890 iso_pu_bacteria 2979742915 2979748077 405
891 iso_pu_bacteria 2979772303 2979772497 405
892 iso_pu_bacteria 2979779861 2979785285 405
893 iso_pu_bacteria 2979793036 2979795259 405
894 iso_pu_bacteria 2979808191 2979809208 405
895 iso_pu_bacteria 2984499530 2984502014 405
896 iso_pu_bacteria 2984504281 2984504490 405
897 iso_pu_bacteria 2987636660 2987641724 405
898 iso_pu_bacteria 2987645492 2987645935 405
899 iso_pu_bacteria 2987652177 2987657630 405
900 iso_pu_bacteria 2987659509 2987662447 405
901 iso_pu_bacteria 2987666974 2987667159 405
902 iso_pu_bacteria 2987673487 2987675782 405
903 iso_pu_bacteria 2989349275 2989353517 405
904 iso_pu_bacteria 2989771324 2989771664 405
905 iso_pu_bacteria 2996310559 2996314165 405
906 iso_pu_bacteria 2996336353 2996338931 405
907 iso_pu_bacteria 2996341866 2996344893 405
908 iso_pu_bacteria 2996348954 2996352222 405
909 iso_pu_bacteria 2996386984 2996389060 405
910 iso_pu_bacteria 2996887358 2996891256 405
911 iso_pu_bacteria 2996893221 2996896534 405
912 iso_pu_bacteria 3000135777 3000137636 405
913 iso_pu_bacteria 3003930520 3003935545 405
914 iso_pu_bacteria 3004167301 3004173509 405
915 iso_pu_bacteria 3004188549 3004191498 405
916 iso_pu_bacteria 3004195979 3004196695 405
917 iso_pu_bacteria 3004203850 3004209464 405
918 iso_pu_bacteria 3004211236 3004218502 405
919 iso_pu_bacteria 3004218560 3004223652 405
920 iso_pu_bacteria 3004232784 3004234226 405
921 iso_pu_bacteria 3004239961 3004242602 405
922 iso_pu_bacteria 3004248173 3004250750 405
923 iso_pu_bacteria 3004268573 3004274325 405
924 iso_pu_bacteria 3004275668 3004278897 405
925 iso_pu_bacteria 3004334049 3004337036 405
926 iso_pu_bacteria 3005409236 3005413602 405
927 iso_pu_bacteria 3005445848 3005450808 405
928 iso_pu_bacteria 3005452660 3005458453 405
929 iso_pu_bacteria 637000159 637076804 405
930 iso_pu_bacteria 639633055 639650896 405
931 iso_pu_bacteria 643692032 643827178 405
932 iso_pu_bacteria 648276728 648735758 405
933 iso_pu_bacteria 649633066 649870750 405
934 iso_pu_bacteria 8002285264 8002290243 405
935 iso_pu_bacteria 8003992118 8003995058 405
936 iso_pu_bacteria 8004300914 8004303059 405
937 iso_pu_bacteria 8004312739 8004314550 405
938 iso_pu_bacteria 8004361976 8004362229 405
939 iso_pu_bacteria 8004374579 8004376364 405
940 iso_pu_bacteria 8004387939 8004390465 405
941 iso_pu_bacteria 8004395343 8004403000 405
942 iso_pu_bacteria 8004445564 8004452086 405
943 iso_pu_bacteria 8004633249 8004639888 405
944 iso_pu_bacteria 8004640170 8004641896 405
945 iso_pu_bacteria 8004695233 8004700612 405
946 iso_pu_bacteria 8004703790 8004706552 405
947 iso_pu_bacteria 8004714634 8004717157 405
948 iso_pu_bacteria 8005258706 8005263804 405
949 iso_pu_bacteria 8005275841 8005275916 405
950 iso_pu_bacteria 8005282627 8005287453 405
951 iso_pu_bacteria 8005289223 8005289813 405
952 iso_pu_bacteria 8005301065 8005307490 405
953 iso_pu_bacteria 8005307578 8005311935 405
954 iso_pu_bacteria 8005321885 8005325783 405
955 iso_pu_bacteria 8005382845 8005389177 405
956 iso_pu_bacteria 8005395548 8005396731 405
957 iso_pu_bacteria 8005430974 8005435856 405
958 iso_pu_bacteria 8005497431 8005503602 405
959 iso_pu_bacteria 8005542996 8005547498 405
960 iso_pu_bacteria 8005556819 8005563114 405
961 iso_pu_bacteria 8005563573 8005564947 405
962 iso_pu_bacteria 8005570704 8005576058 405
963 iso_pu_bacteria 8005619151 8005625913 405
964 iso_pu_bacteria 8005626139 8005632152 405
965 iso_pu_bacteria 8005668836 8005675480 405
966 iso_pu_bacteria 8005682033 8005685932 405
967 iso_pu_bacteria 8005688590 8005688777 405
968 iso_pu_bacteria 8005695170 8005695195 405
969 iso_pu_bacteria 8016728285 8016733708 405
970 iso_pu_bacteria 8018127388 8018134751 405
971 iso_pu_bacteria 8018163183 8018169918 405
972 iso_pu_bacteria 8018176218 8018180804 405
973 iso_pu_bacteria 8023680758 8023685925 405
974 iso_pu_bacteria 8024479707 8024485218 405
975 iso_pu_bacteria 8024486573 8024487460 405
976 iso_pu_bacteria 8024501048 8024506849 405
977 iso_pu_bacteria 8045864390 8045868619 405
978 iso_pu_bacteria 8046767195 8046774465 405
979 iso_pu_bacteria 8047673197 8047679673 405
980 iso_pu_bacteria 8054460903 8054464763 405
981 iso_pu_bacteria 8055617313 8055618133 405
982 iso_pu_bacteria 8056375014 8056381764 405
983 iso_pu_bacteria 8056382006 8056382920 405
984 iso_pu_bacteria 8057529695 8057532509 405
985 iso_pu_bacteria 8057874678 8057876160 405
986 3300005548 Ga0070665_100257934 Ga0070665_1002579342 406
987 3300005937 Ga0081455_10003610 Ga0081455_100036104 406
988 3300049571 Ga0501034_0003296 Ga0501034_0003296_14281_15507 406
989 iso_pu_bacteria 2537561587 2537877555 406
990 iso_pu_bacteria 2554235003 2554245418 406
991 iso_pu_bacteria 2558860242 2559296753 406
992 iso_pu_bacteria 2599185210 2599602756 406
993 iso_pu_bacteria 2600255279 2601610377 406
994 iso_pu_bacteria 2600255308 2601747293 406
995 iso_pu_bacteria 2643221582 2643917270 406
996 iso_pu_bacteria 2643221693 2644520880 406
997 iso_pu_bacteria 2808606387 2808987206 406
998 iso_pu_bacteria 2818991439 2819557457 406
999 iso_pu_bacteria 2834578030 2834580428 406
1000 iso_pu_bacteria 2838675328 2838678036 406
1001 iso_pu_bacteria 2838714209 2838717058 406
1002 iso_pu_bacteria 2838719591 2838722331 406
1003 iso_pu_bacteria 2838724970 2838727807 406
1004 iso_pu_bacteria 2841846520 2841849464 406
1005 iso_pu_bacteria 2841859092 2841861494 406
1006 iso_pu_bacteria 2842124991 2842127787 406
1007 iso_pu_bacteria 2842130223 2842132929 406
1008 iso_pu_bacteria 2842152218 2842154922 406
1009 iso_pu_bacteria 2842170452 2842173421 406
1010 iso_pu_bacteria 2842175837 2842178543 406
1011 iso_pu_bacteria 2842187318 2842190166 406
1012 iso_pu_bacteria 2842211629 2842214480 406
1013 iso_pu_bacteria 2842224351 2842227199 406
1014 iso_pu_bacteria 2842515876 2842518240 406
1015 iso_pu_bacteria 2899792073 2899796535 406
1016 iso_pu_bacteria 2899845264 2899850060 406
1017 iso_pu_bacteria 2919114240 2919117316 406
1018 iso_pu_bacteria 2926754445 2926758763 406
1019 iso_pu_bacteria 2926760298 2926763706 406
1020 iso_pu_bacteria 2933006813 2933009695 406
1021 iso_pu_bacteria 2933011516 2933013869 406
1022 iso_pu_bacteria 2933594066 2933595682 406
1023 iso_pu_bacteria 2979089926 2979091252 406
1024 iso_pu_bacteria 2979095461 2979096777 406
1025 iso_pu_bacteria 2979100975 2979102498 406
1026 iso_pu_bacteria 2984509177 2984509617 406
1027 iso_pu_bacteria 2984518228 2984519685 406
1028 iso_pu_bacteria 2984537506 2984537954 406
1029 iso_pu_bacteria 2984601300 2984604699 406
1030 iso_pu_bacteria 650716007 650843175 406
1031 iso_pu_bacteria 8003570095 8003572750 406
1032 3300005937 Ga0081455_10000373 Ga0081455_1000037315 407
1033 3300006038 Ga0075365_10000621 Ga0075365_100006214 407
1034 3300006177 Ga0075362_10061021 Ga0075362_100610211 407
1035 3300013104 Ga0157370_10010599 Ga0157370_100105994 407
1036 3300013105 Ga0157369_10006614 Ga0157369_100066144 407
1037 3300025913 Ga0207695_10030412 Ga0207695_100304125 407
1038 3300028794 Ga0307515_10038687 Ga0307515_100386876 407
1039 3300037418 Ga0395900_0018932 Ga0395900_0018932_2792_4066 407
1040 3300038443 Ga0395901_0052706 Ga0395901_0052706_2322_3596 407
1041 3300039447 Ga0436361_0019078 Ga0436361_0019078_1374_2600 407
1042 3300049569 Ga0501032_0000017 Ga0501032_0000017_55487_56911 407
1043 3300049570 Ga0501033_0000029 Ga0501033_0000029_55478_56902 407
1044 3300049570 Ga0501033_0107252 Ga0501033_0107252_437_1663 407
1045 3300049571 Ga0501034_0000102 Ga0501034_0000102_55486_56910 407
1046 3300049571 Ga0501034_0101500 Ga0501034_0101500_1273_2499 407
1047 3300049571 Ga0501034_0146586 Ga0501034_0146586_616_1845 407
1048 3300049572 Ga0501036_0000011 Ga0501036_0000011_101393_102817 407
1049 3300049573 Ga0501037_0000015 Ga0501037_0000015_104402_105826 407
1050 3300049574 Ga0501038_0000016 Ga0501038_0000016_55486_56910 407
1051 3300049574 Ga0501038_0074545 Ga0501038_0074545_1273_2499 407
1052 3300049575 Ga0501039_0000023 Ga0501039_0000023_55486_56910 407
1053 3300049575 Ga0501039_0025637 Ga0501039_0025637_3158_4384 407
1054 3300049576 Ga0501040_0045977 Ga0501040_0045977_1005_2429 407
1055 3300049579 Ga0501043_0000372 Ga0501043_0000372_38808_40232 407
1056 3300049580 Ga0501046_0039751 Ga0501046_0039751_571_1995 407
1057 3300049581 Ga0501047_0001169 Ga0501047_0001169_15248_16672 407
1058 3300049581 Ga0501047_0038110 Ga0501047_0038110_1273_2499 407
1059 3300049581 Ga0501047_0248865 Ga0501047_0248865_93_1322 407
1060 3300049582 Ga0501048_0012058 Ga0501048_0012058_2603_3829 407
1061 3300049584 Ga0501068_0006869 Ga0501068_0006869_767_1993 407
1062 3300049744 Ga0501083_0057730 Ga0501083_0057730_718_1944 407
1063 3300049822 Ga0501035_0000038 Ga0501035_0000038_101909_103333 407
1064 3300049822 Ga0501035_0080769 Ga0501035_0080769_372_1598 407
1065 3300049823 Ga0501044_0000046 Ga0501044_0000046_89903_91327 407
1066 3300049823 Ga0501044_0102921 Ga0501044_0102921_1273_2499 407
1067 3300049824 Ga0501045_0012943 Ga0501045_0012943_1024_2250 407
1068 3300050489 nmdc:mga03683_38362_c1 nmdc:mga03683_38362_c1_267_1514 407
1069 3300050491 nmdc:mga00v17_11699_c1 nmdc:mga00v17_11699_c1_2540_3793 407
1070 3300050492 nmdc:mga0yw44_1934_c1 nmdc:mga0yw44_1934_c1_1058_2305 407
1071 3300050492 nmdc:mga0yw44_4057_c1 nmdc:mga0yw44_4057_c1_3285_4538 407
1072 3300050516 nmdc:mga0sz30_26798_c1 nmdc:mga0sz30_26798_c1_1101_2327 407
1073 iso_pu_bacteria 2904578770 2904583347 407
1074 iso_pu_bacteria 2919119836 2919121033 407
1075 3300002705 JGI25156J39149_1012995 JGI25156J39149_10129952 408
1076 3300002737 JGI25162J39368_1001999 JGI25162J39368_10019997 408
1077 3300002738 JGI25154J39366_1003005 JGI25154J39366_10030054 408
1078 3300002739 JGI25158J39367_1000211 JGI25158J39367_10002113 408
1079 3300002741 JGI25157J39369_1000312 JGI25157J39369_100031218 408
1080 3300002741 JGI25157J39369_1002353 JGI25157J39369_10023534 408
1081 3300002773 JGI25152J39213_1000211 JGI25152J39213_100021129 408
1082 3300002773 JGI25152J39213_1001114 JGI25152J39213_10011148 408
1083 3300002773 JGI25152J39213_1005026 JGI25152J39213_10050262 408
1084 3300002773 JGI25152J39213_1005046 JGI25152J39213_10050462 408
1085 3300002774 JGI25150J39212_1000103 JGI25150J39212_10001034 408
1086 3300002987 JGI25159J45721_1000106 JGI25159J45721_100010631 408
1087 3300002987 JGI25159J45721_1000565 JGI25159J45721_100056510 408
1088 3300003187 JGI25151J46595_10000015 JGI25151J46595_10000015208 408
1089 3300003187 JGI25151J46595_10000085 JGI25151J46595_1000008579 408
1090 3300003187 JGI25151J46595_10000303 JGI25151J46595_1000030340 408
1091 3300003187 JGI25151J46595_10000442 JGI25151J46595_1000044227 408
1092 3300003187 JGI25151J46595_10013448 JGI25151J46595_100134482 408
1093 3300003214 JGI25165J46597_1000052 JGI25165J46597_100005280 408
1094 3300003214 JGI25165J46597_1000225 JGI25165J46597_10002252 408
1095 3300003215 JGI25153J46596_10001373 JGI25153J46596_100013737 408
1096 3300003215 JGI25153J46596_10011178 JGI25153J46596_100111782 408
1097 3300003215 JGI25153J46596_10011226 JGI25153J46596_100112262 408
1098 3300003322 rootL2_10076941 rootL2_100769412 408
1099 3300003354 JGI25160J50197_1000134 JGI25160J50197_100013428 408
1100 3300003354 JGI25160J50197_1000357 JGI25160J50197_10003575 408
1101 3300003354 JGI25160J50197_1004101 JGI25160J50197_10041013 408
1102 3300003354 JGI25160J50197_1013969 JGI25160J50197_10139692 408
1103 3300003354 JGI25160J50197_1018240 JGI25160J50197_10182402 408
1104 3300003374 JGI25161J50226_1000116 JGI25161J50226_100011642 408
1105 3300003374 JGI25161J50226_1000227 JGI25161J50226_100022722 408
1106 3300003374 JGI25161J50226_1000272 JGI25161J50226_10002725 408
1107 3300003374 JGI25161J50226_1002006 JGI25161J50226_10020065 408
1108 3300003578 Ga0006562J51391_1009235 Ga0006562J51391_10092352 408
1109 3300003752 Ga0055539_1000392 Ga0055539_100039217 408
1110 3300003756 Ga0055533_1000024 Ga0055533_1000024108 408
1111 3300003759 Ga0055525_1000008 Ga0055525_1000008327 408
1112 3300003759 Ga0055525_1000615 Ga0055525_10006159 408
1113 3300003760 Ga0055527_1000278 Ga0055527_10002788 408
1114 3300003761 Ga0055535_1000562 Ga0055535_100056223 408
1115 3300003762 Ga0055542_1000284 Ga0055542_100028425 408
1116 3300003762 Ga0055542_1000587 Ga0055542_100058723 408
1117 3300003763 Ga0055529_1000418 Ga0055529_100041823 408
1118 3300003771 Ga0055526_1000652 Ga0055526_100065215 408
1119 3300003771 Ga0055526_1001955 Ga0055526_10019552 408
1120 3300003771 Ga0055526_1002947 Ga0055526_10029479 408
1121 3300003771 Ga0055526_1009244 Ga0055526_10092443 408
1122 3300003771 Ga0055526_1010722 Ga0055526_10107223 408
1123 3300003771 Ga0055526_1011288 Ga0055526_10112882 408
1124 3300003771 Ga0055526_1012632 Ga0055526_10126324 408
1125 3300003775 Ga0055524_1000301 Ga0055524_100030138 408
1126 3300003775 Ga0055524_1000618 Ga0055524_100061820 408
1127 3300003775 Ga0055524_1001672 Ga0055524_100167211 408
1128 3300003775 Ga0055524_1001793 Ga0055524_10017939 408
1129 3300003775 Ga0055524_1010049 Ga0055524_10100491 408
1130 3300003775 Ga0055524_1013171 Ga0055524_10131712 408
1131 3300003781 Ga0055536_1005119 Ga0055536_10051194 408
1132 3300003781 Ga0055536_1015701 Ga0055536_10157012 408
1133 3300003790 Ga0055528_1000602 Ga0055528_10006027 408
1134 3300003790 Ga0055528_1000712 Ga0055528_100071213 408
1135 3300003790 Ga0055528_1000849 Ga0055528_10008493 408
1136 3300003790 Ga0055528_1002425 Ga0055528_10024257 408
1137 3300003790 Ga0055528_1008911 Ga0055528_10089112 408
1138 3300003792 Ga0055540_1000131 Ga0055540_10001313 408
1139 3300003792 Ga0055540_1005898 Ga0055540_10058983 408
1140 3300003792 Ga0055540_1007846 Ga0055540_10078463 408
1141 3300003794 Ga0055531_10005530 Ga0055531_100055301 408
1142 3300004625 Ga0055543_1000093 Ga0055543_100009361 408
1143 3300004625 Ga0055543_1000161 Ga0055543_100016125 408
1144 3300004625 Ga0055543_1000574 Ga0055543_10005742 408
1145 3300005262 Ga0065165_1000196 Ga0065165_100019662 408
1146 3300005262 Ga0065165_1000553 Ga0065165_100055325 408
1147 3300005327 Ga0070658_10134102 Ga0070658_101341021 408
1148 3300005327 Ga0070658_10210060 Ga0070658_102100602 408
1149 3300005330 Ga0070690_100043814 Ga0070690_1000438142 408
1150 3300005334 Ga0068869_100128336 Ga0068869_1001283362 408
1151 3300005339 Ga0070660_100044256 Ga0070660_1000442561 408
1152 3300005339 Ga0070660_100122321 Ga0070660_1001223212 408
1153 3300005341 Ga0070691_10004671 Ga0070691_100046712 408
1154 3300005344 Ga0070661_100210633 Ga0070661_1002106332 408
1155 3300005364 Ga0070673_100171582 Ga0070673_1001715821 408
1156 3300005366 Ga0070659_100085886 Ga0070659_1000858861 408
1157 3300005436 Ga0070713_100047301 Ga0070713_1000473012 408
1158 3300005436 Ga0070713_100365743 Ga0070713_1003657431 408
1159 3300005439 Ga0070711_100098757 Ga0070711_1000987571 408
1160 3300005439 Ga0070711_100150922 Ga0070711_1001509222 408
1161 3300005441 Ga0070700_100079706 Ga0070700_1000797061 408
1162 3300005444 Ga0070694_100030931 Ga0070694_1000309313 408
1163 3300005467 Ga0070706_100175279 Ga0070706_1001752792 408
1164 3300005468 Ga0070707_100157727 Ga0070707_1001577272 408
1165 3300005471 Ga0070698_100005438 Ga0070698_1000054384 408
1166 3300005518 Ga0070699_100127316 Ga0070699_1001273162 408
1167 3300005535 Ga0070684_100019867 Ga0070684_1000198674 408
1168 3300005539 Ga0068853_100039120 Ga0068853_1000391203 408
1169 3300005539 Ga0068853_100097806 Ga0068853_1000978062 408
1170 3300005545 Ga0070695_100003867 Ga0070695_1000038674 408
1171 3300005548 Ga0070665_100112054 Ga0070665_1001120542 408
1172 3300005563 Ga0068855_100002198 Ga0068855_1000021986 408
1173 3300005563 Ga0068855_100010534 Ga0068855_1000105345 408
1174 3300005563 Ga0068855_100267875 Ga0068855_1002678751 408
1175 3300005563 Ga0068855_100315710 Ga0068855_1003157101 408
1176 3300005564 Ga0070664_100024464 Ga0070664_1000244644 408
1177 3300005564 Ga0070664_100078408 Ga0070664_1000784083 408
1178 3300005577 Ga0068857_100025509 Ga0068857_1000255094 408
1179 3300005578 Ga0068854_100010289 Ga0068854_1000102895 408
1180 3300005578 Ga0068854_100026684 Ga0068854_1000266844 408
1181 3300005614 Ga0068856_100001613 Ga0068856_1000016136 408
1182 3300005616 Ga0068852_100030903 Ga0068852_1000309033 408
1183 3300005616 Ga0068852_100051942 Ga0068852_1000519424 408
1184 3300005937 Ga0081455_10000637 Ga0081455_100006378 408
1185 3300005937 Ga0081455_10002518 Ga0081455_1000251818 408
1186 3300005983 Ga0081540_1000087 Ga0081540_100008753 408
1187 3300005983 Ga0081540_1033187 Ga0081540_10331872 408
1188 3300005985 Ga0081539_10004039 Ga0081539_1000403916 408
1189 3300006038 Ga0075365_10034710 Ga0075365_100347102 408
1190 3300006038 Ga0075365_10043511 Ga0075365_100435113 408
1191 3300006042 Ga0075368_10040317 Ga0075368_100403172 408
1192 3300006048 Ga0075363_100016576 Ga0075363_1000165763 408
1193 3300006048 Ga0075363_100026744 Ga0075363_1000267442 408
1194 3300006051 Ga0075364_10020622 Ga0075364_100206223 408
1195 3300006051 Ga0075364_10022554 Ga0075364_100225543 408
1196 3300006058 Ga0075432_10030664 Ga0075432_100306643 408
1197 3300006175 Ga0070712_100023146 Ga0070712_1000231462 408
1198 3300006175 Ga0070712_100079287 Ga0070712_1000792873 408
1199 3300006177 Ga0075362_10000600 Ga0075362_100006003 408
1200 3300006177 Ga0075362_10008900 Ga0075362_100089002 408
1201 3300006178 Ga0075367_10004723 Ga0075367_100047235 408
1202 3300006186 Ga0075369_10000214 Ga0075369_1000021410 408
1203 3300006186 Ga0075369_10003614 Ga0075369_100036142 408
1204 3300006186 Ga0075369_10012709 Ga0075369_100127093 408
1205 3300006186 Ga0075369_10022119 Ga0075369_100221191 408
1206 3300006186 Ga0075369_10028215 Ga0075369_100282152 408
1207 3300006195 Ga0075366_10070997 Ga0075366_100709972 408
1208 3300006195 Ga0075366_10111527 Ga0075366_101115272 408
1209 3300006353 Ga0075370_10002165 Ga0075370_100021653 408
1210 3300006844 Ga0075428_100045123 Ga0075428_1000451234 408
1211 3300006846 Ga0075430_100023735 Ga0075430_1000237354 408
1212 3300006847 Ga0075431_100006794 Ga0075431_1000067948 408
1213 3300006847 Ga0075431_100025820 Ga0075431_1000258204 408
1214 3300006852 Ga0075433_10144404 Ga0075433_101444042 408
1215 3300006871 Ga0075434_100014619 Ga0075434_1000146192 408
1216 3300006871 Ga0075434_100188350 Ga0075434_1001883502 408
1217 3300006880 Ga0075429_100040711 Ga0075429_1000407113 408
1218 3300006946 Ga0079104_1000386 Ga0079104_100038640 408
1219 3300006948 Ga0099826_10000080 Ga0099826_1000008023 408
1220 3300007076 Ga0075435_100010284 Ga0075435_1000102846 408
1221 3300007265 Ga0099794_10071455 Ga0099794_100714551 408
1222 3300009036 Ga0105244_10024354 Ga0105244_100243543 408
1223 3300009036 Ga0105244_10047669 Ga0105244_100476692 408
1224 3300009094 Ga0111539_10055655 Ga0111539_100556551 408
1225 3300009147 Ga0114129_10043003 Ga0114129_100430031 408
1226 3300009148 Ga0105243_10044429 Ga0105243_100444292 408
1227 3300009148 Ga0105243_10235250 Ga0105243_102352502 408
1228 3300009177 Ga0105248_10067959 Ga0105248_100679595 408
1229 3300009177 Ga0105248_10141070 Ga0105248_101410702 408
1230 3300009545 Ga0105237_10061705 Ga0105237_100617052 408
1231 3300009545 Ga0105237_10235839 Ga0105237_102358391 408
1232 3300009551 Ga0105238_10009341 Ga0105238_100093415 408
1233 3300009553 Ga0105249_10116374 Ga0105249_101163743 408
1234 3300009765 Ga0123341_1000093 Ga0123341_100009335 408
1235 3300009766 Ga0123342_1017495 Ga0123342_10174953 408
1236 3300010375 Ga0105239_10158669 Ga0105239_101586693 408
1237 3300013100 Ga0157373_10055382 Ga0157373_100553822 408
1238 3300013102 Ga0157371_10000002 Ga0157371_10000002295 408
1239 3300013102 Ga0157371_10058393 Ga0157371_100583934 408
1240 3300013104 Ga0157370_10000143 Ga0157370_1000014349 408
1241 3300013105 Ga0157369_10020411 Ga0157369_100204117 408
1242 3300013105 Ga0157369_10064215 Ga0157369_100642153 408
1243 3300013105 Ga0157369_10291424 Ga0157369_102914242 408
1244 3300013249 Ga0171463_1014 Ga0171463_101431 408
1245 3300014326 Ga0157380_10012206 Ga0157380_100122063 408
1246 3300015690 Ga0183363_1028 Ga0183363_102818 408
1247 3300017792 Ga0163161_10070378 Ga0163161_100703781 408
1248 3300021320 Ga0214544_1000063 Ga0214544_1000063106 408
1249 3300021321 Ga0214542_1000095 Ga0214542_100009596 408
1250 3300021321 Ga0214542_1023913 Ga0214542_10239133 408
1251 3300021327 Ga0214543_1000008 Ga0214543_1000008309 408
1252 3300021327 Ga0214543_1000026 Ga0214543_100002696 408
1253 3300021358 Ga0213873_10011471 Ga0213873_100114712 408
1254 3300021361 Ga0213872_10016302 Ga0213872_100163023 408
1255 3300021377 Ga0213874_10006267 Ga0213874_100062672 408
1256 3300021377 Ga0213874_10010612 Ga0213874_100106122 408
1257 3300021384 Ga0213876_10001001 Ga0213876_1000100110 408
1258 3300021384 Ga0213876_10007938 Ga0213876_100079385 408
1259 3300021384 Ga0213876_10012988 Ga0213876_100129883 408
1260 3300021441 Ga0213871_10001994 Ga0213871_100019941 408
1261 3300022739 Ga0228711_1000003 Ga0228711_1000003233 408
1262 3300022740 Ga0228710_1000003 Ga0228710_1000003239 408
1263 3300025208 Ga0209436_100021 Ga0209436_10002186 408
1264 3300025208 Ga0209436_101037 Ga0209436_10103710 408
1265 3300025226 Ga0209674_100007 Ga0209674_100007153 408
1266 3300025228 Ga0209672_100069 Ga0209672_100069111 408
1267 3300025229 Ga0209147_100044 Ga0209147_100044156 408
1268 3300025230 Ga0209563_100003 Ga0209563_1000031410 408
1269 3300025230 Ga0209563_100060 Ga0209563_100060116 408
1270 3300025231 Ga0207427_100282 Ga0207427_10028223 408
1271 3300025231 Ga0207427_100659 Ga0207427_1006598 408
1272 3300025233 Ga0209437_100183 Ga0209437_10018368 408
1273 3300025242 Ga0209258_100031 Ga0209258_100031235 408
1274 3300025242 Ga0209258_101271 Ga0209258_1012712 408
1275 3300025245 Ga0207425_1000065 Ga0207425_100006576 408
1276 3300025245 Ga0207425_1000912 Ga0207425_100091212 408
1277 3300025245 Ga0207425_1002840 Ga0207425_10028403 408
1278 3300025245 Ga0207425_1008148 Ga0207425_10081481 408
1279 3300025246 Ga0209646_1000056 Ga0209646_100005672 408
1280 3300025246 Ga0209646_1010083 Ga0209646_10100832 408
1281 3300025250 Ga0209026_1000009 Ga0209026_1000009272 408
1282 3300025250 Ga0209026_1000141 Ga0209026_1000141123 408
1283 3300025253 Ga0209677_100088 Ga0209677_100088100 408
1284 3300025253 Ga0209677_100112 Ga0209677_10011269 408
1285 3300025253 Ga0209677_102809 Ga0209677_1028095 408
1286 3300025253 Ga0209677_104123 Ga0209677_1041233 408
1287 3300025254 Ga0209148_1000027 Ga0209148_1000027235 408
1288 3300025254 Ga0209148_1000111 Ga0209148_100011176 408
1289 3300025256 Ga0209759_1000035 Ga0209759_1000035191 408
1290 3300025256 Ga0209759_1001567 Ga0209759_10015671 408
1291 3300025256 Ga0209759_1005260 Ga0209759_10052604 408
1292 3300025258 Ga0209129_1000132 Ga0209129_100013276 408
1293 3300025258 Ga0209129_1001371 Ga0209129_10013713 408
1294 3300025258 Ga0209129_1001912 Ga0209129_10019128 408
1295 3300025258 Ga0209129_1002753 Ga0209129_10027536 408
1296 3300025258 Ga0209129_1003666 Ga0209129_10036663 408
1297 3300025258 Ga0209129_1003832 Ga0209129_10038323 408
1298 3300025261 Ga0209233_1000054 Ga0209233_1000054202 408
1299 3300025261 Ga0209233_1000118 Ga0209233_1000118183 408
1300 3300025263 Ga0209565_1013116 Ga0209565_10131162 408
1301 3300025272 Ga0209455_1000058 Ga0209455_1000058193 408
1302 3300025272 Ga0209455_1000206 Ga0209455_100020675 408
1303 3300025272 Ga0209455_1000742 Ga0209455_100074210 408
1304 3300025273 Ga0209673_1000020 Ga0209673_100002074 408
1305 3300025273 Ga0209673_1000059 Ga0209673_1000059174 408
1306 3300025273 Ga0209673_1000475 Ga0209673_10004759 408
1307 3300025273 Ga0209673_1003583 Ga0209673_10035833 408
1308 3300025273 Ga0209673_1006173 Ga0209673_10061732 408
1309 3300025273 Ga0209673_1006661 Ga0209673_10066615 408
1310 3300025273 Ga0209673_1008055 Ga0209673_10080552 408
1311 3300025273 Ga0209673_1009721 Ga0209673_10097212 408
1312 3300025273 Ga0209673_1018568 Ga0209673_10185682 408
1313 3300025273 Ga0209673_1028253 Ga0209673_10282531 408
1314 3300025284 Ga0209130_1000001 Ga0209130_10000018 408
1315 3300025284 Ga0209130_1000122 Ga0209130_100012212 408
1316 3300025284 Ga0209130_1000198 Ga0209130_100019831 408
1317 3300025291 Ga0209675_1000455 Ga0209675_10004554 408
1318 3300025292 Ga0209676_1020075 Ga0209676_10200752 408
1319 3300025294 Ga0209025_1000010 Ga0209025_1000010652 408
1320 3300025294 Ga0209025_1000081 Ga0209025_1000081215 408
1321 3300025294 Ga0209025_1000247 Ga0209025_100024776 408
1322 3300025294 Ga0209025_1000339 Ga0209025_100033960 408
1323 3300025294 Ga0209025_1004847 Ga0209025_10048474 408
1324 3300025294 Ga0209025_1007051 Ga0209025_10070513 408
1325 3300025294 Ga0209025_1026001 Ga0209025_10260013 408
1326 3300025295 Ga0209564_1000048 Ga0209564_1000048268 408
1327 3300025295 Ga0209564_1000074 Ga0209564_100007472 408
1328 3300025295 Ga0209564_1000205 Ga0209564_1000205123 408
1329 3300025295 Ga0209564_1000353 Ga0209564_100035343 408
1330 3300025295 Ga0209564_1000496 Ga0209564_100049656 408
1331 3300025295 Ga0209564_1001947 Ga0209564_10019475 408
1332 3300025295 Ga0209564_1002995 Ga0209564_10029955 408
1333 3300025295 Ga0209564_1003802 Ga0209564_10038022 408
1334 3300025295 Ga0209564_1006946 Ga0209564_10069462 408
1335 3300025295 Ga0209564_1012841 Ga0209564_10128411 408
1336 3300025297 Ga0209758_1000058 Ga0209758_1000058307 408
1337 3300025297 Ga0209758_1000076 Ga0209758_1000076197 408
1338 3300025297 Ga0209758_1000212 Ga0209758_100021276 408
1339 3300025297 Ga0209758_1000632 Ga0209758_100063212 408
1340 3300025297 Ga0209758_1001845 Ga0209758_100184512 408
1341 3300025297 Ga0209758_1001850 Ga0209758_100185012 408
1342 3300025297 Ga0209758_1009090 Ga0209758_10090903 408
1343 3300025297 Ga0209758_1009203 Ga0209758_10092033 408
1344 3300025297 Ga0209758_1012519 Ga0209758_10125194 408
1345 3300025297 Ga0209758_1014390 Ga0209758_10143903 408
1346 3300025298 Ga0209050_1023979 Ga0209050_10239792 408
1347 3300025299 Ga0209256_1000041 Ga0209256_1000041268 408
1348 3300025299 Ga0209256_1000368 Ga0209256_100036872 408
1349 3300025299 Ga0209256_1000439 Ga0209256_100043956 408
1350 3300025299 Ga0209256_1000456 Ga0209256_100045633 408
1351 3300025299 Ga0209256_1000884 Ga0209256_10008842 408
1352 3300025299 Ga0209256_1001113 Ga0209256_100111314 408
1353 3300025299 Ga0209256_1002079 Ga0209256_10020793 408
1354 3300025299 Ga0209256_1006792 Ga0209256_10067923 408
1355 3300025299 Ga0209256_1007313 Ga0209256_10073135 408
1356 3300025299 Ga0209256_1009415 Ga0209256_10094153 408
1357 3300025299 Ga0209256_1010744 Ga0209256_10107442 408
1358 3300025302 Ga0207426_1000005 Ga0207426_1000005613 408
1359 3300025302 Ga0207426_1000048 Ga0207426_1000048348 408
1360 3300025302 Ga0207426_1000083 Ga0207426_1000083295 408
1361 3300025302 Ga0207426_1000285 Ga0207426_100028526 408
1362 3300025302 Ga0207426_1000679 Ga0207426_100067933 408
1363 3300025302 Ga0207426_1004795 Ga0207426_10047954 408
1364 3300025303 Ga0209051_1000038 Ga0209051_1000038234 408
1365 3300025303 Ga0209051_1002114 Ga0209051_100211413 408
1366 3300025303 Ga0209051_1008605 Ga0209051_10086055 408
1367 3300025304 Ga0209257_1017738 Ga0209257_10177382 408
1368 3300025304 Ga0209257_1021472 Ga0209257_10214722 408
1369 3300025304 Ga0209257_1036226 Ga0209257_10362262 408
1370 3300025901 Ga0207688_10095087 Ga0207688_100950872 408
1371 3300025909 Ga0207705_10003450 Ga0207705_100034505 408
1372 3300025911 Ga0207654_10076509 Ga0207654_100765091 408
1373 3300025913 Ga0207695_10023098 Ga0207695_100230986 408
1374 3300025916 Ga0207663_10030964 Ga0207663_100309642 408
1375 3300025916 Ga0207663_10144453 Ga0207663_101444531 408
1376 3300025919 Ga0207657_10003943 Ga0207657_100039431 408
1377 3300025919 Ga0207657_10019641 Ga0207657_100196412 408
1378 3300025919 Ga0207657_10128807 Ga0207657_101288072 408
1379 3300025921 Ga0207652_10210488 Ga0207652_102104882 408
1380 3300025922 Ga0207646_10085365 Ga0207646_100853653 408
1381 3300025924 Ga0207694_10011887 Ga0207694_100118872 408
1382 3300025928 Ga0207700_10054476 Ga0207700_100544762 408
1383 3300025933 Ga0207706_10275657 Ga0207706_102756572 408
1384 3300025934 Ga0207686_10033052 Ga0207686_100330522 408
1385 3300025936 Ga0207670_10103001 Ga0207670_101030012 408
1386 3300025941 Ga0207711_10187866 Ga0207711_101878662 408
1387 3300025941 Ga0207711_10212205 Ga0207711_102122052 408
1388 3300025942 Ga0207689_10199198 Ga0207689_101991982 408
1389 3300025945 Ga0207679_10095758 Ga0207679_100957583 408
1390 3300025949 Ga0207667_10090792 Ga0207667_100907922 408
1391 3300025960 Ga0207651_10133214 Ga0207651_101332141 408
1392 3300025981 Ga0207640_10007812 Ga0207640_100078124 408
1393 3300026035 Ga0207703_10170902 Ga0207703_101709021 408
1394 3300026067 Ga0207678_10199179 Ga0207678_101991792 408
1395 3300026067 Ga0207678_10220986 Ga0207678_102209861 408
1396 3300026075 Ga0207708_10012415 Ga0207708_100124152 408
1397 3300026078 Ga0207702_10001270 Ga0207702_100012706 408
1398 3300026078 Ga0207702_10003872 Ga0207702_1000387212 408
1399 3300026116 Ga0207674_10029976 Ga0207674_100299764 408
1400 3300026118 Ga0207675_100309123 Ga0207675_1003091232 408
1401 3300026121 Ga0207683_10133125 Ga0207683_101331251 408
1402 3300026142 Ga0207698_10216126 Ga0207698_102161262 408
1403 3300027111 Ga0209281_1000061 Ga0209281_1000061214 408
1404 3300027111 Ga0209281_1000081 Ga0209281_1000081233 408
1405 3300027111 Ga0209281_1000141 Ga0209281_1000141122 408
1406 3300027296 Ga0209389_1000133 Ga0209389_10001336 408
1407 3300027296 Ga0209389_1006188 Ga0209389_10061887 408
1408 3300027312 Ga0209371_1000003 Ga0209371_1000003518 408
1409 3300027312 Ga0209371_1001726 Ga0209371_100172610 408
1410 3300027312 Ga0209371_1002486 Ga0209371_10024866 408
1411 3300027357 Ga0209589_1013845 Ga0209589_10138457 408
1412 3300027361 Ga0209489_110509 Ga0209489_1105095 408
1413 3300027363 Ga0209700_100005 Ga0209700_100005575 408
1414 3300027666 Ga0209282_1000036 Ga0209282_10000365 408
1415 3300027907 Ga0207428_10004370 Ga0207428_100043709 408
1416 3300028379 Ga0268266_10003103 Ga0268266_1000310310 408
1417 3300028379 Ga0268266_10078944 Ga0268266_100789442 408
1418 3300028379 Ga0268266_10088667 Ga0268266_100886672 408
1419 3300028381 Ga0268264_10305404 Ga0268264_103054041 408
1420 3300028666 Ga0265336_10000039 Ga0265336_1000003953 408
1421 3300028794 Ga0307515_10000121 Ga0307515_1000012167 408
1422 3300028794 Ga0307515_10000375 Ga0307515_1000037515 408
1423 3300028794 Ga0307515_10004715 Ga0307515_100047158 408
1424 3300029957 Ga0265324_10000223 Ga0265324_1000022314 408
1425 3300030500 Ga0268256_1000004 Ga0268256_1000004533 408
1426 3300030500 Ga0268256_1001505 Ga0268256_10015059 408
1427 3300030500 Ga0268256_1002211 Ga0268256_10022116 408
1428 3300030521 Ga0307511_10025974 Ga0307511_100259743 408
1429 3300030521 Ga0307511_10090227 Ga0307511_100902271 408
1430 3300031456 Ga0307513_10000685 Ga0307513_100006854 408
1431 3300031456 Ga0307513_10098885 Ga0307513_100988852 408
1432 3300031507 Ga0307509_10005791 Ga0307509_100057917 408
1433 3300031727 Ga0316576_10122192 Ga0316576_101221922 408
1434 3300031730 Ga0307516_10001841 Ga0307516_1000184121 408
1435 3300031731 Ga0307405_10115461 Ga0307405_101154612 408
1436 3300031911 Ga0307412_10001638 Ga0307412_1000163810 408
1437 3300031911 Ga0307412_10130928 Ga0307412_101309282 408
1438 3300031911 Ga0307412_10148001 Ga0307412_101480012 408
1439 3300031967 Ga0315914_1000002 Ga0315914_1000002339 408
1440 3300033179 Ga0307507_10032928 Ga0307507_100329282 408
1441 3300033430 Ga0315913_1000009 Ga0315913_10000095 408
1442 3300033464 Ga0315915_1000005 Ga0315915_1000005339 408
1443 3300035692 Ga0373935_0027424 Ga0373935_0027424_518_1750 408
1444 3300035695 Ga0373927_0002624 Ga0373927_0002624_3619_4851 408
1445 3300035695 Ga0373927_0013018 Ga0373927_0013018_4188_5420 408
1446 3300035695 Ga0373927_0050071 Ga0373927_0050071_441_1670 408
1447 3300035695 Ga0373927_0068840 Ga0373927_0068840_628_1860 408
1448 3300035724 Ga0373933_0010887 Ga0373933_0010887_1334_2566 408
1449 3300035725 Ga0373947_0046525 Ga0373947_0046525_226_1458 408
1450 3300036712 Ga0316584_0042001 Ga0316584_0042001_786_2021 408
1451 3300037068 Ga0373925_0009563 Ga0373925_0009563_5693_6925 408
1452 3300037068 Ga0373925_0075689 Ga0373925_0075689_766_1995 408
1453 3300037312 Ga0395899_0000114 Ga0395899_0000114_80354_81586 408
1454 3300037312 Ga0395899_0000256 Ga0395899_0000256_4754_5986 408
1455 3300037312 Ga0395899_0005500 Ga0395899_0005500_649_1881 408
1456 3300037312 Ga0395899_0008000 Ga0395899_0008000_4415_5647 408
1457 3300037312 Ga0395899_0030974 Ga0395899_0030974_753_1985 408
1458 3300037312 Ga0395899_0197059 Ga0395899_0197059_17_1249 408
1459 3300037418 Ga0395900_0000154 Ga0395900_0000154_59490_60722 408
1460 3300037418 Ga0395900_0000495 Ga0395900_0000495_35437_36669 408
1461 3300037418 Ga0395900_0017561 Ga0395900_0017561_1774_3063 408
1462 3300037418 Ga0395900_0019966 Ga0395900_0019966_446_1678 408
1463 3300037418 Ga0395900_0021874 Ga0395900_0021874_3668_4900 408
1464 3300037418 Ga0395900_0026789 Ga0395900_0026789_4546_5778 408
1465 3300037418 Ga0395900_0034524 Ga0395900_0034524_3366_4652 408
1466 3300037466 Ga0395898_0000308 Ga0395898_0000308_53036_54268 408
1467 3300037466 Ga0395898_0001598 Ga0395898_0001598_26038_27270 408
1468 3300037466 Ga0395898_0008520 Ga0395898_0008520_2179_3465 408
1469 3300037466 Ga0395898_0009676 Ga0395898_0009676_6595_7884 408
1470 3300037466 Ga0395898_0047847 Ga0395898_0047847_2878_4110 408
1471 3300037466 Ga0395898_0082134 Ga0395898_0082134_380_1612 408
1472 3300037466 Ga0395898_0133780 Ga0395898_0133780_473_1705 408
1473 3300037471 Ga0395905_0000153 Ga0395905_0000153_59490_60722 408
1474 3300037471 Ga0395905_0000608 Ga0395905_0000608_29458_30702 408
1475 3300037471 Ga0395905_0002370 Ga0395905_0002370_16134_17366 408
1476 3300037471 Ga0395905_0003440 Ga0395905_0003440_10650_11897 408
1477 3300037471 Ga0395905_0041221 Ga0395905_0041221_624_1856 408
1478 3300037471 Ga0395905_0042986 Ga0395905_0042986_1121_2353 408
1479 3300037471 Ga0395905_0071866 Ga0395905_0071866_1596_2828 408
1480 3300037471 Ga0395905_0118637 Ga0395905_0118637_1068_2300 408
1481 3300037471 Ga0395905_0260112 Ga0395905_0260112_155_1387 408
1482 3300037853 Ga0436364_0404283 Ga0436364_0404283_169_1401 408
1483 3300037853 Ga0436364_0765904 Ga0436364_0765904_572_1804 408
1484 3300038443 Ga0395901_0000094 Ga0395901_0000094_38481_39713 408
1485 3300038443 Ga0395901_0000107 Ga0395901_0000107_53036_54268 408
1486 3300038443 Ga0395901_0000251 Ga0395901_0000251_18295_19584 408
1487 3300038443 Ga0395901_0000442 Ga0395901_0000442_43276_44508 408
1488 3300038443 Ga0395901_0007216 Ga0395901_0007216_7604_8836 408
1489 3300038443 Ga0395901_0026926 Ga0395901_0026926_1257_2543 408
1490 3300038443 Ga0395901_0068851 Ga0395901_0068851_1529_2761 408
1491 3300038443 Ga0395901_0133478 Ga0395901_0133478_66_1298 408
1492 3300038443 Ga0395901_0185078 Ga0395901_0185078_863_2095 408
1493 3300038443 Ga0395901_0324115 Ga0395901_0324115_274_1506 408
1494 3300039437 Ga0436365_0719336 Ga0436365_0719336_2336_3568 408
1495 3300039437 Ga0436365_0753514 Ga0436365_0753514_2629_3861 408
1496 3300039437 Ga0436365_0840670 Ga0436365_0840670_15469_16701 408
1497 3300039437 Ga0436365_1017006 Ga0436365_1017006_9521_10801 408
1498 3300039437 Ga0436365_1031487 Ga0436365_1031487_2555_3787 408
1499 3300039437 Ga0436365_1892158 Ga0436365_1892158_20_1252 408
1500 3300039438 Ga0436360_0326901 Ga0436360_0326901_4214_5446 408
1501 3300039438 Ga0436360_0648562 Ga0436360_0648562_357_1589 408
1502 3300039438 Ga0436360_0990394 Ga0436360_0990394_126_1358 408
1503 3300039447 Ga0436361_0135137 Ga0436361_0135137_1163_2395 408
1504 3300039447 Ga0436361_0507251 Ga0436361_0507251_415_1647 408
1505 3300039450 Ga0436363_0046001 Ga0436363_0046001_9741_10973 408
1506 3300039450 Ga0436363_1344620 Ga0436363_1344620_5797_7029 408
1507 3300039453 Ga0436362_0841325 Ga0436362_0841325_372_1604 408
1508 3300041413 Ga0439465_0003037 Ga0439465_0003037_2625_3857 408
1509 3300042004 Ga0439445_0006529 Ga0439445_0006529_333_1565 408
1510 3300042007 Ga0439449_0034617 Ga0439449_0034617_323_1555 408
1511 3300044684 Ga0466966_0001049 Ga0466966_0001049_12806_14074 408
1512 3300044684 Ga0466966_0144483 Ga0466966_0144483_18_1250 408
1513 3300044693 Ga0466961_0018854 Ga0466961_0018854_148_1416 408
1514 3300044694 Ga0466963_0047358 Ga0466963_0047358_51_1283 408
1515 3300044706 Ga0466964_0014140 Ga0466964_0014140_526_1794 408
1516 3300044719 Ga0466971_0013817 Ga0466971_0013817_953_2221 408
1517 3300044765 Ga0466970_0024484 Ga0466970_0024484_1359_2591 408
1518 3300044842 Ga0466957_0000006 Ga0466957_0000006_71820_73052 408
1519 3300044842 Ga0466957_0010640 Ga0466957_0010640_230_1462 408
1520 3300044901 Ga0466960_0002991 Ga0466960_0002991_1750_3009 408
1521 3300045049 Ga0466959_0040715 Ga0466959_0040715_745_1977 408
1522 3300045049 Ga0466959_0047923 Ga0466959_0047923_351_1583 408
1523 3300045836 Ga0466958_0033350 Ga0466958_0033350_1345_2613 408
1524 3300045836 Ga0466958_0071737 Ga0466958_0071737_85_1317 408
1525 3300045976 Ga0466967_0019819 Ga0466967_0019819_2615_3847 408
1526 3300046452 Ga0495617_000001 Ga0495617_000001_312120_313352 408
1527 3300046452 Ga0495617_000162 Ga0495617_000162_35429_36703 408
1528 3300046453 Ga0495627_000026 Ga0495627_000026_176447_177679 408
1529 3300046454 Ga0495592_0039380 Ga0495592_0039380_872_2104 408
1530 3300046455 Ga0495603_0132796 Ga0495603_0132796_149_1381 408
1531 3300046457 Ga0495590_0000042 Ga0495590_0000042_53216_54448 408
1532 3300046457 Ga0495590_0001365 Ga0495590_0001365_1146_2378 408
1533 3300046458 Ga0495591_000068 Ga0495591_000068_62391_63623 408
1534 3300046459 Ga0495629_0004385 Ga0495629_0004385_417_1649 408
1535 3300046460 Ga0495638_0000163 Ga0495638_0000163_71162_72394 408
1536 3300046462 Ga0495651_0022517 Ga0495651_0022517_576_1808 408
1537 3300046463 Ga0495653_0072342 Ga0495653_0072342_41_1273 408
1538 3300046473 Ga0495582_0005844 Ga0495582_0005844_48_1280 408
1539 3300046474 Ga0495605_0000058 Ga0495605_0000058_36904_38136 408
1540 3300046474 Ga0495605_0000623 Ga0495605_0000623_8221_9459 408
1541 3300046474 Ga0495605_0004673 Ga0495605_0004673_5092_6324 408
1542 3300046474 Ga0495605_0011941 Ga0495605_0011941_3475_4707 408
1543 3300046474 Ga0495605_0018157 Ga0495605_0018157_2398_3630 408
1544 3300046477 Ga0495664_0104900 Ga0495664_0104900_178_1431 408
1545 3300046491 Ga0495584_0000646 Ga0495584_0000646_21811_23067 408
1546 3300046491 Ga0495584_0012261 Ga0495584_0012261_1150_2382 408
1547 3300046491 Ga0495584_0017063 Ga0495584_0017063_88_1320 408
1548 3300046491 Ga0495584_0018451 Ga0495584_0018451_2187_3419 408
1549 3300046491 Ga0495584_0129257 Ga0495584_0129257_33_1262 408
1550 3300046492 Ga0495585_0000003 Ga0495585_0000003_109692_110966 408
1551 3300046492 Ga0495585_0000032 Ga0495585_0000032_10169_11401 408
1552 3300046492 Ga0495585_0000321 Ga0495585_0000321_21426_22682 408
1553 3300046492 Ga0495585_0012725 Ga0495585_0012725_3382_4614 408
1554 3300046492 Ga0495585_0013397 Ga0495585_0013397_3280_4512 408
1555 3300046492 Ga0495585_0024094 Ga0495585_0024094_1747_2979 408
1556 3300046492 Ga0495585_0070281 Ga0495585_0070281_383_1612 408
1557 3300046499 Ga0495594_0004974 Ga0495594_0004974_2271_3503 408
1558 3300046500 Ga0495596_0003265 Ga0495596_0003265_1706_2938 408
1559 3300046501 Ga0495607_0003427 Ga0495607_0003427_2060_3292 408
1560 3300046501 Ga0495607_0003766 Ga0495607_0003766_9663_10895 408
1561 3300046501 Ga0495607_0035976 Ga0495607_0035976_191_1429 408
1562 3300046501 Ga0495607_0073463 Ga0495607_0073463_301_1533 408
1563 3300046506 Ga0495583_0000082 Ga0495583_0000082_91259_92491 408
1564 3300046506 Ga0495583_0000170 Ga0495583_0000170_70140_71372 408
1565 3300046506 Ga0495583_0000200 Ga0495583_0000200_51053_52285 408
1566 3300046506 Ga0495583_0000496 Ga0495583_0000496_51072_52346 408
1567 3300046506 Ga0495583_0008181 Ga0495583_0008181_2348_3580 408
1568 3300046507 Ga0495606_0001544 Ga0495606_0001544_8080_9312 408
1569 3300046507 Ga0495606_0001795 Ga0495606_0001795_6275_7507 408
1570 3300046507 Ga0495606_0002165 Ga0495606_0002165_11342_12574 408
1571 3300046507 Ga0495606_0004946 Ga0495606_0004946_3509_4747 408
1572 3300046511 Ga0495608_0013532 Ga0495608_0013532_3770_5002 408
1573 3300046512 Ga0495610_0011466 Ga0495610_0011466_697_1929 408
1574 3300046512 Ga0495610_0035355 Ga0495610_0035355_431_1663 408
1575 3300046513 Ga0495616_0000096 Ga0495616_0000096_41712_42944 408
1576 3300046513 Ga0495616_0001466 Ga0495616_0001466_8170_9444 408
1577 3300046513 Ga0495616_0006689 Ga0495616_0006689_678_1910 408
1578 3300046513 Ga0495616_0020237 Ga0495616_0020237_1124_2356 408
1579 3300046513 Ga0495616_0053853 Ga0495616_0053853_632_1864 408
1580 3300046515 Ga0495620_0040439 Ga0495620_0040439_653_1885 408
1581 3300046518 Ga0495631_0003450 Ga0495631_0003450_1926_3158 408
1582 3300046518 Ga0495631_0010450 Ga0495631_0010450_873_2105 408
1583 3300046518 Ga0495631_0022130 Ga0495631_0022130_1065_2297 408
1584 3300046519 Ga0495632_0000377 Ga0495632_0000377_25946_27178 408
1585 3300046519 Ga0495632_0001515 Ga0495632_0001515_5582_6814 408
1586 3300046519 Ga0495632_0013879 Ga0495632_0013879_843_2075 408
1587 3300046520 Ga0495637_0000002 Ga0495637_0000002_220340_221572 408
1588 3300046520 Ga0495637_0061761 Ga0495637_0061761_263_1495 408
1589 3300046522 Ga0495643_0000910 Ga0495643_0000910_2868_4100 408
1590 3300046522 Ga0495643_0001124 Ga0495643_0001124_141_1373 408
1591 3300046522 Ga0495643_0005591 Ga0495643_0005591_6268_7500 408
1592 3300046522 Ga0495643_0010166 Ga0495643_0010166_1067_2299 408
1593 3300046522 Ga0495643_0021651 Ga0495643_0021651_825_2057 408
1594 3300046522 Ga0495643_0042100 Ga0495643_0042100_893_2125 408
1595 3300046523 Ga0495644_0016494 Ga0495644_0016494_182_1414 408
1596 3300046524 Ga0495648_0000011 Ga0495648_0000011_34783_36057 408
1597 3300046524 Ga0495648_0000307 Ga0495648_0000307_18590_19822 408
1598 3300046524 Ga0495648_0037801 Ga0495648_0037801_128_1381 408
1599 3300046524 Ga0495648_0090647 Ga0495648_0090647_445_1677 408
1600 3300046526 Ga0495666_0048437 Ga0495666_0048437_88_1320 408
1601 3300046528 Ga0495642_0000001 Ga0495642_0000001_52905_54137 408
1602 3300046529 Ga0495652_0054795 Ga0495652_0054795_459_1691 408
1603 3300046529 Ga0495652_0081300 Ga0495652_0081300_547_1779 408
1604 3300046530 Ga0495654_0002880 Ga0495654_0002880_3330_4562 408
1605 3300046536 Ga0495587_0012781 Ga0495587_0012781_2962_4194 408
1606 3300046536 Ga0495587_0016775 Ga0495587_0016775_1456_2688 408
1607 3300046538 Ga0495609_0000001 Ga0495609_0000001_854954_856186 408
1608 3300046538 Ga0495609_0004972 Ga0495609_0004972_331_1563 408
1609 3300046538 Ga0495609_0037377 Ga0495609_0037377_442_1674 408
1610 3300046542 Ga0495597_0003053 Ga0495597_0003053_5511_6743 408
1611 3300046542 Ga0495597_0007475 Ga0495597_0007475_3672_4904 408
1612 3300046542 Ga0495597_0017905 Ga0495597_0017905_2085_3317 408
1613 3300046542 Ga0495597_0020512 Ga0495597_0020512_287_1519 408
1614 3300046543 Ga0495645_0001029 Ga0495645_0001029_7516_8748 408
1615 3300046543 Ga0495645_0075352 Ga0495645_0075352_383_1615 408
1616 3300046557 Ga0495622_0050612 Ga0495622_0050612_585_1859 408
1617 3300046615 Ga0495656_0011683 Ga0495656_0011683_1861_3093 408
1618 3300046616 Ga0495668_0000357 Ga0495668_0000357_58938_60170 408
1619 3300046616 Ga0495668_0003625 Ga0495668_0003625_242_1474 408
1620 3300046616 Ga0495668_0007039 Ga0495668_0007039_2358_3590 408
1621 3300046616 Ga0495668_0012831 Ga0495668_0012831_109_1341 408
1622 3300046616 Ga0495668_0037188 Ga0495668_0037188_921_2195 408
1623 3300046616 Ga0495668_0059852 Ga0495668_0059852_449_1681 408
1624 3300046648 Ga0495611_0007514 Ga0495611_0007514_1730_2962 408
1625 3300046648 Ga0495611_0037603 Ga0495611_0037603_286_1515 408
1626 3300046660 Ga0495625_0002669 Ga0495625_0002669_11871_13103 408
1627 3300046660 Ga0495625_0034133 Ga0495625_0034133_1621_2853 408
1628 3300046663 Ga0495635_0008379 Ga0495635_0008379_2454_3686 408
1629 3300046665 Ga0495661_0000040 Ga0495661_0000040_59589_60821 408
1630 3300046665 Ga0495661_0000089 Ga0495661_0000089_71999_73231 408
1631 3300046665 Ga0495661_0001925 Ga0495661_0001925_15253_16485 408
1632 3300046665 Ga0495661_0041042 Ga0495661_0041042_210_1442 408
1633 3300046665 Ga0495661_0073713 Ga0495661_0073713_544_1776 408
1634 3300046674 Ga0495588_0000196 Ga0495588_0000196_33920_35239 408
1635 3300046674 Ga0495588_0063794 Ga0495588_0063794_47_1279 408
1636 3300046675 Ga0495657_0049882 Ga0495657_0049882_1087_2340 408
1637 3300046675 Ga0495657_0055050 Ga0495657_0055050_605_1837 408
1638 3300046679 Ga0495623_0005861 Ga0495623_0005861_41_1273 408
1639 3300046679 Ga0495623_0029914 Ga0495623_0029914_95_1327 408
1640 3300046680 Ga0495646_0023831 Ga0495646_0023831_375_1607 408
1641 3300046691 Ga0495670_0060830 Ga0495670_0060830_552_1781 408
1642 3300046691 Ga0495670_0072746 Ga0495670_0072746_140_1372 408
1643 3300046692 Ga0495671_0000167 Ga0495671_0000167_4015_5247 408
1644 3300046692 Ga0495671_0065006 Ga0495671_0065006_93_1325 408
1645 3300046692 Ga0495671_0075033 Ga0495671_0075033_65_1294 408
1646 3300046694 Ga0495649_0000029 Ga0495649_0000029_107607_108839 408
1647 3300046694 Ga0495649_0000068 Ga0495649_0000068_55520_56752 408
1648 3300046694 Ga0495649_0024853 Ga0495649_0024853_101_1333 408
1649 3300046794 Ga0495589_0000015 Ga0495589_0000015_185092_186324 408
1650 3300046794 Ga0495589_0001782 Ga0495589_0001782_4081_5313 408
1651 3300046794 Ga0495589_0030225 Ga0495589_0030225_761_1993 408
1652 3300046809 Ga0495600_0098172 Ga0495600_0098172_65_1318 408
1653 3300046809 Ga0495600_0102882 Ga0495600_0102882_97_1329 408
1654 3300046810 Ga0495660_0008103 Ga0495660_0008103_4509_5741 408
1655 3300046810 Ga0495660_0015717 Ga0495660_0015717_507_1739 408
1656 3300046810 Ga0495660_0028436 Ga0495660_0028436_944_2176 408
1657 3300047315 Ga0495581_0022378 Ga0495581_0022378_2290_3522 408
1658 3300047318 Ga0495636_0000603 Ga0495636_0000603_10817_12049 408
1659 3300047318 Ga0495636_0008803 Ga0495636_0008803_2340_3572 408
1660 3300047319 Ga0495674_0002672 Ga0495674_0002672_1874_3106 408
1661 3300047319 Ga0495674_0113050 Ga0495674_0113050_1048_2280 408
1662 3300047320 Ga0495672_0000065 Ga0495672_0000065_135949_137181 408
1663 3300047320 Ga0495672_0008482 Ga0495672_0008482_944_2176 408
1664 3300047321 Ga0495676_0121095 Ga0495676_0121095_446_1720 408
1665 3300047322 Ga0495680_0048568 Ga0495680_0048568_1810_3042 408
1666 3300047323 Ga0495683_0000007 Ga0495683_0000007_144566_145822 408
1667 3300047323 Ga0495683_0000012 Ga0495683_0000012_26139_27371 408
1668 3300047443 Ga0495687_000002 Ga0495687_000002_167153_168385 408
1669 3300047443 Ga0495687_000003 Ga0495687_000003_644615_645847 408
1670 3300047444 Ga0495675_0015675 Ga0495675_0015675_3298_4530 408
1671 3300047445 Ga0495677_0000001 Ga0495677_0000001_513307_514539 408
1672 3300047445 Ga0495677_0000076 Ga0495677_0000076_43274_44506 408
1673 3300047445 Ga0495677_0000805 Ga0495677_0000805_10288_11520 408
1674 3300047445 Ga0495677_0014238 Ga0495677_0014238_1210_2442 408
1675 3300047445 Ga0495677_0028771 Ga0495677_0028771_249_1481 408
1676 3300047469 Ga0495673_0005697 Ga0495673_0005697_233_1465 408
1677 3300047470 Ga0495681_0011969 Ga0495681_0011969_1206_2444 408
1678 3300047470 Ga0495681_0011987 Ga0495681_0011987_31_1263 408
1679 3300047471 Ga0495684_0091358 Ga0495684_0091358_1044_2276 408
1680 3300047472 Ga0495686_0000190 Ga0495686_0000190_7823_9055 408
1681 3300047472 Ga0495686_0007585 Ga0495686_0007585_2631_3863 408
1682 3300047472 Ga0495686_0017316 Ga0495686_0017316_2464_3696 408
1683 3300048088 Ga0495602_0000790 Ga0495602_0000790_5855_7087 408
1684 3300048088 Ga0495602_0082303 Ga0495602_0082303_1066_2298 408
1685 3300048088 Ga0495602_0129430 Ga0495602_0129430_630_1862 408
1686 3300048088 Ga0495602_0141383 Ga0495602_0141383_18_1250 408
1687 3300048089 Ga0495614_0047210 Ga0495614_0047210_465_1697 408
1688 3300048091 Ga0495626_0000200 Ga0495626_0000200_30717_31949 408
1689 3300048091 Ga0495626_0031258 Ga0495626_0031258_1059_2291 408
1690 3300048091 Ga0495626_0034944 Ga0495626_0034944_1118_2350 408
1691 3300048905 Ga0496102_0004919 Ga0496102_0004919_3328_4560 408
1692 3300048905 Ga0496102_0088698 Ga0496102_0088698_620_1852 408
1693 3300048906 Ga0496103_0003160 Ga0496103_0003160_7301_8533 408
1694 3300048909 Ga0496106_0000102 Ga0496106_0000102_58465_59697 408
1695 3300048909 Ga0496106_0007261 Ga0496106_0007261_5719_6951 408
1696 3300048909 Ga0496106_0194358 Ga0496106_0194358_35_1267 408
1697 3300048910 Ga0496107_0220534 Ga0496107_0220534_48_1280 408
1698 3300048913 Ga0496110_0281963 Ga0496110_0281963_115_1347 408
1699 3300048914 Ga0496111_0079905 Ga0496111_0079905_711_1943 408
1700 3300048915 Ga0496112_0080052 Ga0496112_0080052_719_1951 408
1701 3300048915 Ga0496112_0170888 Ga0496112_0170888_340_1572 408
1702 3300048916 Ga0496113_0037616 Ga0496113_0037616_691_1923 408
1703 3300048917 Ga0496114_0041472 Ga0496114_0041472_285_1514 408
1704 3300048918 Ga0496115_0013166 Ga0496115_0013166_2223_3455 408
1705 3300048918 Ga0496115_0027833 Ga0496115_0027833_79_1311 408
1706 3300048919 Ga0496116_0002317 Ga0496116_0002317_13094_14326 408
1707 3300048919 Ga0496116_0005236 Ga0496116_0005236_2986_4218 408
1708 3300048919 Ga0496116_0028857 Ga0496116_0028857_2104_3342 408
1709 3300048920 Ga0496117_0000016 Ga0496117_0000016_158219_159457 408
1710 3300048920 Ga0496117_0002604 Ga0496117_0002604_7322_8554 408
1711 3300048920 Ga0496117_0093419 Ga0496117_0093419_458_1747 408
1712 3300048921 Ga0496118_0000153 Ga0496118_0000153_100968_102206 408
1713 3300048921 Ga0496118_0003936 Ga0496118_0003936_2445_3677 408
1714 3300048921 Ga0496118_0057507 Ga0496118_0057507_151_1383 408
1715 3300048921 Ga0496118_0059810 Ga0496118_0059810_670_1908 408
1716 3300048922 Ga0496119_0009047 Ga0496119_0009047_4427_5665 408
1717 3300048922 Ga0496119_0009777 Ga0496119_0009777_4775_6013 408
1718 3300048922 Ga0496119_0119957 Ga0496119_0119957_200_1432 408
1719 3300048923 Ga0496120_0000423 Ga0496120_0000423_54702_55940 408
1720 3300048923 Ga0496120_0003353 Ga0496120_0003353_895_2127 408
1721 3300048924 Ga0496121_0004649 Ga0496121_0004649_9220_10452 408
1722 3300048924 Ga0496121_0073222 Ga0496121_0073222_471_1703 408
1723 3300048924 Ga0496121_0083501 Ga0496121_0083501_324_1556 408
1724 3300048925 Ga0496122_0000002 Ga0496122_0000002_158880_160118 408
1725 3300048925 Ga0496122_0000042 Ga0496122_0000042_118000_119256 408
1726 3300048925 Ga0496122_0005598 Ga0496122_0005598_3889_5160 408
1727 3300048925 Ga0496122_0007864 Ga0496122_0007864_2956_4188 408
1728 3300048925 Ga0496122_0008213 Ga0496122_0008213_6943_8175 408
1729 3300048925 Ga0496122_0019899 Ga0496122_0019899_2199_3431 408
1730 3300048925 Ga0496122_0059901 Ga0496122_0059901_1343_2575 408
1731 3300048926 Ga0496123_0000002 Ga0496123_0000002_158880_160118 408
1732 3300048926 Ga0496123_0000002 Ga0496123_0000002_1651565_1652803 408
1733 3300048926 Ga0496123_0000030 Ga0496123_0000030_172504_173760 408
1734 3300048926 Ga0496123_0002829 Ga0496123_0002829_3940_5172 408
1735 3300048926 Ga0496123_0005341 Ga0496123_0005341_11424_12695 408
1736 3300048926 Ga0496123_0029435 Ga0496123_0029435_1801_3033 408
1737 3300048927 Ga0496124_0001457 Ga0496124_0001457_16064_17296 408
1738 3300048927 Ga0496124_0016188 Ga0496124_0016188_3930_5267 408
1739 3300048927 Ga0496124_0101928 Ga0496124_0101928_500_1738 408
1740 3300048927 Ga0496124_0109444 Ga0496124_0109444_720_1949 408
1741 3300048928 Ga0496125_0004489 Ga0496125_0004489_111_1343 408
1742 3300048928 Ga0496125_0008338 Ga0496125_0008338_3496_4728 408
1743 3300048928 Ga0496125_0019190 Ga0496125_0019190_345_1577 408
1744 3300048928 Ga0496125_0048146 Ga0496125_0048146_58_1290 408
1745 3300048929 Ga0496126_0149209 Ga0496126_0149209_271_1503 408
1746 3300049459 Ga0495678_000015 Ga0495678_000015_52692_53924 408
1747 3300049569 Ga0501032_0001004 Ga0501032_0001004_19150_20382 408
1748 3300049570 Ga0501033_0000334 Ga0501033_0000334_30625_31857 408
1749 3300049570 Ga0501033_0013560 Ga0501033_0013560_2582_3814 408
1750 3300049570 Ga0501033_0059784 Ga0501033_0059784_474_1706 408
1751 3300049570 Ga0501033_0104785 Ga0501033_0104785_760_1995 408
1752 3300049570 Ga0501033_0117774 Ga0501033_0117774_361_1593 408
1753 3300049570 Ga0501033_0188945 Ga0501033_0188945_126_1358 408
1754 3300049571 Ga0501034_0107757 Ga0501034_0107757_1355_2587 408
1755 3300049571 Ga0501034_0112224 Ga0501034_0112224_1372_2604 408
1756 3300049571 Ga0501034_0145447 Ga0501034_0145447_949_2181 408
1757 3300049571 Ga0501034_0179429 Ga0501034_0179429_244_1533 408
1758 3300049571 Ga0501034_0227725 Ga0501034_0227725_515_1753 408
1759 3300049573 Ga0501037_0000035 Ga0501037_0000035_69389_70621 408
1760 3300049574 Ga0501038_0094694 Ga0501038_0094694_381_1613 408
1761 3300049574 Ga0501038_0232182 Ga0501038_0232182_216_1448 408
1762 3300049579 Ga0501043_0000031 Ga0501043_0000031_45437_46669 408
1763 3300049580 Ga0501046_0103791 Ga0501046_0103791_297_1529 408
1764 3300049581 Ga0501047_0035181 Ga0501047_0035181_1194_2426 408
1765 3300049581 Ga0501047_0122717 Ga0501047_0122717_932_2164 408
1766 3300049581 Ga0501047_0343457 Ga0501047_0343457_82_1314 408
1767 3300049584 Ga0501068_0002851 Ga0501068_0002851_6135_7367 408
1768 3300049585 Ga0501069_0000056 Ga0501069_0000056_53917_55149 408
1769 3300049585 Ga0501069_0002418 Ga0501069_0002418_7964_9196 408
1770 3300049586 Ga0501070_0000141 Ga0501070_0000141_53919_55151 408
1771 3300049586 Ga0501070_0002589 Ga0501070_0002589_3190_4422 408
1772 3300049586 Ga0501070_0015361 Ga0501070_0015361_1723_2955 408
1773 3300049586 Ga0501070_0116975 Ga0501070_0116975_789_2021 408
1774 3300049586 Ga0501070_0188292 Ga0501070_0188292_310_1542 408
1775 3300049589 Ga0501073_0059206 Ga0501073_0059206_803_2035 408
1776 3300049589 Ga0501073_0108514 Ga0501073_0108514_463_1695 408
1777 3300049590 Ga0501074_0069896 Ga0501074_0069896_343_1575 408
1778 3300049742 Ga0501080_0001729 Ga0501080_0001729_15196_16428 408
1779 3300049742 Ga0501080_0033576 Ga0501080_0033576_379_1611 408
1780 3300049742 Ga0501080_0213637 Ga0501080_0213637_170_1402 408
1781 3300049744 Ga0501083_0001157 Ga0501083_0001157_8590_9822 408
1782 3300049744 Ga0501083_0009242 Ga0501083_0009242_753_1985 408
1783 3300049822 Ga0501035_0000036 Ga0501035_0000036_108808_110040 408
1784 3300049822 Ga0501035_0000761 Ga0501035_0000761_22335_23567 408
1785 3300049822 Ga0501035_0001273 Ga0501035_0001273_1835_3067 408
1786 3300049822 Ga0501035_0031757 Ga0501035_0031757_1576_2808 408
1787 3300049822 Ga0501035_0069871 Ga0501035_0069871_1398_2630 408
1788 3300049823 Ga0501044_0000011 Ga0501044_0000011_217522_218754 408
1789 3300049823 Ga0501044_0014052 Ga0501044_0014052_4910_6142 408
1790 3300049823 Ga0501044_0022095 Ga0501044_0022095_4344_5576 408
1791 3300049823 Ga0501044_0025149 Ga0501044_0025149_2469_3701 408
1792 3300049823 Ga0501044_0100831 Ga0501044_0100831_201_1433 408
1793 3300049823 Ga0501044_0102814 Ga0501044_0102814_465_1697 408
1794 3300049823 Ga0501044_0172628 Ga0501044_0172628_761_1993 408
1795 3300050491 nmdc:mga00v17_25311_c1 nmdc:mga00v17_25311_c1_1273_2508 408
1796 3300050491 nmdc:mga00v17_53_c1 nmdc:mga00v17_53_c1_29722_30960 408
1797 3300050493 nmdc:mga0k408_38659_c1 nmdc:mga0k408_38659_c1_1382_2611 408
1798 3300050493 nmdc:mga0k408_75281_c1 nmdc:mga0k408_75281_c1_279_1544 408
1799 3300050494 nmdc:mga06z11_56792_c1 nmdc:mga06z11_56792_c1_436_1665 408
1800 3300050494 nmdc:mga06z11_81158_c1 nmdc:mga06z11_81158_c1_454_1686 408
1801 3300050496 nmdc:mga07m45_19323_c1 nmdc:mga07m45_19323_c1_2220_3449 408
1802 3300050507 nmdc:mga05p37_56104_c1 nmdc:mga05p37_56104_c1_3224_4456 408
1803 3300050508 nmdc:mga09592_56316_c1 nmdc:mga09592_56316_c1_273_1505 408
1804 3300050509 nmdc:mga0qj67_9637_c1 nmdc:mga0qj67_9637_c1_4926_6158 408
1805 3300050510 nmdc:mga06r32_3229_c1 nmdc:mga06r32_3229_c1_9018_10250 408
1806 3300050511 nmdc:mga08y16_83869_c1 nmdc:mga08y16_83869_c1_273_1505 408
1807 3300050512 nmdc:mga0n895_180434_c1 nmdc:mga0n895_180434_c1_819_2051 408
1808 3300050512 nmdc:mga0n895_67927_c1 nmdc:mga0n895_67927_c1_252_1484 408
1809 3300050515 nmdc:mga0a205_281592_c1 nmdc:mga0a205_281592_c1_225_1457 408
1810 3300050515 nmdc:mga0a205_5649_c1 nmdc:mga0a205_5649_c1_5131_6363 408
1811 3300050516 nmdc:mga0sz30_95_c1 nmdc:mga0sz30_95_c1_21669_22934 408
1812 3300053077 Ga0495601_0010434 Ga0495601_0010434_192_1424 408
1813 3300053078 Ga0495612_0000886 Ga0495612_0000886_8362_9594 408
1814 3300053080 Ga0500635_0000763 Ga0500635_0000763_5470_6702 408
1815 3300053084 Ga0495595_0067772 Ga0495595_0067772_349_1581 408
1816 3300053092 Ga0500583_0019165 Ga0500583_0019165_311_1540 408
1817 3300053093 Ga0500651_0043894 Ga0500651_0043894_371_1636 408
1818 3300053093 Ga0500651_0059032 Ga0500651_0059032_93_1325 408
1819 3300053109 Ga0500569_000646 Ga0500569_000646_892_2124 408
1820 3300053109 Ga0500569_001390 Ga0500569_001390_1244_2476 408
1821 3300053111 Ga0500572_015523 Ga0500572_015523_121_1353 408
1822 3300053116 Ga0500592_002513 Ga0500592_002513_930_2159 408
1823 3300053122 Ga0500608_053633 Ga0500608_053633_626_1858 408
1824 3300053136 Ga0500559_0007985 Ga0500559_0007985_2056_3285 408
1825 3300053137 Ga0500561_0000022 Ga0500561_0000022_28434_29672 408
1826 3300053139 Ga0500568_0000882 Ga0500568_0000882_5218_6450 408
1827 3300053140 Ga0500573_0016743 Ga0500573_0016743_1400_2629 408
1828 3300053142 Ga0500577_0003953 Ga0500577_0003953_234_1463 408
1829 3300053148 Ga0500590_002886 Ga0500590_002886_3795_5048 408
1830 3300053153 Ga0500616_0005199 Ga0500616_0005199_2204_3436 408
1831 3300053153 Ga0500616_0005721 Ga0500616_0005721_6374_7606 408
1832 3300053153 Ga0500616_0010525 Ga0500616_0010525_4097_5329 408
1833 3300053155 Ga0500620_018905 Ga0500620_018905_165_1397 408
1834 3300053156 Ga0500622_0000705 Ga0500622_0000705_27964_29196 408
1835 3300053156 Ga0500622_0002404 Ga0500622_0002404_12255_13487 408
1836 3300053157 Ga0500624_006670 Ga0500624_006670_227_1465 408
1837 3300053158 Ga0500627_0064157 Ga0500627_0064157_130_1365 408
1838 3300053161 Ga0500634_0021256 Ga0500634_0021256_279_1511 408
1839 3300053177 Ga0500636_0001691 Ga0500636_0001691_8039_9271 408
1840 3300053733 Ga0500552_000622 Ga0500552_000622_1705_2937 408
1841 3300060353 Ga0501082_0077538 Ga0501082_0077538_767_1999 408
1842 iso_pu_bacteria 2512875026 2512973837 408
1843 iso_pu_bacteria 2513237089 2513602446 408
1844 iso_pu_bacteria 2513237092 2513628478 408
1845 iso_pu_bacteria 2513237104 2513720521 408
1846 iso_pu_bacteria 2513237156 2513985682 408
1847 iso_pu_bacteria 2513237160 2514004089 408
1848 iso_pu_bacteria 2513237161 2514015768 408
1849 iso_pu_bacteria 2515154107 2515610236 408
1850 iso_pu_bacteria 2517487022 2517571101 408
1851 iso_pu_bacteria 2617270735 2617346153 408
1852 iso_pu_bacteria 2643221551 2643777418 408
1853 iso_pu_bacteria 2643221555 2643795866 408
1854 iso_pu_bacteria 2643221626 2644149631 408
1855 iso_pu_bacteria 2643221659 2644333403 408
1856 iso_pu_bacteria 2767802442 2770198291 408
1857 iso_pu_bacteria 2775506902 2776271232 408
1858 iso_pu_bacteria 2775506904 2776280770 408
1859 iso_pu_bacteria 2791355082 2792582467 408
1860 iso_pu_bacteria 2802428858 2802717809 408
1861 iso_pu_bacteria 2802428859 2802725340 408
1862 iso_pu_bacteria 2802428860 2802730536 408
1863 iso_pu_bacteria 2802428861 2802737883 408
1864 iso_pu_bacteria 2802428862 2802744248 408
1865 iso_pu_bacteria 2802428863 2802753068 408
1866 iso_pu_bacteria 2824679649 2824681621 408
1867 iso_pu_bacteria 2824687955 2824692849 408
1868 iso_pu_bacteria 2824704595 2824713231 408
1869 iso_pu_bacteria 2824753945 2824755178 408
1870 iso_pu_bacteria 2824763712 2824764318 408
1871 iso_pu_bacteria 2824773399 2824774439 408
1872 iso_pu_bacteria 2838122688 2838123243 408
1873 iso_pu_bacteria 2839993093 2839995255 408
1874 iso_pu_bacteria 2840764183 2840770013 408
1875 iso_pu_bacteria 2841941048 2841946518 408
1876 iso_pu_bacteria 2841949485 2841954239 408
1877 iso_pu_bacteria 2841966195 2841969611 408
1878 iso_pu_bacteria 2841974524 2841978951 408
1879 iso_pu_bacteria 2841983080 2841983932 408
1880 iso_pu_bacteria 2842871566 2842872871 408
1881 iso_pu_bacteria 2854916844 2854917536 408
1882 iso_pu_bacteria 2881665667 2881666198 408
1883 iso_pu_bacteria 2894652903 2894654577 408
1884 iso_pu_bacteria 2902405164 2902410599 408
1885 iso_pu_bacteria 2904711408 2904712747 408
1886 iso_pu_bacteria 2919679072 2919683435 408
1887 iso_pu_bacteria 2922393267 2922400136 408
1888 iso_pu_bacteria 2928521798 2928524330 408
1889 iso_pu_bacteria 2936996657 2937000152 408
1890 iso_pu_bacteria 2937029754 2937032904 408
1891 iso_pu_bacteria 2937036028 2937042312 408
1892 iso_pu_bacteria 2937078374 2937078719 408
1893 iso_pu_bacteria 2937084907 2937086667 408
1894 iso_pu_bacteria 2954011201 2954015394 408
1895 iso_pu_bacteria 2957375807 2957376844 408
1896 iso_pu_bacteria 2957437181 2957441390 408
1897 iso_pu_bacteria 2957443900 2957444433 408
1898 iso_pu_bacteria 2960591022 2960591366 408
1899 iso_pu_bacteria 2960617483 2960618671 408
1900 iso_pu_bacteria 2960631154 2960632620 408
1901 iso_pu_bacteria 2960660292 2960662868 408
1902 iso_pu_bacteria 2960680706 2960681450 408
1903 iso_pu_bacteria 2960693952 2960694490 408
1904 iso_pu_bacteria 2967686174 2967686598 408
1905 iso_pu_bacteria 2967728569 2967732398 408
1906 iso_pu_bacteria 2970026789 2970029401 408
1907 iso_pu_bacteria 2970122695 2970126375 408
1908 iso_pu_bacteria 2970143518 2970144631 408
1909 iso_pu_bacteria 2977530762 2977532388 408
1910 iso_pu_bacteria 2977544691 2977551174 408
1911 iso_pu_bacteria 3002141150 3002144022 408
1912 iso_pu_bacteria 3003665799 3003672601 408
1913 iso_pu_bacteria 8003999396 8004002819 408
1914 iso_pu_bacteria 8049293176 8049296021 408
1915 3300002074 JGI24748J21848_1000078 JGI24748J21848_10000789 409
1916 3300002239 JGI24034J26672_10000047 JGI24034J26672_100000479 409
1917 3300005340 Ga0070689_100030629 Ga0070689_1000306292 409
1918 3300005365 Ga0070688_100000440 Ga0070688_1000004406 409
1919 3300005466 Ga0070685_10000538 Ga0070685_100005384 409
1920 3300005548 Ga0070665_100000087 Ga0070665_100000087170 409
1921 3300005841 Ga0068863_100000046 Ga0068863_10000004629 409
1922 3300014325 Ga0163163_10224123 Ga0163163_102241232 409
1923 3300025925 Ga0207650_10060074 Ga0207650_100600742 409
1924 3300025936 Ga0207670_10024566 Ga0207670_100245662 409
1925 3300025941 Ga0207711_10081706 Ga0207711_100817062 409
1926 3300026078 Ga0207702_10141023 Ga0207702_101410232 409
1927 3300026088 Ga0207641_10000517 Ga0207641_1000051728 409
1928 3300028379 Ga0268266_10000009 Ga0268266_10000009883 409
1929 3300035242 Ga0373962_0006832 Ga0373962_0006832_66_1301 409
1930 3300048905 Ga0496102_0002133 Ga0496102_0002133_1991_3220 409
1931 3300048906 Ga0496103_0003397 Ga0496103_0003397_5997_7226 409
1932 3300048908 Ga0496105_0119077 Ga0496105_0119077_77_1306 409
1933 3300048920 Ga0496117_0043739 Ga0496117_0043739_1161_2390 409
1934 3300048921 Ga0496118_0012501 Ga0496118_0012501_1991_3220 409

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00676

E1_dh

Dehydrogenase E1 component

81

370

0.98

PF12573

OxoDH_E1alpha_N

2-oxoisovalerate dehydrogenase E1 alpha subunit N terminal

5

45

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3exi-assembly1.cif.gz_A-2 crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex with the subunit-binding domain (sbd) of e2p, but sbd cannot be modeled into the electron density 0.9451 71 372
1qs0-assembly1.cif.gz_A-2 crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b) 0.9326 3 405
1qs0-assembly1.cif.gz_A-2 crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b) 0.9215 3 405
6cer-assembly2.cif.gz_G human pyruvate dehydrogenase complex e1 component v138m mutation 0.9203 71 387
6cer-assembly1.cif.gz_A human pyruvate dehydrogenase complex e1 component v138m mutation 0.9155 71 387
ID Description Score Start End Superfamily
2bp7G00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9337 3 405 3.40.50.970
2bp7G00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9227 3 405 3.40.50.970
1um9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8995 53 408 3.40.50.970
af_I1N1B9_20_344_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8961 71 355 3.40.50.970
af_B4FGJ4_23_381_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8926 75 397 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A381XZC0-F1-model_v4 Dehydrogenase E1 component domain-containing protein 0.9641 47 349 GO:0003863
GO:0009083
AF-A0A529SZ83-F1-model_v4 2-oxoisovalerate dehydrogenase subunit alpha (EC 1.2.4.4) (Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain) 0.9629 53 305 GO:0003863
GO:0009083
AF-A0A529SZ83-F1-model_v4 2-oxoisovalerate dehydrogenase subunit alpha (EC 1.2.4.4) (Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain) 0.9592 53 305 GO:0003863
GO:0009083
AF-A0A381XZC0-F1-model_v4 Dehydrogenase E1 component domain-containing protein 0.9579 47 349 GO:0003863
GO:0009083
AF-A4F0C7-F1-model_v4 2-oxoisovalerate dehydrogenase subunit alpha (EC 1.2.4.4) (Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain) 0.9539 1 345 GO:0003863
GO:0009083

Feature Viewer

pLDDT pTM Quality
86.58 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map