F495952
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1879 | 743 | 1672 | 157 |
Family's Representative Sequence
| Representative Sequence | 3300015262|Ga0182007_10120303|Ga0182007_101203032 |
| Length | 183 |
| Sequence | MPTTRRQFLSLAGSITAAGTLPIVTLRPLQATPAMLNGAIRNIVGEASVRTGRVKLDIPPLVENGNTVPMTVSVASPMAPEDHVLSIHVFNEKNPQPNIGNFYLGPLAGRAQVSTRIRLADSQKIIAIAKLSDGTFWSASVTTTSATTCQNVSSDIRAIATTFWVSARRMRVETWARPEAGLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 9 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 10 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 11 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 12 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 13 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 14 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 15 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 16 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 17 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 18 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 19 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 20 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 21 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 22 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 23 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 24 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 25 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 26 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 27 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 28 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 29 | 2791355199 | |||
| 30 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 31 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 32 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 33 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 34 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 35 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 36 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 37 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 38 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 39 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 40 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 41 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 42 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 43 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 44 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 45 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 46 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 47 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 48 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 49 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 50 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 51 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 52 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 53 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 54 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 55 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 56 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 57 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 58 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 59 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 60 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 61 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 62 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 63 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 64 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 65 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 66 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 67 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 68 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 69 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 70 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 71 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 72 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 73 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 74 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 75 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 76 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 77 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 78 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 79 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 80 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 81 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 82 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 83 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 84 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 85 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 86 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 87 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 88 | 2904699407 | |||
| 89 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 90 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 91 | 2906610324 | |||
| 92 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 93 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 94 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 95 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 96 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 97 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 98 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 99 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 100 | 2922368715 | |||
| 101 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 102 | 2922425934 | |||
| 103 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 104 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 105 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 106 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 107 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 108 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 109 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 110 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 111 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 112 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 113 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 114 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 115 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 116 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 117 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 118 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 119 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 120 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 121 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 122 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 123 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 124 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 125 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 126 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 127 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 128 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 129 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 130 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 131 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 132 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 133 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 134 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 135 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 136 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 137 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 138 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 139 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 140 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 141 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 142 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 143 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 144 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 145 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 146 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 147 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 148 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 149 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 150 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 151 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 152 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 153 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 154 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 155 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 156 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 157 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 158 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 159 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 160 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 161 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 162 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 163 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 164 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 165 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 166 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 167 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 168 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 169 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 170 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 171 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 172 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 173 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 174 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 175 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 176 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 177 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 178 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 179 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 180 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 181 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 182 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 183 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 184 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 185 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 186 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 189 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 190 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 192 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 194 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 195 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 196 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 198 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 200 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 206 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 209 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 211 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 212 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 213 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 215 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 216 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 220 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 221 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 222 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 223 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 224 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 225 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 226 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 227 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 228 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 229 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 230 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 231 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 232 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 233 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 234 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 235 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 236 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 237 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 238 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 239 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 240 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 241 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 242 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 243 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 244 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 245 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 246 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 247 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 248 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 249 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 250 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 251 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 252 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 253 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 254 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 255 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 256 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 257 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 258 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 259 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 260 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 261 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 262 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 263 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 264 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 265 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 266 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 268 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 269 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 270 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 271 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 272 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 273 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 275 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 276 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 277 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 278 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 279 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 280 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 281 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 282 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 284 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 285 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 287 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 288 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 289 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 290 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 291 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 292 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 293 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 294 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 295 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 296 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 297 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 298 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 299 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 300 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 301 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 302 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 303 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 304 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 305 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 306 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 307 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 308 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 309 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 310 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 311 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 312 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 313 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 314 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 315 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 316 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 317 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 318 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 319 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 320 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 321 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 322 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 323 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 324 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 325 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 326 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 327 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 328 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 329 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 330 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 331 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 396 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 397 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 398 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 399 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 402 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 403 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 407 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 408 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 409 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 410 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 411 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 412 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 413 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 414 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 415 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 416 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 418 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 419 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 420 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 421 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 422 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 423 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 424 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 425 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 426 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 427 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 428 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 429 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 430 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 431 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 432 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 433 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 434 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 435 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 436 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 437 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 438 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 439 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 440 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 441 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 442 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 443 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 444 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 445 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 446 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 447 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 448 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 449 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 450 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 451 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 452 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 453 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 454 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 455 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 456 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 457 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 458 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 459 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 460 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 461 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 462 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 463 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 464 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 465 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 466 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 467 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 468 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 469 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 470 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 471 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 472 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 473 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 474 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 475 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 476 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 477 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 478 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 479 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 480 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 481 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 482 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 483 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 484 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 485 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 486 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 487 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 488 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 489 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 490 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 491 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 492 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 493 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 494 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 495 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 496 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 497 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 498 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 499 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 500 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 501 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 589 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 590 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 591 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 592 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 593 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 594 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 595 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 596 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 597 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 598 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 599 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 600 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 601 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 602 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 603 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 604 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 605 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 606 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 607 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 608 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 609 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 610 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 611 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 612 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 613 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 614 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 615 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 617 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 618 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 619 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 620 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 621 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 622 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 623 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 624 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 625 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 626 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 627 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 628 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 629 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 630 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 631 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 632 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 633 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 634 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 635 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 636 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 637 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 638 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 639 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 640 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 641 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 642 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 643 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 644 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 645 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 646 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 647 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 648 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 649 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 650 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 651 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 652 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 653 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 654 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 655 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 656 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 657 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 658 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 659 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 660 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 661 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 662 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 663 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 664 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 665 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 666 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 667 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 668 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 669 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 670 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 671 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 672 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 673 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 674 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 675 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 676 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 677 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 678 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 679 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 680 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 681 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 682 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 683 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 684 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 685 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 686 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 687 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 688 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 689 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 690 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 691 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 692 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 693 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 694 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 695 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 696 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 697 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 698 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 699 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 700 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 701 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 702 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 703 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 704 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 705 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 706 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 707 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 708 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 709 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 710 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 711 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 712 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 713 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 714 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 715 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 716 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 717 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 718 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 719 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 720 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 721 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 722 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 723 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 724 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 725 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 726 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 727 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 728 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 729 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 730 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 731 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 732 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 733 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 734 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 735 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 736 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 737 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 738 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 739 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 740 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 741 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 742 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 743 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.06 |
| Metatranscriptomes | 0.16 |
| Isolates | 10.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.1 |
| Nodule | 8.94 |
| Rhizoplane | 6.17 |
| Rhizosphere | 61.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10200120 | 3300001990 | Bacteria | 590 |
| 2 | JGI24750J21931_1020184 | 3300002070 | Bacteria | 928 |
| 3 | JGI24744J21845_10058110 | 3300002077 | Bacteria | 709 |
| 4 | JGI24742J22300_10020639 | 3300002244 | Bacteria | 1123 |
| 5 | JGI25406J46586_10000138 | 3300003203 | Bacteria | 31765 |
| 6 | JGI25406J46586_10014944 | 3300003203 | Bacteria | 3287 |
| 7 | JGI25165J46597_1012236 | 3300003214 | Bacteria | 1204 |
| 8 | JGI25153J46596_10000317 | 3300003215 | Bacteria | 35509 |
| 9 | JGI25153J46596_10005866 | 3300003215 | Bacteria | 6357 |
| 10 | JGI25153J46596_10007843 | 3300003215 | Bacteria | 5184 |
| 11 | rootH2_10065934 | 3300003320 | Bacteria | 2392 |
| 12 | rootL2_10146216 | 3300003322 | Bacteria | 1613 |
| 13 | rootL2_10158942 | 3300003322 | Bacteria | 2631 |
| 14 | JGI25160J50197_1002533 | 3300003354 | Bacteria | 8470 |
| 15 | JGI25160J50197_1007102 | 3300003354 | Bacteria | 4422 |
| 16 | JGI25160J50197_1024527 | 3300003354 | Bacteria | 1709 |
| 17 | JGI25160J50197_1074341 | 3300003354 | Bacteria | 642 |
| 18 | JGI25404J52841_10000288 | 3300003659 | Bacteria | 6507 |
| 19 | JGI25404J52841_10000871 | 3300003659 | Bacteria | 4882 |
| 20 | JGI25404J52841_10007910 | 3300003659 | Bacteria | 2256 |
| 21 | JGI25404J52841_10008582 | 3300003659 | Bacteria | 2178 |
| 22 | JGI25404J52841_10016633 | 3300003659 | Bacteria | 1595 |
| 23 | JGI25404J52841_10052353 | 3300003659 | Bacteria | 857 |
| 24 | Ga0055526_1046678 | 3300003771 | Bacteria | 1024 |
| 25 | Ga0055531_10008821 | 3300003794 | Bacteria | 5250 |
| 26 | Ga0055543_1014610 | 3300004625 | Bacteria | 1528 |
| 27 | Ga0065165_1000747 | 3300005262 | Bacteria | 44635 |
| 28 | Ga0065165_1004585 | 3300005262 | Bacteria | 8426 |
| 29 | Ga0065165_1010604 | 3300005262 | Bacteria | 3956 |
| 30 | Ga0065165_1028625 | 3300005262 | Bacteria | 1796 |
| 31 | Ga0065165_1077487 | 3300005262 | Bacteria | 870 |
| 32 | Ga0070658_10136673 | 3300005327 | Bacteria | 2045 |
| 33 | Ga0070658_10647016 | 3300005327 | Bacteria | 917 |
| 34 | Ga0070658_10695316 | 3300005327 | Bacteria | 882 |
| 35 | Ga0070658_10914606 | 3300005327 | Bacteria | 763 |
| 36 | Ga0070676_10133797 | 3300005328 | Bacteria | 1571 |
| 37 | Ga0070676_10281597 | 3300005328 | Bacteria | 1121 |
| 38 | Ga0070676_10910005 | 3300005328 | Bacteria | 656 |
| 39 | Ga0070683_100076181 | 3300005329 | Bacteria | 3135 |
| 40 | Ga0070683_100315205 | 3300005329 | Bacteria | 1488 |
| 41 | Ga0070683_100948112 | 3300005329 | Bacteria | 826 |
| 42 | Ga0070690_101119286 | 3300005330 | Bacteria | 625 |
| 43 | Ga0070670_100851133 | 3300005331 | Bacteria | 825 |
| 44 | Ga0068869_100029055 | 3300005334 | Bacteria | 3869 |
| 45 | Ga0068869_100074710 | 3300005334 | Bacteria | 2516 |
| 46 | Ga0068869_100216730 | 3300005334 | Bacteria | 1515 |
| 47 | Ga0068869_100217523 | 3300005334 | Bacteria | 1513 |
| 48 | Ga0068869_101987340 | 3300005334 | Bacteria | 522 |
| 49 | Ga0070666_10561502 | 3300005335 | Bacteria | 831 |
| 50 | Ga0070666_10642834 | 3300005335 | Bacteria | 776 |
| 51 | Ga0070680_100023775 | 3300005336 | Bacteria | 4891 |
| 52 | Ga0070680_100064981 | 3300005336 | Bacteria | 2990 |
| 53 | Ga0070680_100142232 | 3300005336 | Bacteria | 2012 |
| 54 | Ga0070682_100441849 | 3300005337 | Bacteria | 994 |
| 55 | Ga0070682_100522236 | 3300005337 | Bacteria | 924 |
| 56 | Ga0070682_100944304 | 3300005337 | Bacteria | 712 |
| 57 | Ga0068868_100048941 | 3300005338 | Bacteria | 3317 |
| 58 | Ga0068868_100605095 | 3300005338 | Bacteria | 971 |
| 59 | Ga0068868_100986094 | 3300005338 | Bacteria | 770 |
| 60 | Ga0070660_100037797 | 3300005339 | Bacteria | 3660 |
| 61 | Ga0070660_100250674 | 3300005339 | Bacteria | 1444 |
| 62 | Ga0070687_100176927 | 3300005343 | Bacteria | 1275 |
| 63 | Ga0070661_100104163 | 3300005344 | Bacteria | 2113 |
| 64 | Ga0070661_100844170 | 3300005344 | Bacteria | 753 |
| 65 | Ga0070692_10589853 | 3300005345 | Bacteria | 734 |
| 66 | Ga0070668_100027260 | 3300005347 | Bacteria | 4337 |
| 67 | Ga0070668_100113621 | 3300005347 | Bacteria | 2157 |
| 68 | Ga0070668_100205128 | 3300005347 | Bacteria | 1620 |
| 69 | Ga0070668_100218027 | 3300005347 | Bacteria | 1572 |
| 70 | Ga0070668_100273965 | 3300005347 | Bacteria | 1407 |
| 71 | Ga0070668_100397705 | 3300005347 | Bacteria | 1176 |
| 72 | Ga0070668_100645654 | 3300005347 | Bacteria | 929 |
| 73 | Ga0070668_100763064 | 3300005347 | Bacteria | 857 |
| 74 | Ga0070669_100164810 | 3300005353 | Bacteria | 1724 |
| 75 | Ga0070669_100856682 | 3300005353 | Bacteria | 774 |
| 76 | Ga0070675_100392412 | 3300005354 | Bacteria | 1237 |
| 77 | Ga0070671_100044655 | 3300005355 | Bacteria | 3682 |
| 78 | Ga0070671_100104083 | 3300005355 | Bacteria | 2382 |
| 79 | Ga0070671_100244786 | 3300005355 | Bacteria | 1522 |
| 80 | Ga0070671_100250472 | 3300005355 | Bacteria | 1505 |
| 81 | Ga0070674_100046227 | 3300005356 | Bacteria | 2977 |
| 82 | Ga0070674_100297571 | 3300005356 | Bacteria | 1285 |
| 83 | Ga0070674_101057853 | 3300005356 | Bacteria | 715 |
| 84 | Ga0070688_100344133 | 3300005365 | Bacteria | 1090 |
| 85 | Ga0070659_100198649 | 3300005366 | Bacteria | 1650 |
| 86 | Ga0070659_100263299 | 3300005366 | Bacteria | 1431 |
| 87 | Ga0070667_100146893 | 3300005367 | Bacteria | 2069 |
| 88 | Ga0070709_10022160 | 3300005434 | Bacteria | 3711 |
| 89 | Ga0070709_10023003 | 3300005434 | Bacteria | 3653 |
| 90 | Ga0070709_10036355 | 3300005434 | Bacteria | 2999 |
| 91 | Ga0070709_10250031 | 3300005434 | Bacteria | 1277 |
| 92 | Ga0070709_10300833 | 3300005434 | Bacteria | 1172 |
| 93 | Ga0070709_10756016 | 3300005434 | Bacteria | 760 |
| 94 | Ga0070709_10802566 | 3300005434 | Bacteria | 739 |
| 95 | Ga0070714_100002801 | 3300005435 | Bacteria | 12865 |
| 96 | Ga0070714_100017333 | 3300005435 | Bacteria | 5833 |
| 97 | Ga0070714_100107849 | 3300005435 | Bacteria | 2462 |
| 98 | Ga0070714_100995056 | 3300005435 | Bacteria | 816 |
| 99 | Ga0070713_100014026 | 3300005436 | Bacteria | 5934 |
| 100 | Ga0070713_100026138 | 3300005436 | Bacteria | 4578 |
| 101 | Ga0070713_100074105 | 3300005436 | Bacteria | 2883 |
| 102 | Ga0070713_100101308 | 3300005436 | Bacteria | 2495 |
| 103 | Ga0070713_100103599 | 3300005436 | Bacteria | 2469 |
| 104 | Ga0070713_100150597 | 3300005436 | Bacteria | 2069 |
| 105 | Ga0070710_10000678 | 3300005437 | Bacteria | 16149 |
| 106 | Ga0070710_10019013 | 3300005437 | Bacteria | 3545 |
| 107 | Ga0070710_10040951 | 3300005437 | Bacteria | 2555 |
| 108 | Ga0070710_10096625 | 3300005437 | Bacteria | 1751 |
| 109 | Ga0070710_10102231 | 3300005437 | Bacteria | 1709 |
| 110 | Ga0070701_10263977 | 3300005438 | Bacteria | 1045 |
| 111 | Ga0070711_100003772 | 3300005439 | Bacteria | 8886 |
| 112 | Ga0070711_100019549 | 3300005439 | Bacteria | 4346 |
| 113 | Ga0070711_100030578 | 3300005439 | Bacteria | 3566 |
| 114 | Ga0070711_100125685 | 3300005439 | Bacteria | 1903 |
| 115 | Ga0070711_100153631 | 3300005439 | Bacteria | 1738 |
| 116 | Ga0070711_100614519 | 3300005439 | Bacteria | 908 |
| 117 | Ga0070711_100658017 | 3300005439 | Bacteria | 879 |
| 118 | Ga0070711_101126496 | 3300005439 | Bacteria | 677 |
| 119 | Ga0070700_100107452 | 3300005441 | Bacteria | 1849 |
| 120 | Ga0070700_100141268 | 3300005441 | Bacteria | 1637 |
| 121 | Ga0070694_100144776 | 3300005444 | Bacteria | 1730 |
| 122 | Ga0070694_101316300 | 3300005444 | Bacteria | 608 |
| 123 | Ga0070663_100034033 | 3300005455 | Bacteria | 3525 |
| 124 | Ga0070663_100047641 | 3300005455 | Bacteria | 3036 |
| 125 | Ga0070663_100093621 | 3300005455 | Bacteria | 2230 |
| 126 | Ga0070663_100186548 | 3300005455 | Bacteria | 1612 |
| 127 | Ga0070663_100451553 | 3300005455 | Bacteria | 1059 |
| 128 | Ga0070663_101115033 | 3300005455 | Bacteria | 690 |
| 129 | Ga0070678_100060204 | 3300005456 | Bacteria | 2794 |
| 130 | Ga0070678_100235114 | 3300005456 | Bacteria | 1529 |
| 131 | Ga0070678_100313547 | 3300005456 | Bacteria | 1337 |
| 132 | Ga0070678_100680506 | 3300005456 | Bacteria | 925 |
| 133 | Ga0070662_100044307 | 3300005457 | Bacteria | 3186 |
| 134 | Ga0070662_100056074 | 3300005457 | Bacteria | 2860 |
| 135 | Ga0070662_100237999 | 3300005457 | Bacteria | 1459 |
| 136 | Ga0070662_101568324 | 3300005457 | Bacteria | 568 |
| 137 | Ga0070681_10022753 | 3300005458 | Bacteria | 6298 |
| 138 | Ga0070681_10090364 | 3300005458 | Bacteria | 3013 |
| 139 | Ga0070681_10142977 | 3300005458 | Bacteria | 2322 |
| 140 | Ga0070681_10835838 | 3300005458 | Bacteria | 838 |
| 141 | Ga0068867_100009231 | 3300005459 | Bacteria | 6961 |
| 142 | Ga0068867_101336764 | 3300005459 | Bacteria | 663 |
| 143 | Ga0070706_100141178 | 3300005467 | Bacteria | 2249 |
| 144 | Ga0070698_100291619 | 3300005471 | Bacteria | 1562 |
| 145 | Ga0070698_100731917 | 3300005471 | Bacteria | 932 |
| 146 | Ga0070699_100389557 | 3300005518 | Bacteria | 1259 |
| 147 | Ga0070679_100215130 | 3300005530 | Bacteria | 1884 |
| 148 | Ga0070679_100291049 | 3300005530 | Bacteria | 1585 |
| 149 | Ga0070684_100009391 | 3300005535 | Bacteria | 7700 |
| 150 | Ga0070684_100065826 | 3300005535 | Bacteria | 3181 |
| 151 | Ga0070684_100156524 | 3300005535 | Bacteria | 2066 |
| 152 | Ga0070684_100396193 | 3300005535 | Bacteria | 1273 |
| 153 | Ga0070684_100930511 | 3300005535 | Bacteria | 815 |
| 154 | Ga0070697_100355077 | 3300005536 | Bacteria | 1266 |
| 155 | Ga0068853_100068998 | 3300005539 | Bacteria | 3074 |
| 156 | Ga0068853_100211567 | 3300005539 | Bacteria | 1768 |
| 157 | Ga0068853_100244915 | 3300005539 | Bacteria | 1644 |
| 158 | Ga0068853_100262403 | 3300005539 | Bacteria | 1588 |
| 159 | Ga0068853_100483256 | 3300005539 | Bacteria | 1168 |
| 160 | Ga0068853_100919650 | 3300005539 | Bacteria | 840 |
| 161 | Ga0068853_101474006 | 3300005539 | Bacteria | 659 |
| 162 | Ga0070672_100065744 | 3300005543 | Bacteria | 2869 |
| 163 | Ga0070672_100119392 | 3300005543 | Bacteria | 2157 |
| 164 | Ga0070672_100171427 | 3300005543 | Bacteria | 1805 |
| 165 | Ga0070672_100766193 | 3300005543 | Bacteria | 848 |
| 166 | Ga0070695_100189432 | 3300005545 | Bacteria | 1463 |
| 167 | Ga0070693_100264489 | 3300005547 | Bacteria | 1145 |
| 168 | Ga0070693_100448625 | 3300005547 | Bacteria | 905 |
| 169 | Ga0070693_101276071 | 3300005547 | Bacteria | 567 |
| 170 | Ga0070665_100023384 | 3300005548 | Bacteria | 6222 |
| 171 | Ga0070665_100051490 | 3300005548 | Bacteria | 4129 |
| 172 | Ga0070665_100053413 | 3300005548 | Bacteria | 4052 |
| 173 | Ga0070665_100078654 | 3300005548 | Bacteria | 3304 |
| 174 | Ga0070665_100123917 | 3300005548 | Bacteria | 2586 |
| 175 | Ga0070665_100134445 | 3300005548 | Bacteria | 2475 |
| 176 | Ga0070665_100271612 | 3300005548 | Bacteria | 1697 |
| 177 | Ga0070665_100338751 | 3300005548 | Bacteria | 1508 |
| 178 | Ga0070665_100572960 | 3300005548 | Bacteria | 1142 |
| 179 | Ga0070665_100668662 | 3300005548 | Bacteria | 1052 |
| 180 | Ga0070704_100319412 | 3300005549 | Bacteria | 1300 |
| 181 | Ga0068855_100181159 | 3300005563 | Bacteria | 2382 |
| 182 | Ga0068855_100392661 | 3300005563 | Bacteria | 1522 |
| 183 | Ga0068855_101957415 | 3300005563 | Bacteria | 593 |
| 184 | Ga0070664_100107954 | 3300005564 | Bacteria | 2427 |
| 185 | Ga0070664_100177164 | 3300005564 | Bacteria | 1893 |
| 186 | Ga0068857_100037748 | 3300005577 | Bacteria | 4280 |
| 187 | Ga0068857_100059974 | 3300005577 | Bacteria | 3380 |
| 188 | Ga0068857_100291795 | 3300005577 | Bacteria | 1502 |
| 189 | Ga0068857_100384076 | 3300005577 | Bacteria | 1304 |
| 190 | Ga0068854_100097953 | 3300005578 | Bacteria | 2193 |
| 191 | Ga0068854_100475090 | 3300005578 | Bacteria | 1049 |
| 192 | Ga0068854_100649236 | 3300005578 | Bacteria | 906 |
| 193 | Ga0068856_100079699 | 3300005614 | Bacteria | 3247 |
| 194 | Ga0068856_100236559 | 3300005614 | Bacteria | 1842 |
| 195 | Ga0068856_100754975 | 3300005614 | Bacteria | 993 |
| 196 | Ga0068856_101744456 | 3300005614 | Bacteria | 635 |
| 197 | Ga0070702_100239985 | 3300005615 | Bacteria | 1223 |
| 198 | Ga0070702_100672057 | 3300005615 | Bacteria | 786 |
| 199 | Ga0070702_101798201 | 3300005615 | Bacteria | 512 |
| 200 | Ga0068852_100038198 | 3300005616 | Bacteria | 4033 |
| 201 | Ga0068852_100133040 | 3300005616 | Bacteria | 2292 |
| 202 | Ga0068852_100348236 | 3300005616 | Bacteria | 1446 |
| 203 | Ga0068852_100455793 | 3300005616 | Bacteria | 1267 |
| 204 | Ga0068852_101783980 | 3300005616 | Bacteria | 638 |
| 205 | Ga0068859_100103545 | 3300005617 | Bacteria | 2904 |
| 206 | Ga0068859_100181183 | 3300005617 | Bacteria | 2189 |
| 207 | Ga0068859_101012313 | 3300005617 | Bacteria | 913 |
| 208 | Ga0068864_100058929 | 3300005618 | Bacteria | 3320 |
| 209 | Ga0068864_100278065 | 3300005618 | Bacteria | 1562 |
| 210 | Ga0068864_100300154 | 3300005618 | Bacteria | 1503 |
| 211 | Ga0068864_100772554 | 3300005618 | Bacteria | 943 |
| 212 | Ga0068864_101589310 | 3300005618 | Bacteria | 658 |
| 213 | Ga0068866_10121670 | 3300005718 | Bacteria | 1471 |
| 214 | Ga0068866_10544429 | 3300005718 | Bacteria | 775 |
| 215 | Ga0068861_100045277 | 3300005719 | Bacteria | 3312 |
| 216 | Ga0068861_100130900 | 3300005719 | Bacteria | 2036 |
| 217 | Ga0068861_100426495 | 3300005719 | Bacteria | 1183 |
| 218 | Ga0068861_101137133 | 3300005719 | Bacteria | 752 |
| 219 | Ga0068861_101393323 | 3300005719 | Bacteria | 685 |
| 220 | Ga0068861_101554281 | 3300005719 | Bacteria | 651 |
| 221 | Ga0068861_101573860 | 3300005719 | Bacteria | 647 |
| 222 | Ga0068851_10118916 | 3300005834 | Bacteria | 1418 |
| 223 | Ga0068851_10320069 | 3300005834 | Bacteria | 896 |
| 224 | Ga0068870_10075455 | 3300005840 | Bacteria | 1849 |
| 225 | Ga0068863_100234737 | 3300005841 | Bacteria | 1770 |
| 226 | Ga0068863_100290578 | 3300005841 | Bacteria | 1584 |
| 227 | Ga0068863_101985131 | 3300005841 | Bacteria | 592 |
| 228 | Ga0068863_102170036 | 3300005841 | Bacteria | 565 |
| 229 | Ga0068858_100119984 | 3300005842 | Bacteria | 2458 |
| 230 | Ga0068858_100195894 | 3300005842 | Bacteria | 1909 |
| 231 | Ga0068858_100627464 | 3300005842 | Bacteria | 1044 |
| 232 | Ga0068860_100000360 | 3300005843 | Bacteria | 60297 |
| 233 | Ga0068860_100153207 | 3300005843 | Bacteria | 2220 |
| 234 | Ga0068860_100190322 | 3300005843 | Bacteria | 1986 |
| 235 | Ga0068860_101266327 | 3300005843 | Bacteria | 758 |
| 236 | Ga0068862_100034594 | 3300005844 | Bacteria | 4276 |
| 237 | Ga0068862_100207210 | 3300005844 | Bacteria | 1770 |
| 238 | Ga0081455_10005955 | 3300005937 | Bacteria | 13226 |
| 239 | Ga0081455_10030485 | 3300005937 | Bacteria | 4897 |
| 240 | Ga0081455_10045444 | 3300005937 | Bacteria | 3821 |
| 241 | Ga0081455_10080661 | 3300005937 | Bacteria | 2667 |
| 242 | Ga0081455_10456688 | 3300005937 | Bacteria | 871 |
| 243 | Ga0081538_10198308 | 3300005981 | Bacteria | 829 |
| 244 | Ga0081540_1003418 | 3300005983 | Bacteria | 12554 |
| 245 | Ga0081540_1003851 | 3300005983 | Bacteria | 11718 |
| 246 | Ga0081540_1008125 | 3300005983 | Bacteria | 7364 |
| 247 | Ga0081540_1008941 | 3300005983 | Bacteria | 6939 |
| 248 | Ga0081540_1012000 | 3300005983 | Bacteria | 5740 |
| 249 | Ga0081540_1014330 | 3300005983 | Bacteria | 5086 |
| 250 | Ga0081540_1021006 | 3300005983 | Bacteria | 3906 |
| 251 | Ga0081540_1021049 | 3300005983 | Bacteria | 3901 |
| 252 | Ga0081540_1027303 | 3300005983 | Bacteria | 3238 |
| 253 | Ga0081540_1035588 | 3300005983 | Bacteria | 2668 |
| 254 | Ga0081540_1043950 | 3300005983 | Bacteria | 2286 |
| 255 | Ga0081540_1064372 | 3300005983 | Bacteria | 1730 |
| 256 | Ga0081540_1076996 | 3300005983 | Bacteria | 1518 |
| 257 | Ga0081540_1088582 | 3300005983 | Bacteria | 1368 |
| 258 | Ga0081540_1088921 | 3300005983 | Bacteria | 1364 |
| 259 | Ga0081540_1184764 | 3300005983 | Bacteria | 775 |
| 260 | Ga0081540_1230772 | 3300005983 | Bacteria | 654 |
| 261 | Ga0081540_1231189 | 3300005983 | Bacteria | 653 |
| 262 | Ga0081540_1328556 | 3300005983 | Bacteria | 524 |
| 263 | Ga0081539_10000008 | 3300005985 | Bacteria | 525071 |
| 264 | Ga0081539_10000220 | 3300005985 | Bacteria | 133834 |
| 265 | Ga0070717_10001656 | 3300006028 | Bacteria | 15473 |
| 266 | Ga0070717_10007544 | 3300006028 | Bacteria | 8083 |
| 267 | Ga0070717_10128172 | 3300006028 | Bacteria | 2180 |
| 268 | Ga0070717_10382104 | 3300006028 | Bacteria | 1263 |
| 269 | Ga0070717_10619385 | 3300006028 | Bacteria | 982 |
| 270 | Ga0070717_10708124 | 3300006028 | Bacteria | 915 |
| 271 | Ga0070717_10876778 | 3300006028 | Bacteria | 817 |
| 272 | Ga0070717_11096399 | 3300006028 | Bacteria | 725 |
| 273 | Ga0075365_10018590 | 3300006038 | Bacteria | 4275 |
| 274 | Ga0075365_10024652 | 3300006038 | Bacteria | 3798 |
| 275 | Ga0075365_10033778 | 3300006038 | Bacteria | 3299 |
| 276 | Ga0075365_10055451 | 3300006038 | Bacteria | 2631 |
| 277 | Ga0075365_10093391 | 3300006038 | Bacteria | 2052 |
| 278 | Ga0075365_10131425 | 3300006038 | Bacteria | 1732 |
| 279 | Ga0075365_10137263 | 3300006038 | Bacteria | 1696 |
| 280 | Ga0075365_10243968 | 3300006038 | Bacteria | 1262 |
| 281 | Ga0075365_10461200 | 3300006038 | Bacteria | 897 |
| 282 | Ga0075365_10957249 | 3300006038 | Bacteria | 603 |
| 283 | Ga0075365_11039466 | 3300006038 | Bacteria | 577 |
| 284 | Ga0075368_10011424 | 3300006042 | Bacteria | 3231 |
| 285 | Ga0075363_100002488 | 3300006048 | Bacteria | 7545 |
| 286 | Ga0075363_100024676 | 3300006048 | Bacteria | 3059 |
| 287 | Ga0075363_100026304 | 3300006048 | Bacteria | 2976 |
| 288 | Ga0075363_100111587 | 3300006048 | Bacteria | 1520 |
| 289 | Ga0075363_100181370 | 3300006048 | Bacteria | 1198 |
| 290 | Ga0075363_100193705 | 3300006048 | Bacteria | 1160 |
| 291 | Ga0075363_100496097 | 3300006048 | Bacteria | 725 |
| 292 | Ga0075363_100684428 | 3300006048 | Bacteria | 619 |
| 293 | Ga0075364_10024940 | 3300006051 | Bacteria | 3802 |
| 294 | Ga0075364_10215443 | 3300006051 | Bacteria | 1302 |
| 295 | Ga0075364_10869894 | 3300006051 | Bacteria | 614 |
| 296 | Ga0070715_10001127 | 3300006163 | Bacteria | 7613 |
| 297 | Ga0070715_10024843 | 3300006163 | Bacteria | 2366 |
| 298 | Ga0070715_10116926 | 3300006163 | Bacteria | 1266 |
| 299 | Ga0070715_10118381 | 3300006163 | Unclassified | 1259 |
| 300 | Ga0070716_100041694 | 3300006173 | Bacteria | 2559 |
| 301 | Ga0070716_100047412 | 3300006173 | Bacteria | 2424 |
| 302 | Ga0070716_100106258 | 3300006173 | Bacteria | 1731 |
| 303 | Ga0070716_100153302 | 3300006173 | Bacteria | 1485 |
| 304 | Ga0070712_100013240 | 3300006175 | Bacteria | 5266 |
| 305 | Ga0070712_100022680 | 3300006175 | Bacteria | 4138 |
| 306 | Ga0070712_100038780 | 3300006175 | Bacteria | 3257 |
| 307 | Ga0070712_100156096 | 3300006175 | Bacteria | 1757 |
| 308 | Ga0070712_100581041 | 3300006175 | Bacteria | 947 |
| 309 | Ga0070712_100630173 | 3300006175 | Bacteria | 910 |
| 310 | Ga0070712_100660216 | 3300006175 | Bacteria | 889 |
| 311 | Ga0075362_10090506 | 3300006177 | Bacteria | 1420 |
| 312 | Ga0075367_10121791 | 3300006178 | Bacteria | 1608 |
| 313 | Ga0075367_10492498 | 3300006178 | Bacteria | 777 |
| 314 | Ga0075367_10720220 | 3300006178 | Bacteria | 635 |
| 315 | Ga0075367_10789854 | 3300006178 | Bacteria | 605 |
| 316 | Ga0075369_10005844 | 3300006186 | Bacteria | 4625 |
| 317 | Ga0075369_10011717 | 3300006186 | Bacteria | 3453 |
| 318 | Ga0075369_10012874 | 3300006186 | Bacteria | 3309 |
| 319 | Ga0075369_10060284 | 3300006186 | Bacteria | 1655 |
| 320 | Ga0075369_10220726 | 3300006186 | Bacteria | 877 |
| 321 | Ga0075366_10033470 | 3300006195 | Bacteria | 3027 |
| 322 | Ga0075366_10157481 | 3300006195 | Bacteria | 1376 |
| 323 | Ga0075366_10332512 | 3300006195 | Bacteria | 931 |
| 324 | Ga0097621_100359483 | 3300006237 | Bacteria | 1297 |
| 325 | Ga0097621_100860082 | 3300006237 | Bacteria | 843 |
| 326 | Ga0097621_101500008 | 3300006237 | Bacteria | 640 |
| 327 | Ga0097621_101662222 | 3300006237 | Bacteria | 608 |
| 328 | Ga0075370_10038846 | 3300006353 | Bacteria | 2679 |
| 329 | Ga0075370_10082329 | 3300006353 | Bacteria | 1851 |
| 330 | Ga0075370_10238198 | 3300006353 | Bacteria | 1077 |
| 331 | Ga0075370_10251729 | 3300006353 | Bacteria | 1047 |
| 332 | Ga0075370_10309220 | 3300006353 | Bacteria | 941 |
| 333 | Ga0075370_10329161 | 3300006353 | Bacteria | 911 |
| 334 | Ga0068871_100069423 | 3300006358 | Bacteria | 2894 |
| 335 | Ga0068871_100072638 | 3300006358 | Bacteria | 2834 |
| 336 | Ga0068871_100525777 | 3300006358 | Bacteria | 1069 |
| 337 | Ga0068871_100585244 | 3300006358 | Bacteria | 1014 |
| 338 | Ga0068871_101652352 | 3300006358 | Bacteria | 607 |
| 339 | Ga0075428_100208936 | 3300006844 | Bacteria | 2110 |
| 340 | Ga0075428_100341471 | 3300006844 | Bacteria | 1608 |
| 341 | Ga0075431_100682133 | 3300006847 | Bacteria | 1006 |
| 342 | Ga0075434_100642083 | 3300006871 | Bacteria | 1080 |
| 343 | Ga0075434_100737073 | 3300006871 | Bacteria | 1003 |
| 344 | Ga0068865_100190154 | 3300006881 | Bacteria | 1587 |
| 345 | Ga0068865_100541348 | 3300006881 | Bacteria | 976 |
| 346 | Ga0068865_101133321 | 3300006881 | Bacteria | 690 |
| 347 | Ga0097620_100103547 | 3300006931 | Bacteria | 2904 |
| 348 | Ga0097620_100181187 | 3300006931 | Bacteria | 2189 |
| 349 | Ga0097620_101012304 | 3300006931 | Bacteria | 913 |
| 350 | Ga0099825_1047657 | 3300006941 | Bacteria | 1006 |
| 351 | Ga0099824_1018474 | 3300006942 | Bacteria | 5716 |
| 352 | Ga0099822_1021826 | 3300006943 | Bacteria | 6137 |
| 353 | Ga0099822_1065794 | 3300006943 | Bacteria | 1098 |
| 354 | Ga0075435_100129312 | 3300007076 | Bacteria | 2113 |
| 355 | Ga0099794_10106117 | 3300007265 | Bacteria | 1405 |
| 356 | Ga0099794_10228064 | 3300007265 | Bacteria | 958 |
| 357 | Ga0099794_10228415 | 3300007265 | Bacteria | 957 |
| 358 | Ga0099795_10009487 | 3300007788 | Bacteria | 2827 |
| 359 | Ga0099795_10021525 | 3300007788 | Bacteria | 2116 |
| 360 | Ga0099795_10211652 | 3300007788 | Bacteria | 822 |
| 361 | Ga0105250_10073796 | 3300009092 | Bacteria | 1380 |
| 362 | Ga0105250_10179380 | 3300009092 | Bacteria | 888 |
| 363 | Ga0105240_10021941 | 3300009093 | Bacteria | 8480 |
| 364 | Ga0105240_10084695 | 3300009093 | Bacteria | 3887 |
| 365 | Ga0105240_10379621 | 3300009093 | Bacteria | 1596 |
| 366 | Ga0105240_10657936 | 3300009093 | Bacteria | 1147 |
| 367 | Ga0111539_10010769 | 3300009094 | Bacteria | 11512 |
| 368 | Ga0105245_10137591 | 3300009098 | Bacteria | 2297 |
| 369 | Ga0105245_10264619 | 3300009098 | Bacteria | 1675 |
| 370 | Ga0105245_10461621 | 3300009098 | Bacteria | 1280 |
| 371 | Ga0105245_10669447 | 3300009098 | Bacteria | 1069 |
| 372 | Ga0105247_10034754 | 3300009101 | Bacteria | 3070 |
| 373 | Ga0105247_10100789 | 3300009101 | Bacteria | 1846 |
| 374 | Ga0105247_10121990 | 3300009101 | Bacteria | 1690 |
| 375 | Ga0105247_10225649 | 3300009101 | Bacteria | 1270 |
| 376 | Ga0105247_10254543 | 3300009101 | Bacteria | 1202 |
| 377 | Ga0105247_10356318 | 3300009101 | Bacteria | 1030 |
| 378 | Ga0105247_10677871 | 3300009101 | Bacteria | 773 |
| 379 | Ga0105247_11160894 | 3300009101 | Bacteria | 613 |
| 380 | Ga0114129_10368158 | 3300009147 | Bacteria | 1900 |
| 381 | Ga0114129_10640263 | 3300009147 | Bacteria | 1373 |
| 382 | Ga0105243_10373444 | 3300009148 | Bacteria | 1316 |
| 383 | Ga0105243_10387430 | 3300009148 | Bacteria | 1295 |
| 384 | Ga0105243_10518846 | 3300009148 | Bacteria | 1133 |
| 385 | Ga0105241_10029756 | 3300009174 | Bacteria | 4077 |
| 386 | Ga0105241_10050318 | 3300009174 | Bacteria | 3175 |
| 387 | Ga0105241_10082425 | 3300009174 | Bacteria | 2521 |
| 388 | Ga0105241_10232984 | 3300009174 | Bacteria | 1553 |
| 389 | Ga0105241_10435013 | 3300009174 | Bacteria | 1157 |
| 390 | Ga0105241_10684529 | 3300009174 | Bacteria | 935 |
| 391 | Ga0105242_10072771 | 3300009176 | Bacteria | 2856 |
| 392 | Ga0105242_10165539 | 3300009176 | Bacteria | 1939 |
| 393 | Ga0105242_10467047 | 3300009176 | Bacteria | 1193 |
| 394 | Ga0105242_10687051 | 3300009176 | Bacteria | 1000 |
| 395 | Ga0105248_10104172 | 3300009177 | Bacteria | 3198 |
| 396 | Ga0105248_10167112 | 3300009177 | Bacteria | 2479 |
| 397 | Ga0105248_10260394 | 3300009177 | Bacteria | 1953 |
| 398 | Ga0105248_10265805 | 3300009177 | Bacteria | 1931 |
| 399 | Ga0105248_10945710 | 3300009177 | Bacteria | 973 |
| 400 | Ga0105248_11042714 | 3300009177 | Bacteria | 924 |
| 401 | Ga0105237_10009950 | 3300009545 | Bacteria | 10145 |
| 402 | Ga0105237_10021234 | 3300009545 | Bacteria | 6678 |
| 403 | Ga0105237_10047158 | 3300009545 | Bacteria | 4332 |
| 404 | Ga0105237_10110574 | 3300009545 | Bacteria | 2740 |
| 405 | Ga0105237_10558820 | 3300009545 | Bacteria | 1151 |
| 406 | Ga0105237_10683805 | 3300009545 | Bacteria | 1033 |
| 407 | Ga0105237_10750872 | 3300009545 | Bacteria | 982 |
| 408 | Ga0105237_10822256 | 3300009545 | Bacteria | 936 |
| 409 | Ga0105237_10824915 | 3300009545 | Bacteria | 934 |
| 410 | Ga0105238_10027647 | 3300009551 | Bacteria | 5781 |
| 411 | Ga0105238_10135316 | 3300009551 | Bacteria | 2442 |
| 412 | Ga0105238_10151847 | 3300009551 | Bacteria | 2291 |
| 413 | Ga0105238_10331334 | 3300009551 | Bacteria | 1509 |
| 414 | Ga0105238_10377366 | 3300009551 | Bacteria | 1409 |
| 415 | Ga0105238_10686681 | 3300009551 | Bacteria | 1035 |
| 416 | Ga0105238_10754634 | 3300009551 | Bacteria | 987 |
| 417 | Ga0105238_11508599 | 3300009551 | Bacteria | 701 |
| 418 | Ga0105238_11568038 | 3300009551 | Bacteria | 688 |
| 419 | Ga0105249_10074396 | 3300009553 | Bacteria | 3144 |
| 420 | Ga0105249_10177078 | 3300009553 | Bacteria | 2072 |
| 421 | Ga0105249_12073413 | 3300009553 | Bacteria | 641 |
| 422 | Ga0099796_10071633 | 3300010159 | Bacteria | 1253 |
| 423 | Ga0099796_10100427 | 3300010159 | Bacteria | 1088 |
| 424 | Ga0099796_10127917 | 3300010159 | Bacteria | 982 |
| 425 | Ga0105239_10066752 | 3300010375 | Bacteria | 3951 |
| 426 | Ga0105239_10084742 | 3300010375 | Bacteria | 3492 |
| 427 | Ga0105239_10139452 | 3300010375 | Bacteria | 2701 |
| 428 | Ga0105239_10159171 | 3300010375 | Bacteria | 2522 |
| 429 | Ga0105239_10218055 | 3300010375 | Bacteria | 2139 |
| 430 | Ga0105239_10292556 | 3300010375 | Bacteria | 1834 |
| 431 | Ga0105239_10387551 | 3300010375 | Bacteria | 1580 |
| 432 | Ga0105239_10575312 | 3300010375 | Bacteria | 1284 |
| 433 | Ga0105239_10578048 | 3300010375 | Bacteria | 1281 |
| 434 | Ga0105239_11055342 | 3300010375 | Bacteria | 935 |
| 435 | Ga0105246_10013775 | 3300011119 | Bacteria | 5074 |
| 436 | Ga0105246_10045998 | 3300011119 | Bacteria | 2975 |
| 437 | Ga0105246_10104444 | 3300011119 | Bacteria | 2069 |
| 438 | Ga0105246_10228690 | 3300011119 | Bacteria | 1463 |
| 439 | Ga0105246_10266822 | 3300011119 | Bacteria | 1366 |
| 440 | Ga0105246_10268572 | 3300011119 | Bacteria | 1362 |
| 441 | Ga0105246_10350085 | 3300011119 | Bacteria | 1210 |
| 442 | Ga0105246_10694380 | 3300011119 | Bacteria | 891 |
| 443 | Ga0157370_10057618 | 3300013104 | Bacteria | 3693 |
| 444 | Ga0157370_10643066 | 3300013104 | Bacteria | 970 |
| 445 | Ga0157370_10885876 | 3300013104 | Bacteria | 810 |
| 446 | Ga0157369_10012423 | 3300013105 | Bacteria | 9667 |
| 447 | Ga0157369_10195154 | 3300013105 | Bacteria | 2126 |
| 448 | Ga0157369_10348532 | 3300013105 | Bacteria | 1538 |
| 449 | Ga0157369_10616948 | 3300013105 | Bacteria | 1119 |
| 450 | Ga0157374_10024785 | 3300013296 | Bacteria | 5379 |
| 451 | Ga0157374_10040321 | 3300013296 | Bacteria | 4299 |
| 452 | Ga0157374_11755321 | 3300013296 | Bacteria | 645 |
| 453 | Ga0157374_11891070 | 3300013296 | Bacteria | 623 |
| 454 | Ga0157378_10004961 | 3300013297 | Bacteria | 11667 |
| 455 | Ga0157378_10133315 | 3300013297 | Bacteria | 2302 |
| 456 | Ga0157378_10662215 | 3300013297 | Bacteria | 1060 |
| 457 | Ga0157378_10807552 | 3300013297 | Bacteria | 964 |
| 458 | Ga0157378_10934671 | 3300013297 | Bacteria | 899 |
| 459 | Ga0157378_11025692 | 3300013297 | Bacteria | 860 |
| 460 | Ga0163162_10060239 | 3300013306 | Bacteria | 3831 |
| 461 | Ga0163162_10062895 | 3300013306 | Bacteria | 3752 |
| 462 | Ga0163162_10163138 | 3300013306 | Bacteria | 2351 |
| 463 | Ga0163162_10184729 | 3300013306 | Bacteria | 2212 |
| 464 | Ga0163162_10370985 | 3300013306 | Bacteria | 1564 |
| 465 | Ga0163162_10893966 | 3300013306 | Bacteria | 1002 |
| 466 | Ga0163162_11221664 | 3300013306 | Bacteria | 853 |
| 467 | Ga0163162_11419257 | 3300013306 | Bacteria | 790 |
| 468 | Ga0157372_10782245 | 3300013307 | Bacteria | 1109 |
| 469 | Ga0157375_10063269 | 3300013308 | Bacteria | 3680 |
| 470 | Ga0157375_10105710 | 3300013308 | Bacteria | 2906 |
| 471 | Ga0157375_10108399 | 3300013308 | Bacteria | 2872 |
| 472 | Ga0157375_10498328 | 3300013308 | Bacteria | 1382 |
| 473 | Ga0157375_10888727 | 3300013308 | Bacteria | 1035 |
| 474 | Ga0157375_11224732 | 3300013308 | Bacteria | 881 |
| 475 | Ga0157375_11415865 | 3300013308 | Bacteria | 819 |
| 476 | Ga0163163_10009852 | 3300014325 | Bacteria | 8564 |
| 477 | Ga0163163_10060452 | 3300014325 | Bacteria | 3752 |
| 478 | Ga0163163_10060614 | 3300014325 | Bacteria | 3747 |
| 479 | Ga0163163_10177238 | 3300014325 | Bacteria | 2178 |
| 480 | Ga0163163_10352566 | 3300014325 | Bacteria | 1528 |
| 481 | Ga0163163_10927490 | 3300014325 | Bacteria | 934 |
| 482 | Ga0157380_10052368 | 3300014326 | Bacteria | 3232 |
| 483 | Ga0157380_10260620 | 3300014326 | Bacteria | 1574 |
| 484 | Ga0157380_10316878 | 3300014326 | Bacteria | 1444 |
| 485 | Ga0157377_10110199 | 3300014745 | Bacteria | 1653 |
| 486 | Ga0157377_10113067 | 3300014745 | Bacteria | 1635 |
| 487 | Ga0157377_10164552 | 3300014745 | Bacteria | 1382 |
| 488 | Ga0157379_10092888 | 3300014968 | Bacteria | 2707 |
| 489 | Ga0157379_10100952 | 3300014968 | Bacteria | 2590 |
| 490 | Ga0157379_10115038 | 3300014968 | Bacteria | 2418 |
| 491 | Ga0157379_10614098 | 3300014968 | Bacteria | 1016 |
| 492 | Ga0157376_10053421 | 3300014969 | Bacteria | 3364 |
| 493 | Ga0157376_10160876 | 3300014969 | Bacteria | 2035 |
| 494 | Ga0157376_10686731 | 3300014969 | Bacteria | 1027 |
| 495 | Ga0182007_10120303 | 3300015262 | Bacteria | 878 |
| 496 | Ga0163161_10049743 | 3300017792 | Bacteria | 3031 |
| 497 | Ga0163161_10297384 | 3300017792 | Bacteria | 1270 |
| 498 | Ga0163161_10546613 | 3300017792 | Bacteria | 949 |
| 499 | Ga0163161_10566890 | 3300017792 | Bacteria | 932 |
| 500 | Ga0206353_11239574 | 3300020082 | Bacteria | 855 |
| 501 | Ga0214542_1001925 | 3300021321 | Bacteria | 42950 |
| 502 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 503 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 504 | Ga0213872_10023682 | 3300021361 | Bacteria | 2825 |
| 505 | Ga0213876_10020877 | 3300021384 | Bacteria | 3463 |
| 506 | Ga0213875_10074339 | 3300021388 | Bacteria | 1586 |
| 507 | Ga0224572_1024786 | 3300024225 | Bacteria | 1152 |
| 508 | Ga0228598_1003083 | 3300024227 | Bacteria | 3613 |
| 509 | Ga0209563_100325 | 3300025230 | Bacteria | 18742 |
| 510 | Ga0207425_1030815 | 3300025245 | Bacteria | 1072 |
| 511 | Ga0209677_102346 | 3300025253 | Bacteria | 7251 |
| 512 | Ga0209148_1000812 | 3300025254 | Bacteria | 22632 |
| 513 | Ga0209233_1002884 | 3300025261 | Bacteria | 6146 |
| 514 | Ga0209233_1003610 | 3300025261 | Bacteria | 5425 |
| 515 | Ga0209233_1008563 | 3300025261 | Bacteria | 3154 |
| 516 | Ga0209233_1017593 | 3300025261 | Bacteria | 1944 |
| 517 | Ga0209233_1026199 | 3300025261 | Bacteria | 1429 |
| 518 | Ga0209673_1045625 | 3300025273 | Bacteria | 1202 |
| 519 | Ga0209564_1005325 | 3300025295 | Bacteria | 7407 |
| 520 | Ga0209564_1016531 | 3300025295 | Bacteria | 2929 |
| 521 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 522 | Ga0209758_1000120 | 3300025297 | Bacteria | 192212 |
| 523 | Ga0209758_1001848 | 3300025297 | Bacteria | 23245 |
| 524 | Ga0209758_1002526 | 3300025297 | Bacteria | 18502 |
| 525 | Ga0209758_1002848 | 3300025297 | Bacteria | 16788 |
| 526 | Ga0209758_1008838 | 3300025297 | Bacteria | 6412 |
| 527 | Ga0209758_1018387 | 3300025297 | Bacteria | 3426 |
| 528 | Ga0209758_1069994 | 3300025297 | Bacteria | 1109 |
| 529 | Ga0209758_1075221 | 3300025297 | Bacteria | 1045 |
| 530 | Ga0209256_1010441 | 3300025299 | Bacteria | 3886 |
| 531 | Ga0209256_1040226 | 3300025299 | Bacteria | 1196 |
| 532 | Ga0207426_1000328 | 3300025302 | Bacteria | 90659 |
| 533 | Ga0207426_1000458 | 3300025302 | Bacteria | 64019 |
| 534 | Ga0207426_1006703 | 3300025302 | Bacteria | 4942 |
| 535 | Ga0207426_1066486 | 3300025302 | Bacteria | 1018 |
| 536 | Ga0209051_1089771 | 3300025303 | Bacteria | 858 |
| 537 | Ga0209257_1001101 | 3300025304 | Bacteria | 35153 |
| 538 | Ga0209257_1030664 | 3300025304 | Bacteria | 1732 |
| 539 | Ga0207697_10262449 | 3300025315 | Bacteria | 765 |
| 540 | Ga0207697_10413234 | 3300025315 | Bacteria | 599 |
| 541 | Ga0207656_10107837 | 3300025321 | Bacteria | 1284 |
| 542 | Ga0207656_10147548 | 3300025321 | Bacteria | 1112 |
| 543 | Ga0207653_10027624 | 3300025885 | Bacteria | 1822 |
| 544 | Ga0207692_10000797 | 3300025898 | Bacteria | 11223 |
| 545 | Ga0207692_10034442 | 3300025898 | Bacteria | 2452 |
| 546 | Ga0207692_10040116 | 3300025898 | Bacteria | 2309 |
| 547 | Ga0207692_10108271 | 3300025898 | Bacteria | 1537 |
| 548 | Ga0207692_10751592 | 3300025898 | Bacteria | 635 |
| 549 | Ga0207642_10090132 | 3300025899 | Bacteria | 1512 |
| 550 | Ga0207642_10592054 | 3300025899 | Bacteria | 689 |
| 551 | Ga0207710_10161530 | 3300025900 | Bacteria | 1092 |
| 552 | Ga0207688_10119760 | 3300025901 | Bacteria | 1535 |
| 553 | Ga0207688_10266632 | 3300025901 | Bacteria | 1041 |
| 554 | Ga0207647_10008820 | 3300025904 | Bacteria | 7199 |
| 555 | Ga0207647_10077783 | 3300025904 | Bacteria | 1994 |
| 556 | Ga0207647_10429309 | 3300025904 | Bacteria | 742 |
| 557 | Ga0207647_10532657 | 3300025904 | Bacteria | 653 |
| 558 | Ga0207699_10001610 | 3300025906 | Bacteria | 10719 |
| 559 | Ga0207699_10014207 | 3300025906 | Bacteria | 4097 |
| 560 | Ga0207699_10017213 | 3300025906 | Bacteria | 3798 |
| 561 | Ga0207699_10054282 | 3300025906 | Bacteria | 2379 |
| 562 | Ga0207699_10085855 | 3300025906 | Bacteria | 1964 |
| 563 | Ga0207699_10088282 | 3300025906 | Bacteria | 1940 |
| 564 | Ga0207699_10119427 | 3300025906 | Bacteria | 1702 |
| 565 | Ga0207699_10403897 | 3300025906 | Bacteria | 973 |
| 566 | Ga0207645_10132858 | 3300025907 | Bacteria | 1620 |
| 567 | Ga0207643_10104196 | 3300025908 | Bacteria | 1666 |
| 568 | Ga0207643_10728021 | 3300025908 | Bacteria | 642 |
| 569 | Ga0207705_10125295 | 3300025909 | Bacteria | 1909 |
| 570 | Ga0207705_10195132 | 3300025909 | Bacteria | 1532 |
| 571 | Ga0207705_11134653 | 3300025909 | Bacteria | 601 |
| 572 | Ga0207684_11153938 | 3300025910 | Bacteria | 643 |
| 573 | Ga0207654_10119575 | 3300025911 | Bacteria | 1652 |
| 574 | Ga0207654_10397877 | 3300025911 | Bacteria | 957 |
| 575 | Ga0207654_10488780 | 3300025911 | Bacteria | 868 |
| 576 | Ga0207707_10000886 | 3300025912 | Bacteria | 29266 |
| 577 | Ga0207707_10023656 | 3300025912 | Bacteria | 5372 |
| 578 | Ga0207707_10031075 | 3300025912 | Bacteria | 4672 |
| 579 | Ga0207707_10299929 | 3300025912 | Bacteria | 1389 |
| 580 | Ga0207707_10518469 | 3300025912 | Bacteria | 1015 |
| 581 | Ga0207707_11490262 | 3300025912 | Bacteria | 536 |
| 582 | Ga0207695_10000163 | 3300025913 | Bacteria | 197030 |
| 583 | Ga0207695_10306738 | 3300025913 | Bacteria | 1478 |
| 584 | Ga0207695_10308478 | 3300025913 | Bacteria | 1473 |
| 585 | Ga0207671_10056823 | 3300025914 | Bacteria | 2900 |
| 586 | Ga0207671_10058973 | 3300025914 | Bacteria | 2846 |
| 587 | Ga0207671_10110956 | 3300025914 | Bacteria | 2087 |
| 588 | Ga0207671_10332303 | 3300025914 | Bacteria | 1204 |
| 589 | Ga0207671_10378502 | 3300025914 | Bacteria | 1124 |
| 590 | Ga0207693_10002637 | 3300025915 | Bacteria | 15580 |
| 591 | Ga0207693_10007874 | 3300025915 | Bacteria | 8752 |
| 592 | Ga0207693_10018468 | 3300025915 | Bacteria | 5555 |
| 593 | Ga0207693_10034047 | 3300025915 | Bacteria | 4019 |
| 594 | Ga0207693_10060270 | 3300025915 | Bacteria | 2972 |
| 595 | Ga0207693_10203094 | 3300025915 | Bacteria | 1558 |
| 596 | Ga0207693_10453506 | 3300025915 | Bacteria | 1002 |
| 597 | Ga0207693_10539021 | 3300025915 | Bacteria | 910 |
| 598 | Ga0207663_10006243 | 3300025916 | Bacteria | 6080 |
| 599 | Ga0207663_10011845 | 3300025916 | Bacteria | 4695 |
| 600 | Ga0207663_10028419 | 3300025916 | Bacteria | 3273 |
| 601 | Ga0207663_10044640 | 3300025916 | Bacteria | 2722 |
| 602 | Ga0207663_10121345 | 3300025916 | Bacteria | 1790 |
| 603 | Ga0207663_10140152 | 3300025916 | Bacteria | 1683 |
| 604 | Ga0207663_11006565 | 3300025916 | Bacteria | 669 |
| 605 | Ga0207663_11244168 | 3300025916 | Bacteria | 600 |
| 606 | Ga0207660_10010388 | 3300025917 | Bacteria | 6040 |
| 607 | Ga0207660_10022287 | 3300025917 | Bacteria | 4267 |
| 608 | Ga0207660_10027535 | 3300025917 | Bacteria | 3880 |
| 609 | Ga0207660_10231996 | 3300025917 | Bacteria | 1451 |
| 610 | Ga0207660_10256833 | 3300025917 | Bacteria | 1380 |
| 611 | Ga0207660_10502071 | 3300025917 | Bacteria | 984 |
| 612 | Ga0207662_10177795 | 3300025918 | Bacteria | 1368 |
| 613 | Ga0207657_10008437 | 3300025919 | Bacteria | 10455 |
| 614 | Ga0207649_10040161 | 3300025920 | Bacteria | 2842 |
| 615 | Ga0207649_10684652 | 3300025920 | Bacteria | 794 |
| 616 | Ga0207649_10932267 | 3300025920 | Bacteria | 682 |
| 617 | Ga0207652_10019601 | 3300025921 | Bacteria | 5566 |
| 618 | Ga0207652_10105158 | 3300025921 | Bacteria | 2498 |
| 619 | Ga0207652_10274051 | 3300025921 | Bacteria | 1522 |
| 620 | Ga0207681_10036681 | 3300025923 | Bacteria | 3236 |
| 621 | Ga0207681_10208829 | 3300025923 | Bacteria | 1504 |
| 622 | Ga0207681_10293023 | 3300025923 | Bacteria | 1285 |
| 623 | Ga0207694_10040173 | 3300025924 | Bacteria | 3601 |
| 624 | Ga0207694_10071234 | 3300025924 | Bacteria | 2716 |
| 625 | Ga0207694_10203424 | 3300025924 | Bacteria | 1611 |
| 626 | Ga0207694_10208299 | 3300025924 | Bacteria | 1592 |
| 627 | Ga0207694_10282251 | 3300025924 | Bacteria | 1364 |
| 628 | Ga0207694_10454862 | 3300025924 | Bacteria | 1069 |
| 629 | Ga0207694_11140667 | 3300025924 | Bacteria | 660 |
| 630 | Ga0207650_10527525 | 3300025925 | Bacteria | 988 |
| 631 | Ga0207650_10815484 | 3300025925 | Bacteria | 791 |
| 632 | Ga0207650_10925300 | 3300025925 | Bacteria | 741 |
| 633 | Ga0207659_10789612 | 3300025926 | Bacteria | 815 |
| 634 | Ga0207659_10981193 | 3300025926 | Bacteria | 727 |
| 635 | Ga0207659_11035003 | 3300025926 | Bacteria | 706 |
| 636 | Ga0207687_10053608 | 3300025927 | Bacteria | 2818 |
| 637 | Ga0207687_10218131 | 3300025927 | Bacteria | 1500 |
| 638 | Ga0207687_10327438 | 3300025927 | Bacteria | 1242 |
| 639 | Ga0207700_10007466 | 3300025928 | Bacteria | 6681 |
| 640 | Ga0207700_10011479 | 3300025928 | Bacteria | 5650 |
| 641 | Ga0207700_10052174 | 3300025928 | Bacteria | 3056 |
| 642 | Ga0207700_10095945 | 3300025928 | Bacteria | 2353 |
| 643 | Ga0207700_10304870 | 3300025928 | Bacteria | 1376 |
| 644 | Ga0207664_10002586 | 3300025929 | Bacteria | 11979 |
| 645 | Ga0207664_10007788 | 3300025929 | Bacteria | 7438 |
| 646 | Ga0207664_10267241 | 3300025929 | Bacteria | 1497 |
| 647 | Ga0207664_10276253 | 3300025929 | Bacteria | 1473 |
| 648 | Ga0207664_10276358 | 3300025929 | Bacteria | 1473 |
| 649 | Ga0207664_10378557 | 3300025929 | Bacteria | 1256 |
| 650 | Ga0207644_10188346 | 3300025931 | Bacteria | 1621 |
| 651 | Ga0207644_10272742 | 3300025931 | Bacteria | 1356 |
| 652 | Ga0207644_10448930 | 3300025931 | Bacteria | 1059 |
| 653 | Ga0207690_10014466 | 3300025932 | Bacteria | 4767 |
| 654 | Ga0207690_10522991 | 3300025932 | Bacteria | 962 |
| 655 | Ga0207690_11302912 | 3300025932 | Bacteria | 607 |
| 656 | Ga0207706_10059649 | 3300025933 | Bacteria | 3360 |
| 657 | Ga0207706_10149460 | 3300025933 | Bacteria | 2054 |
| 658 | Ga0207706_10261499 | 3300025933 | Bacteria | 1511 |
| 659 | Ga0207706_10634162 | 3300025933 | Bacteria | 916 |
| 660 | Ga0207706_10855574 | 3300025933 | Bacteria | 770 |
| 661 | Ga0207706_11349173 | 3300025933 | Bacteria | 587 |
| 662 | Ga0207686_10089706 | 3300025934 | Bacteria | 2027 |
| 663 | Ga0207686_10103845 | 3300025934 | Bacteria | 1902 |
| 664 | Ga0207686_10390090 | 3300025934 | Bacteria | 1058 |
| 665 | Ga0207709_10040013 | 3300025935 | Bacteria | 2804 |
| 666 | Ga0207670_10210240 | 3300025936 | Bacteria | 1483 |
| 667 | Ga0207669_10005298 | 3300025937 | Bacteria | 5770 |
| 668 | Ga0207669_10219534 | 3300025937 | Bacteria | 1394 |
| 669 | Ga0207669_10564302 | 3300025937 | Bacteria | 920 |
| 670 | Ga0207669_10972046 | 3300025937 | Bacteria | 712 |
| 671 | Ga0207669_10972372 | 3300025937 | Bacteria | 712 |
| 672 | Ga0207669_11135585 | 3300025937 | Bacteria | 660 |
| 673 | Ga0207704_10175381 | 3300025938 | Bacteria | 1543 |
| 674 | Ga0207704_10222242 | 3300025938 | Bacteria | 1398 |
| 675 | Ga0207704_10390975 | 3300025938 | Bacteria | 1094 |
| 676 | Ga0207665_10001385 | 3300025939 | Bacteria | 16335 |
| 677 | Ga0207665_10021917 | 3300025939 | Bacteria | 4201 |
| 678 | Ga0207665_10065508 | 3300025939 | Bacteria | 2471 |
| 679 | Ga0207665_10116671 | 3300025939 | Bacteria | 1882 |
| 680 | Ga0207665_10172049 | 3300025939 | Bacteria | 1565 |
| 681 | Ga0207665_10910243 | 3300025939 | Bacteria | 698 |
| 682 | Ga0207691_10025303 | 3300025940 | Bacteria | 5574 |
| 683 | Ga0207691_10148496 | 3300025940 | Bacteria | 2062 |
| 684 | Ga0207691_10149913 | 3300025940 | Bacteria | 2051 |
| 685 | Ga0207691_11065095 | 3300025940 | Bacteria | 673 |
| 686 | Ga0207711_10067359 | 3300025941 | Bacteria | 3099 |
| 687 | Ga0207689_10019353 | 3300025942 | Bacteria | 5738 |
| 688 | Ga0207689_10036827 | 3300025942 | Bacteria | 4060 |
| 689 | Ga0207689_10117631 | 3300025942 | Bacteria | 2185 |
| 690 | Ga0207689_10305796 | 3300025942 | Bacteria | 1318 |
| 691 | Ga0207689_10782418 | 3300025942 | Bacteria | 805 |
| 692 | Ga0207689_11596551 | 3300025942 | Bacteria | 543 |
| 693 | Ga0207661_10018951 | 3300025944 | Bacteria | 5120 |
| 694 | Ga0207679_10205321 | 3300025945 | Bacteria | 1649 |
| 695 | Ga0207679_10621109 | 3300025945 | Bacteria | 975 |
| 696 | Ga0207679_10757306 | 3300025945 | Bacteria | 883 |
| 697 | Ga0207667_10019974 | 3300025949 | Bacteria | 7463 |
| 698 | Ga0207667_10113813 | 3300025949 | Bacteria | 2789 |
| 699 | Ga0207667_10168621 | 3300025949 | Bacteria | 2250 |
| 700 | Ga0207667_10189492 | 3300025949 | Bacteria | 2111 |
| 701 | Ga0207667_10230228 | 3300025949 | Bacteria | 1898 |
| 702 | Ga0207667_10474438 | 3300025949 | Bacteria | 1270 |
| 703 | Ga0207667_10536798 | 3300025949 | Bacteria | 1184 |
| 704 | Ga0207667_11684186 | 3300025949 | Bacteria | 601 |
| 705 | Ga0207651_10311328 | 3300025960 | Bacteria | 1313 |
| 706 | Ga0207651_10882550 | 3300025960 | Bacteria | 796 |
| 707 | Ga0207651_11112223 | 3300025960 | Bacteria | 708 |
| 708 | Ga0207712_10082756 | 3300025961 | Bacteria | 2341 |
| 709 | Ga0207712_11310256 | 3300025961 | Bacteria | 647 |
| 710 | Ga0207668_10030855 | 3300025972 | Bacteria | 3525 |
| 711 | Ga0207668_10064631 | 3300025972 | Bacteria | 2586 |
| 712 | Ga0207668_10069258 | 3300025972 | Bacteria | 2511 |
| 713 | Ga0207668_10108642 | 3300025972 | Bacteria | 2076 |
| 714 | Ga0207668_10119579 | 3300025972 | Bacteria | 1992 |
| 715 | Ga0207668_10151383 | 3300025972 | Bacteria | 1796 |
| 716 | Ga0207668_10972115 | 3300025972 | Bacteria | 758 |
| 717 | Ga0207640_10187043 | 3300025981 | Bacteria | 1558 |
| 718 | Ga0207640_10450463 | 3300025981 | Bacteria | 1061 |
| 719 | Ga0207640_10633117 | 3300025981 | Bacteria | 909 |
| 720 | Ga0207640_11197543 | 3300025981 | Bacteria | 675 |
| 721 | Ga0207658_10059201 | 3300025986 | Bacteria | 2854 |
| 722 | Ga0207658_10109147 | 3300025986 | Bacteria | 2184 |
| 723 | Ga0207658_10546621 | 3300025986 | Bacteria | 1036 |
| 724 | Ga0207677_10073769 | 3300026023 | Bacteria | 2418 |
| 725 | Ga0207677_10721331 | 3300026023 | Bacteria | 886 |
| 726 | Ga0207677_10838878 | 3300026023 | Bacteria | 825 |
| 727 | Ga0207677_11112933 | 3300026023 | Bacteria | 720 |
| 728 | Ga0207703_10127440 | 3300026035 | Bacteria | 2193 |
| 729 | Ga0207703_10129128 | 3300026035 | Bacteria | 2180 |
| 730 | Ga0207703_10473656 | 3300026035 | Bacteria | 1173 |
| 731 | Ga0207703_10725421 | 3300026035 | Bacteria | 946 |
| 732 | Ga0207703_10812025 | 3300026035 | Bacteria | 893 |
| 733 | Ga0207703_10992098 | 3300026035 | Bacteria | 806 |
| 734 | Ga0207639_10034032 | 3300026041 | Bacteria | 3763 |
| 735 | Ga0207639_10089016 | 3300026041 | Bacteria | 2465 |
| 736 | Ga0207639_11024210 | 3300026041 | Bacteria | 773 |
| 737 | Ga0207678_10017857 | 3300026067 | Bacteria | 6231 |
| 738 | Ga0207678_10022393 | 3300026067 | Bacteria | 5534 |
| 739 | Ga0207678_10026311 | 3300026067 | Bacteria | 5076 |
| 740 | Ga0207678_10033211 | 3300026067 | Bacteria | 4496 |
| 741 | Ga0207678_10034200 | 3300026067 | Bacteria | 4427 |
| 742 | Ga0207678_10035164 | 3300026067 | Bacteria | 4362 |
| 743 | Ga0207678_10058046 | 3300026067 | Bacteria | 3331 |
| 744 | Ga0207678_10154732 | 3300026067 | Bacteria | 1958 |
| 745 | Ga0207678_10374084 | 3300026067 | Bacteria | 1231 |
| 746 | Ga0207678_10596797 | 3300026067 | Bacteria | 968 |
| 747 | Ga0207678_10849948 | 3300026067 | Bacteria | 806 |
| 748 | Ga0207678_11146906 | 3300026067 | Bacteria | 688 |
| 749 | Ga0207708_10062133 | 3300026075 | Bacteria | 2853 |
| 750 | Ga0207708_10494035 | 3300026075 | Bacteria | 1025 |
| 751 | Ga0207708_10521770 | 3300026075 | Bacteria | 998 |
| 752 | Ga0207702_10087083 | 3300026078 | Bacteria | 2725 |
| 753 | Ga0207702_10762169 | 3300026078 | Bacteria | 956 |
| 754 | Ga0207702_11190195 | 3300026078 | Bacteria | 756 |
| 755 | Ga0207641_10203963 | 3300026088 | Bacteria | 1825 |
| 756 | Ga0207641_11198100 | 3300026088 | Bacteria | 759 |
| 757 | Ga0207648_10032340 | 3300026089 | Bacteria | 4619 |
| 758 | Ga0207648_10605595 | 3300026089 | Bacteria | 1010 |
| 759 | Ga0207648_11862359 | 3300026089 | Bacteria | 563 |
| 760 | Ga0207676_10068020 | 3300026095 | Bacteria | 2847 |
| 761 | Ga0207676_10125942 | 3300026095 | Bacteria | 2170 |
| 762 | Ga0207676_10177406 | 3300026095 | Bacteria | 1862 |
| 763 | Ga0207676_10209105 | 3300026095 | Bacteria | 1730 |
| 764 | Ga0207674_10007720 | 3300026116 | Bacteria | 12520 |
| 765 | Ga0207674_10078663 | 3300026116 | Bacteria | 3303 |
| 766 | Ga0207674_10167564 | 3300026116 | Bacteria | 2150 |
| 767 | Ga0207674_10328757 | 3300026116 | Bacteria | 1478 |
| 768 | Ga0207674_11087386 | 3300026116 | Bacteria | 769 |
| 769 | Ga0207675_100058719 | 3300026118 | Bacteria | 3590 |
| 770 | Ga0207675_100293273 | 3300026118 | Bacteria | 1582 |
| 771 | Ga0207675_100537114 | 3300026118 | Bacteria | 1167 |
| 772 | Ga0207675_100954201 | 3300026118 | Bacteria | 875 |
| 773 | Ga0207675_101079958 | 3300026118 | Bacteria | 822 |
| 774 | Ga0207675_101535517 | 3300026118 | Bacteria | 686 |
| 775 | Ga0207683_10003797 | 3300026121 | Bacteria | 13083 |
| 776 | Ga0207683_10037123 | 3300026121 | Bacteria | 4243 |
| 777 | Ga0207683_10068301 | 3300026121 | Bacteria | 3137 |
| 778 | Ga0207683_10091282 | 3300026121 | Bacteria | 2713 |
| 779 | Ga0207683_10363740 | 3300026121 | Bacteria | 1329 |
| 780 | Ga0207683_10469443 | 3300026121 | Bacteria | 1161 |
| 781 | Ga0207683_10539113 | 3300026121 | Bacteria | 1079 |
| 782 | Ga0207683_10656745 | 3300026121 | Bacteria | 971 |
| 783 | Ga0207683_10865217 | 3300026121 | Bacteria | 839 |
| 784 | Ga0207698_10132646 | 3300026142 | Bacteria | 2132 |
| 785 | Ga0207698_10138196 | 3300026142 | Bacteria | 2094 |
| 786 | Ga0207698_10365103 | 3300026142 | Bacteria | 1368 |
| 787 | Ga0207698_10432956 | 3300026142 | Bacteria | 1265 |
| 788 | Ga0207698_11333200 | 3300026142 | Bacteria | 732 |
| 789 | Ga0209389_1000043 | 3300027296 | Bacteria | 123224 |
| 790 | Ga0209389_1000077 | 3300027296 | Bacteria | 91273 |
| 791 | Ga0209589_1000011 | 3300027357 | Bacteria | 236981 |
| 792 | Ga0209589_1000047 | 3300027357 | Bacteria | 118659 |
| 793 | Ga0209489_100012 | 3300027361 | Bacteria | 236981 |
| 794 | Ga0209489_100075 | 3300027361 | Bacteria | 136991 |
| 795 | Ga0209489_100251 | 3300027361 | Bacteria | 91273 |
| 796 | Ga0209700_100019 | 3300027363 | Bacteria | 236981 |
| 797 | Ga0209700_100271 | 3300027363 | Bacteria | 91215 |
| 798 | Ga0209179_1003275 | 3300027512 | Bacteria | 2312 |
| 799 | Ga0209588_1012656 | 3300027671 | Bacteria | 2563 |
| 800 | Ga0209588_1030031 | 3300027671 | Bacteria | 1735 |
| 801 | Ga0209813_10046981 | 3300027866 | Bacteria | 1335 |
| 802 | Ga0209813_10049013 | 3300027866 | Bacteria | 1313 |
| 803 | Ga0207428_10255880 | 3300027907 | Bacteria | 1305 |
| 804 | Ga0268266_10007625 | 3300028379 | Bacteria | 9734 |
| 805 | Ga0268266_10020198 | 3300028379 | Bacteria | 5678 |
| 806 | Ga0268266_10022295 | 3300028379 | Bacteria | 5397 |
| 807 | Ga0268266_10043720 | 3300028379 | Bacteria | 3829 |
| 808 | Ga0268266_10056470 | 3300028379 | Bacteria | 3377 |
| 809 | Ga0268266_10128490 | 3300028379 | Bacteria | 2264 |
| 810 | Ga0268266_10759427 | 3300028379 | Bacteria | 936 |
| 811 | Ga0268266_11410195 | 3300028379 | Bacteria | 672 |
| 812 | Ga0268266_11808682 | 3300028379 | Bacteria | 585 |
| 813 | Ga0268265_10054843 | 3300028380 | Bacteria | 3026 |
| 814 | Ga0268265_10170480 | 3300028380 | Bacteria | 1859 |
| 815 | Ga0268265_10487539 | 3300028380 | Bacteria | 1159 |
| 816 | Ga0268265_10791405 | 3300028380 | Bacteria | 923 |
| 817 | Ga0268265_11299103 | 3300028380 | Bacteria | 727 |
| 818 | Ga0268264_10000030 | 3300028381 | Bacteria | 418542 |
| 819 | Ga0268264_10140299 | 3300028381 | Bacteria | 2154 |
| 820 | Ga0265337_1006171 | 3300028556 | Bacteria | 4658 |
| 821 | Ga0265319_1011253 | 3300028563 | Bacteria | 3676 |
| 822 | Ga0265334_10010046 | 3300028573 | Bacteria | 3999 |
| 823 | Ga0265323_10000434 | 3300028653 | Bacteria | 23913 |
| 824 | Ga0265322_10017119 | 3300028654 | Bacteria | 2089 |
| 825 | Ga0265336_10000649 | 3300028666 | Bacteria | 18964 |
| 826 | Ga0307517_10000279 | 3300028786 | Bacteria | 88025 |
| 827 | Ga0307515_10118784 | 3300028794 | Bacteria | 3014 |
| 828 | Ga0265338_10000280 | 3300028800 | Bacteria | 91942 |
| 829 | Ga0307512_10162065 | 3300030522 | Bacteria | 1307 |
| 830 | Ga0265762_1030524 | 3300030760 | Bacteria | 1023 |
| 831 | Ga0265330_10006697 | 3300031235 | Bacteria | 5683 |
| 832 | Ga0265330_10016700 | 3300031235 | Bacteria | 3384 |
| 833 | Ga0265330_10047707 | 3300031235 | Bacteria | 1884 |
| 834 | Ga0265332_10013075 | 3300031238 | Bacteria | 3679 |
| 835 | Ga0265332_10252158 | 3300031238 | Bacteria | 730 |
| 836 | Ga0265328_10277413 | 3300031239 | Bacteria | 645 |
| 837 | Ga0265325_10071434 | 3300031241 | Bacteria | 1742 |
| 838 | Ga0265340_10140965 | 3300031247 | Bacteria | 1102 |
| 839 | Ga0265340_10378982 | 3300031247 | Bacteria | 624 |
| 840 | Ga0265339_10173947 | 3300031249 | Bacteria | 1076 |
| 841 | Ga0265339_10198075 | 3300031249 | Bacteria | 992 |
| 842 | Ga0265339_10376988 | 3300031249 | Bacteria | 665 |
| 843 | Ga0265331_10068893 | 3300031250 | Bacteria | 1658 |
| 844 | Ga0265331_10083507 | 3300031250 | Bacteria | 1481 |
| 845 | Ga0265316_10789044 | 3300031344 | Bacteria | 666 |
| 846 | Ga0307513_10530716 | 3300031456 | Bacteria | 891 |
| 847 | Ga0307509_10014245 | 3300031507 | Bacteria | 9362 |
| 848 | Ga0307509_10098111 | 3300031507 | Bacteria | 2976 |
| 849 | Ga0307509_10592549 | 3300031507 | Bacteria | 782 |
| 850 | Ga0307408_100713904 | 3300031548 | Bacteria | 902 |
| 851 | Ga0307408_101558671 | 3300031548 | Bacteria | 626 |
| 852 | Ga0265313_10063475 | 3300031595 | Bacteria | 1722 |
| 853 | Ga0307508_10111858 | 3300031616 | Bacteria | 2331 |
| 854 | Ga0307508_10232923 | 3300031616 | Bacteria | 1440 |
| 855 | Ga0307508_10340520 | 3300031616 | Bacteria | 1091 |
| 856 | Ga0265314_10031072 | 3300031711 | Bacteria | 3947 |
| 857 | Ga0265314_10099606 | 3300031711 | Bacteria | 1872 |
| 858 | Ga0265342_10009847 | 3300031712 | Bacteria | 6686 |
| 859 | Ga0265342_10065315 | 3300031712 | Bacteria | 2133 |
| 860 | Ga0307516_10005995 | 3300031730 | Bacteria | 14363 |
| 861 | Ga0307516_10097075 | 3300031730 | Bacteria | 2767 |
| 862 | Ga0307516_10126545 | 3300031730 | Bacteria | 2339 |
| 863 | Ga0307516_10401264 | 3300031730 | Bacteria | 1030 |
| 864 | Ga0307516_10429131 | 3300031730 | Bacteria | 979 |
| 865 | Ga0307413_10468445 | 3300031824 | Bacteria | 1004 |
| 866 | Ga0307410_10623428 | 3300031852 | Bacteria | 902 |
| 867 | Ga0307406_10744456 | 3300031901 | Bacteria | 822 |
| 868 | Ga0307407_11335175 | 3300031903 | Bacteria | 563 |
| 869 | Ga0307412_10379263 | 3300031911 | Bacteria | 1144 |
| 870 | Ga0307409_101524258 | 3300031995 | Bacteria | 696 |
| 871 | Ga0307409_102086504 | 3300031995 | Bacteria | 596 |
| 872 | Ga0307416_100747531 | 3300032002 | Bacteria | 1070 |
| 873 | Ga0307416_100778753 | 3300032002 | Bacteria | 1051 |
| 874 | Ga0307416_101034913 | 3300032002 | Bacteria | 925 |
| 875 | Ga0307415_100233281 | 3300032126 | Bacteria | 1483 |
| 876 | Ga0307415_100825403 | 3300032126 | Bacteria | 848 |
| 877 | Ga0307415_100925050 | 3300032126 | Bacteria | 805 |
| 878 | Ga0307415_100939741 | 3300032126 | Bacteria | 800 |
| 879 | Ga0307507_10329935 | 3300033179 | Bacteria | 912 |
| 880 | Ga0307510_10006305 | 3300033180 | Bacteria | 14151 |
| 881 | Ga0307510_10041581 | 3300033180 | Bacteria | 5022 |
| 882 | Ga0315911_1000003 | 3300033442 | Bacteria | 502217 |
| 883 | Ga0316215_1013218 | 3300033544 | Bacteria | 823 |
| 884 | Ga0373950_0135823 | 3300034818 | Bacteria | 554 |
| 885 | Ga0373926_0044210 | 3300035083 | Bacteria | 1595 |
| 886 | Ga0373934_0031807 | 3300035086 | Bacteria | 2067 |
| 887 | Ga0373934_0035852 | 3300035086 | Bacteria | 1953 |
| 888 | Ga0373934_0299123 | 3300035086 | Bacteria | 667 |
| 889 | Ga0373944_0357454 | 3300035089 | Bacteria | 557 |
| 890 | Ga0373923_0051442 | 3300035111 | Bacteria | 1728 |
| 891 | Ga0373923_0537138 | 3300035111 | Bacteria | 572 |
| 892 | Ga0373936_0157833 | 3300035113 | Bacteria | 987 |
| 893 | Ga0373941_0028234 | 3300035115 | Bacteria | 1646 |
| 894 | Ga0373945_0057394 | 3300035116 | Bacteria | 1446 |
| 895 | Ga0373953_0003406 | 3300035117 | Bacteria | 4946 |
| 896 | Ga0373953_0150420 | 3300035117 | Bacteria | 998 |
| 897 | Ga0373954_0005974 | 3300035118 | Bacteria | 5295 |
| 898 | Ga0373954_0339928 | 3300035118 | Bacteria | 741 |
| 899 | Ga0373956_0056434 | 3300035119 | Bacteria | 1773 |
| 900 | Ga0373957_0020281 | 3300035120 | Bacteria | 2347 |
| 901 | Ga0373957_0022105 | 3300035120 | Bacteria | 2263 |
| 902 | Ga0373957_0168222 | 3300035120 | Bacteria | 905 |
| 903 | Ga0373943_0000795 | 3300035170 | Bacteria | 13844 |
| 904 | Ga0373943_0153691 | 3300035170 | Bacteria | 1248 |
| 905 | Ga0373946_0006225 | 3300035171 | Bacteria | 4322 |
| 906 | Ga0373946_0210640 | 3300035171 | Bacteria | 935 |
| 907 | Ga0373946_0229166 | 3300035171 | Bacteria | 899 |
| 908 | Ga0373946_0310404 | 3300035171 | Bacteria | 782 |
| 909 | Ga0373955_0159501 | 3300035172 | Bacteria | 1330 |
| 910 | Ga0373955_0179618 | 3300035172 | Bacteria | 1255 |
| 911 | Ga0373955_0627919 | 3300035172 | Bacteria | 658 |
| 912 | Ga0373942_0032763 | 3300035207 | Bacteria | 1382 |
| 913 | Ga0373924_0009206 | 3300035410 | Bacteria | 3615 |
| 914 | Ga0373924_0017906 | 3300035410 | Bacteria | 2724 |
| 915 | Ga0373931_0023469 | 3300035691 | Bacteria | 3114 |
| 916 | Ga0373931_0341514 | 3300035691 | Bacteria | 935 |
| 917 | Ga0373931_0467324 | 3300035691 | Bacteria | 809 |
| 918 | Ga0373931_0505071 | 3300035691 | Bacteria | 780 |
| 919 | Ga0373931_0622424 | 3300035691 | Bacteria | 707 |
| 920 | Ga0373935_0000536 | 3300035692 | Bacteria | 19758 |
| 921 | Ga0373935_0130397 | 3300035692 | Bacteria | 1689 |
| 922 | Ga0373935_0368091 | 3300035692 | Bacteria | 1027 |
| 923 | Ga0373927_0000898 | 3300035695 | Bacteria | 22620 |
| 924 | Ga0373927_0039104 | 3300035695 | Bacteria | 3078 |
| 925 | Ga0373927_0083817 | 3300035695 | Bacteria | 2067 |
| 926 | Ga0373927_0110471 | 3300035695 | Bacteria | 1791 |
| 927 | Ga0373933_0001821 | 3300035724 | Bacteria | 12354 |
| 928 | Ga0373933_0382728 | 3300035724 | Bacteria | 916 |
| 929 | Ga0373947_0010479 | 3300035725 | Bacteria | 5318 |
| 930 | Ga0373947_0032481 | 3300035725 | Bacteria | 3076 |
| 931 | Ga0373937_0064227 | 3300036401 | Bacteria | 3377 |
| 932 | Ga0373937_0092525 | 3300036401 | Bacteria | 2803 |
| 933 | Ga0373937_0095987 | 3300036401 | Bacteria | 2749 |
| 934 | Ga0373937_0142169 | 3300036401 | Bacteria | 2245 |
| 935 | Ga0373937_0285918 | 3300036401 | Bacteria | 1558 |
| 936 | Ga0372808_055570 | 3300036459 | Bacteria | 567 |
| 937 | Ga0373925_0001796 | 3300037068 | Bacteria | 17888 |
| 938 | Ga0373925_0038336 | 3300037068 | Bacteria | 3543 |
| 939 | Ga0373925_0168515 | 3300037068 | Bacteria | 1728 |
| 940 | Ga0373925_0339375 | 3300037068 | Bacteria | 1218 |
| 941 | Ga0373925_0368755 | 3300037068 | Bacteria | 1168 |
| 942 | Ga0373925_0941432 | 3300037068 | Unclassified | 712 |
| 943 | Ga0373925_1159596 | 3300037068 | Bacteria | 635 |
| 944 | Ga0395900_0485656 | 3300037418 | Bacteria | 1187 |
| 945 | Ga0395905_0015460 | 3300037471 | Bacteria | 7255 |
| 946 | Ga0395905_0031994 | 3300037471 | Bacteria | 4949 |
| 947 | Ga0395905_0161613 | 3300037471 | Bacteria | 2105 |
| 948 | Ga0436364_0231314 | 3300037853 | Bacteria | 2982 |
| 949 | Ga0436364_0807757 | 3300037853 | Bacteria | 734 |
| 950 | Ga0436364_1142822 | 3300037853 | Bacteria | 1781 |
| 951 | Ga0395901_0137905 | 3300038443 | Bacteria | 2564 |
| 952 | Ga0436365_0312278 | 3300039437 | Bacteria | 749 |
| 953 | Ga0436365_0339172 | 3300039437 | Bacteria | 3745 |
| 954 | Ga0436365_0679534 | 3300039437 | Bacteria | 1226 |
| 955 | Ga0436365_1425854 | 3300039437 | Bacteria | 2723 |
| 956 | Ga0436360_0588427 | 3300039438 | Bacteria | 1472 |
| 957 | Ga0436360_0619192 | 3300039438 | Bacteria | 809 |
| 958 | Ga0436360_0808748 | 3300039438 | Bacteria | 1542 |
| 959 | Ga0436360_0832371 | 3300039438 | Bacteria | 3206 |
| 960 | Ga0436360_0926138 | 3300039438 | Bacteria | 1030 |
| 961 | Ga0436361_0108686 | 3300039447 | Bacteria | 4031 |
| 962 | Ga0436361_0497086 | 3300039447 | Bacteria | 758 |
| 963 | Ga0436361_0518565 | 3300039447 | Bacteria | 1050 |
| 964 | Ga0436361_1222273 | 3300039447 | Bacteria | 2495 |
| 965 | Ga0436363_0142697 | 3300039450 | Bacteria | 666 |
| 966 | Ga0436363_0923145 | 3300039450 | Bacteria | 598 |
| 967 | Ga0436363_1166057 | 3300039450 | Bacteria | 1118 |
| 968 | Ga0436363_1556276 | 3300039450 | Bacteria | 1087 |
| 969 | Ga0436362_0868287 | 3300039453 | Bacteria | 706 |
| 970 | Ga0451787_768313 | 3300041441 | Bacteria | 608 |
| 971 | Ga0451791_1328224 | 3300041451 | Bacteria | 2074 |
| 972 | Ga0451793_0250726 | 3300041452 | Bacteria | 1062 |
| 973 | Ga0451797_0393201 | 3300041453 | Bacteria | 793 |
| 974 | Ga0451795_1029459 | 3300041456 | Bacteria | 1436 |
| 975 | Ga0451798_0974609 | 3300041458 | Bacteria | 630 |
| 976 | Ga0451802_0275182 | 3300041460 | Bacteria | 1388 |
| 977 | Ga0451802_1139949 | 3300041460 | Bacteria | 836 |
| 978 | Ga0451807_1659583 | 3300041486 | Bacteria | 577 |
| 979 | Ga0451847_0789714 | 3300041503 | Bacteria | 861 |
| 980 | Ga0451843_0345131 | 3300041509 | Bacteria | 1395 |
| 981 | Ga0451843_0534612 | 3300041509 | Bacteria | 738 |
| 982 | Ga0439455_0055061 | 3300042012 | Bacteria | 1046 |
| 983 | Ga0466972_0000079 | 3300044658 | Bacteria | 90348 |
| 984 | Ga0466972_0001061 | 3300044658 | Bacteria | 13191 |
| 985 | Ga0466965_0247552 | 3300044683 | Bacteria | 955 |
| 986 | Ga0466965_0323623 | 3300044683 | Bacteria | 840 |
| 987 | Ga0466965_0532943 | 3300044683 | Bacteria | 661 |
| 988 | Ga0466966_0058132 | 3300044684 | Bacteria | 2445 |
| 989 | Ga0466963_0007491 | 3300044694 | Bacteria | 6512 |
| 990 | Ga0466964_0144189 | 3300044706 | Bacteria | 1098 |
| 991 | Ga0466964_0178972 | 3300044706 | Bacteria | 1004 |
| 992 | Ga0466964_0253871 | 3300044706 | Bacteria | 868 |
| 993 | Ga0466968_0010560 | 3300044735 | Bacteria | 3583 |
| 994 | Ga0466968_0193789 | 3300044735 | Bacteria | 949 |
| 995 | Ga0466957_0093861 | 3300044842 | Bacteria | 1884 |
| 996 | Ga0466957_0145307 | 3300044842 | Bacteria | 1530 |
| 997 | Ga0466957_0284174 | 3300044842 | Bacteria | 1108 |
| 998 | Ga0466957_0472257 | 3300044842 | Bacteria | 867 |
| 999 | Ga0466959_0033466 | 3300045049 | Bacteria | 3801 |
| 1000 | Ga0466959_0040060 | 3300045049 | Bacteria | 3462 |
| 1001 | Ga0451576_0002188 | 3300045051 | Bacteria | 30183 |
| 1002 | Ga0451576_0125392 | 3300045051 | Bacteria | 2675 |
| 1003 | Ga0466958_0642977 | 3300045836 | Bacteria | 690 |
| 1004 | Ga0466967_0144470 | 3300045976 | Bacteria | 2218 |
| 1005 | Ga0466967_0202886 | 3300045976 | Bacteria | 1878 |
| 1006 | Ga0466967_0508568 | 3300045976 | Bacteria | 1183 |
| 1007 | Ga0466967_0593849 | 3300045976 | Bacteria | 1092 |
| 1008 | Ga0495617_079919 | 3300046452 | Bacteria | 1071 |
| 1009 | Ga0495592_0011606 | 3300046454 | Bacteria | 6672 |
| 1010 | Ga0495592_0029907 | 3300046454 | Bacteria | 4121 |
| 1011 | Ga0495592_0207253 | 3300046454 | Bacteria | 1319 |
| 1012 | Ga0495592_0580120 | 3300046454 | Bacteria | 686 |
| 1013 | Ga0495603_0000046 | 3300046455 | Bacteria | 53187 |
| 1014 | Ga0495603_0002778 | 3300046455 | Bacteria | 10319 |
| 1015 | Ga0495603_0040136 | 3300046455 | Bacteria | 2802 |
| 1016 | Ga0495603_0280312 | 3300046455 | Bacteria | 958 |
| 1017 | Ga0495590_0175671 | 3300046457 | Bacteria | 782 |
| 1018 | Ga0495629_0000071 | 3300046459 | Bacteria | 88879 |
| 1019 | Ga0495629_0065563 | 3300046459 | Bacteria | 2535 |
| 1020 | Ga0495629_0177624 | 3300046459 | Bacteria | 1476 |
| 1021 | Ga0495629_0274632 | 3300046459 | Bacteria | 1157 |
| 1022 | Ga0495629_0314481 | 3300046459 | Bacteria | 1071 |
| 1023 | Ga0495629_0410884 | 3300046459 | Bacteria | 919 |
| 1024 | Ga0495629_0636485 | 3300046459 | Bacteria | 711 |
| 1025 | Ga0495638_0020090 | 3300046460 | Bacteria | 4414 |
| 1026 | Ga0495638_0054543 | 3300046460 | Bacteria | 2484 |
| 1027 | Ga0495638_0373896 | 3300046460 | Bacteria | 746 |
| 1028 | Ga0495641_0009896 | 3300046461 | Bacteria | 5611 |
| 1029 | Ga0495641_0029184 | 3300046461 | Bacteria | 2659 |
| 1030 | Ga0495651_0029360 | 3300046462 | Bacteria | 4287 |
| 1031 | Ga0495651_0545205 | 3300046462 | Bacteria | 737 |
| 1032 | Ga0495653_0228910 | 3300046463 | Bacteria | 1245 |
| 1033 | Ga0495653_0702077 | 3300046463 | Bacteria | 614 |
| 1034 | Ga0495580_0000057 | 3300046472 | Bacteria | 64650 |
| 1035 | Ga0495580_0043983 | 3300046472 | Bacteria | 3177 |
| 1036 | Ga0495580_0152884 | 3300046472 | Bacteria | 1599 |
| 1037 | Ga0495582_0000111 | 3300046473 | Bacteria | 42751 |
| 1038 | Ga0495582_0082297 | 3300046473 | Bacteria | 1788 |
| 1039 | Ga0495605_0079481 | 3300046474 | Bacteria | 1536 |
| 1040 | Ga0495605_0174422 | 3300046474 | Bacteria | 948 |
| 1041 | Ga0495639_0000108 | 3300046475 | Bacteria | 41656 |
| 1042 | Ga0495639_0214805 | 3300046475 | Bacteria | 944 |
| 1043 | Ga0495639_0275106 | 3300046475 | Bacteria | 836 |
| 1044 | Ga0495662_0000992 | 3300046476 | Bacteria | 13882 |
| 1045 | Ga0495662_0020305 | 3300046476 | Bacteria | 3213 |
| 1046 | Ga0495664_0002718 | 3300046477 | Bacteria | 9505 |
| 1047 | Ga0495664_0030650 | 3300046477 | Bacteria | 3151 |
| 1048 | Ga0495664_0056145 | 3300046477 | Bacteria | 2342 |
| 1049 | Ga0495664_0092363 | 3300046477 | Bacteria | 1820 |
| 1050 | Ga0495664_0122727 | 3300046477 | Bacteria | 1571 |
| 1051 | Ga0495664_0325560 | 3300046477 | Bacteria | 927 |
| 1052 | Ga0495584_0515486 | 3300046491 | Bacteria | 609 |
| 1053 | Ga0495594_0000133 | 3300046499 | Bacteria | 34897 |
| 1054 | Ga0495594_0137260 | 3300046499 | Bacteria | 1386 |
| 1055 | Ga0495594_0573922 | 3300046499 | Bacteria | 640 |
| 1056 | Ga0495596_0105487 | 3300046500 | Bacteria | 1094 |
| 1057 | Ga0495596_0186849 | 3300046500 | Bacteria | 806 |
| 1058 | Ga0495607_0152369 | 3300046501 | Bacteria | 1182 |
| 1059 | Ga0495607_0210154 | 3300046501 | Bacteria | 958 |
| 1060 | Ga0495606_0006998 | 3300046507 | Bacteria | 10238 |
| 1061 | Ga0495606_0066480 | 3300046507 | Bacteria | 2286 |
| 1062 | Ga0495606_0081284 | 3300046507 | Bacteria | 2015 |
| 1063 | Ga0495606_0082074 | 3300046507 | Bacteria | 2003 |
| 1064 | Ga0495606_0341486 | 3300046507 | Bacteria | 797 |
| 1065 | Ga0495608_0112357 | 3300046511 | Bacteria | 1751 |
| 1066 | Ga0495608_0129691 | 3300046511 | Bacteria | 1614 |
| 1067 | Ga0495608_0642976 | 3300046511 | Bacteria | 634 |
| 1068 | Ga0495610_0285565 | 3300046512 | Bacteria | 641 |
| 1069 | Ga0495610_0300481 | 3300046512 | Bacteria | 619 |
| 1070 | Ga0495616_0260402 | 3300046513 | Bacteria | 742 |
| 1071 | Ga0495616_0272750 | 3300046513 | Bacteria | 721 |
| 1072 | Ga0495616_0320530 | 3300046513 | Bacteria | 651 |
| 1073 | Ga0495618_0064992 | 3300046514 | Bacteria | 2318 |
| 1074 | Ga0495620_0293822 | 3300046515 | Bacteria | 618 |
| 1075 | Ga0495628_0012530 | 3300046516 | Bacteria | 7144 |
| 1076 | Ga0495628_0074053 | 3300046516 | Bacteria | 2653 |
| 1077 | Ga0495628_0121239 | 3300046516 | Bacteria | 2005 |
| 1078 | Ga0495628_0162259 | 3300046516 | Unclassified | 1698 |
| 1079 | Ga0495628_0307226 | 3300046516 | Bacteria | 1173 |
| 1080 | Ga0495630_0000959 | 3300046517 | Bacteria | 20201 |
| 1081 | Ga0495630_0019164 | 3300046517 | Bacteria | 5028 |
| 1082 | Ga0495630_0077623 | 3300046517 | Bacteria | 2504 |
| 1083 | Ga0495632_0085482 | 3300046519 | Bacteria | 1501 |
| 1084 | Ga0495637_0090080 | 3300046520 | Bacteria | 1211 |
| 1085 | Ga0495637_0140225 | 3300046520 | Bacteria | 918 |
| 1086 | Ga0495643_0005954 | 3300046522 | Bacteria | 8136 |
| 1087 | Ga0495643_0049068 | 3300046522 | Bacteria | 2278 |
| 1088 | Ga0495643_0138335 | 3300046522 | Bacteria | 1216 |
| 1089 | Ga0495643_0302495 | 3300046522 | Bacteria | 728 |
| 1090 | Ga0495644_0037867 | 3300046523 | Bacteria | 1820 |
| 1091 | Ga0495644_0079264 | 3300046523 | Bacteria | 1237 |
| 1092 | Ga0495644_0133893 | 3300046523 | Bacteria | 945 |
| 1093 | Ga0495648_0014927 | 3300046524 | Bacteria | 5658 |
| 1094 | Ga0495648_0023584 | 3300046524 | Bacteria | 4209 |
| 1095 | Ga0495648_0037099 | 3300046524 | Bacteria | 3136 |
| 1096 | Ga0495648_0041864 | 3300046524 | Bacteria | 2888 |
| 1097 | Ga0495648_0082027 | 3300046524 | Bacteria | 1832 |
| 1098 | Ga0495648_0156846 | 3300046524 | Bacteria | 1181 |
| 1099 | Ga0495648_0222277 | 3300046524 | Bacteria | 930 |
| 1100 | Ga0495648_0308876 | 3300046524 | Bacteria | 738 |
| 1101 | Ga0495642_0118884 | 3300046528 | Bacteria | 1133 |
| 1102 | Ga0495642_0183959 | 3300046528 | Bacteria | 910 |
| 1103 | Ga0495652_0042099 | 3300046529 | Bacteria | 3939 |
| 1104 | Ga0495652_0155483 | 3300046529 | Bacteria | 1781 |
| 1105 | Ga0495652_0220458 | 3300046529 | Bacteria | 1426 |
| 1106 | Ga0495652_0440217 | 3300046529 | Bacteria | 914 |
| 1107 | Ga0495652_0444358 | 3300046529 | Bacteria | 909 |
| 1108 | Ga0495652_0535283 | 3300046529 | Bacteria | 807 |
| 1109 | Ga0495652_0721299 | 3300046529 | Bacteria | 669 |
| 1110 | Ga0495654_0138148 | 3300046530 | Bacteria | 1088 |
| 1111 | Ga0495654_0235796 | 3300046530 | Bacteria | 768 |
| 1112 | Ga0495665_0000001 | 3300046531 | Bacteria | 156121 |
| 1113 | Ga0495665_0049613 | 3300046531 | Bacteria | 2225 |
| 1114 | Ga0495640_0007124 | 3300046533 | Bacteria | 8801 |
| 1115 | Ga0495640_0012179 | 3300046533 | Bacteria | 6583 |
| 1116 | Ga0495640_0023983 | 3300046533 | Bacteria | 4438 |
| 1117 | Ga0495640_0028223 | 3300046533 | Bacteria | 4042 |
| 1118 | Ga0495640_0085615 | 3300046533 | Bacteria | 2088 |
| 1119 | Ga0495586_0078473 | 3300046535 | Bacteria | 1812 |
| 1120 | Ga0495587_0014340 | 3300046536 | Bacteria | 4974 |
| 1121 | Ga0495587_0066633 | 3300046536 | Bacteria | 2100 |
| 1122 | Ga0495587_0209922 | 3300046536 | Bacteria | 1100 |
| 1123 | Ga0495598_0024640 | 3300046537 | Bacteria | 1633 |
| 1124 | Ga0495598_0065662 | 3300046537 | Bacteria | 1130 |
| 1125 | Ga0495609_0147695 | 3300046538 | Bacteria | 1001 |
| 1126 | Ga0495597_0210216 | 3300046542 | Bacteria | 776 |
| 1127 | Ga0495597_0226892 | 3300046542 | Bacteria | 740 |
| 1128 | Ga0495597_0278015 | 3300046542 | Bacteria | 653 |
| 1129 | Ga0495645_0007155 | 3300046543 | Bacteria | 7768 |
| 1130 | Ga0495645_0065908 | 3300046543 | Bacteria | 2620 |
| 1131 | Ga0495645_0159553 | 3300046543 | Bacteria | 1560 |
| 1132 | Ga0495645_0202750 | 3300046543 | Bacteria | 1344 |
| 1133 | Ga0495645_0417019 | 3300046543 | Bacteria | 853 |
| 1134 | Ga0495622_0001363 | 3300046557 | Bacteria | 12492 |
| 1135 | Ga0495622_0008156 | 3300046557 | Bacteria | 4853 |
| 1136 | Ga0495622_0039374 | 3300046557 | Bacteria | 2201 |
| 1137 | Ga0495622_0052657 | 3300046557 | Bacteria | 1888 |
| 1138 | Ga0495667_0006892 | 3300046559 | Bacteria | 7715 |
| 1139 | Ga0495667_0193047 | 3300046559 | Bacteria | 1304 |
| 1140 | Ga0495667_0210400 | 3300046559 | Bacteria | 1243 |
| 1141 | Ga0495668_0082096 | 3300046616 | Bacteria | 1768 |
| 1142 | Ga0495668_0221511 | 3300046616 | Bacteria | 1036 |
| 1143 | Ga0495668_0236868 | 3300046616 | Bacteria | 999 |
| 1144 | Ga0495668_0282928 | 3300046616 | Bacteria | 909 |
| 1145 | Ga0495668_0361799 | 3300046616 | Bacteria | 797 |
| 1146 | Ga0495634_0000046 | 3300046642 | Bacteria | 97947 |
| 1147 | Ga0495611_0037207 | 3300046648 | Bacteria | 2162 |
| 1148 | Ga0495625_0027298 | 3300046660 | Bacteria | 4300 |
| 1149 | Ga0495625_0116759 | 3300046660 | Bacteria | 1820 |
| 1150 | Ga0495625_0168223 | 3300046660 | Bacteria | 1465 |
| 1151 | Ga0495625_0176247 | 3300046660 | Bacteria | 1424 |
| 1152 | Ga0495625_0228992 | 3300046660 | Bacteria | 1214 |
| 1153 | Ga0495625_0356125 | 3300046660 | Bacteria | 924 |
| 1154 | Ga0495625_0526855 | 3300046660 | Bacteria | 719 |
| 1155 | Ga0495625_0655899 | 3300046660 | Bacteria | 624 |
| 1156 | Ga0495635_0000338 | 3300046663 | Bacteria | 29955 |
| 1157 | Ga0495635_0051638 | 3300046663 | Bacteria | 2832 |
| 1158 | Ga0495635_0307369 | 3300046663 | Bacteria | 1062 |
| 1159 | Ga0495635_0407123 | 3300046663 | Bacteria | 903 |
| 1160 | Ga0495635_0438523 | 3300046663 | Bacteria | 864 |
| 1161 | Ga0495659_0009434 | 3300046664 | Bacteria | 3114 |
| 1162 | Ga0495661_0254082 | 3300046665 | Bacteria | 896 |
| 1163 | Ga0495588_0001464 | 3300046674 | Bacteria | 10138 |
| 1164 | Ga0495588_0011004 | 3300046674 | Bacteria | 4233 |
| 1165 | Ga0495588_0112702 | 3300046674 | Bacteria | 1433 |
| 1166 | Ga0495657_0019556 | 3300046675 | Bacteria | 4884 |
| 1167 | Ga0495657_0054792 | 3300046675 | Bacteria | 2662 |
| 1168 | Ga0495599_0021343 | 3300046678 | Bacteria | 4039 |
| 1169 | Ga0495599_0085667 | 3300046678 | Bacteria | 1968 |
| 1170 | Ga0495623_0032327 | 3300046679 | Bacteria | 3363 |
| 1171 | Ga0495623_0108103 | 3300046679 | Bacteria | 1688 |
| 1172 | Ga0495623_0157199 | 3300046679 | Bacteria | 1339 |
| 1173 | Ga0495623_0224266 | 3300046679 | Bacteria | 1069 |
| 1174 | Ga0495646_0008580 | 3300046680 | Bacteria | 6490 |
| 1175 | Ga0495646_0010341 | 3300046680 | Bacteria | 5934 |
| 1176 | Ga0495646_0055725 | 3300046680 | Bacteria | 2372 |
| 1177 | Ga0495647_0000754 | 3300046681 | Bacteria | 9612 |
| 1178 | Ga0495658_0000994 | 3300046683 | Bacteria | 14995 |
| 1179 | Ga0495658_0074262 | 3300046683 | Bacteria | 1981 |
| 1180 | Ga0495658_0145919 | 3300046683 | Bacteria | 1450 |
| 1181 | Ga0495658_0485641 | 3300046683 | Bacteria | 790 |
| 1182 | Ga0495669_0001990 | 3300046684 | Bacteria | 8393 |
| 1183 | Ga0495669_0227003 | 3300046684 | Bacteria | 895 |
| 1184 | Ga0495669_0233449 | 3300046684 | Bacteria | 883 |
| 1185 | Ga0495669_0337156 | 3300046684 | Bacteria | 728 |
| 1186 | Ga0495613_0005517 | 3300046689 | Bacteria | 9500 |
| 1187 | Ga0495613_0086480 | 3300046689 | Bacteria | 2273 |
| 1188 | Ga0495613_0103256 | 3300046689 | Bacteria | 2058 |
| 1189 | Ga0495613_0162469 | 3300046689 | Bacteria | 1588 |
| 1190 | Ga0495624_0003652 | 3300046690 | Bacteria | 11380 |
| 1191 | Ga0495624_0082595 | 3300046690 | Bacteria | 1988 |
| 1192 | Ga0495624_0092157 | 3300046690 | Bacteria | 1869 |
| 1193 | Ga0495624_0230376 | 3300046690 | Bacteria | 1122 |
| 1194 | Ga0495624_0468409 | 3300046690 | Bacteria | 755 |
| 1195 | Ga0495670_0008405 | 3300046691 | Bacteria | 5075 |
| 1196 | Ga0495670_0161747 | 3300046691 | Bacteria | 1176 |
| 1197 | Ga0495671_0159475 | 3300046692 | Bacteria | 1097 |
| 1198 | Ga0495671_0234698 | 3300046692 | Bacteria | 887 |
| 1199 | Ga0495671_0239628 | 3300046692 | Bacteria | 876 |
| 1200 | Ga0495649_0277609 | 3300046694 | Bacteria | 856 |
| 1201 | Ga0495649_0315524 | 3300046694 | Bacteria | 794 |
| 1202 | Ga0495649_0333935 | 3300046694 | Bacteria | 768 |
| 1203 | Ga0495589_0112277 | 3300046794 | Bacteria | 1315 |
| 1204 | Ga0495600_0091391 | 3300046809 | Bacteria | 1985 |
| 1205 | Ga0495600_0247155 | 3300046809 | Bacteria | 1135 |
| 1206 | Ga0495600_0320588 | 3300046809 | Bacteria | 975 |
| 1207 | Ga0495660_0054850 | 3300046810 | Bacteria | 2159 |
| 1208 | Ga0495660_0206592 | 3300046810 | Bacteria | 934 |
| 1209 | Ga0495581_0000012 | 3300047315 | Bacteria | 62886 |
| 1210 | Ga0495581_0080479 | 3300047315 | Bacteria | 1886 |
| 1211 | Ga0495581_0161447 | 3300047315 | Bacteria | 1310 |
| 1212 | Ga0495581_0250556 | 3300047315 | Bacteria | 1036 |
| 1213 | Ga0495581_0299586 | 3300047315 | Bacteria | 940 |
| 1214 | Ga0495581_0544918 | 3300047315 | Bacteria | 673 |
| 1215 | Ga0495604_0004988 | 3300047317 | Bacteria | 10511 |
| 1216 | Ga0495604_0071062 | 3300047317 | Bacteria | 2634 |
| 1217 | Ga0495604_0192614 | 3300047317 | Bacteria | 1420 |
| 1218 | Ga0495604_0208007 | 3300047317 | Bacteria | 1353 |
| 1219 | Ga0495604_0484019 | 3300047317 | Bacteria | 804 |
| 1220 | Ga0495604_0910490 | 3300047317 | Bacteria | 549 |
| 1221 | Ga0495674_0000031 | 3300047319 | Bacteria | 115867 |
| 1222 | Ga0495674_0042923 | 3300047319 | Bacteria | 4029 |
| 1223 | Ga0495674_0049361 | 3300047319 | Bacteria | 3719 |
| 1224 | Ga0495674_0203809 | 3300047319 | Bacteria | 1640 |
| 1225 | Ga0495674_0204370 | 3300047319 | Bacteria | 1638 |
| 1226 | Ga0495674_0213934 | 3300047319 | Bacteria | 1596 |
| 1227 | Ga0495674_0749626 | 3300047319 | Bacteria | 763 |
| 1228 | Ga0495674_0771308 | 3300047319 | Bacteria | 750 |
| 1229 | Ga0495672_0060458 | 3300047320 | Bacteria | 2188 |
| 1230 | Ga0495672_0078591 | 3300047320 | Bacteria | 1845 |
| 1231 | Ga0495672_0104425 | 3300047320 | Bacteria | 1531 |
| 1232 | Ga0495676_0076470 | 3300047321 | Bacteria | 2556 |
| 1233 | Ga0495676_0399032 | 3300047321 | Bacteria | 913 |
| 1234 | Ga0495676_0447583 | 3300047321 | Bacteria | 852 |
| 1235 | Ga0495676_0783887 | 3300047321 | Unclassified | 614 |
| 1236 | Ga0495680_0025139 | 3300047322 | Bacteria | 4933 |
| 1237 | Ga0495680_0110891 | 3300047322 | Bacteria | 2033 |
| 1238 | Ga0495680_0193852 | 3300047322 | Bacteria | 1461 |
| 1239 | Ga0495680_0359808 | 3300047322 | Bacteria | 1012 |
| 1240 | Ga0495680_0521323 | 3300047322 | Bacteria | 804 |
| 1241 | Ga0495683_0083558 | 3300047323 | Bacteria | 1555 |
| 1242 | Ga0495683_0140443 | 3300047323 | Bacteria | 1132 |
| 1243 | Ga0495683_0246511 | 3300047323 | Bacteria | 786 |
| 1244 | Ga0495687_014302 | 3300047443 | Bacteria | 4091 |
| 1245 | Ga0495675_0027294 | 3300047444 | Bacteria | 3638 |
| 1246 | Ga0495675_0132509 | 3300047444 | Bacteria | 1548 |
| 1247 | Ga0495675_0187240 | 3300047444 | Bacteria | 1265 |
| 1248 | Ga0495675_0325266 | 3300047444 | Bacteria | 909 |
| 1249 | Ga0495677_0015930 | 3300047445 | Bacteria | 2729 |
| 1250 | Ga0495677_0046237 | 3300047445 | Bacteria | 1598 |
| 1251 | Ga0495679_022313 | 3300047446 | Bacteria | 2169 |
| 1252 | Ga0495685_143639 | 3300047447 | Bacteria | 777 |
| 1253 | Ga0495685_174451 | 3300047447 | Bacteria | 694 |
| 1254 | Ga0495673_0079869 | 3300047469 | Bacteria | 1357 |
| 1255 | Ga0495673_0121034 | 3300047469 | Bacteria | 1037 |
| 1256 | Ga0495673_0153952 | 3300047469 | Bacteria | 887 |
| 1257 | Ga0495684_0005641 | 3300047471 | Bacteria | 9751 |
| 1258 | Ga0495684_0203441 | 3300047471 | Bacteria | 1459 |
| 1259 | Ga0495684_0230085 | 3300047471 | Bacteria | 1356 |
| 1260 | Ga0495686_0042652 | 3300047472 | Bacteria | 2882 |
| 1261 | Ga0495686_0057595 | 3300047472 | Bacteria | 2425 |
| 1262 | Ga0495686_0210423 | 3300047472 | Bacteria | 1111 |
| 1263 | Ga0495686_0289914 | 3300047472 | Bacteria | 907 |
| 1264 | Ga0495686_0301996 | 3300047472 | Bacteria | 883 |
| 1265 | Ga0495686_0372181 | 3300047472 | Bacteria | 772 |
| 1266 | Ga0495593_0000008 | 3300047673 | Bacteria | 87310 |
| 1267 | Ga0495593_0316927 | 3300047673 | Bacteria | 780 |
| 1268 | Ga0495602_0011752 | 3300048088 | Bacteria | 9041 |
| 1269 | Ga0495602_0064657 | 3300048088 | Bacteria | 3161 |
| 1270 | Ga0495602_0138088 | 3300048088 | Bacteria | 1933 |
| 1271 | Ga0495615_0018473 | 3300048090 | Bacteria | 1535 |
| 1272 | Ga0495615_0034571 | 3300048090 | Bacteria | 1231 |
| 1273 | Ga0495615_0217610 | 3300048090 | Bacteria | 595 |
| 1274 | Ga0495626_0096064 | 3300048091 | Bacteria | 1297 |
| 1275 | Ga0496100_0038138 | 3300048903 | Bacteria | 3043 |
| 1276 | Ga0496100_0057335 | 3300048903 | Bacteria | 2551 |
| 1277 | Ga0496100_0081519 | 3300048903 | Bacteria | 2186 |
| 1278 | Ga0496100_0213578 | 3300048903 | Bacteria | 1412 |
| 1279 | Ga0496100_0591946 | 3300048903 | Bacteria | 861 |
| 1280 | Ga0496101_0006365 | 3300048904 | Bacteria | 7599 |
| 1281 | Ga0496101_0033698 | 3300048904 | Bacteria | 3614 |
| 1282 | Ga0496101_0147253 | 3300048904 | Bacteria | 1799 |
| 1283 | Ga0496101_0235397 | 3300048904 | Bacteria | 1424 |
| 1284 | Ga0496101_0480347 | 3300048904 | Bacteria | 981 |
| 1285 | Ga0496101_0590532 | 3300048904 | Bacteria | 878 |
| 1286 | Ga0496101_1089009 | 3300048904 | Bacteria | 627 |
| 1287 | Ga0496102_0003595 | 3300048905 | Bacteria | 13132 |
| 1288 | Ga0496102_0067964 | 3300048905 | Bacteria | 3269 |
| 1289 | Ga0496102_0100826 | 3300048905 | Bacteria | 2682 |
| 1290 | Ga0496102_0326950 | 3300048905 | Bacteria | 1444 |
| 1291 | Ga0496102_0332893 | 3300048905 | Bacteria | 1430 |
| 1292 | Ga0496102_0402410 | 3300048905 | Bacteria | 1287 |
| 1293 | Ga0496102_0537843 | 3300048905 | Bacteria | 1091 |
| 1294 | Ga0496102_0680337 | 3300048905 | Bacteria | 952 |
| 1295 | Ga0496102_0735010 | 3300048905 | Unclassified | 910 |
| 1296 | Ga0496102_0817436 | 3300048905 | Bacteria | 854 |
| 1297 | Ga0496102_0910493 | 3300048905 | Bacteria | 801 |
| 1298 | Ga0496103_0013766 | 3300048906 | Bacteria | 4802 |
| 1299 | Ga0496103_0086099 | 3300048906 | Bacteria | 1981 |
| 1300 | Ga0496103_0183494 | 3300048906 | Bacteria | 1345 |
| 1301 | Ga0496103_0205021 | 3300048906 | Bacteria | 1268 |
| 1302 | Ga0496103_0317532 | 3300048906 | Bacteria | 1002 |
| 1303 | Ga0496104_0010574 | 3300048907 | Bacteria | 8242 |
| 1304 | Ga0496104_0056792 | 3300048907 | Bacteria | 3703 |
| 1305 | Ga0496104_0080908 | 3300048907 | Bacteria | 3097 |
| 1306 | Ga0496104_0346005 | 3300048907 | Bacteria | 1399 |
| 1307 | Ga0496104_1267733 | 3300048907 | Bacteria | 640 |
| 1308 | Ga0496105_0051555 | 3300048908 | Bacteria | 3399 |
| 1309 | Ga0496105_0183729 | 3300048908 | Bacteria | 1711 |
| 1310 | Ga0496105_0368735 | 3300048908 | Bacteria | 1144 |
| 1311 | Ga0496106_0001857 | 3300048909 | Bacteria | 15809 |
| 1312 | Ga0496106_0029456 | 3300048909 | Bacteria | 4091 |
| 1313 | Ga0496106_0031714 | 3300048909 | Bacteria | 3938 |
| 1314 | Ga0496106_0048244 | 3300048909 | Bacteria | 3207 |
| 1315 | Ga0496106_0098072 | 3300048909 | Bacteria | 2270 |
| 1316 | Ga0496106_0146926 | 3300048909 | Bacteria | 1858 |
| 1317 | Ga0496106_0200627 | 3300048909 | Bacteria | 1587 |
| 1318 | Ga0496106_0414878 | 3300048909 | Bacteria | 1082 |
| 1319 | Ga0496107_0000947 | 3300048910 | Bacteria | 17177 |
| 1320 | Ga0496107_0104673 | 3300048910 | Bacteria | 2077 |
| 1321 | Ga0496107_0173695 | 3300048910 | Bacteria | 1599 |
| 1322 | Ga0496107_0381294 | 3300048910 | Bacteria | 1049 |
| 1323 | Ga0496107_0410120 | 3300048910 | Bacteria | 1008 |
| 1324 | Ga0496107_0462102 | 3300048910 | Bacteria | 942 |
| 1325 | Ga0496107_0546490 | 3300048910 | Bacteria | 858 |
| 1326 | Ga0496108_0013705 | 3300048911 | Bacteria | 6616 |
| 1327 | Ga0496108_0028679 | 3300048911 | Bacteria | 4606 |
| 1328 | Ga0496108_0053689 | 3300048911 | Bacteria | 3380 |
| 1329 | Ga0496108_0136699 | 3300048911 | Bacteria | 2109 |
| 1330 | Ga0496109_0008951 | 3300048912 | Bacteria | 8527 |
| 1331 | Ga0496109_0048452 | 3300048912 | Bacteria | 3866 |
| 1332 | Ga0496109_0220090 | 3300048912 | Bacteria | 1785 |
| 1333 | Ga0496109_0312979 | 3300048912 | Bacteria | 1481 |
| 1334 | Ga0496109_0506901 | 3300048912 | Bacteria | 1139 |
| 1335 | Ga0496109_0559210 | 3300048912 | Bacteria | 1079 |
| 1336 | Ga0496109_1195045 | 3300048912 | Bacteria | 697 |
| 1337 | Ga0496109_1199216 | 3300048912 | Bacteria | 696 |
| 1338 | Ga0496110_0047060 | 3300048913 | Bacteria | 3775 |
| 1339 | Ga0496110_0062445 | 3300048913 | Bacteria | 3290 |
| 1340 | Ga0496110_0132945 | 3300048913 | Bacteria | 2247 |
| 1341 | Ga0496110_0161087 | 3300048913 | Bacteria | 2034 |
| 1342 | Ga0496110_0164218 | 3300048913 | Bacteria | 2013 |
| 1343 | Ga0496110_0498068 | 3300048913 | Bacteria | 1109 |
| 1344 | Ga0496110_1226028 | 3300048913 | Bacteria | 659 |
| 1345 | Ga0496111_0028576 | 3300048914 | Bacteria | 3953 |
| 1346 | Ga0496111_0039323 | 3300048914 | Bacteria | 3391 |
| 1347 | Ga0496111_0107836 | 3300048914 | Bacteria | 2051 |
| 1348 | Ga0496111_0423490 | 3300048914 | Bacteria | 983 |
| 1349 | Ga0496111_0602203 | 3300048914 | Bacteria | 804 |
| 1350 | Ga0496111_0771113 | 3300048914 | Bacteria | 697 |
| 1351 | Ga0496111_0993871 | 3300048914 | Bacteria | 601 |
| 1352 | Ga0496112_0000008 | 3300048915 | Bacteria | 310323 |
| 1353 | Ga0496112_0012760 | 3300048915 | Bacteria | 7731 |
| 1354 | Ga0496112_0110694 | 3300048915 | Bacteria | 2716 |
| 1355 | Ga0496112_0176405 | 3300048915 | Bacteria | 2102 |
| 1356 | Ga0496112_0336783 | 3300048915 | Bacteria | 1452 |
| 1357 | Ga0496112_0338342 | 3300048915 | Bacteria | 1448 |
| 1358 | Ga0496112_0471865 | 3300048915 | Bacteria | 1192 |
| 1359 | Ga0496112_0594801 | 3300048915 | Bacteria | 1038 |
| 1360 | Ga0496113_0001327 | 3300048916 | Bacteria | 13676 |
| 1361 | Ga0496113_0038477 | 3300048916 | Bacteria | 3517 |
| 1362 | Ga0496113_0039228 | 3300048916 | Bacteria | 3485 |
| 1363 | Ga0496113_0060669 | 3300048916 | Bacteria | 2852 |
| 1364 | Ga0496113_0111008 | 3300048916 | Bacteria | 2134 |
| 1365 | Ga0496113_0153794 | 3300048916 | Bacteria | 1816 |
| 1366 | Ga0496114_0021716 | 3300048917 | Bacteria | 5225 |
| 1367 | Ga0496114_0024353 | 3300048917 | Bacteria | 4940 |
| 1368 | Ga0496114_0376999 | 3300048917 | Bacteria | 1256 |
| 1369 | Ga0496114_0633259 | 3300048917 | Bacteria | 942 |
| 1370 | Ga0496114_0712511 | 3300048917 | Bacteria | 879 |
| 1371 | Ga0496114_0818246 | 3300048917 | Bacteria | 811 |
| 1372 | Ga0496115_0000604 | 3300048918 | Bacteria | 27391 |
| 1373 | Ga0496115_0033862 | 3300048918 | Bacteria | 4036 |
| 1374 | Ga0496115_0058271 | 3300048918 | Bacteria | 3108 |
| 1375 | Ga0496115_0065715 | 3300048918 | Bacteria | 2930 |
| 1376 | Ga0496115_0071313 | 3300048918 | Bacteria | 2818 |
| 1377 | Ga0496115_0144469 | 3300048918 | Bacteria | 1963 |
| 1378 | Ga0496115_0278603 | 3300048918 | Bacteria | 1373 |
| 1379 | Ga0496115_0769491 | 3300048918 | Bacteria | 751 |
| 1380 | Ga0496115_0818251 | 3300048918 | Unclassified | 724 |
| 1381 | Ga0496116_0088080 | 3300048919 | Bacteria | 1898 |
| 1382 | Ga0496116_0274032 | 3300048919 | Bacteria | 822 |
| 1383 | Ga0496117_0010071 | 3300048920 | Bacteria | 8683 |
| 1384 | Ga0496117_0093571 | 3300048920 | Bacteria | 1927 |
| 1385 | Ga0496117_0241697 | 3300048920 | Bacteria | 991 |
| 1386 | Ga0496117_0273014 | 3300048920 | Bacteria | 910 |
| 1387 | Ga0496117_0445527 | 3300048920 | Bacteria | 641 |
| 1388 | Ga0496117_0497679 | 3300048920 | Bacteria | 592 |
| 1389 | Ga0496118_0008611 | 3300048921 | Bacteria | 10500 |
| 1390 | Ga0496118_0033891 | 3300048921 | Bacteria | 4179 |
| 1391 | Ga0496118_0095578 | 3300048921 | Bacteria | 2028 |
| 1392 | Ga0496118_0153750 | 3300048921 | Bacteria | 1435 |
| 1393 | Ga0496118_0161367 | 3300048921 | Bacteria | 1386 |
| 1394 | Ga0496118_0193568 | 3300048921 | Bacteria | 1213 |
| 1395 | Ga0496119_0006875 | 3300048922 | Bacteria | 10389 |
| 1396 | Ga0496119_0093315 | 3300048922 | Bacteria | 1705 |
| 1397 | Ga0496119_0117249 | 3300048922 | Bacteria | 1468 |
| 1398 | Ga0496119_0222562 | 3300048922 | Bacteria | 965 |
| 1399 | Ga0496119_0422530 | 3300048922 | Bacteria | 632 |
| 1400 | Ga0496120_0014529 | 3300048923 | Bacteria | 5244 |
| 1401 | Ga0496120_0070618 | 3300048923 | Bacteria | 1920 |
| 1402 | Ga0496121_0002635 | 3300048924 | Bacteria | 27038 |
| 1403 | Ga0496121_0010213 | 3300048924 | Bacteria | 10625 |
| 1404 | Ga0496121_0017920 | 3300048924 | Bacteria | 7184 |
| 1405 | Ga0496121_0020183 | 3300048924 | Bacteria | 6613 |
| 1406 | Ga0496121_0022241 | 3300048924 | Bacteria | 6166 |
| 1407 | Ga0496121_0037977 | 3300048924 | Bacteria | 4271 |
| 1408 | Ga0496121_0062307 | 3300048924 | Bacteria | 3056 |
| 1409 | Ga0496121_0071091 | 3300048924 | Bacteria | 2800 |
| 1410 | Ga0496121_0115405 | 3300048924 | Bacteria | 2039 |
| 1411 | Ga0496121_0126057 | 3300048924 | Bacteria | 1924 |
| 1412 | Ga0496121_0195694 | 3300048924 | Bacteria | 1445 |
| 1413 | Ga0496121_0224795 | 3300048924 | Bacteria | 1319 |
| 1414 | Ga0496121_0237789 | 3300048924 | Bacteria | 1271 |
| 1415 | Ga0496121_0263104 | 3300048924 | Bacteria | 1190 |
| 1416 | Ga0496121_0348525 | 3300048924 | Bacteria | 987 |
| 1417 | Ga0496121_0651957 | 3300048924 | Bacteria | 641 |
| 1418 | Ga0496121_0801137 | 3300048924 | Bacteria | 554 |
| 1419 | Ga0496122_0018275 | 3300048925 | Bacteria | 6489 |
| 1420 | Ga0496122_0049838 | 3300048925 | Bacteria | 3200 |
| 1421 | Ga0496122_0282027 | 3300048925 | Bacteria | 907 |
| 1422 | Ga0496123_0022282 | 3300048926 | Bacteria | 4888 |
| 1423 | Ga0496123_0335761 | 3300048926 | Bacteria | 708 |
| 1424 | Ga0496124_0011581 | 3300048927 | Bacteria | 8801 |
| 1425 | Ga0496124_0137659 | 3300048927 | Bacteria | 1931 |
| 1426 | Ga0496124_0263152 | 3300048927 | Bacteria | 1268 |
| 1427 | Ga0496124_0346105 | 3300048927 | Bacteria | 1053 |
| 1428 | Ga0496124_0830069 | 3300048927 | Bacteria | 569 |
| 1429 | Ga0496125_0000048 | 3300048928 | Bacteria | 290651 |
| 1430 | Ga0496125_0000746 | 3300048928 | Bacteria | 53671 |
| 1431 | Ga0496125_0004827 | 3300048928 | Bacteria | 15320 |
| 1432 | Ga0496125_0071057 | 3300048928 | Bacteria | 2721 |
| 1433 | Ga0496125_0076359 | 3300048928 | Bacteria | 2587 |
| 1434 | Ga0496125_0131030 | 3300048928 | Bacteria | 1765 |
| 1435 | Ga0496125_0219108 | 3300048928 | Bacteria | 1228 |
| 1436 | Ga0496126_0002122 | 3300048929 | Bacteria | 27701 |
| 1437 | Ga0496126_0008677 | 3300048929 | Bacteria | 10918 |
| 1438 | Ga0496126_0009242 | 3300048929 | Bacteria | 10508 |
| 1439 | Ga0496126_0038000 | 3300048929 | Bacteria | 4482 |
| 1440 | Ga0496126_0066191 | 3300048929 | Bacteria | 3231 |
| 1441 | Ga0496126_0073717 | 3300048929 | Bacteria | 3034 |
| 1442 | Ga0496126_0108022 | 3300048929 | Bacteria | 2426 |
| 1443 | Ga0496126_0117860 | 3300048929 | Bacteria | 2306 |
| 1444 | Ga0496126_0118073 | 3300048929 | Bacteria | 2303 |
| 1445 | Ga0496126_0157082 | 3300048929 | Bacteria | 1946 |
| 1446 | Ga0496126_0173025 | 3300048929 | Bacteria | 1838 |
| 1447 | Ga0496126_0204271 | 3300048929 | Bacteria | 1666 |
| 1448 | Ga0496126_0235255 | 3300048929 | Bacteria | 1533 |
| 1449 | Ga0496126_0244448 | 3300048929 | Bacteria | 1498 |
| 1450 | Ga0496126_0250513 | 3300048929 | Bacteria | 1476 |
| 1451 | Ga0496126_0301634 | 3300048929 | Bacteria | 1321 |
| 1452 | Ga0496126_0422747 | 3300048929 | Bacteria | 1077 |
| 1453 | Ga0496126_0423249 | 3300048929 | Bacteria | 1076 |
| 1454 | Ga0496126_0683564 | 3300048929 | Bacteria | 799 |
| 1455 | Ga0496126_0698614 | 3300048929 | Bacteria | 788 |
| 1456 | Ga0496126_0888035 | 3300048929 | Bacteria | 677 |
| 1457 | Ga0496126_1010822 | 3300048929 | Bacteria | 623 |
| 1458 | Ga0495682_0018342 | 3300049460 | Bacteria | 2636 |
| 1459 | Ga0501036_0114702 | 3300049572 | Bacteria | 2277 |
| 1460 | Ga0501040_0089179 | 3300049576 | Bacteria | 2143 |
| 1461 | Ga0501041_0432056 | 3300049577 | Bacteria | 835 |
| 1462 | Ga0501047_0699862 | 3300049581 | Bacteria | 831 |
| 1463 | Ga0501067_0099416 | 3300049583 | Bacteria | 1616 |
| 1464 | Ga0501067_0174653 | 3300049583 | Bacteria | 1197 |
| 1465 | Ga0501067_0282238 | 3300049583 | Bacteria | 925 |
| 1466 | Ga0501073_0465433 | 3300049589 | Bacteria | 874 |
| 1467 | Ga0501074_0083579 | 3300049590 | Bacteria | 2289 |
| 1468 | Ga0501080_0760834 | 3300049742 | Bacteria | 851 |
| 1469 | Ga0501241_071706 | 3300049758 | Bacteria | 709 |
| 1470 | Ga0501044_0454083 | 3300049823 | Bacteria | 1188 |
| 1471 | nmdc:mga03n38_112793_c1 | 3300050490 | Bacteria | 1326 |
| 1472 | nmdc:mga03n38_1351_c1 | 3300050490 | Bacteria | 6942 |
| 1473 | nmdc:mga03n38_178693_c1 | 3300050490 | Bacteria | 1086 |
| 1474 | nmdc:mga03n38_260384_c1 | 3300050490 | Bacteria | 919 |
| 1475 | nmdc:mga03n38_377530_c1 | 3300050490 | Bacteria | 776 |
| 1476 | nmdc:mga00v17_242288_c1 | 3300050491 | Bacteria | 1169 |
| 1477 | nmdc:mga00v17_4146_c1 | 3300050491 | Bacteria | 7505 |
| 1478 | nmdc:mga00v17_648651_c1 | 3300050491 | Bacteria | 679 |
| 1479 | nmdc:mga0yw44_111096_c1 | 3300050492 | Bacteria | 1756 |
| 1480 | nmdc:mga0yw44_139702_c1 | 3300050492 | Bacteria | 1573 |
| 1481 | nmdc:mga0yw44_16709_c1 | 3300050492 | Bacteria | 3973 |
| 1482 | nmdc:mga0yw44_18431_c1 | 3300050492 | Bacteria | 3823 |
| 1483 | nmdc:mga0yw44_263826_c1 | 3300050492 | Bacteria | 1148 |
| 1484 | nmdc:mga0yw44_452661_c1 | 3300050492 | Bacteria | 870 |
| 1485 | nmdc:mga0yw44_47972_c1 | 3300050492 | Bacteria | 2574 |
| 1486 | nmdc:mga0yw44_5233_c1 | 3300050492 | Bacteria | 6085 |
| 1487 | nmdc:mga0yw44_907756_c1 | 3300050492 | Bacteria | 597 |
| 1488 | nmdc:mga0yw44_99641_c1 | 3300050492 | Bacteria | 1849 |
| 1489 | nmdc:mga0k408_188649_c1 | 3300050493 | Bacteria | 1230 |
| 1490 | nmdc:mga0k408_200248_c1 | 3300050493 | Bacteria | 1192 |
| 1491 | nmdc:mga0k408_444816_c1 | 3300050493 | Bacteria | 770 |
| 1492 | nmdc:mga06z11_15389_c1 | 3300050494 | Bacteria | 3414 |
| 1493 | nmdc:mga06z11_220266_c1 | 3300050494 | Bacteria | 1109 |
| 1494 | nmdc:mga06z11_319944_c1 | 3300050494 | Bacteria | 925 |
| 1495 | nmdc:mga06z11_61386_c1 | 3300050494 | Bacteria | 1960 |
| 1496 | nmdc:mga06z11_93936_c1 | 3300050494 | Bacteria | 1634 |
| 1497 | nmdc:mga04h51_35189_c1 | 3300050495 | Bacteria | 1604 |
| 1498 | nmdc:mga07m45_42075_c1 | 3300050496 | Bacteria | 2560 |
| 1499 | nmdc:mga07m45_44129_c1 | 3300050496 | Bacteria | 2501 |
| 1500 | nmdc:mga07m45_554131_c1 | 3300050496 | Bacteria | 665 |
| 1501 | nmdc:mga05p37_40049_c1 | 3300050507 | Bacteria | 5754 |
| 1502 | nmdc:mga05p37_921676_c1 | 3300050507 | Bacteria | 939 |
| 1503 | nmdc:mga06r32_1126713_c1 | 3300050510 | Bacteria | 733 |
| 1504 | nmdc:mga08y16_261869_c1 | 3300050511 | Bacteria | 1786 |
| 1505 | nmdc:mga08y16_347781_c1 | 3300050511 | Bacteria | 1523 |
| 1506 | nmdc:mga0n895_454902_c1 | 3300050512 | Bacteria | 1292 |
| 1507 | nmdc:mga0n895_743716_c1 | 3300050512 | Bacteria | 974 |
| 1508 | nmdc:mga0rr50_102280_c1 | 3300050513 | Bacteria | 2253 |
| 1509 | nmdc:mga0rr50_472736_c1 | 3300050513 | Bacteria | 1064 |
| 1510 | nmdc:mga0a205_606513_c1 | 3300050515 | Bacteria | 947 |
| 1511 | nmdc:mga0sz30_110075_c1 | 3300050516 | Bacteria | 1207 |
| 1512 | nmdc:mga0sz30_176394_c1 | 3300050516 | Bacteria | 948 |
| 1513 | nmdc:mga0sz30_20155_c1 | 3300050516 | Bacteria | 2688 |
| 1514 | Ga0495601_0035469 | 3300053077 | Bacteria | 3114 |
| 1515 | Ga0495601_0303104 | 3300053077 | Bacteria | 1040 |
| 1516 | Ga0495612_0026650 | 3300053078 | Bacteria | 2323 |
| 1517 | Ga0495612_0146753 | 3300053078 | Unclassified | 1025 |
| 1518 | Ga0500610_0115212 | 3300053079 | Bacteria | 1378 |
| 1519 | Ga0495655_0018190 | 3300053083 | Bacteria | 1541 |
| 1520 | Ga0495655_0112480 | 3300053083 | Bacteria | 820 |
| 1521 | Ga0495595_0009899 | 3300053084 | Bacteria | 3952 |
| 1522 | Ga0495595_0031623 | 3300053084 | Bacteria | 2380 |
| 1523 | Ga0495619_0001789 | 3300053085 | Bacteria | 14292 |
| 1524 | Ga0495619_0017972 | 3300053085 | Bacteria | 4484 |
| 1525 | Ga0495619_0022726 | 3300053085 | Bacteria | 4016 |
| 1526 | Ga0495619_0046671 | 3300053085 | Bacteria | 2849 |
| 1527 | Ga0495619_0297903 | 3300053085 | Unclassified | 1117 |
| 1528 | Ga0495619_0424691 | 3300053085 | Bacteria | 917 |
| 1529 | Ga0500578_0140992 | 3300053086 | Bacteria | 1507 |
| 1530 | Ga0500578_0235380 | 3300053086 | Bacteria | 1108 |
| 1531 | Ga0500578_0375011 | 3300053086 | Bacteria | 826 |
| 1532 | Ga0500578_0505167 | 3300053086 | Bacteria | 679 |
| 1533 | Ga0500643_000150 | 3300053087 | Bacteria | 71016 |
| 1534 | Ga0500581_034767 | 3300053089 | Bacteria | 2580 |
| 1535 | Ga0500646_0012699 | 3300053090 | Bacteria | 2176 |
| 1536 | Ga0500583_0078053 | 3300053092 | Bacteria | 1595 |
| 1537 | Ga0500583_0279806 | 3300053092 | Bacteria | 819 |
| 1538 | Ga0500651_0035391 | 3300053093 | Bacteria | 3146 |
| 1539 | Ga0500651_0095797 | 3300053093 | Bacteria | 1824 |
| 1540 | Ga0500651_0378594 | 3300053093 | Bacteria | 798 |
| 1541 | Ga0500566_0000011 | 3300053094 | Bacteria | 118644 |
| 1542 | Ga0500566_0000293 | 3300053094 | Bacteria | 26861 |
| 1543 | Ga0500566_0001917 | 3300053094 | Bacteria | 12244 |
| 1544 | Ga0500640_001527 | 3300053095 | Bacteria | 7094 |
| 1545 | Ga0500640_077058 | 3300053095 | Bacteria | 1421 |
| 1546 | Ga0500640_246080 | 3300053095 | Bacteria | 579 |
| 1547 | Ga0500641_0007243 | 3300053096 | Bacteria | 3954 |
| 1548 | Ga0500641_0027854 | 3300053096 | Bacteria | 2202 |
| 1549 | Ga0500641_0034843 | 3300053096 | Bacteria | 2006 |
| 1550 | Ga0500641_0207397 | 3300053096 | Bacteria | 835 |
| 1551 | Ga0500641_0351311 | 3300053096 | Bacteria | 592 |
| 1552 | Ga0500650_0000747 | 3300053098 | Bacteria | 8809 |
| 1553 | Ga0500650_0064410 | 3300053098 | Bacteria | 1713 |
| 1554 | Ga0500650_0120302 | 3300053098 | Bacteria | 1224 |
| 1555 | Ga0500650_0251301 | 3300053098 | Bacteria | 793 |
| 1556 | Ga0500554_004219 | 3300053102 | Bacteria | 3025 |
| 1557 | Ga0500555_001186 | 3300053103 | Bacteria | 8535 |
| 1558 | Ga0500556_0000003 | 3300053104 | Bacteria | 679379 |
| 1559 | Ga0500556_0011102 | 3300053104 | Bacteria | 2660 |
| 1560 | Ga0500557_000062 | 3300053105 | Bacteria | 43893 |
| 1561 | Ga0500562_027854 | 3300053108 | Bacteria | 1483 |
| 1562 | Ga0500562_051985 | 3300053108 | Bacteria | 1096 |
| 1563 | Ga0500562_076549 | 3300053108 | Bacteria | 904 |
| 1564 | Ga0500572_000065 | 3300053111 | Bacteria | 32713 |
| 1565 | Ga0500572_001006 | 3300053111 | Bacteria | 8512 |
| 1566 | Ga0500572_041328 | 3300053111 | Bacteria | 1338 |
| 1567 | Ga0500582_086196 | 3300053114 | Bacteria | 1083 |
| 1568 | Ga0500592_002557 | 3300053116 | Bacteria | 2918 |
| 1569 | Ga0500593_156178 | 3300053117 | Bacteria | 878 |
| 1570 | Ga0500595_000395 | 3300053119 | Bacteria | 28044 |
| 1571 | Ga0500595_000496 | 3300053119 | Bacteria | 24015 |
| 1572 | Ga0500595_016246 | 3300053119 | Bacteria | 2776 |
| 1573 | Ga0500595_016839 | 3300053119 | Bacteria | 2714 |
| 1574 | Ga0500595_030732 | 3300053119 | Bacteria | 1807 |
| 1575 | Ga0500607_022647 | 3300053121 | Bacteria | 3529 |
| 1576 | Ga0500607_101781 | 3300053121 | Bacteria | 1425 |
| 1577 | Ga0500608_051222 | 3300053122 | Bacteria | 1983 |
| 1578 | Ga0500614_003255 | 3300053123 | Bacteria | 3514 |
| 1579 | Ga0500614_018221 | 3300053123 | Bacteria | 1595 |
| 1580 | Ga0500621_155658 | 3300053126 | Bacteria | 853 |
| 1581 | Ga0500621_221152 | 3300053126 | Bacteria | 656 |
| 1582 | Ga0500626_033792 | 3300053128 | Bacteria | 2311 |
| 1583 | Ga0500642_0000006 | 3300053130 | Bacteria | 350064 |
| 1584 | Ga0500642_0000127 | 3300053130 | Bacteria | 34341 |
| 1585 | Ga0500642_0042964 | 3300053130 | Bacteria | 1962 |
| 1586 | Ga0500642_0168026 | 3300053130 | Bacteria | 1027 |
| 1587 | Ga0500642_0296984 | 3300053130 | Bacteria | 730 |
| 1588 | Ga0500652_002025 | 3300053131 | Bacteria | 6100 |
| 1589 | Ga0500655_011686 | 3300053133 | Bacteria | 1593 |
| 1590 | Ga0500658_0215062 | 3300053134 | Bacteria | 880 |
| 1591 | Ga0500658_0233060 | 3300053134 | Bacteria | 845 |
| 1592 | Ga0500658_0400032 | 3300053134 | Bacteria | 628 |
| 1593 | Ga0500559_0000308 | 3300053136 | Bacteria | 37080 |
| 1594 | Ga0500559_0001798 | 3300053136 | Bacteria | 11758 |
| 1595 | Ga0500559_0077325 | 3300053136 | Bacteria | 1507 |
| 1596 | Ga0500559_0094578 | 3300053136 | Bacteria | 1371 |
| 1597 | Ga0500559_0310354 | 3300053136 | Bacteria | 740 |
| 1598 | Ga0500559_0328608 | 3300053136 | Bacteria | 716 |
| 1599 | Ga0500561_0253713 | 3300053137 | Bacteria | 560 |
| 1600 | Ga0500568_0000856 | 3300053139 | Bacteria | 21406 |
| 1601 | Ga0500577_0000070 | 3300053142 | Bacteria | 23258 |
| 1602 | Ga0500577_0115812 | 3300053142 | Bacteria | 1111 |
| 1603 | Ga0500577_0314212 | 3300053142 | Bacteria | 684 |
| 1604 | Ga0500577_0317177 | 3300053142 | Bacteria | 681 |
| 1605 | Ga0500585_125663 | 3300053144 | Bacteria | 912 |
| 1606 | Ga0500586_058255 | 3300053145 | Bacteria | 1341 |
| 1607 | Ga0500589_080197 | 3300053147 | Bacteria | 1459 |
| 1608 | Ga0500590_054988 | 3300053148 | Bacteria | 2014 |
| 1609 | Ga0500590_108729 | 3300053148 | Bacteria | 1319 |
| 1610 | Ga0500590_206896 | 3300053148 | Bacteria | 824 |
| 1611 | Ga0500603_000269 | 3300053150 | Bacteria | 13789 |
| 1612 | Ga0500603_006349 | 3300053150 | Bacteria | 2567 |
| 1613 | Ga0500603_223630 | 3300053150 | Bacteria | 601 |
| 1614 | Ga0500604_0003912 | 3300053151 | Bacteria | 3978 |
| 1615 | Ga0500604_0018478 | 3300053151 | Bacteria | 1943 |
| 1616 | Ga0500604_0162847 | 3300053151 | Bacteria | 760 |
| 1617 | Ga0500616_0000033 | 3300053153 | Bacteria | 398830 |
| 1618 | Ga0500616_0042038 | 3300053153 | Bacteria | 2449 |
| 1619 | Ga0500620_016390 | 3300053155 | Bacteria | 2117 |
| 1620 | Ga0500622_0003447 | 3300053156 | Bacteria | 10553 |
| 1621 | Ga0500622_0062318 | 3300053156 | Bacteria | 1899 |
| 1622 | Ga0500622_0063763 | 3300053156 | Bacteria | 1875 |
| 1623 | Ga0500622_0074084 | 3300053156 | Bacteria | 1716 |
| 1624 | Ga0500622_0150890 | 3300053156 | Bacteria | 1099 |
| 1625 | Ga0500624_007439 | 3300053157 | Bacteria | 1507 |
| 1626 | Ga0500627_0018363 | 3300053158 | Bacteria | 2767 |
| 1627 | Ga0500627_0026749 | 3300053158 | Bacteria | 2385 |
| 1628 | Ga0500627_0039239 | 3300053158 | Bacteria | 2027 |
| 1629 | Ga0500627_0247020 | 3300053158 | Bacteria | 790 |
| 1630 | Ga0500630_000832 | 3300053159 | Bacteria | 14267 |
| 1631 | Ga0500634_0143873 | 3300053161 | Bacteria | 1125 |
| 1632 | Ga0500638_000370 | 3300053162 | Bacteria | 10477 |
| 1633 | Ga0500638_015393 | 3300053162 | Bacteria | 3509 |
| 1634 | Ga0500638_022359 | 3300053162 | Bacteria | 2996 |
| 1635 | Ga0500639_000079 | 3300053163 | Bacteria | 45631 |
| 1636 | Ga0500639_004522 | 3300053163 | Bacteria | 7069 |
| 1637 | Ga0500639_028570 | 3300053163 | Bacteria | 2947 |
| 1638 | Ga0500639_178108 | 3300053163 | Bacteria | 944 |
| 1639 | Ga0500636_0000041 | 3300053177 | Bacteria | 69687 |
| 1640 | Ga0500636_0005812 | 3300053177 | Bacteria | 7062 |
| 1641 | Ga0500636_0053870 | 3300053177 | Bacteria | 2360 |
| 1642 | Ga0500636_0088163 | 3300053177 | Bacteria | 1780 |
| 1643 | Ga0500636_0171883 | 3300053177 | Bacteria | 1171 |
| 1644 | Ga0500636_0207473 | 3300053177 | Bacteria | 1031 |
| 1645 | Ga0500637_0000026 | 3300053178 | Bacteria | 59050 |
| 1646 | Ga0500637_0056548 | 3300053178 | Bacteria | 2241 |
| 1647 | Ga0500637_0079586 | 3300053178 | Bacteria | 1892 |
| 1648 | Ga0500637_0082391 | 3300053178 | Bacteria | 1859 |
| 1649 | Ga0500637_0103093 | 3300053178 | Bacteria | 1654 |
| 1650 | Ga0500637_0239292 | 3300053178 | Bacteria | 1018 |
| 1651 | Ga0500637_0274419 | 3300053178 | Bacteria | 931 |
| 1652 | Ga0500637_0391727 | 3300053178 | Bacteria | 725 |
| 1653 | Ga0500649_188904 | 3300053722 | Bacteria | 684 |
| 1654 | Ga0500576_001460 | 3300053725 | Bacteria | 7974 |
| 1655 | Ga0500576_089743 | 3300053725 | Bacteria | 1279 |
| 1656 | Ga0500611_050523 | 3300053727 | Bacteria | 951 |
| 1657 | Ga0500611_099126 | 3300053727 | Bacteria | 752 |
| 1658 | Ga0500645_010714 | 3300053730 | Bacteria | 3018 |
| 1659 | Ga0500645_018852 | 3300053730 | Bacteria | 2151 |
| 1660 | Ga0500645_035199 | 3300053730 | Bacteria | 1492 |
| 1661 | Ga0500609_024025 | 3300053731 | Bacteria | 835 |
| 1662 | Ga0500596_000987 | 3300053735 | Bacteria | 5689 |
| 1663 | Ga0500596_005660 | 3300053735 | Bacteria | 2174 |
| 1664 | Ga0500596_014937 | 3300053735 | Bacteria | 1167 |
| 1665 | Ga0500599_018322 | 3300053736 | Bacteria | 978 |
| 1666 | Ga0500601_000306 | 3300053737 | Bacteria | 9164 |
| 1667 | Ga0500661_001127 | 3300055283 | Bacteria | 5003 |
| 1668 | Ga0500661_011645 | 3300055283 | Bacteria | 1589 |
| 1669 | Ga0500661_032566 | 3300055283 | Bacteria | 920 |
| 1670 | Ga0501082_1175165 | 3300060353 | Bacteria | 671 |
| 1671 | Ga0501082_1273804 | 3300060353 | Bacteria | 642 |
| 1672 | Ga0466962_0232804 | 3300061719 | Bacteria | 903 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009553 | Ga0105249_12073413 | Ga0105249_120734132 | 147 |
| 2 | 3300035113 | Ga0373936_0157833 | Ga0373936_0157833_27_473 | 148 |
| 3 | iso_pu_bacteria | 2513237094 | 2513636904 | 148 |
| 4 | iso_pu_bacteria | 2513237104 | 2513721519 | 148 |
| 5 | iso_pu_bacteria | 2932794094 | 2932799649 | 148 |
| 6 | iso_pu_bacteria | 2932801729 | 2932808763 | 148 |
| 7 | iso_pu_bacteria | 2935883170 | 2935885693 | 148 |
| 8 | iso_pu_bacteria | 3005594810 | 3005600527 | 148 |
| 9 | iso_pu_bacteria | 8019648815 | 8019649595 | 148 |
| 10 | iso_pu_bacteria | 2667528175 | 2671123241 | 149 |
| 11 | iso_pu_bacteria | 2885374607 | 2885378215 | 149 |
| 12 | iso_pu_bacteria | 2908739725 | 2908741475 | 149 |
| 13 | 3300009551 | Ga0105238_11568038 | Ga0105238_115680381 | 150 |
| 14 | 3300010375 | Ga0105239_11055342 | Ga0105239_110553422 | 150 |
| 15 | 3300031238 | Ga0265332_10252158 | Ga0265332_102521581 | 150 |
| 16 | 3300041460 | Ga0451802_1139949 | Ga0451802_1139949_33_515 | 150 |
| 17 | iso_pu_bacteria | 2513237096 | 2513657141 | 150 |
| 18 | iso_pu_bacteria | 2513237137 | 2513857029 | 150 |
| 19 | iso_pu_bacteria | 2513237145 | 2513919149 | 150 |
| 20 | iso_pu_bacteria | 2517572143 | 2517891157 | 150 |
| 21 | iso_pu_bacteria | 2524023228 | 2524533659 | 150 |
| 22 | iso_pu_bacteria | 2791355197 | 2793066500 | 150 |
| 23 | iso_pu_bacteria | 2903748898 | 2903752224 | 150 |
| 24 | iso_pu_bacteria | 2904699407 | 2904701036 | 150 |
| 25 | iso_pu_bacteria | 2906610324 | 2906616337 | 150 |
| 26 | iso_pu_bacteria | 2906635258 | 2906641542 | 150 |
| 27 | iso_pu_bacteria | 2906660503 | 2906662880 | 150 |
| 28 | iso_pu_bacteria | 2922425934 | 2922431665 | 150 |
| 29 | iso_pu_bacteria | 3005474847 | 3005481464 | 150 |
| 30 | iso_pu_bacteria | 8006933436 | 8006939253 | 150 |
| 31 | iso_pu_bacteria | 8006973647 | 8006978911 | 150 |
| 32 | iso_pu_bacteria | 8019555841 | 8019565114 | 150 |
| 33 | iso_pu_bacteria | 8019565922 | 8019575216 | 150 |
| 34 | iso_pu_bacteria | 2507262055 | 2507507461 | 151 |
| 35 | iso_pu_bacteria | 2508501009 | 2508541575 | 151 |
| 36 | iso_pu_bacteria | 2508501042 | 2508692882 | 151 |
| 37 | iso_pu_bacteria | 2511231028 | 2511398977 | 151 |
| 38 | iso_pu_bacteria | 2513237095 | 2513651151 | 151 |
| 39 | iso_pu_bacteria | 2513237102 | 2513700650 | 151 |
| 40 | iso_pu_bacteria | 2513237139 | 2513878360 | 151 |
| 41 | iso_pu_bacteria | 2513237161 | 2514011713 | 151 |
| 42 | iso_pu_bacteria | 2515154112 | 2515626272 | 151 |
| 43 | iso_pu_bacteria | 2517093001 | 2517107854 | 151 |
| 44 | iso_pu_bacteria | 2524023205 | 2524436078 | 151 |
| 45 | iso_pu_bacteria | 2528768022 | 2528852875 | 151 |
| 46 | iso_pu_bacteria | 2617270735 | 2617352716 | 151 |
| 47 | iso_pu_bacteria | 2744054633 | 2745080022 | 151 |
| 48 | iso_pu_bacteria | 2791355196 | 2793061083 | 151 |
| 49 | iso_pu_bacteria | 2802429603 | 2805920583 | 151 |
| 50 | iso_pu_bacteria | 2816332527 | 2818236769 | 151 |
| 51 | iso_pu_bacteria | 2824609381 | 2824611776 | 151 |
| 52 | iso_pu_bacteria | 2824617872 | 2824622033 | 151 |
| 53 | iso_pu_bacteria | 2824626560 | 2824629297 | 151 |
| 54 | iso_pu_bacteria | 2824635225 | 2824639170 | 151 |
| 55 | iso_pu_bacteria | 2824644064 | 2824652639 | 151 |
| 56 | iso_pu_bacteria | 2824653114 | 2824655012 | 151 |
| 57 | iso_pu_bacteria | 2824661429 | 2824664033 | 151 |
| 58 | iso_pu_bacteria | 2824671348 | 2824675201 | 151 |
| 59 | iso_pu_bacteria | 2824696289 | 2824701152 | 151 |
| 60 | iso_pu_bacteria | 2824704595 | 2824711113 | 151 |
| 61 | iso_pu_bacteria | 2824714736 | 2824723189 | 151 |
| 62 | iso_pu_bacteria | 2824723954 | 2824731759 | 151 |
| 63 | iso_pu_bacteria | 2824753945 | 2824760452 | 151 |
| 64 | iso_pu_bacteria | 2824763712 | 2824766559 | 151 |
| 65 | iso_pu_bacteria | 2824773399 | 2824776679 | 151 |
| 66 | iso_pu_bacteria | 2838122688 | 2838127371 | 151 |
| 67 | iso_pu_bacteria | 2841941048 | 2841946390 | 151 |
| 68 | iso_pu_bacteria | 2841949485 | 2841957109 | 151 |
| 69 | iso_pu_bacteria | 2841957949 | 2841965631 | 151 |
| 70 | iso_pu_bacteria | 2841966195 | 2841972900 | 151 |
| 71 | iso_pu_bacteria | 2841974524 | 2841978428 | 151 |
| 72 | iso_pu_bacteria | 2841983080 | 2841987470 | 151 |
| 73 | iso_pu_bacteria | 2844315083 | 2844320214 | 151 |
| 74 | iso_pu_bacteria | 2847930680 | 2847937536 | 151 |
| 75 | iso_pu_bacteria | 2847939898 | 2847947964 | 151 |
| 76 | iso_pu_bacteria | 2849076700 | 2849078188 | 151 |
| 77 | iso_pu_bacteria | 2857509624 | 2857511349 | 151 |
| 78 | iso_pu_bacteria | 2874590934 | 2874598577 | 151 |
| 79 | iso_pu_bacteria | 2874612657 | 2874616762 | 151 |
| 80 | iso_pu_bacteria | 2874620515 | 2874628288 | 151 |
| 81 | iso_pu_bacteria | 2874628541 | 2874630115 | 151 |
| 82 | iso_pu_bacteria | 2874645413 | 2874652030 | 151 |
| 83 | iso_pu_bacteria | 2876771140 | 2876778615 | 151 |
| 84 | iso_pu_bacteria | 2876818435 | 2876823420 | 151 |
| 85 | iso_pu_bacteria | 2879074833 | 2879082408 | 151 |
| 86 | iso_pu_bacteria | 2879083081 | 2879084949 | 151 |
| 87 | iso_pu_bacteria | 2879099564 | 2879107932 | 151 |
| 88 | iso_pu_bacteria | 2879127579 | 2879131811 | 151 |
| 89 | iso_pu_bacteria | 2879142872 | 2879150147 | 151 |
| 90 | iso_pu_bacteria | 2881364244 | 2881370116 | 151 |
| 91 | iso_pu_bacteria | 2881665667 | 2881670116 | 151 |
| 92 | iso_pu_bacteria | 2885366525 | 2885370181 | 151 |
| 93 | iso_pu_bacteria | 2885409591 | 2885414372 | 151 |
| 94 | iso_pu_bacteria | 2888378607 | 2888385692 | 151 |
| 95 | iso_pu_bacteria | 2888419890 | 2888425815 | 151 |
| 96 | iso_pu_bacteria | 2903727486 | 2903731196 | 151 |
| 97 | iso_pu_bacteria | 2904666416 | 2904674093 | 151 |
| 98 | iso_pu_bacteria | 2904711408 | 2904711743 | 151 |
| 99 | iso_pu_bacteria | 2906602504 | 2906610037 | 151 |
| 100 | iso_pu_bacteria | 2906626472 | 2906629222 | 151 |
| 101 | iso_pu_bacteria | 2906643746 | 2906651215 | 151 |
| 102 | iso_pu_bacteria | 2922368715 | 2922375939 | 151 |
| 103 | iso_pu_bacteria | 2929615660 | 2929621252 | 151 |
| 104 | iso_pu_bacteria | 2929624759 | 2929625917 | 151 |
| 105 | iso_pu_bacteria | 2932784394 | 2932785198 | 151 |
| 106 | iso_pu_bacteria | 2932809354 | 2932810232 | 151 |
| 107 | iso_pu_bacteria | 2932818245 | 2932821804 | 151 |
| 108 | iso_pu_bacteria | 2932828146 | 2932829034 | 151 |
| 109 | iso_pu_bacteria | 2933577622 | 2933582879 | 151 |
| 110 | iso_pu_bacteria | 2935608549 | 2935610035 | 151 |
| 111 | iso_pu_bacteria | 2935616580 | 2935619546 | 151 |
| 112 | iso_pu_bacteria | 2935638405 | 2935638526 | 151 |
| 113 | iso_pu_bacteria | 2935648319 | 2935656355 | 151 |
| 114 | iso_pu_bacteria | 2935656913 | 2935660089 | 151 |
| 115 | iso_pu_bacteria | 2935665750 | 2935666622 | 151 |
| 116 | iso_pu_bacteria | 2935675223 | 2935682188 | 151 |
| 117 | iso_pu_bacteria | 2935684952 | 2935691156 | 151 |
| 118 | iso_pu_bacteria | 2935694250 | 2935694419 | 151 |
| 119 | iso_pu_bacteria | 2935703347 | 2935703532 | 151 |
| 120 | iso_pu_bacteria | 2935713505 | 2935718537 | 151 |
| 121 | iso_pu_bacteria | 2935722832 | 2935727483 | 151 |
| 122 | iso_pu_bacteria | 2935732158 | 2935736186 | 151 |
| 123 | iso_pu_bacteria | 2935741537 | 2935745566 | 151 |
| 124 | iso_pu_bacteria | 2935750917 | 2935755947 | 151 |
| 125 | iso_pu_bacteria | 2935760218 | 2935760791 | 151 |
| 126 | iso_pu_bacteria | 2935769743 | 2935776446 | 151 |
| 127 | iso_pu_bacteria | 2935777560 | 2935780839 | 151 |
| 128 | iso_pu_bacteria | 2935785616 | 2935792329 | 151 |
| 129 | iso_pu_bacteria | 2935793552 | 2935800496 | 151 |
| 130 | iso_pu_bacteria | 2935801545 | 2935801669 | 151 |
| 131 | iso_pu_bacteria | 2935810662 | 2935814921 | 151 |
| 132 | iso_pu_bacteria | 2935819856 | 2935823195 | 151 |
| 133 | iso_pu_bacteria | 2935827899 | 2935828020 | 151 |
| 134 | iso_pu_bacteria | 2935837841 | 2935842226 | 151 |
| 135 | iso_pu_bacteria | 2935847175 | 2935848777 | 151 |
| 136 | iso_pu_bacteria | 2935855204 | 2935858138 | 151 |
| 137 | iso_pu_bacteria | 2935864058 | 2935868043 | 151 |
| 138 | iso_pu_bacteria | 2935873716 | 2935873934 | 151 |
| 139 | iso_pu_bacteria | 2935908558 | 2935909421 | 151 |
| 140 | iso_pu_bacteria | 2935916978 | 2935917143 | 151 |
| 141 | iso_pu_bacteria | 2935926038 | 2935926902 | 151 |
| 142 | iso_pu_bacteria | 2935934488 | 2935937254 | 151 |
| 143 | iso_pu_bacteria | 2935942939 | 2935944443 | 151 |
| 144 | iso_pu_bacteria | 2935951376 | 2935952880 | 151 |
| 145 | iso_pu_bacteria | 2935967501 | 2935969720 | 151 |
| 146 | iso_pu_bacteria | 2935975950 | 2935976331 | 151 |
| 147 | iso_pu_bacteria | 2935984226 | 2935991828 | 151 |
| 148 | iso_pu_bacteria | 2935992306 | 2935993142 | 151 |
| 149 | iso_pu_bacteria | 2936002035 | 2936003079 | 151 |
| 150 | iso_pu_bacteria | 2936011229 | 2936014505 | 151 |
| 151 | iso_pu_bacteria | 2936019824 | 2936027828 | 151 |
| 152 | iso_pu_bacteria | 2936028420 | 2936031298 | 151 |
| 153 | iso_pu_bacteria | 2936037263 | 2936040436 | 151 |
| 154 | iso_pu_bacteria | 2936046547 | 2936049611 | 151 |
| 155 | iso_pu_bacteria | 2936055302 | 2936061173 | 151 |
| 156 | iso_pu_bacteria | 2940556831 | 2940562078 | 151 |
| 157 | iso_pu_bacteria | 2941531003 | 2941531404 | 151 |
| 158 | iso_pu_bacteria | 2941538514 | 2941542274 | 151 |
| 159 | iso_pu_bacteria | 3005483717 | 3005488444 | 151 |
| 160 | iso_pu_bacteria | 3005506211 | 3005508229 | 151 |
| 161 | iso_pu_bacteria | 3005587118 | 3005588269 | 151 |
| 162 | iso_pu_bacteria | 3005710791 | 3005716001 | 151 |
| 163 | iso_pu_bacteria | 8016511872 | 8016520427 | 151 |
| 164 | iso_pu_bacteria | 8016522445 | 8016528499 | 151 |
| 165 | iso_pu_bacteria | 8016530956 | 8016533658 | 151 |
| 166 | iso_pu_bacteria | 8016539877 | 8016546880 | 151 |
| 167 | iso_pu_bacteria | 8016548790 | 8016555239 | 151 |
| 168 | iso_pu_bacteria | 8016557553 | 8016563601 | 151 |
| 169 | iso_pu_bacteria | 8016566248 | 8016571988 | 151 |
| 170 | iso_pu_bacteria | 8016583857 | 8016594600 | 151 |
| 171 | iso_pu_bacteria | 8016595262 | 8016601336 | 151 |
| 172 | iso_pu_bacteria | 8016603502 | 8016609094 | 151 |
| 173 | iso_pu_bacteria | 8016622563 | 8016625423 | 151 |
| 174 | iso_pu_bacteria | 8016630954 | 8016638948 | 151 |
| 175 | iso_pu_bacteria | 8017057580 | 8017065148 | 151 |
| 176 | iso_pu_bacteria | 8019530166 | 8019533438 | 151 |
| 177 | iso_pu_bacteria | 8019538911 | 8019546238 | 151 |
| 178 | iso_pu_bacteria | 8019547302 | 8019552470 | 151 |
| 179 | iso_pu_bacteria | 8019576017 | 8019584538 | 151 |
| 180 | iso_pu_bacteria | 8019586578 | 8019592311 | 151 |
| 181 | iso_pu_bacteria | 8019597564 | 8019598976 | 151 |
| 182 | iso_pu_bacteria | 8019608314 | 8019609401 | 151 |
| 183 | iso_pu_bacteria | 8019619141 | 8019620024 | 151 |
| 184 | iso_pu_bacteria | 8019638758 | 8019646821 | 151 |
| 185 | iso_pu_bacteria | 8019659431 | 8019660962 | 151 |
| 186 | iso_pu_bacteria | 8019668869 | 8019670522 | 151 |
| 187 | iso_pu_bacteria | 8019678201 | 8019685710 | 151 |
| 188 | iso_pu_bacteria | 8019687851 | 8019691287 | 151 |
| 189 | iso_pu_bacteria | 8055742211 | 8055744887 | 151 |
| 190 | iso_pu_bacteria | 8056967851 | 8056974856 | 151 |
| 191 | 3300003203 | JGI25406J46586_10014944 | JGI25406J46586_100149443 | 152 |
| 192 | 3300003322 | rootL2_10146216 | rootL2_101462162 | 152 |
| 193 | 3300003659 | JGI25404J52841_10000288 | JGI25404J52841_100002883 | 152 |
| 194 | 3300003659 | JGI25404J52841_10000871 | JGI25404J52841_100008713 | 152 |
| 195 | 3300003659 | JGI25404J52841_10007910 | JGI25404J52841_100079103 | 152 |
| 196 | 3300003659 | JGI25404J52841_10008582 | JGI25404J52841_100085824 | 152 |
| 197 | 3300005327 | Ga0070658_10647016 | Ga0070658_106470162 | 152 |
| 198 | 3300005539 | Ga0068853_100244915 | Ga0068853_1002449153 | 152 |
| 199 | 3300005578 | Ga0068854_100649236 | Ga0068854_1006492362 | 152 |
| 200 | 3300005615 | Ga0070702_101798201 | Ga0070702_1017982011 | 152 |
| 201 | 3300005937 | Ga0081455_10005955 | Ga0081455_1000595512 | 152 |
| 202 | 3300005937 | Ga0081455_10030485 | Ga0081455_100304853 | 152 |
| 203 | 3300005937 | Ga0081455_10080661 | Ga0081455_100806612 | 152 |
| 204 | 3300005937 | Ga0081455_10456688 | Ga0081455_104566881 | 152 |
| 205 | 3300005983 | Ga0081540_1003418 | Ga0081540_10034184 | 152 |
| 206 | 3300005983 | Ga0081540_1003851 | Ga0081540_10038515 | 152 |
| 207 | 3300005983 | Ga0081540_1012000 | Ga0081540_10120007 | 152 |
| 208 | 3300005983 | Ga0081540_1021006 | Ga0081540_10210064 | 152 |
| 209 | 3300005983 | Ga0081540_1021049 | Ga0081540_10210494 | 152 |
| 210 | 3300005983 | Ga0081540_1035588 | Ga0081540_10355884 | 152 |
| 211 | 3300005983 | Ga0081540_1043950 | Ga0081540_10439502 | 152 |
| 212 | 3300005983 | Ga0081540_1088921 | Ga0081540_10889212 | 152 |
| 213 | 3300005983 | Ga0081540_1230772 | Ga0081540_12307722 | 152 |
| 214 | 3300005983 | Ga0081540_1231189 | Ga0081540_12311892 | 152 |
| 215 | 3300005985 | Ga0081539_10000220 | Ga0081539_1000022058 | 152 |
| 216 | 3300006353 | Ga0075370_10251729 | Ga0075370_102517292 | 152 |
| 217 | 3300006871 | Ga0075434_100642083 | Ga0075434_1006420832 | 152 |
| 218 | 3300009093 | Ga0105240_10021941 | Ga0105240_100219412 | 152 |
| 219 | 3300009098 | Ga0105245_10461621 | Ga0105245_104616213 | 152 |
| 220 | 3300009147 | Ga0114129_10368158 | Ga0114129_103681582 | 152 |
| 221 | 3300009174 | Ga0105241_10050318 | Ga0105241_100503184 | 152 |
| 222 | 3300010375 | Ga0105239_10066752 | Ga0105239_100667524 | 152 |
| 223 | 3300010375 | Ga0105239_10139452 | Ga0105239_101394523 | 152 |
| 224 | 3300025261 | Ga0209233_1026199 | Ga0209233_10261991 | 152 |
| 225 | 3300025297 | Ga0209758_1002848 | Ga0209758_100284810 | 152 |
| 226 | 3300025913 | Ga0207695_10000163 | Ga0207695_100001638 | 152 |
| 227 | 3300025914 | Ga0207671_10058973 | Ga0207671_100589733 | 152 |
| 228 | 3300025945 | Ga0207679_10621109 | Ga0207679_106211092 | 152 |
| 229 | 3300026041 | Ga0207639_11024210 | Ga0207639_110242102 | 152 |
| 230 | 3300026142 | Ga0207698_10432956 | Ga0207698_104329562 | 152 |
| 231 | 3300034818 | Ga0373950_0135823 | Ga0373950_0135823_38_496 | 152 |
| 232 | 3300035691 | Ga0373931_0341514 | Ga0373931_0341514_445_903 | 152 |
| 233 | 3300045051 | Ga0451576_0002188 | Ga0451576_0002188_15647_16105 | 152 |
| 234 | 3300045051 | Ga0451576_0125392 | Ga0451576_0125392_1093_1551 | 152 |
| 235 | 3300046454 | Ga0495592_0207253 | Ga0495592_0207253_405_863 | 152 |
| 236 | 3300046459 | Ga0495629_0636485 | Ga0495629_0636485_64_522 | 152 |
| 237 | 3300046511 | Ga0495608_0642976 | Ga0495608_0642976_16_474 | 152 |
| 238 | 3300046516 | Ga0495628_0307226 | Ga0495628_0307226_192_650 | 152 |
| 239 | 3300046529 | Ga0495652_0155483 | Ga0495652_0155483_137_595 | 152 |
| 240 | 3300046533 | Ga0495640_0085615 | Ga0495640_0085615_368_826 | 152 |
| 241 | 3300046557 | Ga0495622_0039374 | Ga0495622_0039374_260_718 | 152 |
| 242 | 3300046616 | Ga0495668_0221511 | Ga0495668_0221511_126_584 | 152 |
| 243 | 3300046684 | Ga0495669_0337156 | Ga0495669_0337156_257_715 | 152 |
| 244 | 3300046690 | Ga0495624_0082595 | Ga0495624_0082595_398_856 | 152 |
| 245 | 3300047315 | Ga0495581_0299586 | Ga0495581_0299586_44_502 | 152 |
| 246 | 3300047317 | Ga0495604_0484019 | Ga0495604_0484019_183_641 | 152 |
| 247 | 3300047321 | Ga0495676_0076470 | Ga0495676_0076470_143_601 | 152 |
| 248 | 3300047469 | Ga0495673_0153952 | Ga0495673_0153952_340_798 | 152 |
| 249 | 3300047471 | Ga0495684_0203441 | Ga0495684_0203441_856_1314 | 152 |
| 250 | 3300047472 | Ga0495686_0210423 | Ga0495686_0210423_562_1020 | 152 |
| 251 | 3300048904 | Ga0496101_0480347 | Ga0496101_0480347_352_810 | 152 |
| 252 | 3300048907 | Ga0496104_0010574 | Ga0496104_0010574_1763_2221 | 152 |
| 253 | 3300048908 | Ga0496105_0183729 | Ga0496105_0183729_653_1111 | 152 |
| 254 | 3300048916 | Ga0496113_0060669 | Ga0496113_0060669_1490_1948 | 152 |
| 255 | 3300048917 | Ga0496114_0712511 | Ga0496114_0712511_312_770 | 152 |
| 256 | 3300048918 | Ga0496115_0058271 | Ga0496115_0058271_1333_1791 | 152 |
| 257 | 3300048921 | Ga0496118_0193568 | Ga0496118_0193568_305_763 | 152 |
| 258 | 3300048922 | Ga0496119_0006875 | Ga0496119_0006875_3799_4257 | 152 |
| 259 | 3300048923 | Ga0496120_0014529 | Ga0496120_0014529_983_1441 | 152 |
| 260 | 3300048925 | Ga0496122_0282027 | Ga0496122_0282027_82_540 | 152 |
| 261 | 3300048927 | Ga0496124_0346105 | Ga0496124_0346105_208_666 | 152 |
| 262 | 3300048929 | Ga0496126_0301634 | Ga0496126_0301634_65_523 | 152 |
| 263 | 3300049583 | Ga0501067_0282238 | Ga0501067_0282238_134_592 | 152 |
| 264 | 3300049589 | Ga0501073_0465433 | Ga0501073_0465433_323_781 | 152 |
| 265 | 3300050507 | nmdc:mga05p37_921676_c1 | nmdc:mga05p37_921676_c1_223_681 | 152 |
| 266 | 3300050512 | nmdc:mga0n895_454902_c1 | nmdc:mga0n895_454902_c1_472_930 | 152 |
| 267 | 3300050512 | nmdc:mga0n895_743716_c1 | nmdc:mga0n895_743716_c1_373_831 | 152 |
| 268 | 3300053095 | Ga0500640_246080 | Ga0500640_246080_107_565 | 152 |
| 269 | 3300053119 | Ga0500595_016246 | Ga0500595_016246_1680_2138 | 152 |
| 270 | 3300053136 | Ga0500559_0328608 | Ga0500559_0328608_18_476 | 152 |
| 271 | 3300053178 | Ga0500637_0274419 | Ga0500637_0274419_280_738 | 152 |
| 272 | 3300053722 | Ga0500649_188904 | Ga0500649_188904_205_663 | 152 |
| 273 | 3300055283 | Ga0500661_011645 | Ga0500661_011645_648_1106 | 152 |
| 274 | 3300005329 | Ga0070683_100948112 | Ga0070683_1009481122 | 153 |
| 275 | 3300005337 | Ga0070682_100944304 | Ga0070682_1009443041 | 153 |
| 276 | 3300005338 | Ga0068868_100986094 | Ga0068868_1009860941 | 153 |
| 277 | 3300005618 | Ga0068864_100772554 | Ga0068864_1007725542 | 153 |
| 278 | 3300005981 | Ga0081538_10198308 | Ga0081538_101983082 | 153 |
| 279 | 3300006358 | Ga0068871_101652352 | Ga0068871_1016523522 | 153 |
| 280 | 3300011119 | Ga0105246_10694380 | Ga0105246_106943802 | 153 |
| 281 | 3300013297 | Ga0157378_10004961 | Ga0157378_100049615 | 153 |
| 282 | 3300013306 | Ga0163162_11419257 | Ga0163162_114192572 | 153 |
| 283 | 3300013308 | Ga0157375_10888727 | Ga0157375_108887272 | 153 |
| 284 | 3300014325 | Ga0163163_10927490 | Ga0163163_109274902 | 153 |
| 285 | 3300015262 | Ga0182007_10120303 | Ga0182007_101203032 | 153 |
| 286 | 3300017792 | Ga0163161_10546613 | Ga0163161_105466132 | 153 |
| 287 | 3300025315 | Ga0207697_10262449 | Ga0207697_102624492 | 153 |
| 288 | 3300025900 | Ga0207710_10161530 | Ga0207710_101615303 | 153 |
| 289 | 3300025925 | Ga0207650_10815484 | Ga0207650_108154842 | 153 |
| 290 | 3300026075 | Ga0207708_10494035 | Ga0207708_104940353 | 153 |
| 291 | 3300026095 | Ga0207676_10125942 | Ga0207676_101259423 | 153 |
| 292 | 3300031548 | Ga0307408_100713904 | Ga0307408_1007139042 | 153 |
| 293 | 3300046542 | Ga0495597_0278015 | Ga0495597_0278015_98_559 | 153 |
| 294 | 3300046694 | Ga0495649_0333935 | Ga0495649_0333935_183_644 | 153 |
| 295 | 3300048922 | Ga0496119_0117249 | Ga0496119_0117249_904_1365 | 153 |
| 296 | 3300048929 | Ga0496126_0422747 | Ga0496126_0422747_108_569 | 153 |
| 297 | 3300050492 | nmdc:mga0yw44_452661_c1 | nmdc:mga0yw44_452661_c1_121_582 | 153 |
| 298 | 3300053096 | Ga0500641_0027854 | Ga0500641_0027854_140_604 | 153 |
| 299 | 3300005434 | Ga0070709_10802566 | Ga0070709_108025662 | 154 |
| 300 | 3300005435 | Ga0070714_100017333 | Ga0070714_1000173332 | 154 |
| 301 | 3300005437 | Ga0070710_10102231 | Ga0070710_101022312 | 154 |
| 302 | 3300006028 | Ga0070717_10128172 | Ga0070717_101281723 | 154 |
| 303 | 3300006163 | Ga0070715_10024843 | Ga0070715_100248433 | 154 |
| 304 | 3300021388 | Ga0213875_10074339 | Ga0213875_100743393 | 154 |
| 305 | 3300025261 | Ga0209233_1003610 | Ga0209233_10036103 | 154 |
| 306 | 3300025261 | Ga0209233_1017593 | Ga0209233_10175933 | 154 |
| 307 | 3300025898 | Ga0207692_10108271 | Ga0207692_101082712 | 154 |
| 308 | 3300025904 | Ga0207647_10429309 | Ga0207647_104293092 | 154 |
| 309 | 3300025929 | Ga0207664_10002586 | Ga0207664_100025867 | 154 |
| 310 | 3300033442 | Ga0315911_1000003 | Ga0315911_1000003445 | 154 |
| 311 | 3300037853 | Ga0436364_1142822 | Ga0436364_1142822_93_578 | 154 |
| 312 | 3300048905 | Ga0496102_0332893 | Ga0496102_0332893_830_1294 | 154 |
| 313 | 3300048907 | Ga0496104_1267733 | Ga0496104_1267733_86_550 | 154 |
| 314 | 3300048910 | Ga0496107_0410120 | Ga0496107_0410120_226_690 | 154 |
| 315 | 3300048924 | Ga0496121_0115405 | Ga0496121_0115405_1038_1502 | 154 |
| 316 | 3300048924 | Ga0496121_0348525 | Ga0496121_0348525_459_923 | 154 |
| 317 | 3300048929 | Ga0496126_0235255 | Ga0496126_0235255_349_813 | 154 |
| 318 | 3300048929 | Ga0496126_0423249 | Ga0496126_0423249_245_709 | 154 |
| 319 | 3300053094 | Ga0500566_0000011 | Ga0500566_0000011_68180_68644 | 154 |
| 320 | 3300053095 | Ga0500640_001527 | Ga0500640_001527_1705_2169 | 154 |
| 321 | 3300053111 | Ga0500572_000065 | Ga0500572_000065_1774_2238 | 154 |
| 322 | 3300053122 | Ga0500608_051222 | Ga0500608_051222_794_1258 | 154 |
| 323 | 3300053123 | Ga0500614_003255 | Ga0500614_003255_1814_2278 | 154 |
| 324 | 3300053136 | Ga0500559_0001798 | Ga0500559_0001798_7206_7670 | 154 |
| 325 | 3300053144 | Ga0500585_125663 | Ga0500585_125663_383_847 | 154 |
| 326 | 3300053150 | Ga0500603_000269 | Ga0500603_000269_8106_8570 | 154 |
| 327 | 3300053159 | Ga0500630_000832 | Ga0500630_000832_7755_8219 | 154 |
| 328 | 3300053162 | Ga0500638_015393 | Ga0500638_015393_2270_2734 | 154 |
| 329 | 3300053163 | Ga0500639_000079 | Ga0500639_000079_10394_10858 | 154 |
| 330 | 3300053725 | Ga0500576_089743 | Ga0500576_089743_304_768 | 154 |
| 331 | 3300053735 | Ga0500596_000987 | Ga0500596_000987_1900_2364 | 154 |
| 332 | 3300055283 | Ga0500661_032566 | Ga0500661_032566_416_880 | 154 |
| 333 | iso_pu_bacteria | 2508501128 | 2509152285 | 154 |
| 334 | iso_pu_bacteria | 2513237141 | 2513892565 | 154 |
| 335 | iso_pu_bacteria | 2857524615 | 2857525124 | 154 |
| 336 | iso_pu_bacteria | 2893066018 | 2893069707 | 154 |
| 337 | iso_pu_bacteria | 2919073203 | 2919079012 | 154 |
| 338 | 3300003214 | JGI25165J46597_1012236 | JGI25165J46597_10122362 | 155 |
| 339 | 3300003215 | JGI25153J46596_10000317 | JGI25153J46596_1000031710 | 155 |
| 340 | 3300003215 | JGI25153J46596_10005866 | JGI25153J46596_100058666 | 155 |
| 341 | 3300003320 | rootH2_10065934 | rootH2_100659343 | 155 |
| 342 | 3300003354 | JGI25160J50197_1002533 | JGI25160J50197_10025338 | 155 |
| 343 | 3300003354 | JGI25160J50197_1007102 | JGI25160J50197_10071025 | 155 |
| 344 | 3300003354 | JGI25160J50197_1024527 | JGI25160J50197_10245273 | 155 |
| 345 | 3300003354 | JGI25160J50197_1074341 | JGI25160J50197_10743411 | 155 |
| 346 | 3300003771 | Ga0055526_1046678 | Ga0055526_10466781 | 155 |
| 347 | 3300003794 | Ga0055531_10008821 | Ga0055531_100088214 | 155 |
| 348 | 3300004625 | Ga0055543_1014610 | Ga0055543_10146103 | 155 |
| 349 | 3300005262 | Ga0065165_1000747 | Ga0065165_100074718 | 155 |
| 350 | 3300005262 | Ga0065165_1004585 | Ga0065165_10045854 | 155 |
| 351 | 3300005262 | Ga0065165_1010604 | Ga0065165_10106042 | 155 |
| 352 | 3300005262 | Ga0065165_1028625 | Ga0065165_10286252 | 155 |
| 353 | 3300005262 | Ga0065165_1077487 | Ga0065165_10774872 | 155 |
| 354 | 3300005327 | Ga0070658_10136673 | Ga0070658_101366733 | 155 |
| 355 | 3300005327 | Ga0070658_10695316 | Ga0070658_106953162 | 155 |
| 356 | 3300005328 | Ga0070676_10910005 | Ga0070676_109100051 | 155 |
| 357 | 3300005335 | Ga0070666_10561502 | Ga0070666_105615021 | 155 |
| 358 | 3300005339 | Ga0070660_100250674 | Ga0070660_1002506743 | 155 |
| 359 | 3300005344 | Ga0070661_100844170 | Ga0070661_1008441702 | 155 |
| 360 | 3300005353 | Ga0070669_100856682 | Ga0070669_1008566821 | 155 |
| 361 | 3300005355 | Ga0070671_100044655 | Ga0070671_1000446554 | 155 |
| 362 | 3300005434 | Ga0070709_10250031 | Ga0070709_102500312 | 155 |
| 363 | 3300005437 | Ga0070710_10040951 | Ga0070710_100409513 | 155 |
| 364 | 3300005439 | Ga0070711_100030578 | Ga0070711_1000305783 | 155 |
| 365 | 3300005455 | Ga0070663_100034033 | Ga0070663_1000340334 | 155 |
| 366 | 3300005455 | Ga0070663_100451553 | Ga0070663_1004515531 | 155 |
| 367 | 3300005456 | Ga0070678_100313547 | Ga0070678_1003135471 | 155 |
| 368 | 3300005457 | Ga0070662_100237999 | Ga0070662_1002379993 | 155 |
| 369 | 3300005535 | Ga0070684_100396193 | Ga0070684_1003961931 | 155 |
| 370 | 3300005539 | Ga0068853_100211567 | Ga0068853_1002115672 | 155 |
| 371 | 3300005539 | Ga0068853_100483256 | Ga0068853_1004832563 | 155 |
| 372 | 3300005547 | Ga0070693_100448625 | Ga0070693_1004486251 | 155 |
| 373 | 3300005548 | Ga0070665_100051490 | Ga0070665_1000514906 | 155 |
| 374 | 3300005563 | Ga0068855_101957415 | Ga0068855_1019574151 | 155 |
| 375 | 3300005614 | Ga0068856_100079699 | Ga0068856_1000796992 | 155 |
| 376 | 3300005614 | Ga0068856_101744456 | Ga0068856_1017444561 | 155 |
| 377 | 3300005615 | Ga0070702_100672057 | Ga0070702_1006720572 | 155 |
| 378 | 3300005616 | Ga0068852_100038198 | Ga0068852_1000381984 | 155 |
| 379 | 3300005618 | Ga0068864_100278065 | Ga0068864_1002780653 | 155 |
| 380 | 3300005718 | Ga0068866_10121670 | Ga0068866_101216702 | 155 |
| 381 | 3300005719 | Ga0068861_101137133 | Ga0068861_1011371332 | 155 |
| 382 | 3300005719 | Ga0068861_101573860 | Ga0068861_1015738602 | 155 |
| 383 | 3300005983 | Ga0081540_1076996 | Ga0081540_10769963 | 155 |
| 384 | 3300006038 | Ga0075365_10033778 | Ga0075365_100337782 | 155 |
| 385 | 3300006038 | Ga0075365_10055451 | Ga0075365_100554512 | 155 |
| 386 | 3300006038 | Ga0075365_10243968 | Ga0075365_102439682 | 155 |
| 387 | 3300006042 | Ga0075368_10011424 | Ga0075368_100114244 | 155 |
| 388 | 3300006048 | Ga0075363_100002488 | Ga0075363_1000024882 | 155 |
| 389 | 3300006048 | Ga0075363_100024676 | Ga0075363_1000246763 | 155 |
| 390 | 3300006051 | Ga0075364_10215443 | Ga0075364_102154432 | 155 |
| 391 | 3300006051 | Ga0075364_10869894 | Ga0075364_108698941 | 155 |
| 392 | 3300006173 | Ga0070716_100153302 | Ga0070716_1001533023 | 155 |
| 393 | 3300006175 | Ga0070712_100630173 | Ga0070712_1006301732 | 155 |
| 394 | 3300006178 | Ga0075367_10720220 | Ga0075367_107202201 | 155 |
| 395 | 3300006186 | Ga0075369_10005844 | Ga0075369_100058441 | 155 |
| 396 | 3300006186 | Ga0075369_10011717 | Ga0075369_100117173 | 155 |
| 397 | 3300006186 | Ga0075369_10220726 | Ga0075369_102207262 | 155 |
| 398 | 3300006195 | Ga0075366_10033470 | Ga0075366_100334702 | 155 |
| 399 | 3300006353 | Ga0075370_10038846 | Ga0075370_100388464 | 155 |
| 400 | 3300006353 | Ga0075370_10082329 | Ga0075370_100823293 | 155 |
| 401 | 3300006881 | Ga0068865_101133321 | Ga0068865_1011333212 | 155 |
| 402 | 3300006943 | Ga0099822_1065794 | Ga0099822_10657942 | 155 |
| 403 | 3300009101 | Ga0105247_10034754 | Ga0105247_100347544 | 155 |
| 404 | 3300009101 | Ga0105247_10121990 | Ga0105247_101219903 | 155 |
| 405 | 3300009148 | Ga0105243_10387430 | Ga0105243_103874303 | 155 |
| 406 | 3300009174 | Ga0105241_10082425 | Ga0105241_100824253 | 155 |
| 407 | 3300009177 | Ga0105248_10167112 | Ga0105248_101671123 | 155 |
| 408 | 3300009177 | Ga0105248_10945710 | Ga0105248_109457102 | 155 |
| 409 | 3300009177 | Ga0105248_11042714 | Ga0105248_110427142 | 155 |
| 410 | 3300009545 | Ga0105237_10047158 | Ga0105237_100471586 | 155 |
| 411 | 3300009545 | Ga0105237_10683805 | Ga0105237_106838052 | 155 |
| 412 | 3300009545 | Ga0105237_10824915 | Ga0105237_108249152 | 155 |
| 413 | 3300009551 | Ga0105238_10151847 | Ga0105238_101518472 | 155 |
| 414 | 3300009551 | Ga0105238_10754634 | Ga0105238_107546341 | 155 |
| 415 | 3300010375 | Ga0105239_10578048 | Ga0105239_105780483 | 155 |
| 416 | 3300011119 | Ga0105246_10013775 | Ga0105246_100137754 | 155 |
| 417 | 3300013104 | Ga0157370_10643066 | Ga0157370_106430662 | 155 |
| 418 | 3300013105 | Ga0157369_10616948 | Ga0157369_106169482 | 155 |
| 419 | 3300013296 | Ga0157374_10040321 | Ga0157374_100403213 | 155 |
| 420 | 3300013297 | Ga0157378_10662215 | Ga0157378_106622153 | 155 |
| 421 | 3300013297 | Ga0157378_10934671 | Ga0157378_109346711 | 155 |
| 422 | 3300013306 | Ga0163162_10163138 | Ga0163162_101631383 | 155 |
| 423 | 3300013307 | Ga0157372_10782245 | Ga0157372_107822452 | 155 |
| 424 | 3300013308 | Ga0157375_10063269 | Ga0157375_100632695 | 155 |
| 425 | 3300014325 | Ga0163163_10177238 | Ga0163163_101772383 | 155 |
| 426 | 3300014968 | Ga0157379_10614098 | Ga0157379_106140982 | 155 |
| 427 | 3300017792 | Ga0163161_10566890 | Ga0163161_105668902 | 155 |
| 428 | 3300021321 | Ga0214542_1001925 | Ga0214542_100192533 | 155 |
| 429 | 3300021324 | Ga0214545_1000003 | Ga0214545_1000003216 | 155 |
| 430 | 3300021327 | Ga0214543_1000002 | Ga0214543_1000002550 | 155 |
| 431 | 3300024227 | Ga0228598_1003083 | Ga0228598_10030835 | 155 |
| 432 | 3300025230 | Ga0209563_100325 | Ga0209563_1003254 | 155 |
| 433 | 3300025245 | Ga0207425_1030815 | Ga0207425_10308152 | 155 |
| 434 | 3300025253 | Ga0209677_102346 | Ga0209677_1023466 | 155 |
| 435 | 3300025254 | Ga0209148_1000812 | Ga0209148_100081217 | 155 |
| 436 | 3300025261 | Ga0209233_1002884 | Ga0209233_10028847 | 155 |
| 437 | 3300025261 | Ga0209233_1008563 | Ga0209233_10085632 | 155 |
| 438 | 3300025273 | Ga0209673_1045625 | Ga0209673_10456252 | 155 |
| 439 | 3300025295 | Ga0209564_1005325 | Ga0209564_10053258 | 155 |
| 440 | 3300025295 | Ga0209564_1016531 | Ga0209564_10165313 | 155 |
| 441 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011537 | 155 |
| 442 | 3300025297 | Ga0209758_1000120 | Ga0209758_100012036 | 155 |
| 443 | 3300025297 | Ga0209758_1001848 | Ga0209758_100184814 | 155 |
| 444 | 3300025297 | Ga0209758_1008838 | Ga0209758_10088383 | 155 |
| 445 | 3300025297 | Ga0209758_1018387 | Ga0209758_10183874 | 155 |
| 446 | 3300025297 | Ga0209758_1069994 | Ga0209758_10699943 | 155 |
| 447 | 3300025297 | Ga0209758_1075221 | Ga0209758_10752212 | 155 |
| 448 | 3300025299 | Ga0209256_1010441 | Ga0209256_10104413 | 155 |
| 449 | 3300025299 | Ga0209256_1040226 | Ga0209256_10402261 | 155 |
| 450 | 3300025302 | Ga0207426_1000328 | Ga0207426_10003287 | 155 |
| 451 | 3300025302 | Ga0207426_1000458 | Ga0207426_100045815 | 155 |
| 452 | 3300025302 | Ga0207426_1006703 | Ga0207426_10067033 | 155 |
| 453 | 3300025302 | Ga0207426_1066486 | Ga0207426_10664862 | 155 |
| 454 | 3300025303 | Ga0209051_1089771 | Ga0209051_10897711 | 155 |
| 455 | 3300025304 | Ga0209257_1001101 | Ga0209257_10011019 | 155 |
| 456 | 3300025304 | Ga0209257_1030664 | Ga0209257_10306643 | 155 |
| 457 | 3300025315 | Ga0207697_10413234 | Ga0207697_104132342 | 155 |
| 458 | 3300025321 | Ga0207656_10147548 | Ga0207656_101475482 | 155 |
| 459 | 3300025898 | Ga0207692_10040116 | Ga0207692_100401163 | 155 |
| 460 | 3300025904 | Ga0207647_10008820 | Ga0207647_100088204 | 155 |
| 461 | 3300025904 | Ga0207647_10532657 | Ga0207647_105326571 | 155 |
| 462 | 3300025906 | Ga0207699_10085855 | Ga0207699_100858553 | 155 |
| 463 | 3300025908 | Ga0207643_10728021 | Ga0207643_107280211 | 155 |
| 464 | 3300025909 | Ga0207705_10195132 | Ga0207705_101951323 | 155 |
| 465 | 3300025914 | Ga0207671_10056823 | Ga0207671_100568233 | 155 |
| 466 | 3300025915 | Ga0207693_10539021 | Ga0207693_105390212 | 155 |
| 467 | 3300025916 | Ga0207663_10140152 | Ga0207663_101401522 | 155 |
| 468 | 3300025920 | Ga0207649_10684652 | Ga0207649_106846522 | 155 |
| 469 | 3300025924 | Ga0207694_10071234 | Ga0207694_100712342 | 155 |
| 470 | 3300025924 | Ga0207694_10208299 | Ga0207694_102082993 | 155 |
| 471 | 3300025924 | Ga0207694_11140667 | Ga0207694_111406671 | 155 |
| 472 | 3300025929 | Ga0207664_10378557 | Ga0207664_103785572 | 155 |
| 473 | 3300025932 | Ga0207690_11302912 | Ga0207690_113029121 | 155 |
| 474 | 3300025933 | Ga0207706_10261499 | Ga0207706_102614992 | 155 |
| 475 | 3300025939 | Ga0207665_10116671 | Ga0207665_101166713 | 155 |
| 476 | 3300025942 | Ga0207689_11596551 | Ga0207689_115965511 | 155 |
| 477 | 3300025949 | Ga0207667_10189492 | Ga0207667_101894923 | 155 |
| 478 | 3300025949 | Ga0207667_11684186 | Ga0207667_116841862 | 155 |
| 479 | 3300025961 | Ga0207712_11310256 | Ga0207712_113102561 | 155 |
| 480 | 3300025972 | Ga0207668_10030855 | Ga0207668_100308552 | 155 |
| 481 | 3300026035 | Ga0207703_10812025 | Ga0207703_108120252 | 155 |
| 482 | 3300026067 | Ga0207678_10022393 | Ga0207678_100223934 | 155 |
| 483 | 3300026067 | Ga0207678_10034200 | Ga0207678_100342004 | 155 |
| 484 | 3300026067 | Ga0207678_10154732 | Ga0207678_101547323 | 155 |
| 485 | 3300026078 | Ga0207702_10087083 | Ga0207702_100870832 | 155 |
| 486 | 3300026078 | Ga0207702_11190195 | Ga0207702_111901952 | 155 |
| 487 | 3300026095 | Ga0207676_10209105 | Ga0207676_102091053 | 155 |
| 488 | 3300026116 | Ga0207674_10167564 | Ga0207674_101675644 | 155 |
| 489 | 3300026118 | Ga0207675_100537114 | Ga0207675_1005371142 | 155 |
| 490 | 3300026118 | Ga0207675_101535517 | Ga0207675_1015355172 | 155 |
| 491 | 3300026121 | Ga0207683_10469443 | Ga0207683_104694432 | 155 |
| 492 | 3300026142 | Ga0207698_10138196 | Ga0207698_101381962 | 155 |
| 493 | 3300027296 | Ga0209389_1000043 | Ga0209389_100004318 | 155 |
| 494 | 3300027296 | Ga0209389_1000077 | Ga0209389_100007784 | 155 |
| 495 | 3300027357 | Ga0209589_1000047 | Ga0209589_100004793 | 155 |
| 496 | 3300027361 | Ga0209489_100075 | Ga0209489_100075125 | 155 |
| 497 | 3300027361 | Ga0209489_100251 | Ga0209489_10025184 | 155 |
| 498 | 3300027363 | Ga0209700_100271 | Ga0209700_10027184 | 155 |
| 499 | 3300027866 | Ga0209813_10049013 | Ga0209813_100490132 | 155 |
| 500 | 3300028379 | Ga0268266_10022295 | Ga0268266_100222952 | 155 |
| 501 | 3300028379 | Ga0268266_10759427 | Ga0268266_107594273 | 155 |
| 502 | 3300028379 | Ga0268266_11808682 | Ga0268266_118086821 | 155 |
| 503 | 3300031616 | Ga0307508_10340520 | Ga0307508_103405203 | 155 |
| 504 | 3300035089 | Ga0373944_0357454 | Ga0373944_0357454_16_483 | 155 |
| 505 | 3300035695 | Ga0373927_0083817 | Ga0373927_0083817_1408_1875 | 155 |
| 506 | 3300037068 | Ga0373925_0038336 | Ga0373925_0038336_1178_1645 | 155 |
| 507 | 3300037418 | Ga0395900_0485656 | Ga0395900_0485656_155_622 | 155 |
| 508 | 3300037471 | Ga0395905_0015460 | Ga0395905_0015460_494_961 | 155 |
| 509 | 3300037471 | Ga0395905_0031994 | Ga0395905_0031994_1912_2379 | 155 |
| 510 | 3300039437 | Ga0436365_0312278 | Ga0436365_0312278_206_682 | 155 |
| 511 | 3300039438 | Ga0436360_0926138 | Ga0436360_0926138_56_532 | 155 |
| 512 | 3300041453 | Ga0451797_0393201 | Ga0451797_0393201_63_530 | 155 |
| 513 | 3300041456 | Ga0451795_1029459 | Ga0451795_1029459_188_655 | 155 |
| 514 | 3300041460 | Ga0451802_0275182 | Ga0451802_0275182_154_621 | 155 |
| 515 | 3300041503 | Ga0451847_0789714 | Ga0451847_0789714_246_713 | 155 |
| 516 | 3300042012 | Ga0439455_0055061 | Ga0439455_0055061_419_886 | 155 |
| 517 | 3300044658 | Ga0466972_0000079 | Ga0466972_0000079_68203_68670 | 155 |
| 518 | 3300044658 | Ga0466972_0001061 | Ga0466972_0001061_1831_2298 | 155 |
| 519 | 3300044683 | Ga0466965_0247552 | Ga0466965_0247552_285_752 | 155 |
| 520 | 3300044683 | Ga0466965_0323623 | Ga0466965_0323623_62_529 | 155 |
| 521 | 3300044683 | Ga0466965_0532943 | Ga0466965_0532943_159_626 | 155 |
| 522 | 3300044684 | Ga0466966_0058132 | Ga0466966_0058132_491_958 | 155 |
| 523 | 3300044706 | Ga0466964_0144189 | Ga0466964_0144189_362_829 | 155 |
| 524 | 3300044706 | Ga0466964_0178972 | Ga0466964_0178972_456_923 | 155 |
| 525 | 3300044706 | Ga0466964_0253871 | Ga0466964_0253871_228_695 | 155 |
| 526 | 3300044735 | Ga0466968_0010560 | Ga0466968_0010560_2092_2559 | 155 |
| 527 | 3300044735 | Ga0466968_0193789 | Ga0466968_0193789_125_592 | 155 |
| 528 | 3300044842 | Ga0466957_0093861 | Ga0466957_0093861_771_1238 | 155 |
| 529 | 3300044842 | Ga0466957_0284174 | Ga0466957_0284174_400_867 | 155 |
| 530 | 3300045049 | Ga0466959_0040060 | Ga0466959_0040060_357_824 | 155 |
| 531 | 3300045836 | Ga0466958_0642977 | Ga0466958_0642977_179_646 | 155 |
| 532 | 3300045976 | Ga0466967_0202886 | Ga0466967_0202886_190_657 | 155 |
| 533 | 3300046454 | Ga0495592_0011606 | Ga0495592_0011606_2641_3108 | 155 |
| 534 | 3300046455 | Ga0495603_0280312 | Ga0495603_0280312_216_683 | 155 |
| 535 | 3300046457 | Ga0495590_0175671 | Ga0495590_0175671_65_532 | 155 |
| 536 | 3300046459 | Ga0495629_0274632 | Ga0495629_0274632_509_976 | 155 |
| 537 | 3300046460 | Ga0495638_0020090 | Ga0495638_0020090_2076_2543 | 155 |
| 538 | 3300046462 | Ga0495651_0029360 | Ga0495651_0029360_3351_3818 | 155 |
| 539 | 3300046474 | Ga0495605_0174422 | Ga0495605_0174422_246_713 | 155 |
| 540 | 3300046475 | Ga0495639_0275106 | Ga0495639_0275106_194_661 | 155 |
| 541 | 3300046477 | Ga0495664_0056145 | Ga0495664_0056145_544_1011 | 155 |
| 542 | 3300046477 | Ga0495664_0092363 | Ga0495664_0092363_313_780 | 155 |
| 543 | 3300046500 | Ga0495596_0186849 | Ga0495596_0186849_282_749 | 155 |
| 544 | 3300046507 | Ga0495606_0006998 | Ga0495606_0006998_3759_4226 | 155 |
| 545 | 3300046507 | Ga0495606_0066480 | Ga0495606_0066480_307_774 | 155 |
| 546 | 3300046511 | Ga0495608_0112357 | Ga0495608_0112357_1042_1509 | 155 |
| 547 | 3300046512 | Ga0495610_0300481 | Ga0495610_0300481_99_566 | 155 |
| 548 | 3300046513 | Ga0495616_0260402 | Ga0495616_0260402_85_552 | 155 |
| 549 | 3300046513 | Ga0495616_0272750 | Ga0495616_0272750_133_600 | 155 |
| 550 | 3300046513 | Ga0495616_0320530 | Ga0495616_0320530_86_553 | 155 |
| 551 | 3300046516 | Ga0495628_0012530 | Ga0495628_0012530_4708_5175 | 155 |
| 552 | 3300046522 | Ga0495643_0005954 | Ga0495643_0005954_7636_8103 | 155 |
| 553 | 3300046522 | Ga0495643_0138335 | Ga0495643_0138335_488_955 | 155 |
| 554 | 3300046524 | Ga0495648_0037099 | Ga0495648_0037099_312_779 | 155 |
| 555 | 3300046524 | Ga0495648_0041864 | Ga0495648_0041864_1037_1504 | 155 |
| 556 | 3300046524 | Ga0495648_0156846 | Ga0495648_0156846_604_1071 | 155 |
| 557 | 3300046524 | Ga0495648_0222277 | Ga0495648_0222277_105_572 | 155 |
| 558 | 3300046529 | Ga0495652_0440217 | Ga0495652_0440217_217_684 | 155 |
| 559 | 3300046533 | Ga0495640_0028223 | Ga0495640_0028223_3154_3621 | 155 |
| 560 | 3300046536 | Ga0495587_0014340 | Ga0495587_0014340_3377_3844 | 155 |
| 561 | 3300046543 | Ga0495645_0007155 | Ga0495645_0007155_3009_3476 | 155 |
| 562 | 3300046543 | Ga0495645_0202750 | Ga0495645_0202750_470_937 | 155 |
| 563 | 3300046557 | Ga0495622_0052657 | Ga0495622_0052657_172_639 | 155 |
| 564 | 3300046559 | Ga0495667_0006892 | Ga0495667_0006892_4122_4589 | 155 |
| 565 | 3300046616 | Ga0495668_0282928 | Ga0495668_0282928_299_766 | 155 |
| 566 | 3300046648 | Ga0495611_0037207 | Ga0495611_0037207_1282_1749 | 155 |
| 567 | 3300046660 | Ga0495625_0116759 | Ga0495625_0116759_118_585 | 155 |
| 568 | 3300046660 | Ga0495625_0168223 | Ga0495625_0168223_594_1061 | 155 |
| 569 | 3300046663 | Ga0495635_0051638 | Ga0495635_0051638_2091_2558 | 155 |
| 570 | 3300046665 | Ga0495661_0254082 | Ga0495661_0254082_406_873 | 155 |
| 571 | 3300046674 | Ga0495588_0011004 | Ga0495588_0011004_1104_1571 | 155 |
| 572 | 3300046674 | Ga0495588_0112702 | Ga0495588_0112702_950_1417 | 155 |
| 573 | 3300046675 | Ga0495657_0019556 | Ga0495657_0019556_4054_4521 | 155 |
| 574 | 3300046679 | Ga0495623_0032327 | Ga0495623_0032327_1360_1827 | 155 |
| 575 | 3300046680 | Ga0495646_0010341 | Ga0495646_0010341_773_1240 | 155 |
| 576 | 3300046683 | Ga0495658_0485641 | Ga0495658_0485641_226_693 | 155 |
| 577 | 3300046689 | Ga0495613_0086480 | Ga0495613_0086480_195_662 | 155 |
| 578 | 3300046692 | Ga0495671_0234698 | Ga0495671_0234698_103_570 | 155 |
| 579 | 3300046692 | Ga0495671_0239628 | Ga0495671_0239628_71_538 | 155 |
| 580 | 3300046694 | Ga0495649_0315524 | Ga0495649_0315524_66_533 | 155 |
| 581 | 3300046809 | Ga0495600_0091391 | Ga0495600_0091391_1021_1488 | 155 |
| 582 | 3300047315 | Ga0495581_0250556 | Ga0495581_0250556_106_573 | 155 |
| 583 | 3300047317 | Ga0495604_0004988 | Ga0495604_0004988_9805_10272 | 155 |
| 584 | 3300047319 | Ga0495674_0042923 | Ga0495674_0042923_3019_3486 | 155 |
| 585 | 3300047319 | Ga0495674_0749626 | Ga0495674_0749626_89_556 | 155 |
| 586 | 3300047321 | Ga0495676_0447583 | Ga0495676_0447583_314_781 | 155 |
| 587 | 3300047322 | Ga0495680_0025139 | Ga0495680_0025139_3077_3544 | 155 |
| 588 | 3300047323 | Ga0495683_0083558 | Ga0495683_0083558_379_846 | 155 |
| 589 | 3300047323 | Ga0495683_0246511 | Ga0495683_0246511_133_600 | 155 |
| 590 | 3300047443 | Ga0495687_014302 | Ga0495687_014302_3522_3989 | 155 |
| 591 | 3300047444 | Ga0495675_0027294 | Ga0495675_0027294_877_1344 | 155 |
| 592 | 3300047445 | Ga0495677_0046237 | Ga0495677_0046237_39_506 | 155 |
| 593 | 3300047469 | Ga0495673_0079869 | Ga0495673_0079869_687_1154 | 155 |
| 594 | 3300047472 | Ga0495686_0057595 | Ga0495686_0057595_113_580 | 155 |
| 595 | 3300047472 | Ga0495686_0301996 | Ga0495686_0301996_239_706 | 155 |
| 596 | 3300047472 | Ga0495686_0372181 | Ga0495686_0372181_37_504 | 155 |
| 597 | 3300048088 | Ga0495602_0011752 | Ga0495602_0011752_240_707 | 155 |
| 598 | 3300048903 | Ga0496100_0038138 | Ga0496100_0038138_2401_2868 | 155 |
| 599 | 3300048903 | Ga0496100_0081519 | Ga0496100_0081519_47_514 | 155 |
| 600 | 3300048903 | Ga0496100_0213578 | Ga0496100_0213578_234_701 | 155 |
| 601 | 3300048904 | Ga0496101_0033698 | Ga0496101_0033698_2390_2857 | 155 |
| 602 | 3300048904 | Ga0496101_0235397 | Ga0496101_0235397_213_680 | 155 |
| 603 | 3300048905 | Ga0496102_0067964 | Ga0496102_0067964_2308_2775 | 155 |
| 604 | 3300048906 | Ga0496103_0317532 | Ga0496103_0317532_407_874 | 155 |
| 605 | 3300048907 | Ga0496104_0080908 | Ga0496104_0080908_948_1415 | 155 |
| 606 | 3300048907 | Ga0496104_0346005 | Ga0496104_0346005_746_1213 | 155 |
| 607 | 3300048908 | Ga0496105_0051555 | Ga0496105_0051555_348_815 | 155 |
| 608 | 3300048908 | Ga0496105_0368735 | Ga0496105_0368735_500_967 | 155 |
| 609 | 3300048909 | Ga0496106_0098072 | Ga0496106_0098072_1055_1522 | 155 |
| 610 | 3300048909 | Ga0496106_0200627 | Ga0496106_0200627_40_507 | 155 |
| 611 | 3300048911 | Ga0496108_0028679 | Ga0496108_0028679_2780_3247 | 155 |
| 612 | 3300048913 | Ga0496110_0062445 | Ga0496110_0062445_1140_1607 | 155 |
| 613 | 3300048913 | Ga0496110_0164218 | Ga0496110_0164218_1438_1905 | 155 |
| 614 | 3300048914 | Ga0496111_0028576 | Ga0496111_0028576_1249_1716 | 155 |
| 615 | 3300048915 | Ga0496112_0336783 | Ga0496112_0336783_922_1389 | 155 |
| 616 | 3300048915 | Ga0496112_0594801 | Ga0496112_0594801_262_729 | 155 |
| 617 | 3300048916 | Ga0496113_0039228 | Ga0496113_0039228_2046_2513 | 155 |
| 618 | 3300048918 | Ga0496115_0065715 | Ga0496115_0065715_2331_2798 | 155 |
| 619 | 3300048918 | Ga0496115_0144469 | Ga0496115_0144469_1484_1951 | 155 |
| 620 | 3300048918 | Ga0496115_0769491 | Ga0496115_0769491_45_512 | 155 |
| 621 | 3300048919 | Ga0496116_0088080 | Ga0496116_0088080_859_1326 | 155 |
| 622 | 3300048920 | Ga0496117_0273014 | Ga0496117_0273014_161_628 | 155 |
| 623 | 3300048921 | Ga0496118_0095578 | Ga0496118_0095578_1352_1819 | 155 |
| 624 | 3300048921 | Ga0496118_0153750 | Ga0496118_0153750_799_1266 | 155 |
| 625 | 3300048921 | Ga0496118_0161367 | Ga0496118_0161367_369_836 | 155 |
| 626 | 3300048922 | Ga0496119_0093315 | Ga0496119_0093315_921_1388 | 155 |
| 627 | 3300048922 | Ga0496119_0422530 | Ga0496119_0422530_99_566 | 155 |
| 628 | 3300048923 | Ga0496120_0070618 | Ga0496120_0070618_828_1295 | 155 |
| 629 | 3300048924 | Ga0496121_0037977 | Ga0496121_0037977_593_1060 | 155 |
| 630 | 3300048924 | Ga0496121_0126057 | Ga0496121_0126057_877_1344 | 155 |
| 631 | 3300048924 | Ga0496121_0651957 | Ga0496121_0651957_88_555 | 155 |
| 632 | 3300048924 | Ga0496121_0801137 | Ga0496121_0801137_72_539 | 155 |
| 633 | 3300048926 | Ga0496123_0335761 | Ga0496123_0335761_64_531 | 155 |
| 634 | 3300048928 | Ga0496125_0219108 | Ga0496125_0219108_656_1123 | 155 |
| 635 | 3300048929 | Ga0496126_0009242 | Ga0496126_0009242_4419_4904 | 155 |
| 636 | 3300048929 | Ga0496126_0250513 | Ga0496126_0250513_589_1056 | 155 |
| 637 | 3300048929 | Ga0496126_0888035 | Ga0496126_0888035_65_532 | 155 |
| 638 | 3300049460 | Ga0495682_0018342 | Ga0495682_0018342_1759_2226 | 155 |
| 639 | 3300049583 | Ga0501067_0174653 | Ga0501067_0174653_390_857 | 155 |
| 640 | 3300050490 | nmdc:mga03n38_260384_c1 | nmdc:mga03n38_260384_c1_113_589 | 155 |
| 641 | 3300050491 | nmdc:mga00v17_242288_c1 | nmdc:mga00v17_242288_c1_646_1113 | 155 |
| 642 | 3300050492 | nmdc:mga0yw44_139702_c1 | nmdc:mga0yw44_139702_c1_765_1232 | 155 |
| 643 | 3300050492 | nmdc:mga0yw44_16709_c1 | nmdc:mga0yw44_16709_c1_2560_3027 | 155 |
| 644 | 3300050492 | nmdc:mga0yw44_47972_c1 | nmdc:mga0yw44_47972_c1_418_885 | 155 |
| 645 | 3300050492 | nmdc:mga0yw44_99641_c1 | nmdc:mga0yw44_99641_c1_541_1008 | 155 |
| 646 | 3300050493 | nmdc:mga0k408_444816_c1 | nmdc:mga0k408_444816_c1_37_504 | 155 |
| 647 | 3300050494 | nmdc:mga06z11_15389_c1 | nmdc:mga06z11_15389_c1_620_1096 | 155 |
| 648 | 3300050494 | nmdc:mga06z11_319944_c1 | nmdc:mga06z11_319944_c1_440_907 | 155 |
| 649 | 3300050494 | nmdc:mga06z11_93936_c1 | nmdc:mga06z11_93936_c1_156_623 | 155 |
| 650 | 3300050496 | nmdc:mga07m45_44129_c1 | nmdc:mga07m45_44129_c1_895_1362 | 155 |
| 651 | 3300050516 | nmdc:mga0sz30_176394_c1 | nmdc:mga0sz30_176394_c1_103_570 | 155 |
| 652 | 3300050516 | nmdc:mga0sz30_20155_c1 | nmdc:mga0sz30_20155_c1_239_715 | 155 |
| 653 | 3300053077 | Ga0495601_0035469 | Ga0495601_0035469_1708_2175 | 155 |
| 654 | 3300053078 | Ga0495612_0146753 | Ga0495612_0146753_143_613 | 155 |
| 655 | 3300053085 | Ga0495619_0022726 | Ga0495619_0022726_1501_1968 | 155 |
| 656 | 3300053086 | Ga0500578_0140992 | Ga0500578_0140992_490_957 | 155 |
| 657 | 3300053086 | Ga0500578_0235380 | Ga0500578_0235380_234_701 | 155 |
| 658 | 3300053086 | Ga0500578_0375011 | Ga0500578_0375011_300_767 | 155 |
| 659 | 3300053086 | Ga0500578_0505167 | Ga0500578_0505167_136_603 | 155 |
| 660 | 3300053087 | Ga0500643_000150 | Ga0500643_000150_66628_67095 | 155 |
| 661 | 3300053092 | Ga0500583_0279806 | Ga0500583_0279806_11_478 | 155 |
| 662 | 3300053095 | Ga0500640_077058 | Ga0500640_077058_916_1383 | 155 |
| 663 | 3300053096 | Ga0500641_0351311 | Ga0500641_0351311_39_506 | 155 |
| 664 | 3300053098 | Ga0500650_0120302 | Ga0500650_0120302_441_917 | 155 |
| 665 | 3300053103 | Ga0500555_001186 | Ga0500555_001186_6958_7425 | 155 |
| 666 | 3300053104 | Ga0500556_0011102 | Ga0500556_0011102_2154_2621 | 155 |
| 667 | 3300053105 | Ga0500557_000062 | Ga0500557_000062_39056_39523 | 155 |
| 668 | 3300053108 | Ga0500562_027854 | Ga0500562_027854_213_680 | 155 |
| 669 | 3300053111 | Ga0500572_041328 | Ga0500572_041328_804_1271 | 155 |
| 670 | 3300053119 | Ga0500595_030732 | Ga0500595_030732_360_827 | 155 |
| 671 | 3300053121 | Ga0500607_022647 | Ga0500607_022647_2707_3174 | 155 |
| 672 | 3300053123 | Ga0500614_018221 | Ga0500614_018221_382_849 | 155 |
| 673 | 3300053126 | Ga0500621_221152 | Ga0500621_221152_29_496 | 155 |
| 674 | 3300053128 | Ga0500626_033792 | Ga0500626_033792_1302_1769 | 155 |
| 675 | 3300053130 | Ga0500642_0000127 | Ga0500642_0000127_20644_21111 | 155 |
| 676 | 3300053130 | Ga0500642_0168026 | Ga0500642_0168026_318_785 | 155 |
| 677 | 3300053134 | Ga0500658_0233060 | Ga0500658_0233060_101_568 | 155 |
| 678 | 3300053136 | Ga0500559_0077325 | Ga0500559_0077325_107_574 | 155 |
| 679 | 3300053137 | Ga0500561_0253713 | Ga0500561_0253713_74_541 | 155 |
| 680 | 3300053142 | Ga0500577_0115812 | Ga0500577_0115812_156_623 | 155 |
| 681 | 3300053142 | Ga0500577_0314212 | Ga0500577_0314212_57_524 | 155 |
| 682 | 3300053145 | Ga0500586_058255 | Ga0500586_058255_71_538 | 155 |
| 683 | 3300053147 | Ga0500589_080197 | Ga0500589_080197_11_478 | 155 |
| 684 | 3300053148 | Ga0500590_206896 | Ga0500590_206896_300_767 | 155 |
| 685 | 3300053151 | Ga0500604_0018478 | Ga0500604_0018478_1143_1610 | 155 |
| 686 | 3300053153 | Ga0500616_0042038 | Ga0500616_0042038_605_1072 | 155 |
| 687 | 3300053155 | Ga0500620_016390 | Ga0500620_016390_285_752 | 155 |
| 688 | 3300053156 | Ga0500622_0062318 | Ga0500622_0062318_680_1147 | 155 |
| 689 | 3300053157 | Ga0500624_007439 | Ga0500624_007439_395_862 | 155 |
| 690 | 3300053158 | Ga0500627_0018363 | Ga0500627_0018363_1046_1513 | 155 |
| 691 | 3300053162 | Ga0500638_022359 | Ga0500638_022359_2259_2726 | 155 |
| 692 | 3300053163 | Ga0500639_178108 | Ga0500639_178108_237_704 | 155 |
| 693 | 3300053177 | Ga0500636_0000041 | Ga0500636_0000041_17468_17935 | 155 |
| 694 | 3300053177 | Ga0500636_0088163 | Ga0500636_0088163_1173_1640 | 155 |
| 695 | 3300053178 | Ga0500637_0391727 | Ga0500637_0391727_186_653 | 155 |
| 696 | 3300053727 | Ga0500611_099126 | Ga0500611_099126_240_707 | 155 |
| 697 | 3300053730 | Ga0500645_010714 | Ga0500645_010714_2178_2645 | 155 |
| 698 | 3300053730 | Ga0500645_018852 | Ga0500645_018852_953_1429 | 155 |
| 699 | 3300053736 | Ga0500599_018322 | Ga0500599_018322_101_568 | 155 |
| 700 | 3300053737 | Ga0500601_000306 | Ga0500601_000306_534_1001 | 155 |
| 701 | 3300061719 | Ga0466962_0232804 | Ga0466962_0232804_16_483 | 155 |
| 702 | iso_pu_bacteria | 2513237101 | 2513693726 | 155 |
| 703 | iso_pu_bacteria | 2728368998 | 2728755522 | 155 |
| 704 | iso_pu_bacteria | 2791355199 | 2793083972 | 155 |
| 705 | iso_pu_bacteria | 2874604998 | 2874611590 | 155 |
| 706 | iso_pu_bacteria | 2876808645 | 2876813624 | 155 |
| 707 | iso_pu_bacteria | 2879110137 | 2879117447 | 155 |
| 708 | iso_pu_bacteria | 2889033259 | 2889037809 | 155 |
| 709 | iso_pu_bacteria | 2904690495 | 2904698943 | 155 |
| 710 | iso_pu_bacteria | 2908756301 | 2908758740 | 155 |
| 711 | iso_pu_bacteria | 2922361189 | 2922361756 | 155 |
| 712 | iso_pu_bacteria | 2922386360 | 2922386999 | 155 |
| 713 | iso_pu_bacteria | 2941507105 | 2941512378 | 155 |
| 714 | iso_pu_bacteria | 2941515067 | 2941520117 | 155 |
| 715 | iso_pu_bacteria | 2941523033 | 2941528266 | 155 |
| 716 | iso_pu_bacteria | 8006964411 | 8006966870 | 155 |
| 717 | iso_pu_bacteria | 8006984368 | 8006984622 | 155 |
| 718 | iso_pu_bacteria | 8006994254 | 8006994622 | 155 |
| 719 | iso_pu_bacteria | 8056673599 | 8056680911 | 155 |
| 720 | 3300006038 | Ga0075365_11039466 | Ga0075365_110394662 | 156 |
| 721 | 3300031247 | Ga0265340_10378982 | Ga0265340_103789822 | 156 |
| 722 | 3300048927 | Ga0496124_0830069 | Ga0496124_0830069_31_501 | 156 |
| 723 | 3300048929 | Ga0496126_0157082 | Ga0496126_0157082_35_505 | 156 |
| 724 | 3300050492 | nmdc:mga0yw44_907756_c1 | nmdc:mga0yw44_907756_c1_14_484 | 156 |
| 725 | 3300003322 | rootL2_10158942 | rootL2_101589421 | 157 |
| 726 | 3300005331 | Ga0070670_100851133 | Ga0070670_1008511332 | 157 |
| 727 | 3300005456 | Ga0070678_100060204 | Ga0070678_1000602043 | 157 |
| 728 | 3300005539 | Ga0068853_100068998 | Ga0068853_1000689982 | 157 |
| 729 | 3300005543 | Ga0070672_100119392 | Ga0070672_1001193923 | 157 |
| 730 | 3300005548 | Ga0070665_100053413 | Ga0070665_1000534134 | 157 |
| 731 | 3300006038 | Ga0075365_10131425 | Ga0075365_101314253 | 157 |
| 732 | 3300009545 | Ga0105237_10021234 | Ga0105237_100212345 | 157 |
| 733 | 3300009551 | Ga0105238_10027647 | Ga0105238_100276475 | 157 |
| 734 | 3300010159 | Ga0099796_10071633 | Ga0099796_100716332 | 157 |
| 735 | 3300025920 | Ga0207649_10932267 | Ga0207649_109322672 | 157 |
| 736 | 3300025924 | Ga0207694_10040173 | Ga0207694_100401733 | 157 |
| 737 | 3300025925 | Ga0207650_10925300 | Ga0207650_109253001 | 157 |
| 738 | 3300025940 | Ga0207691_10149913 | Ga0207691_101499133 | 157 |
| 739 | 3300025949 | Ga0207667_10168621 | Ga0207667_101686214 | 157 |
| 740 | 3300026041 | Ga0207639_10089016 | Ga0207639_100890162 | 157 |
| 741 | 3300026121 | Ga0207683_10037123 | Ga0207683_100371233 | 157 |
| 742 | 3300047320 | Ga0495672_0078591 | Ga0495672_0078591_1242_1715 | 157 |
| 743 | 3300048917 | Ga0496114_0376999 | Ga0496114_0376999_203_676 | 157 |
| 744 | 3300048925 | Ga0496122_0049838 | Ga0496122_0049838_1662_2138 | 157 |
| 745 | 3300048928 | Ga0496125_0000048 | Ga0496125_0000048_157605_158081 | 157 |
| 746 | 3300050492 | nmdc:mga0yw44_263826_c1 | nmdc:mga0yw44_263826_c1_348_821 | 157 |
| 747 | 3300005336 | Ga0070680_100142232 | Ga0070680_1001422323 | 158 |
| 748 | 3300005347 | Ga0070668_100397705 | Ga0070668_1003977052 | 158 |
| 749 | 3300005434 | Ga0070709_10022160 | Ga0070709_100221603 | 158 |
| 750 | 3300005434 | Ga0070709_10300833 | Ga0070709_103008333 | 158 |
| 751 | 3300005435 | Ga0070714_100995056 | Ga0070714_1009950561 | 158 |
| 752 | 3300005436 | Ga0070713_100074105 | Ga0070713_1000741053 | 158 |
| 753 | 3300005439 | Ga0070711_100003772 | Ga0070711_1000037724 | 158 |
| 754 | 3300005439 | Ga0070711_101126496 | Ga0070711_1011264962 | 158 |
| 755 | 3300005455 | Ga0070663_100093621 | Ga0070663_1000936213 | 158 |
| 756 | 3300005458 | Ga0070681_10090364 | Ga0070681_100903644 | 158 |
| 757 | 3300005458 | Ga0070681_10142977 | Ga0070681_101429773 | 158 |
| 758 | 3300005535 | Ga0070684_100009391 | Ga0070684_1000093915 | 158 |
| 759 | 3300005548 | Ga0070665_100338751 | Ga0070665_1003387512 | 158 |
| 760 | 3300005548 | Ga0070665_100572960 | Ga0070665_1005729602 | 158 |
| 761 | 3300005548 | Ga0070665_100668662 | Ga0070665_1006686622 | 158 |
| 762 | 3300005577 | Ga0068857_100059974 | Ga0068857_1000599744 | 158 |
| 763 | 3300005616 | Ga0068852_100348236 | Ga0068852_1003482363 | 158 |
| 764 | 3300005718 | Ga0068866_10544429 | Ga0068866_105444291 | 158 |
| 765 | 3300005719 | Ga0068861_101393323 | Ga0068861_1013933231 | 158 |
| 766 | 3300006028 | Ga0070717_10876778 | Ga0070717_108767781 | 158 |
| 767 | 3300006038 | Ga0075365_10018590 | Ga0075365_100185905 | 158 |
| 768 | 3300006038 | Ga0075365_10093391 | Ga0075365_100933913 | 158 |
| 769 | 3300006038 | Ga0075365_10957249 | Ga0075365_109572491 | 158 |
| 770 | 3300006048 | Ga0075363_100193705 | Ga0075363_1001937051 | 158 |
| 771 | 3300006048 | Ga0075363_100496097 | Ga0075363_1004960972 | 158 |
| 772 | 3300006048 | Ga0075363_100684428 | Ga0075363_1006844282 | 158 |
| 773 | 3300006173 | Ga0070716_100041694 | Ga0070716_1000416944 | 158 |
| 774 | 3300006175 | Ga0070712_100156096 | Ga0070712_1001560962 | 158 |
| 775 | 3300006178 | Ga0075367_10789854 | Ga0075367_107898542 | 158 |
| 776 | 3300006186 | Ga0075369_10060284 | Ga0075369_100602841 | 158 |
| 777 | 3300009093 | Ga0105240_10657936 | Ga0105240_106579363 | 158 |
| 778 | 3300009101 | Ga0105247_10356318 | Ga0105247_103563182 | 158 |
| 779 | 3300009177 | Ga0105248_10104172 | Ga0105248_101041723 | 158 |
| 780 | 3300013104 | Ga0157370_10885876 | Ga0157370_108858762 | 158 |
| 781 | 3300014968 | Ga0157379_10115038 | Ga0157379_101150382 | 158 |
| 782 | 3300021361 | Ga0213872_10023682 | Ga0213872_100236824 | 158 |
| 783 | 3300021384 | Ga0213876_10020877 | Ga0213876_100208774 | 158 |
| 784 | 3300024225 | Ga0224572_1024786 | Ga0224572_10247861 | 158 |
| 785 | 3300025906 | Ga0207699_10088282 | Ga0207699_100882823 | 158 |
| 786 | 3300025906 | Ga0207699_10403897 | Ga0207699_104038972 | 158 |
| 787 | 3300025912 | Ga0207707_10031075 | Ga0207707_100310754 | 158 |
| 788 | 3300025912 | Ga0207707_11490262 | Ga0207707_114902621 | 158 |
| 789 | 3300025915 | Ga0207693_10060270 | Ga0207693_100602704 | 158 |
| 790 | 3300025916 | Ga0207663_10028419 | Ga0207663_100284193 | 158 |
| 791 | 3300025917 | Ga0207660_10256833 | Ga0207660_102568333 | 158 |
| 792 | 3300025921 | Ga0207652_10274051 | Ga0207652_102740513 | 158 |
| 793 | 3300025924 | Ga0207694_10454862 | Ga0207694_104548622 | 158 |
| 794 | 3300025928 | Ga0207700_10095945 | Ga0207700_100959453 | 158 |
| 795 | 3300025931 | Ga0207644_10448930 | Ga0207644_104489303 | 158 |
| 796 | 3300025939 | Ga0207665_10172049 | Ga0207665_101720492 | 158 |
| 797 | 3300025941 | Ga0207711_10067359 | Ga0207711_100673594 | 158 |
| 798 | 3300025949 | Ga0207667_10230228 | Ga0207667_102302283 | 158 |
| 799 | 3300026067 | Ga0207678_10058046 | Ga0207678_100580463 | 158 |
| 800 | 3300026067 | Ga0207678_11146906 | Ga0207678_111469061 | 158 |
| 801 | 3300026089 | Ga0207648_11862359 | Ga0207648_118623591 | 158 |
| 802 | 3300026116 | Ga0207674_10078663 | Ga0207674_100786633 | 158 |
| 803 | 3300028379 | Ga0268266_10043720 | Ga0268266_100437203 | 158 |
| 804 | 3300028379 | Ga0268266_11410195 | Ga0268266_114101952 | 158 |
| 805 | 3300028786 | Ga0307517_10000279 | Ga0307517_1000027918 | 158 |
| 806 | 3300028794 | Ga0307515_10118784 | Ga0307515_101187843 | 158 |
| 807 | 3300031456 | Ga0307513_10530716 | Ga0307513_105307162 | 158 |
| 808 | 3300031711 | Ga0265314_10031072 | Ga0265314_100310724 | 158 |
| 809 | 3300031730 | Ga0307516_10429131 | Ga0307516_104291312 | 158 |
| 810 | 3300032126 | Ga0307415_100939741 | Ga0307415_1009397412 | 158 |
| 811 | 3300035724 | Ga0373933_0001821 | Ga0373933_0001821_7845_8321 | 158 |
| 812 | 3300037068 | Ga0373925_0941432 | Ga0373925_0941432_76_564 | 158 |
| 813 | 3300039437 | Ga0436365_0339172 | Ga0436365_0339172_1534_2010 | 158 |
| 814 | 3300039438 | Ga0436360_0619192 | Ga0436360_0619192_26_502 | 158 |
| 815 | 3300039438 | Ga0436360_0808748 | Ga0436360_0808748_760_1248 | 158 |
| 816 | 3300039438 | Ga0436360_0832371 | Ga0436360_0832371_295_783 | 158 |
| 817 | 3300039447 | Ga0436361_0108686 | Ga0436361_0108686_478_954 | 158 |
| 818 | 3300039447 | Ga0436361_0497086 | Ga0436361_0497086_35_511 | 158 |
| 819 | 3300039447 | Ga0436361_1222273 | Ga0436361_1222273_510_998 | 158 |
| 820 | 3300039450 | Ga0436363_1166057 | Ga0436363_1166057_378_854 | 158 |
| 821 | 3300041509 | Ga0451843_0534612 | Ga0451843_0534612_197_673 | 158 |
| 822 | 3300044694 | Ga0466963_0007491 | Ga0466963_0007491_5466_5942 | 158 |
| 823 | 3300044842 | Ga0466957_0472257 | Ga0466957_0472257_123_599 | 158 |
| 824 | 3300045049 | Ga0466959_0033466 | Ga0466959_0033466_1280_1768 | 158 |
| 825 | 3300045976 | Ga0466967_0144470 | Ga0466967_0144470_42_518 | 158 |
| 826 | 3300045976 | Ga0466967_0508568 | Ga0466967_0508568_134_610 | 158 |
| 827 | 3300045976 | Ga0466967_0593849 | Ga0466967_0593849_596_1072 | 158 |
| 828 | 3300046460 | Ga0495638_0054543 | Ga0495638_0054543_1645_2121 | 158 |
| 829 | 3300046507 | Ga0495606_0081284 | Ga0495606_0081284_1031_1507 | 158 |
| 830 | 3300046512 | Ga0495610_0285565 | Ga0495610_0285565_154_630 | 158 |
| 831 | 3300046516 | Ga0495628_0162259 | Ga0495628_0162259_1073_1561 | 158 |
| 832 | 3300046522 | Ga0495643_0049068 | Ga0495643_0049068_766_1242 | 158 |
| 833 | 3300046524 | Ga0495648_0023584 | Ga0495648_0023584_2784_3260 | 158 |
| 834 | 3300046530 | Ga0495654_0138148 | Ga0495654_0138148_530_1006 | 158 |
| 835 | 3300046530 | Ga0495654_0235796 | Ga0495654_0235796_80_556 | 158 |
| 836 | 3300046542 | Ga0495597_0210216 | Ga0495597_0210216_88_564 | 158 |
| 837 | 3300046557 | Ga0495622_0008156 | Ga0495622_0008156_1698_2174 | 158 |
| 838 | 3300046559 | Ga0495667_0210400 | Ga0495667_0210400_417_905 | 158 |
| 839 | 3300046660 | Ga0495625_0027298 | Ga0495625_0027298_3768_4244 | 158 |
| 840 | 3300046660 | Ga0495625_0176247 | Ga0495625_0176247_292_768 | 158 |
| 841 | 3300046660 | Ga0495625_0655899 | Ga0495625_0655899_74_550 | 158 |
| 842 | 3300046691 | Ga0495670_0008405 | Ga0495670_0008405_1032_1508 | 158 |
| 843 | 3300046810 | Ga0495660_0054850 | Ga0495660_0054850_1618_2094 | 158 |
| 844 | 3300047320 | Ga0495672_0060458 | Ga0495672_0060458_604_1080 | 158 |
| 845 | 3300047472 | Ga0495686_0042652 | Ga0495686_0042652_2117_2593 | 158 |
| 846 | 3300048905 | Ga0496102_0735010 | Ga0496102_0735010_206_694 | 158 |
| 847 | 3300048918 | Ga0496115_0818251 | Ga0496115_0818251_56_544 | 158 |
| 848 | 3300048920 | Ga0496117_0093571 | Ga0496117_0093571_846_1322 | 158 |
| 849 | 3300048920 | Ga0496117_0445527 | Ga0496117_0445527_82_558 | 158 |
| 850 | 3300048921 | Ga0496118_0033891 | Ga0496118_0033891_355_831 | 158 |
| 851 | 3300048924 | Ga0496121_0022241 | Ga0496121_0022241_741_1217 | 158 |
| 852 | 3300048924 | Ga0496121_0071091 | Ga0496121_0071091_211_687 | 158 |
| 853 | 3300048924 | Ga0496121_0224795 | Ga0496121_0224795_432_908 | 158 |
| 854 | 3300048925 | Ga0496122_0018275 | Ga0496122_0018275_2668_3144 | 158 |
| 855 | 3300048926 | Ga0496123_0022282 | Ga0496123_0022282_1640_2116 | 158 |
| 856 | 3300048927 | Ga0496124_0263152 | Ga0496124_0263152_423_899 | 158 |
| 857 | 3300048928 | Ga0496125_0000746 | Ga0496125_0000746_37579_38055 | 158 |
| 858 | 3300048928 | Ga0496125_0004827 | Ga0496125_0004827_5216_5692 | 158 |
| 859 | 3300048929 | Ga0496126_0108022 | Ga0496126_0108022_937_1413 | 158 |
| 860 | 3300048929 | Ga0496126_0118073 | Ga0496126_0118073_238_714 | 158 |
| 861 | 3300048929 | Ga0496126_0204271 | Ga0496126_0204271_824_1300 | 158 |
| 862 | 3300048929 | Ga0496126_0683564 | Ga0496126_0683564_291_767 | 158 |
| 863 | 3300049581 | Ga0501047_0699862 | Ga0501047_0699862_98_574 | 158 |
| 864 | 3300049590 | Ga0501074_0083579 | Ga0501074_0083579_912_1388 | 158 |
| 865 | 3300049742 | Ga0501080_0760834 | Ga0501080_0760834_157_633 | 158 |
| 866 | 3300049823 | Ga0501044_0454083 | Ga0501044_0454083_518_994 | 158 |
| 867 | 3300050490 | nmdc:mga03n38_377530_c1 | nmdc:mga03n38_377530_c1_250_726 | 158 |
| 868 | 3300050492 | nmdc:mga0yw44_18431_c1 | nmdc:mga0yw44_18431_c1_1977_2453 | 158 |
| 869 | 3300053085 | Ga0495619_0297903 | Ga0495619_0297903_137_625 | 158 |
| 870 | 3300053089 | Ga0500581_034767 | Ga0500581_034767_1092_1568 | 158 |
| 871 | 3300053090 | Ga0500646_0012699 | Ga0500646_0012699_325_801 | 158 |
| 872 | 3300053092 | Ga0500583_0078053 | Ga0500583_0078053_257_736 | 158 |
| 873 | 3300053093 | Ga0500651_0095797 | Ga0500651_0095797_467_943 | 158 |
| 874 | 3300053094 | Ga0500566_0001917 | Ga0500566_0001917_2381_2857 | 158 |
| 875 | 3300053098 | Ga0500650_0000747 | Ga0500650_0000747_3280_3756 | 158 |
| 876 | 3300053098 | Ga0500650_0251301 | Ga0500650_0251301_13_492 | 158 |
| 877 | 3300053104 | Ga0500556_0000003 | Ga0500556_0000003_318729_319205 | 158 |
| 878 | 3300053108 | Ga0500562_051985 | Ga0500562_051985_438_914 | 158 |
| 879 | 3300053108 | Ga0500562_076549 | Ga0500562_076549_323_799 | 158 |
| 880 | 3300053116 | Ga0500592_002557 | Ga0500592_002557_354_830 | 158 |
| 881 | 3300053117 | Ga0500593_156178 | Ga0500593_156178_31_507 | 158 |
| 882 | 3300053119 | Ga0500595_000496 | Ga0500595_000496_16236_16715 | 158 |
| 883 | 3300053121 | Ga0500607_101781 | Ga0500607_101781_700_1176 | 158 |
| 884 | 3300053130 | Ga0500642_0000006 | Ga0500642_0000006_12978_13454 | 158 |
| 885 | 3300053131 | Ga0500652_002025 | Ga0500652_002025_3635_4111 | 158 |
| 886 | 3300053134 | Ga0500658_0215062 | Ga0500658_0215062_177_653 | 158 |
| 887 | 3300053134 | Ga0500658_0400032 | Ga0500658_0400032_40_516 | 158 |
| 888 | 3300053136 | Ga0500559_0000308 | Ga0500559_0000308_6963_7439 | 158 |
| 889 | 3300053139 | Ga0500568_0000856 | Ga0500568_0000856_2043_2519 | 158 |
| 890 | 3300053142 | Ga0500577_0000070 | Ga0500577_0000070_15533_16012 | 158 |
| 891 | 3300053148 | Ga0500590_054988 | Ga0500590_054988_1306_1782 | 158 |
| 892 | 3300053151 | Ga0500604_0003912 | Ga0500604_0003912_748_1224 | 158 |
| 893 | 3300053151 | Ga0500604_0162847 | Ga0500604_0162847_88_564 | 158 |
| 894 | 3300053153 | Ga0500616_0000033 | Ga0500616_0000033_146522_146998 | 158 |
| 895 | 3300053156 | Ga0500622_0003447 | Ga0500622_0003447_599_1075 | 158 |
| 896 | 3300053156 | Ga0500622_0150890 | Ga0500622_0150890_463_939 | 158 |
| 897 | 3300053158 | Ga0500627_0247020 | Ga0500627_0247020_154_630 | 158 |
| 898 | 3300053161 | Ga0500634_0143873 | Ga0500634_0143873_516_992 | 158 |
| 899 | 3300053177 | Ga0500636_0005812 | Ga0500636_0005812_3641_4117 | 158 |
| 900 | 3300053178 | Ga0500637_0239292 | Ga0500637_0239292_379_855 | 158 |
| 901 | 3300053735 | Ga0500596_014937 | Ga0500596_014937_166_642 | 158 |
| 902 | 3300001990 | JGI24737J22298_10200120 | JGI24737J22298_102001201 | 159 |
| 903 | 3300002070 | JGI24750J21931_1020184 | JGI24750J21931_10201843 | 159 |
| 904 | 3300002077 | JGI24744J21845_10058110 | JGI24744J21845_100581102 | 159 |
| 905 | 3300002244 | JGI24742J22300_10020639 | JGI24742J22300_100206392 | 159 |
| 906 | 3300003203 | JGI25406J46586_10000138 | JGI25406J46586_100001384 | 159 |
| 907 | 3300003215 | JGI25153J46596_10007843 | JGI25153J46596_100078435 | 159 |
| 908 | 3300003659 | JGI25404J52841_10016633 | JGI25404J52841_100166332 | 159 |
| 909 | 3300003659 | JGI25404J52841_10052353 | JGI25404J52841_100523531 | 159 |
| 910 | 3300005327 | Ga0070658_10914606 | Ga0070658_109146062 | 159 |
| 911 | 3300005328 | Ga0070676_10133797 | Ga0070676_101337973 | 159 |
| 912 | 3300005328 | Ga0070676_10281597 | Ga0070676_102815972 | 159 |
| 913 | 3300005329 | Ga0070683_100076181 | Ga0070683_1000761813 | 159 |
| 914 | 3300005329 | Ga0070683_100315205 | Ga0070683_1003152053 | 159 |
| 915 | 3300005330 | Ga0070690_101119286 | Ga0070690_1011192861 | 159 |
| 916 | 3300005334 | Ga0068869_100029055 | Ga0068869_1000290553 | 159 |
| 917 | 3300005334 | Ga0068869_100074710 | Ga0068869_1000747103 | 159 |
| 918 | 3300005334 | Ga0068869_100216730 | Ga0068869_1002167302 | 159 |
| 919 | 3300005334 | Ga0068869_100217523 | Ga0068869_1002175233 | 159 |
| 920 | 3300005334 | Ga0068869_101987340 | Ga0068869_1019873401 | 159 |
| 921 | 3300005335 | Ga0070666_10642834 | Ga0070666_106428341 | 159 |
| 922 | 3300005336 | Ga0070680_100023775 | Ga0070680_1000237755 | 159 |
| 923 | 3300005336 | Ga0070680_100064981 | Ga0070680_1000649814 | 159 |
| 924 | 3300005337 | Ga0070682_100441849 | Ga0070682_1004418491 | 159 |
| 925 | 3300005337 | Ga0070682_100522236 | Ga0070682_1005222362 | 159 |
| 926 | 3300005338 | Ga0068868_100048941 | Ga0068868_1000489413 | 159 |
| 927 | 3300005338 | Ga0068868_100605095 | Ga0068868_1006050952 | 159 |
| 928 | 3300005339 | Ga0070660_100037797 | Ga0070660_1000377974 | 159 |
| 929 | 3300005343 | Ga0070687_100176927 | Ga0070687_1001769272 | 159 |
| 930 | 3300005344 | Ga0070661_100104163 | Ga0070661_1001041633 | 159 |
| 931 | 3300005345 | Ga0070692_10589853 | Ga0070692_105898531 | 159 |
| 932 | 3300005347 | Ga0070668_100027260 | Ga0070668_1000272604 | 159 |
| 933 | 3300005347 | Ga0070668_100113621 | Ga0070668_1001136213 | 159 |
| 934 | 3300005347 | Ga0070668_100205128 | Ga0070668_1002051283 | 159 |
| 935 | 3300005347 | Ga0070668_100218027 | Ga0070668_1002180271 | 159 |
| 936 | 3300005347 | Ga0070668_100273965 | Ga0070668_1002739653 | 159 |
| 937 | 3300005347 | Ga0070668_100645654 | Ga0070668_1006456542 | 159 |
| 938 | 3300005347 | Ga0070668_100763064 | Ga0070668_1007630642 | 159 |
| 939 | 3300005353 | Ga0070669_100164810 | Ga0070669_1001648102 | 159 |
| 940 | 3300005354 | Ga0070675_100392412 | Ga0070675_1003924121 | 159 |
| 941 | 3300005355 | Ga0070671_100104083 | Ga0070671_1001040834 | 159 |
| 942 | 3300005355 | Ga0070671_100244786 | Ga0070671_1002447861 | 159 |
| 943 | 3300005355 | Ga0070671_100250472 | Ga0070671_1002504721 | 159 |
| 944 | 3300005356 | Ga0070674_100046227 | Ga0070674_1000462274 | 159 |
| 945 | 3300005356 | Ga0070674_100297571 | Ga0070674_1002975712 | 159 |
| 946 | 3300005356 | Ga0070674_101057853 | Ga0070674_1010578532 | 159 |
| 947 | 3300005365 | Ga0070688_100344133 | Ga0070688_1003441332 | 159 |
| 948 | 3300005366 | Ga0070659_100198649 | Ga0070659_1001986493 | 159 |
| 949 | 3300005366 | Ga0070659_100263299 | Ga0070659_1002632991 | 159 |
| 950 | 3300005367 | Ga0070667_100146893 | Ga0070667_1001468932 | 159 |
| 951 | 3300005434 | Ga0070709_10023003 | Ga0070709_100230034 | 159 |
| 952 | 3300005434 | Ga0070709_10036355 | Ga0070709_100363555 | 159 |
| 953 | 3300005434 | Ga0070709_10756016 | Ga0070709_107560162 | 159 |
| 954 | 3300005435 | Ga0070714_100002801 | Ga0070714_1000028013 | 159 |
| 955 | 3300005435 | Ga0070714_100107849 | Ga0070714_1001078493 | 159 |
| 956 | 3300005436 | Ga0070713_100014026 | Ga0070713_1000140265 | 159 |
| 957 | 3300005436 | Ga0070713_100026138 | Ga0070713_1000261384 | 159 |
| 958 | 3300005436 | Ga0070713_100101308 | Ga0070713_1001013084 | 159 |
| 959 | 3300005436 | Ga0070713_100103599 | Ga0070713_1001035993 | 159 |
| 960 | 3300005436 | Ga0070713_100150597 | Ga0070713_1001505973 | 159 |
| 961 | 3300005437 | Ga0070710_10000678 | Ga0070710_100006782 | 159 |
| 962 | 3300005437 | Ga0070710_10019013 | Ga0070710_100190133 | 159 |
| 963 | 3300005437 | Ga0070710_10096625 | Ga0070710_100966253 | 159 |
| 964 | 3300005438 | Ga0070701_10263977 | Ga0070701_102639771 | 159 |
| 965 | 3300005439 | Ga0070711_100019549 | Ga0070711_1000195491 | 159 |
| 966 | 3300005439 | Ga0070711_100125685 | Ga0070711_1001256853 | 159 |
| 967 | 3300005439 | Ga0070711_100153631 | Ga0070711_1001536312 | 159 |
| 968 | 3300005439 | Ga0070711_100614519 | Ga0070711_1006145191 | 159 |
| 969 | 3300005439 | Ga0070711_100658017 | Ga0070711_1006580172 | 159 |
| 970 | 3300005441 | Ga0070700_100107452 | Ga0070700_1001074523 | 159 |
| 971 | 3300005441 | Ga0070700_100141268 | Ga0070700_1001412683 | 159 |
| 972 | 3300005444 | Ga0070694_100144776 | Ga0070694_1001447761 | 159 |
| 973 | 3300005444 | Ga0070694_101316300 | Ga0070694_1013163001 | 159 |
| 974 | 3300005455 | Ga0070663_100047641 | Ga0070663_1000476414 | 159 |
| 975 | 3300005455 | Ga0070663_100186548 | Ga0070663_1001865482 | 159 |
| 976 | 3300005455 | Ga0070663_101115033 | Ga0070663_1011150331 | 159 |
| 977 | 3300005456 | Ga0070678_100235114 | Ga0070678_1002351142 | 159 |
| 978 | 3300005456 | Ga0070678_100680506 | Ga0070678_1006805061 | 159 |
| 979 | 3300005457 | Ga0070662_100044307 | Ga0070662_1000443071 | 159 |
| 980 | 3300005457 | Ga0070662_100056074 | Ga0070662_1000560744 | 159 |
| 981 | 3300005457 | Ga0070662_101568324 | Ga0070662_1015683241 | 159 |
| 982 | 3300005458 | Ga0070681_10022753 | Ga0070681_100227536 | 159 |
| 983 | 3300005458 | Ga0070681_10835838 | Ga0070681_108358382 | 159 |
| 984 | 3300005459 | Ga0068867_100009231 | Ga0068867_1000092311 | 159 |
| 985 | 3300005459 | Ga0068867_101336764 | Ga0068867_1013367642 | 159 |
| 986 | 3300005467 | Ga0070706_100141178 | Ga0070706_1001411783 | 159 |
| 987 | 3300005471 | Ga0070698_100291619 | Ga0070698_1002916192 | 159 |
| 988 | 3300005471 | Ga0070698_100731917 | Ga0070698_1007319171 | 159 |
| 989 | 3300005518 | Ga0070699_100389557 | Ga0070699_1003895573 | 159 |
| 990 | 3300005530 | Ga0070679_100215130 | Ga0070679_1002151303 | 159 |
| 991 | 3300005530 | Ga0070679_100291049 | Ga0070679_1002910493 | 159 |
| 992 | 3300005535 | Ga0070684_100065826 | Ga0070684_1000658264 | 159 |
| 993 | 3300005535 | Ga0070684_100156524 | Ga0070684_1001565242 | 159 |
| 994 | 3300005535 | Ga0070684_100930511 | Ga0070684_1009305112 | 159 |
| 995 | 3300005536 | Ga0070697_100355077 | Ga0070697_1003550772 | 159 |
| 996 | 3300005539 | Ga0068853_100262403 | Ga0068853_1002624033 | 159 |
| 997 | 3300005539 | Ga0068853_100919650 | Ga0068853_1009196501 | 159 |
| 998 | 3300005539 | Ga0068853_101474006 | Ga0068853_1014740061 | 159 |
| 999 | 3300005543 | Ga0070672_100065744 | Ga0070672_1000657443 | 159 |
| 1000 | 3300005543 | Ga0070672_100171427 | Ga0070672_1001714273 | 159 |
| 1001 | 3300005543 | Ga0070672_100766193 | Ga0070672_1007661932 | 159 |
| 1002 | 3300005545 | Ga0070695_100189432 | Ga0070695_1001894322 | 159 |
| 1003 | 3300005547 | Ga0070693_100264489 | Ga0070693_1002644893 | 159 |
| 1004 | 3300005547 | Ga0070693_101276071 | Ga0070693_1012760711 | 159 |
| 1005 | 3300005548 | Ga0070665_100023384 | Ga0070665_1000233846 | 159 |
| 1006 | 3300005548 | Ga0070665_100078654 | Ga0070665_1000786545 | 159 |
| 1007 | 3300005548 | Ga0070665_100123917 | Ga0070665_1001239173 | 159 |
| 1008 | 3300005548 | Ga0070665_100134445 | Ga0070665_1001344453 | 159 |
| 1009 | 3300005548 | Ga0070665_100271612 | Ga0070665_1002716123 | 159 |
| 1010 | 3300005549 | Ga0070704_100319412 | Ga0070704_1003194122 | 159 |
| 1011 | 3300005563 | Ga0068855_100181159 | Ga0068855_1001811594 | 159 |
| 1012 | 3300005563 | Ga0068855_100392661 | Ga0068855_1003926612 | 159 |
| 1013 | 3300005564 | Ga0070664_100107954 | Ga0070664_1001079543 | 159 |
| 1014 | 3300005564 | Ga0070664_100177164 | Ga0070664_1001771643 | 159 |
| 1015 | 3300005577 | Ga0068857_100037748 | Ga0068857_1000377483 | 159 |
| 1016 | 3300005577 | Ga0068857_100291795 | Ga0068857_1002917953 | 159 |
| 1017 | 3300005577 | Ga0068857_100384076 | Ga0068857_1003840762 | 159 |
| 1018 | 3300005578 | Ga0068854_100097953 | Ga0068854_1000979532 | 159 |
| 1019 | 3300005578 | Ga0068854_100475090 | Ga0068854_1004750903 | 159 |
| 1020 | 3300005614 | Ga0068856_100236559 | Ga0068856_1002365593 | 159 |
| 1021 | 3300005614 | Ga0068856_100754975 | Ga0068856_1007549752 | 159 |
| 1022 | 3300005615 | Ga0070702_100239985 | Ga0070702_1002399852 | 159 |
| 1023 | 3300005616 | Ga0068852_100133040 | Ga0068852_1001330403 | 159 |
| 1024 | 3300005616 | Ga0068852_100455793 | Ga0068852_1004557932 | 159 |
| 1025 | 3300005616 | Ga0068852_101783980 | Ga0068852_1017839802 | 159 |
| 1026 | 3300005617 | Ga0068859_100103545 | Ga0068859_1001035453 | 159 |
| 1027 | 3300005617 | Ga0068859_100181183 | Ga0068859_1001811832 | 159 |
| 1028 | 3300005617 | Ga0068859_101012313 | Ga0068859_1010123132 | 159 |
| 1029 | 3300005618 | Ga0068864_100058929 | Ga0068864_1000589294 | 159 |
| 1030 | 3300005618 | Ga0068864_100300154 | Ga0068864_1003001543 | 159 |
| 1031 | 3300005618 | Ga0068864_101589310 | Ga0068864_1015893101 | 159 |
| 1032 | 3300005719 | Ga0068861_100045277 | Ga0068861_1000452773 | 159 |
| 1033 | 3300005719 | Ga0068861_100130900 | Ga0068861_1001309001 | 159 |
| 1034 | 3300005719 | Ga0068861_100426495 | Ga0068861_1004264952 | 159 |
| 1035 | 3300005719 | Ga0068861_101554281 | Ga0068861_1015542811 | 159 |
| 1036 | 3300005834 | Ga0068851_10118916 | Ga0068851_101189163 | 159 |
| 1037 | 3300005834 | Ga0068851_10320069 | Ga0068851_103200691 | 159 |
| 1038 | 3300005840 | Ga0068870_10075455 | Ga0068870_100754552 | 159 |
| 1039 | 3300005841 | Ga0068863_100234737 | Ga0068863_1002347373 | 159 |
| 1040 | 3300005841 | Ga0068863_100290578 | Ga0068863_1002905782 | 159 |
| 1041 | 3300005841 | Ga0068863_101985131 | Ga0068863_1019851312 | 159 |
| 1042 | 3300005841 | Ga0068863_102170036 | Ga0068863_1021700361 | 159 |
| 1043 | 3300005842 | Ga0068858_100119984 | Ga0068858_1001199844 | 159 |
| 1044 | 3300005842 | Ga0068858_100195894 | Ga0068858_1001958943 | 159 |
| 1045 | 3300005842 | Ga0068858_100627464 | Ga0068858_1006274642 | 159 |
| 1046 | 3300005843 | Ga0068860_100000360 | Ga0068860_10000036043 | 159 |
| 1047 | 3300005843 | Ga0068860_100153207 | Ga0068860_1001532072 | 159 |
| 1048 | 3300005843 | Ga0068860_100190322 | Ga0068860_1001903223 | 159 |
| 1049 | 3300005843 | Ga0068860_101266327 | Ga0068860_1012663272 | 159 |
| 1050 | 3300005844 | Ga0068862_100034594 | Ga0068862_1000345944 | 159 |
| 1051 | 3300005844 | Ga0068862_100207210 | Ga0068862_1002072103 | 159 |
| 1052 | 3300005937 | Ga0081455_10045444 | Ga0081455_100454444 | 159 |
| 1053 | 3300005983 | Ga0081540_1008125 | Ga0081540_10081254 | 159 |
| 1054 | 3300005983 | Ga0081540_1008941 | Ga0081540_10089413 | 159 |
| 1055 | 3300005983 | Ga0081540_1014330 | Ga0081540_10143304 | 159 |
| 1056 | 3300005983 | Ga0081540_1027303 | Ga0081540_10273034 | 159 |
| 1057 | 3300005983 | Ga0081540_1064372 | Ga0081540_10643723 | 159 |
| 1058 | 3300005983 | Ga0081540_1088582 | Ga0081540_10885822 | 159 |
| 1059 | 3300005983 | Ga0081540_1184764 | Ga0081540_11847642 | 159 |
| 1060 | 3300005983 | Ga0081540_1328556 | Ga0081540_13285561 | 159 |
| 1061 | 3300005985 | Ga0081539_10000008 | Ga0081539_1000000868 | 159 |
| 1062 | 3300006028 | Ga0070717_10001656 | Ga0070717_1000165613 | 159 |
| 1063 | 3300006028 | Ga0070717_10007544 | Ga0070717_100075444 | 159 |
| 1064 | 3300006028 | Ga0070717_10382104 | Ga0070717_103821043 | 159 |
| 1065 | 3300006028 | Ga0070717_10619385 | Ga0070717_106193851 | 159 |
| 1066 | 3300006028 | Ga0070717_10708124 | Ga0070717_107081241 | 159 |
| 1067 | 3300006028 | Ga0070717_11096399 | Ga0070717_110963991 | 159 |
| 1068 | 3300006038 | Ga0075365_10024652 | Ga0075365_100246523 | 159 |
| 1069 | 3300006038 | Ga0075365_10137263 | Ga0075365_101372632 | 159 |
| 1070 | 3300006038 | Ga0075365_10461200 | Ga0075365_104612002 | 159 |
| 1071 | 3300006048 | Ga0075363_100026304 | Ga0075363_1000263042 | 159 |
| 1072 | 3300006048 | Ga0075363_100111587 | Ga0075363_1001115872 | 159 |
| 1073 | 3300006048 | Ga0075363_100181370 | Ga0075363_1001813702 | 159 |
| 1074 | 3300006051 | Ga0075364_10024940 | Ga0075364_100249403 | 159 |
| 1075 | 3300006163 | Ga0070715_10001127 | Ga0070715_100011278 | 159 |
| 1076 | 3300006163 | Ga0070715_10116926 | Ga0070715_101169262 | 159 |
| 1077 | 3300006163 | Ga0070715_10118381 | Ga0070715_101183812 | 159 |
| 1078 | 3300006173 | Ga0070716_100047412 | Ga0070716_1000474121 | 159 |
| 1079 | 3300006173 | Ga0070716_100106258 | Ga0070716_1001062583 | 159 |
| 1080 | 3300006175 | Ga0070712_100013240 | Ga0070712_1000132405 | 159 |
| 1081 | 3300006175 | Ga0070712_100022680 | Ga0070712_1000226804 | 159 |
| 1082 | 3300006175 | Ga0070712_100038780 | Ga0070712_1000387804 | 159 |
| 1083 | 3300006175 | Ga0070712_100581041 | Ga0070712_1005810411 | 159 |
| 1084 | 3300006175 | Ga0070712_100660216 | Ga0070712_1006602161 | 159 |
| 1085 | 3300006177 | Ga0075362_10090506 | Ga0075362_100905062 | 159 |
| 1086 | 3300006178 | Ga0075367_10121791 | Ga0075367_101217913 | 159 |
| 1087 | 3300006178 | Ga0075367_10492498 | Ga0075367_104924982 | 159 |
| 1088 | 3300006186 | Ga0075369_10012874 | Ga0075369_100128742 | 159 |
| 1089 | 3300006195 | Ga0075366_10157481 | Ga0075366_101574812 | 159 |
| 1090 | 3300006195 | Ga0075366_10332512 | Ga0075366_103325121 | 159 |
| 1091 | 3300006237 | Ga0097621_100359483 | Ga0097621_1003594833 | 159 |
| 1092 | 3300006237 | Ga0097621_100860082 | Ga0097621_1008600822 | 159 |
| 1093 | 3300006237 | Ga0097621_101500008 | Ga0097621_1015000081 | 159 |
| 1094 | 3300006237 | Ga0097621_101662222 | Ga0097621_1016622221 | 159 |
| 1095 | 3300006353 | Ga0075370_10238198 | Ga0075370_102381982 | 159 |
| 1096 | 3300006353 | Ga0075370_10309220 | Ga0075370_103092202 | 159 |
| 1097 | 3300006353 | Ga0075370_10329161 | Ga0075370_103291612 | 159 |
| 1098 | 3300006358 | Ga0068871_100069423 | Ga0068871_1000694235 | 159 |
| 1099 | 3300006358 | Ga0068871_100072638 | Ga0068871_1000726383 | 159 |
| 1100 | 3300006358 | Ga0068871_100525777 | Ga0068871_1005257773 | 159 |
| 1101 | 3300006358 | Ga0068871_100585244 | Ga0068871_1005852442 | 159 |
| 1102 | 3300006844 | Ga0075428_100208936 | Ga0075428_1002089363 | 159 |
| 1103 | 3300006844 | Ga0075428_100341471 | Ga0075428_1003414713 | 159 |
| 1104 | 3300006847 | Ga0075431_100682133 | Ga0075431_1006821332 | 159 |
| 1105 | 3300006871 | Ga0075434_100737073 | Ga0075434_1007370732 | 159 |
| 1106 | 3300006881 | Ga0068865_100190154 | Ga0068865_1001901543 | 159 |
| 1107 | 3300006881 | Ga0068865_100541348 | Ga0068865_1005413482 | 159 |
| 1108 | 3300006931 | Ga0097620_100103547 | Ga0097620_1001035474 | 159 |
| 1109 | 3300006931 | Ga0097620_100181187 | Ga0097620_1001811874 | 159 |
| 1110 | 3300006931 | Ga0097620_101012304 | Ga0097620_1010123042 | 159 |
| 1111 | 3300006941 | Ga0099825_1047657 | Ga0099825_10476571 | 159 |
| 1112 | 3300006942 | Ga0099824_1018474 | Ga0099824_10184742 | 159 |
| 1113 | 3300006943 | Ga0099822_1021826 | Ga0099822_10218266 | 159 |
| 1114 | 3300007076 | Ga0075435_100129312 | Ga0075435_1001293123 | 159 |
| 1115 | 3300007265 | Ga0099794_10106117 | Ga0099794_101061172 | 159 |
| 1116 | 3300007265 | Ga0099794_10228064 | Ga0099794_102280642 | 159 |
| 1117 | 3300007265 | Ga0099794_10228415 | Ga0099794_102284152 | 159 |
| 1118 | 3300007788 | Ga0099795_10009487 | Ga0099795_100094874 | 159 |
| 1119 | 3300007788 | Ga0099795_10021525 | Ga0099795_100215251 | 159 |
| 1120 | 3300007788 | Ga0099795_10211652 | Ga0099795_102116522 | 159 |
| 1121 | 3300009092 | Ga0105250_10073796 | Ga0105250_100737962 | 159 |
| 1122 | 3300009092 | Ga0105250_10179380 | Ga0105250_101793802 | 159 |
| 1123 | 3300009093 | Ga0105240_10084695 | Ga0105240_100846953 | 159 |
| 1124 | 3300009093 | Ga0105240_10379621 | Ga0105240_103796213 | 159 |
| 1125 | 3300009094 | Ga0111539_10010769 | Ga0111539_100107698 | 159 |
| 1126 | 3300009098 | Ga0105245_10137591 | Ga0105245_101375912 | 159 |
| 1127 | 3300009098 | Ga0105245_10264619 | Ga0105245_102646192 | 159 |
| 1128 | 3300009098 | Ga0105245_10669447 | Ga0105245_106694472 | 159 |
| 1129 | 3300009101 | Ga0105247_10100789 | Ga0105247_101007894 | 159 |
| 1130 | 3300009101 | Ga0105247_10225649 | Ga0105247_102256493 | 159 |
| 1131 | 3300009101 | Ga0105247_10254543 | Ga0105247_102545431 | 159 |
| 1132 | 3300009101 | Ga0105247_10677871 | Ga0105247_106778712 | 159 |
| 1133 | 3300009101 | Ga0105247_11160894 | Ga0105247_111608942 | 159 |
| 1134 | 3300009147 | Ga0114129_10640263 | Ga0114129_106402633 | 159 |
| 1135 | 3300009148 | Ga0105243_10373444 | Ga0105243_103734442 | 159 |
| 1136 | 3300009148 | Ga0105243_10518846 | Ga0105243_105188462 | 159 |
| 1137 | 3300009174 | Ga0105241_10029756 | Ga0105241_100297563 | 159 |
| 1138 | 3300009174 | Ga0105241_10232984 | Ga0105241_102329843 | 159 |
| 1139 | 3300009174 | Ga0105241_10435013 | Ga0105241_104350133 | 159 |
| 1140 | 3300009174 | Ga0105241_10684529 | Ga0105241_106845292 | 159 |
| 1141 | 3300009176 | Ga0105242_10072771 | Ga0105242_100727711 | 159 |
| 1142 | 3300009176 | Ga0105242_10165539 | Ga0105242_101655393 | 159 |
| 1143 | 3300009176 | Ga0105242_10467047 | Ga0105242_104670472 | 159 |
| 1144 | 3300009176 | Ga0105242_10687051 | Ga0105242_106870512 | 159 |
| 1145 | 3300009177 | Ga0105248_10260394 | Ga0105248_102603942 | 159 |
| 1146 | 3300009177 | Ga0105248_10265805 | Ga0105248_102658051 | 159 |
| 1147 | 3300009545 | Ga0105237_10009950 | Ga0105237_100099508 | 159 |
| 1148 | 3300009545 | Ga0105237_10110574 | Ga0105237_101105742 | 159 |
| 1149 | 3300009545 | Ga0105237_10558820 | Ga0105237_105588202 | 159 |
| 1150 | 3300009545 | Ga0105237_10750872 | Ga0105237_107508723 | 159 |
| 1151 | 3300009545 | Ga0105237_10822256 | Ga0105237_108222563 | 159 |
| 1152 | 3300009551 | Ga0105238_10135316 | Ga0105238_101353163 | 159 |
| 1153 | 3300009551 | Ga0105238_10331334 | Ga0105238_103313343 | 159 |
| 1154 | 3300009551 | Ga0105238_10377366 | Ga0105238_103773663 | 159 |
| 1155 | 3300009551 | Ga0105238_10686681 | Ga0105238_106866812 | 159 |
| 1156 | 3300009551 | Ga0105238_11508599 | Ga0105238_115085991 | 159 |
| 1157 | 3300009553 | Ga0105249_10074396 | Ga0105249_100743965 | 159 |
| 1158 | 3300009553 | Ga0105249_10177078 | Ga0105249_101770783 | 159 |
| 1159 | 3300010159 | Ga0099796_10100427 | Ga0099796_101004273 | 159 |
| 1160 | 3300010159 | Ga0099796_10127917 | Ga0099796_101279172 | 159 |
| 1161 | 3300010375 | Ga0105239_10084742 | Ga0105239_100847424 | 159 |
| 1162 | 3300010375 | Ga0105239_10159171 | Ga0105239_101591714 | 159 |
| 1163 | 3300010375 | Ga0105239_10218055 | Ga0105239_102180552 | 159 |
| 1164 | 3300010375 | Ga0105239_10292556 | Ga0105239_102925563 | 159 |
| 1165 | 3300010375 | Ga0105239_10387551 | Ga0105239_103875512 | 159 |
| 1166 | 3300010375 | Ga0105239_10575312 | Ga0105239_105753121 | 159 |
| 1167 | 3300011119 | Ga0105246_10045998 | Ga0105246_100459983 | 159 |
| 1168 | 3300011119 | Ga0105246_10104444 | Ga0105246_101044442 | 159 |
| 1169 | 3300011119 | Ga0105246_10228690 | Ga0105246_102286903 | 159 |
| 1170 | 3300011119 | Ga0105246_10266822 | Ga0105246_102668222 | 159 |
| 1171 | 3300011119 | Ga0105246_10268572 | Ga0105246_102685722 | 159 |
| 1172 | 3300011119 | Ga0105246_10350085 | Ga0105246_103500852 | 159 |
| 1173 | 3300013104 | Ga0157370_10057618 | Ga0157370_100576183 | 159 |
| 1174 | 3300013105 | Ga0157369_10012423 | Ga0157369_100124235 | 159 |
| 1175 | 3300013105 | Ga0157369_10195154 | Ga0157369_101951543 | 159 |
| 1176 | 3300013105 | Ga0157369_10348532 | Ga0157369_103485322 | 159 |
| 1177 | 3300013296 | Ga0157374_10024785 | Ga0157374_100247854 | 159 |
| 1178 | 3300013296 | Ga0157374_11755321 | Ga0157374_117553212 | 159 |
| 1179 | 3300013296 | Ga0157374_11891070 | Ga0157374_118910701 | 159 |
| 1180 | 3300013297 | Ga0157378_10133315 | Ga0157378_101333153 | 159 |
| 1181 | 3300013297 | Ga0157378_10807552 | Ga0157378_108075522 | 159 |
| 1182 | 3300013297 | Ga0157378_11025692 | Ga0157378_110256922 | 159 |
| 1183 | 3300013306 | Ga0163162_10060239 | Ga0163162_100602393 | 159 |
| 1184 | 3300013306 | Ga0163162_10062895 | Ga0163162_100628953 | 159 |
| 1185 | 3300013306 | Ga0163162_10184729 | Ga0163162_101847293 | 159 |
| 1186 | 3300013306 | Ga0163162_10370985 | Ga0163162_103709852 | 159 |
| 1187 | 3300013306 | Ga0163162_10893966 | Ga0163162_108939662 | 159 |
| 1188 | 3300013306 | Ga0163162_11221664 | Ga0163162_112216642 | 159 |
| 1189 | 3300013308 | Ga0157375_10105710 | Ga0157375_101057102 | 159 |
| 1190 | 3300013308 | Ga0157375_10108399 | Ga0157375_101083994 | 159 |
| 1191 | 3300013308 | Ga0157375_10498328 | Ga0157375_104983281 | 159 |
| 1192 | 3300013308 | Ga0157375_11224732 | Ga0157375_112247321 | 159 |
| 1193 | 3300013308 | Ga0157375_11415865 | Ga0157375_114158652 | 159 |
| 1194 | 3300014325 | Ga0163163_10009852 | Ga0163163_100098524 | 159 |
| 1195 | 3300014325 | Ga0163163_10060452 | Ga0163163_100604524 | 159 |
| 1196 | 3300014325 | Ga0163163_10060614 | Ga0163163_100606143 | 159 |
| 1197 | 3300014325 | Ga0163163_10352566 | Ga0163163_103525662 | 159 |
| 1198 | 3300014326 | Ga0157380_10052368 | Ga0157380_100523683 | 159 |
| 1199 | 3300014326 | Ga0157380_10260620 | Ga0157380_102606203 | 159 |
| 1200 | 3300014326 | Ga0157380_10316878 | Ga0157380_103168783 | 159 |
| 1201 | 3300014745 | Ga0157377_10110199 | Ga0157377_101101992 | 159 |
| 1202 | 3300014745 | Ga0157377_10113067 | Ga0157377_101130673 | 159 |
| 1203 | 3300014745 | Ga0157377_10164552 | Ga0157377_101645522 | 159 |
| 1204 | 3300014968 | Ga0157379_10092888 | Ga0157379_100928883 | 159 |
| 1205 | 3300014968 | Ga0157379_10100952 | Ga0157379_101009522 | 159 |
| 1206 | 3300014969 | Ga0157376_10053421 | Ga0157376_100534212 | 159 |
| 1207 | 3300014969 | Ga0157376_10160876 | Ga0157376_101608762 | 159 |
| 1208 | 3300014969 | Ga0157376_10686731 | Ga0157376_106867312 | 159 |
| 1209 | 3300017792 | Ga0163161_10049743 | Ga0163161_100497433 | 159 |
| 1210 | 3300017792 | Ga0163161_10297384 | Ga0163161_102973843 | 159 |
| 1211 | 3300020082 | Ga0206353_11239574 | Ga0206353_112395742 | 159 |
| 1212 | 3300025297 | Ga0209758_1002526 | Ga0209758_100252614 | 159 |
| 1213 | 3300025321 | Ga0207656_10107837 | Ga0207656_101078373 | 159 |
| 1214 | 3300025885 | Ga0207653_10027624 | Ga0207653_100276241 | 159 |
| 1215 | 3300025898 | Ga0207692_10000797 | Ga0207692_100007974 | 159 |
| 1216 | 3300025898 | Ga0207692_10034442 | Ga0207692_100344425 | 159 |
| 1217 | 3300025898 | Ga0207692_10751592 | Ga0207692_107515922 | 159 |
| 1218 | 3300025899 | Ga0207642_10090132 | Ga0207642_100901322 | 159 |
| 1219 | 3300025899 | Ga0207642_10592054 | Ga0207642_105920541 | 159 |
| 1220 | 3300025901 | Ga0207688_10119760 | Ga0207688_101197603 | 159 |
| 1221 | 3300025901 | Ga0207688_10266632 | Ga0207688_102666323 | 159 |
| 1222 | 3300025904 | Ga0207647_10077783 | Ga0207647_100777833 | 159 |
| 1223 | 3300025906 | Ga0207699_10001610 | Ga0207699_100016105 | 159 |
| 1224 | 3300025906 | Ga0207699_10014207 | Ga0207699_100142073 | 159 |
| 1225 | 3300025906 | Ga0207699_10017213 | Ga0207699_100172132 | 159 |
| 1226 | 3300025906 | Ga0207699_10054282 | Ga0207699_100542823 | 159 |
| 1227 | 3300025906 | Ga0207699_10119427 | Ga0207699_101194273 | 159 |
| 1228 | 3300025907 | Ga0207645_10132858 | Ga0207645_101328582 | 159 |
| 1229 | 3300025908 | Ga0207643_10104196 | Ga0207643_101041962 | 159 |
| 1230 | 3300025909 | Ga0207705_10125295 | Ga0207705_101252953 | 159 |
| 1231 | 3300025909 | Ga0207705_11134653 | Ga0207705_111346532 | 159 |
| 1232 | 3300025910 | Ga0207684_11153938 | Ga0207684_111539382 | 159 |
| 1233 | 3300025911 | Ga0207654_10119575 | Ga0207654_101195753 | 159 |
| 1234 | 3300025911 | Ga0207654_10397877 | Ga0207654_103978772 | 159 |
| 1235 | 3300025911 | Ga0207654_10488780 | Ga0207654_104887802 | 159 |
| 1236 | 3300025912 | Ga0207707_10000886 | Ga0207707_1000088621 | 159 |
| 1237 | 3300025912 | Ga0207707_10023656 | Ga0207707_100236566 | 159 |
| 1238 | 3300025912 | Ga0207707_10299929 | Ga0207707_102999293 | 159 |
| 1239 | 3300025912 | Ga0207707_10518469 | Ga0207707_105184693 | 159 |
| 1240 | 3300025913 | Ga0207695_10306738 | Ga0207695_103067383 | 159 |
| 1241 | 3300025913 | Ga0207695_10308478 | Ga0207695_103084782 | 159 |
| 1242 | 3300025914 | Ga0207671_10110956 | Ga0207671_101109563 | 159 |
| 1243 | 3300025914 | Ga0207671_10332303 | Ga0207671_103323032 | 159 |
| 1244 | 3300025914 | Ga0207671_10378502 | Ga0207671_103785022 | 159 |
| 1245 | 3300025915 | Ga0207693_10002637 | Ga0207693_100026372 | 159 |
| 1246 | 3300025915 | Ga0207693_10007874 | Ga0207693_100078745 | 159 |
| 1247 | 3300025915 | Ga0207693_10018468 | Ga0207693_100184684 | 159 |
| 1248 | 3300025915 | Ga0207693_10034047 | Ga0207693_100340474 | 159 |
| 1249 | 3300025915 | Ga0207693_10203094 | Ga0207693_102030943 | 159 |
| 1250 | 3300025915 | Ga0207693_10453506 | Ga0207693_104535061 | 159 |
| 1251 | 3300025916 | Ga0207663_10006243 | Ga0207663_100062433 | 159 |
| 1252 | 3300025916 | Ga0207663_10011845 | Ga0207663_100118452 | 159 |
| 1253 | 3300025916 | Ga0207663_10044640 | Ga0207663_100446403 | 159 |
| 1254 | 3300025916 | Ga0207663_10121345 | Ga0207663_101213453 | 159 |
| 1255 | 3300025916 | Ga0207663_11006565 | Ga0207663_110065652 | 159 |
| 1256 | 3300025916 | Ga0207663_11244168 | Ga0207663_112441681 | 159 |
| 1257 | 3300025917 | Ga0207660_10010388 | Ga0207660_100103886 | 159 |
| 1258 | 3300025917 | Ga0207660_10022287 | Ga0207660_100222874 | 159 |
| 1259 | 3300025917 | Ga0207660_10027535 | Ga0207660_100275356 | 159 |
| 1260 | 3300025917 | Ga0207660_10231996 | Ga0207660_102319963 | 159 |
| 1261 | 3300025917 | Ga0207660_10502071 | Ga0207660_105020712 | 159 |
| 1262 | 3300025918 | Ga0207662_10177795 | Ga0207662_101777952 | 159 |
| 1263 | 3300025919 | Ga0207657_10008437 | Ga0207657_1000843711 | 159 |
| 1264 | 3300025920 | Ga0207649_10040161 | Ga0207649_100401614 | 159 |
| 1265 | 3300025921 | Ga0207652_10019601 | Ga0207652_100196012 | 159 |
| 1266 | 3300025921 | Ga0207652_10105158 | Ga0207652_101051583 | 159 |
| 1267 | 3300025923 | Ga0207681_10036681 | Ga0207681_100366814 | 159 |
| 1268 | 3300025923 | Ga0207681_10208829 | Ga0207681_102088292 | 159 |
| 1269 | 3300025923 | Ga0207681_10293023 | Ga0207681_102930232 | 159 |
| 1270 | 3300025924 | Ga0207694_10203424 | Ga0207694_102034243 | 159 |
| 1271 | 3300025924 | Ga0207694_10282251 | Ga0207694_102822512 | 159 |
| 1272 | 3300025925 | Ga0207650_10527525 | Ga0207650_105275251 | 159 |
| 1273 | 3300025926 | Ga0207659_10789612 | Ga0207659_107896122 | 159 |
| 1274 | 3300025926 | Ga0207659_10981193 | Ga0207659_109811932 | 159 |
| 1275 | 3300025926 | Ga0207659_11035003 | Ga0207659_110350032 | 159 |
| 1276 | 3300025927 | Ga0207687_10053608 | Ga0207687_100536082 | 159 |
| 1277 | 3300025927 | Ga0207687_10218131 | Ga0207687_102181312 | 159 |
| 1278 | 3300025927 | Ga0207687_10327438 | Ga0207687_103274382 | 159 |
| 1279 | 3300025928 | Ga0207700_10007466 | Ga0207700_100074663 | 159 |
| 1280 | 3300025928 | Ga0207700_10011479 | Ga0207700_100114796 | 159 |
| 1281 | 3300025928 | Ga0207700_10052174 | Ga0207700_100521743 | 159 |
| 1282 | 3300025928 | Ga0207700_10304870 | Ga0207700_103048702 | 159 |
| 1283 | 3300025929 | Ga0207664_10007788 | Ga0207664_100077883 | 159 |
| 1284 | 3300025929 | Ga0207664_10267241 | Ga0207664_102672412 | 159 |
| 1285 | 3300025929 | Ga0207664_10276253 | Ga0207664_102762532 | 159 |
| 1286 | 3300025929 | Ga0207664_10276358 | Ga0207664_102763582 | 159 |
| 1287 | 3300025931 | Ga0207644_10188346 | Ga0207644_101883463 | 159 |
| 1288 | 3300025931 | Ga0207644_10272742 | Ga0207644_102727422 | 159 |
| 1289 | 3300025932 | Ga0207690_10014466 | Ga0207690_100144665 | 159 |
| 1290 | 3300025932 | Ga0207690_10522991 | Ga0207690_105229912 | 159 |
| 1291 | 3300025933 | Ga0207706_10059649 | Ga0207706_100596493 | 159 |
| 1292 | 3300025933 | Ga0207706_10149460 | Ga0207706_101494603 | 159 |
| 1293 | 3300025933 | Ga0207706_10634162 | Ga0207706_106341622 | 159 |
| 1294 | 3300025933 | Ga0207706_10855574 | Ga0207706_108555742 | 159 |
| 1295 | 3300025933 | Ga0207706_11349173 | Ga0207706_113491731 | 159 |
| 1296 | 3300025934 | Ga0207686_10089706 | Ga0207686_100897062 | 159 |
| 1297 | 3300025934 | Ga0207686_10103845 | Ga0207686_101038453 | 159 |
| 1298 | 3300025934 | Ga0207686_10390090 | Ga0207686_103900902 | 159 |
| 1299 | 3300025935 | Ga0207709_10040013 | Ga0207709_100400135 | 159 |
| 1300 | 3300025936 | Ga0207670_10210240 | Ga0207670_102102401 | 159 |
| 1301 | 3300025937 | Ga0207669_10005298 | Ga0207669_100052983 | 159 |
| 1302 | 3300025937 | Ga0207669_10219534 | Ga0207669_102195341 | 159 |
| 1303 | 3300025937 | Ga0207669_10564302 | Ga0207669_105643022 | 159 |
| 1304 | 3300025937 | Ga0207669_10972046 | Ga0207669_109720462 | 159 |
| 1305 | 3300025937 | Ga0207669_10972372 | Ga0207669_109723721 | 159 |
| 1306 | 3300025937 | Ga0207669_11135585 | Ga0207669_111355852 | 159 |
| 1307 | 3300025938 | Ga0207704_10175381 | Ga0207704_101753813 | 159 |
| 1308 | 3300025938 | Ga0207704_10222242 | Ga0207704_102222423 | 159 |
| 1309 | 3300025938 | Ga0207704_10390975 | Ga0207704_103909752 | 159 |
| 1310 | 3300025939 | Ga0207665_10001385 | Ga0207665_100013856 | 159 |
| 1311 | 3300025939 | Ga0207665_10021917 | Ga0207665_100219174 | 159 |
| 1312 | 3300025939 | Ga0207665_10065508 | Ga0207665_100655084 | 159 |
| 1313 | 3300025939 | Ga0207665_10910243 | Ga0207665_109102432 | 159 |
| 1314 | 3300025940 | Ga0207691_10025303 | Ga0207691_100253036 | 159 |
| 1315 | 3300025940 | Ga0207691_10148496 | Ga0207691_101484961 | 159 |
| 1316 | 3300025940 | Ga0207691_11065095 | Ga0207691_110650952 | 159 |
| 1317 | 3300025942 | Ga0207689_10019353 | Ga0207689_100193537 | 159 |
| 1318 | 3300025942 | Ga0207689_10036827 | Ga0207689_100368274 | 159 |
| 1319 | 3300025942 | Ga0207689_10117631 | Ga0207689_101176313 | 159 |
| 1320 | 3300025942 | Ga0207689_10305796 | Ga0207689_103057962 | 159 |
| 1321 | 3300025942 | Ga0207689_10782418 | Ga0207689_107824182 | 159 |
| 1322 | 3300025944 | Ga0207661_10018951 | Ga0207661_100189513 | 159 |
| 1323 | 3300025945 | Ga0207679_10205321 | Ga0207679_102053212 | 159 |
| 1324 | 3300025945 | Ga0207679_10757306 | Ga0207679_107573062 | 159 |
| 1325 | 3300025949 | Ga0207667_10019974 | Ga0207667_100199746 | 159 |
| 1326 | 3300025949 | Ga0207667_10113813 | Ga0207667_101138133 | 159 |
| 1327 | 3300025949 | Ga0207667_10474438 | Ga0207667_104744382 | 159 |
| 1328 | 3300025949 | Ga0207667_10536798 | Ga0207667_105367982 | 159 |
| 1329 | 3300025960 | Ga0207651_10311328 | Ga0207651_103113282 | 159 |
| 1330 | 3300025960 | Ga0207651_10882550 | Ga0207651_108825502 | 159 |
| 1331 | 3300025960 | Ga0207651_11112223 | Ga0207651_111122232 | 159 |
| 1332 | 3300025961 | Ga0207712_10082756 | Ga0207712_100827563 | 159 |
| 1333 | 3300025972 | Ga0207668_10064631 | Ga0207668_100646314 | 159 |
| 1334 | 3300025972 | Ga0207668_10069258 | Ga0207668_100692583 | 159 |
| 1335 | 3300025972 | Ga0207668_10108642 | Ga0207668_101086423 | 159 |
| 1336 | 3300025972 | Ga0207668_10119579 | Ga0207668_101195793 | 159 |
| 1337 | 3300025972 | Ga0207668_10151383 | Ga0207668_101513833 | 159 |
| 1338 | 3300025972 | Ga0207668_10972115 | Ga0207668_109721152 | 159 |
| 1339 | 3300025981 | Ga0207640_10187043 | Ga0207640_101870433 | 159 |
| 1340 | 3300025981 | Ga0207640_10450463 | Ga0207640_104504632 | 159 |
| 1341 | 3300025981 | Ga0207640_10633117 | Ga0207640_106331172 | 159 |
| 1342 | 3300025981 | Ga0207640_11197543 | Ga0207640_111975432 | 159 |
| 1343 | 3300025986 | Ga0207658_10059201 | Ga0207658_100592013 | 159 |
| 1344 | 3300025986 | Ga0207658_10109147 | Ga0207658_101091474 | 159 |
| 1345 | 3300025986 | Ga0207658_10546621 | Ga0207658_105466212 | 159 |
| 1346 | 3300026023 | Ga0207677_10073769 | Ga0207677_100737694 | 159 |
| 1347 | 3300026023 | Ga0207677_10721331 | Ga0207677_107213312 | 159 |
| 1348 | 3300026023 | Ga0207677_10838878 | Ga0207677_108388782 | 159 |
| 1349 | 3300026023 | Ga0207677_11112933 | Ga0207677_111129331 | 159 |
| 1350 | 3300026035 | Ga0207703_10127440 | Ga0207703_101274404 | 159 |
| 1351 | 3300026035 | Ga0207703_10129128 | Ga0207703_101291284 | 159 |
| 1352 | 3300026035 | Ga0207703_10473656 | Ga0207703_104736562 | 159 |
| 1353 | 3300026035 | Ga0207703_10725421 | Ga0207703_107254212 | 159 |
| 1354 | 3300026035 | Ga0207703_10992098 | Ga0207703_109920982 | 159 |
| 1355 | 3300026041 | Ga0207639_10034032 | Ga0207639_100340323 | 159 |
| 1356 | 3300026067 | Ga0207678_10017857 | Ga0207678_100178576 | 159 |
| 1357 | 3300026067 | Ga0207678_10026311 | Ga0207678_100263113 | 159 |
| 1358 | 3300026067 | Ga0207678_10033211 | Ga0207678_100332115 | 159 |
| 1359 | 3300026067 | Ga0207678_10035164 | Ga0207678_100351643 | 159 |
| 1360 | 3300026067 | Ga0207678_10374084 | Ga0207678_103740842 | 159 |
| 1361 | 3300026067 | Ga0207678_10596797 | Ga0207678_105967972 | 159 |
| 1362 | 3300026067 | Ga0207678_10849948 | Ga0207678_108499482 | 159 |
| 1363 | 3300026075 | Ga0207708_10062133 | Ga0207708_100621333 | 159 |
| 1364 | 3300026075 | Ga0207708_10521770 | Ga0207708_105217702 | 159 |
| 1365 | 3300026078 | Ga0207702_10762169 | Ga0207702_107621692 | 159 |
| 1366 | 3300026088 | Ga0207641_10203963 | Ga0207641_102039632 | 159 |
| 1367 | 3300026088 | Ga0207641_11198100 | Ga0207641_111981001 | 159 |
| 1368 | 3300026089 | Ga0207648_10032340 | Ga0207648_100323404 | 159 |
| 1369 | 3300026089 | Ga0207648_10605595 | Ga0207648_106055952 | 159 |
| 1370 | 3300026095 | Ga0207676_10068020 | Ga0207676_100680202 | 159 |
| 1371 | 3300026095 | Ga0207676_10177406 | Ga0207676_101774062 | 159 |
| 1372 | 3300026116 | Ga0207674_10007720 | Ga0207674_100077206 | 159 |
| 1373 | 3300026116 | Ga0207674_10328757 | Ga0207674_103287573 | 159 |
| 1374 | 3300026116 | Ga0207674_11087386 | Ga0207674_110873862 | 159 |
| 1375 | 3300026118 | Ga0207675_100058719 | Ga0207675_1000587193 | 159 |
| 1376 | 3300026118 | Ga0207675_100293273 | Ga0207675_1002932733 | 159 |
| 1377 | 3300026118 | Ga0207675_100954201 | Ga0207675_1009542012 | 159 |
| 1378 | 3300026118 | Ga0207675_101079958 | Ga0207675_1010799582 | 159 |
| 1379 | 3300026121 | Ga0207683_10003797 | Ga0207683_100037975 | 159 |
| 1380 | 3300026121 | Ga0207683_10068301 | Ga0207683_100683016 | 159 |
| 1381 | 3300026121 | Ga0207683_10091282 | Ga0207683_100912824 | 159 |
| 1382 | 3300026121 | Ga0207683_10363740 | Ga0207683_103637402 | 159 |
| 1383 | 3300026121 | Ga0207683_10539113 | Ga0207683_105391132 | 159 |
| 1384 | 3300026121 | Ga0207683_10656745 | Ga0207683_106567452 | 159 |
| 1385 | 3300026121 | Ga0207683_10865217 | Ga0207683_108652172 | 159 |
| 1386 | 3300026142 | Ga0207698_10132646 | Ga0207698_101326464 | 159 |
| 1387 | 3300026142 | Ga0207698_10365103 | Ga0207698_103651031 | 159 |
| 1388 | 3300026142 | Ga0207698_11333200 | Ga0207698_113332002 | 159 |
| 1389 | 3300027357 | Ga0209589_1000011 | Ga0209589_100001139 | 159 |
| 1390 | 3300027361 | Ga0209489_100012 | Ga0209489_10001239 | 159 |
| 1391 | 3300027363 | Ga0209700_100019 | Ga0209700_10001939 | 159 |
| 1392 | 3300027512 | Ga0209179_1003275 | Ga0209179_10032753 | 159 |
| 1393 | 3300027671 | Ga0209588_1012656 | Ga0209588_10126563 | 159 |
| 1394 | 3300027671 | Ga0209588_1030031 | Ga0209588_10300313 | 159 |
| 1395 | 3300027866 | Ga0209813_10046981 | Ga0209813_100469813 | 159 |
| 1396 | 3300027907 | Ga0207428_10255880 | Ga0207428_102558803 | 159 |
| 1397 | 3300028379 | Ga0268266_10007625 | Ga0268266_100076255 | 159 |
| 1398 | 3300028379 | Ga0268266_10020198 | Ga0268266_100201986 | 159 |
| 1399 | 3300028379 | Ga0268266_10056470 | Ga0268266_100564705 | 159 |
| 1400 | 3300028379 | Ga0268266_10128490 | Ga0268266_101284903 | 159 |
| 1401 | 3300028380 | Ga0268265_10054843 | Ga0268265_100548434 | 159 |
| 1402 | 3300028380 | Ga0268265_10170480 | Ga0268265_101704803 | 159 |
| 1403 | 3300028380 | Ga0268265_10487539 | Ga0268265_104875393 | 159 |
| 1404 | 3300028380 | Ga0268265_10791405 | Ga0268265_107914052 | 159 |
| 1405 | 3300028380 | Ga0268265_11299103 | Ga0268265_112991031 | 159 |
| 1406 | 3300028381 | Ga0268264_10000030 | Ga0268264_10000030240 | 159 |
| 1407 | 3300028381 | Ga0268264_10140299 | Ga0268264_101402994 | 159 |
| 1408 | 3300028556 | Ga0265337_1006171 | Ga0265337_10061714 | 159 |
| 1409 | 3300028563 | Ga0265319_1011253 | Ga0265319_10112534 | 159 |
| 1410 | 3300028573 | Ga0265334_10010046 | Ga0265334_100100464 | 159 |
| 1411 | 3300028653 | Ga0265323_10000434 | Ga0265323_1000043423 | 159 |
| 1412 | 3300028654 | Ga0265322_10017119 | Ga0265322_100171192 | 159 |
| 1413 | 3300028666 | Ga0265336_10000649 | Ga0265336_1000064916 | 159 |
| 1414 | 3300028800 | Ga0265338_10000280 | Ga0265338_1000028049 | 159 |
| 1415 | 3300030522 | Ga0307512_10162065 | Ga0307512_101620653 | 159 |
| 1416 | 3300030760 | Ga0265762_1030524 | Ga0265762_10305242 | 159 |
| 1417 | 3300031235 | Ga0265330_10006697 | Ga0265330_100066976 | 159 |
| 1418 | 3300031235 | Ga0265330_10016700 | Ga0265330_100167004 | 159 |
| 1419 | 3300031235 | Ga0265330_10047707 | Ga0265330_100477072 | 159 |
| 1420 | 3300031238 | Ga0265332_10013075 | Ga0265332_100130753 | 159 |
| 1421 | 3300031239 | Ga0265328_10277413 | Ga0265328_102774131 | 159 |
| 1422 | 3300031241 | Ga0265325_10071434 | Ga0265325_100714342 | 159 |
| 1423 | 3300031247 | Ga0265340_10140965 | Ga0265340_101409653 | 159 |
| 1424 | 3300031249 | Ga0265339_10173947 | Ga0265339_101739472 | 159 |
| 1425 | 3300031249 | Ga0265339_10198075 | Ga0265339_101980751 | 159 |
| 1426 | 3300031249 | Ga0265339_10376988 | Ga0265339_103769882 | 159 |
| 1427 | 3300031250 | Ga0265331_10068893 | Ga0265331_100688933 | 159 |
| 1428 | 3300031250 | Ga0265331_10083507 | Ga0265331_100835072 | 159 |
| 1429 | 3300031344 | Ga0265316_10789044 | Ga0265316_107890442 | 159 |
| 1430 | 3300031507 | Ga0307509_10014245 | Ga0307509_100142452 | 159 |
| 1431 | 3300031507 | Ga0307509_10098111 | Ga0307509_100981113 | 159 |
| 1432 | 3300031507 | Ga0307509_10592549 | Ga0307509_105925492 | 159 |
| 1433 | 3300031548 | Ga0307408_101558671 | Ga0307408_1015586712 | 159 |
| 1434 | 3300031595 | Ga0265313_10063475 | Ga0265313_100634753 | 159 |
| 1435 | 3300031616 | Ga0307508_10111858 | Ga0307508_101118584 | 159 |
| 1436 | 3300031616 | Ga0307508_10232923 | Ga0307508_102329233 | 159 |
| 1437 | 3300031711 | Ga0265314_10099606 | Ga0265314_100996063 | 159 |
| 1438 | 3300031712 | Ga0265342_10009847 | Ga0265342_100098472 | 159 |
| 1439 | 3300031712 | Ga0265342_10065315 | Ga0265342_100653151 | 159 |
| 1440 | 3300031730 | Ga0307516_10005995 | Ga0307516_100059958 | 159 |
| 1441 | 3300031730 | Ga0307516_10097075 | Ga0307516_100970752 | 159 |
| 1442 | 3300031730 | Ga0307516_10126545 | Ga0307516_101265453 | 159 |
| 1443 | 3300031730 | Ga0307516_10401264 | Ga0307516_104012642 | 159 |
| 1444 | 3300031824 | Ga0307413_10468445 | Ga0307413_104684452 | 159 |
| 1445 | 3300031852 | Ga0307410_10623428 | Ga0307410_106234282 | 159 |
| 1446 | 3300031901 | Ga0307406_10744456 | Ga0307406_107444562 | 159 |
| 1447 | 3300031903 | Ga0307407_11335175 | Ga0307407_113351751 | 159 |
| 1448 | 3300031911 | Ga0307412_10379263 | Ga0307412_103792633 | 159 |
| 1449 | 3300031995 | Ga0307409_101524258 | Ga0307409_1015242582 | 159 |
| 1450 | 3300031995 | Ga0307409_102086504 | Ga0307409_1020865041 | 159 |
| 1451 | 3300032002 | Ga0307416_100747531 | Ga0307416_1007475311 | 159 |
| 1452 | 3300032002 | Ga0307416_100778753 | Ga0307416_1007787532 | 159 |
| 1453 | 3300032002 | Ga0307416_101034913 | Ga0307416_1010349132 | 159 |
| 1454 | 3300032126 | Ga0307415_100233281 | Ga0307415_1002332812 | 159 |
| 1455 | 3300032126 | Ga0307415_100825403 | Ga0307415_1008254032 | 159 |
| 1456 | 3300032126 | Ga0307415_100925050 | Ga0307415_1009250502 | 159 |
| 1457 | 3300033179 | Ga0307507_10329935 | Ga0307507_103299351 | 159 |
| 1458 | 3300033180 | Ga0307510_10006305 | Ga0307510_1000630510 | 159 |
| 1459 | 3300033180 | Ga0307510_10041581 | Ga0307510_100415813 | 159 |
| 1460 | 3300033544 | Ga0316215_1013218 | Ga0316215_10132182 | 159 |
| 1461 | 3300035083 | Ga0373926_0044210 | Ga0373926_0044210_388_876 | 159 |
| 1462 | 3300035086 | Ga0373934_0031807 | Ga0373934_0031807_14_499 | 159 |
| 1463 | 3300035086 | Ga0373934_0035852 | Ga0373934_0035852_1102_1590 | 159 |
| 1464 | 3300035086 | Ga0373934_0299123 | Ga0373934_0299123_69_548 | 159 |
| 1465 | 3300035111 | Ga0373923_0051442 | Ga0373923_0051442_357_845 | 159 |
| 1466 | 3300035111 | Ga0373923_0537138 | Ga0373923_0537138_69_560 | 159 |
| 1467 | 3300035115 | Ga0373941_0028234 | Ga0373941_0028234_458_937 | 159 |
| 1468 | 3300035116 | Ga0373945_0057394 | Ga0373945_0057394_115_606 | 159 |
| 1469 | 3300035117 | Ga0373953_0003406 | Ga0373953_0003406_2335_2823 | 159 |
| 1470 | 3300035117 | Ga0373953_0150420 | Ga0373953_0150420_209_688 | 159 |
| 1471 | 3300035118 | Ga0373954_0005974 | Ga0373954_0005974_3008_3496 | 159 |
| 1472 | 3300035118 | Ga0373954_0339928 | Ga0373954_0339928_71_550 | 159 |
| 1473 | 3300035119 | Ga0373956_0056434 | Ga0373956_0056434_275_763 | 159 |
| 1474 | 3300035120 | Ga0373957_0020281 | Ga0373957_0020281_1757_2245 | 159 |
| 1475 | 3300035120 | Ga0373957_0022105 | Ga0373957_0022105_1197_1682 | 159 |
| 1476 | 3300035120 | Ga0373957_0168222 | Ga0373957_0168222_86_577 | 159 |
| 1477 | 3300035170 | Ga0373943_0000795 | Ga0373943_0000795_11185_11676 | 159 |
| 1478 | 3300035170 | Ga0373943_0153691 | Ga0373943_0153691_68_556 | 159 |
| 1479 | 3300035171 | Ga0373946_0006225 | Ga0373946_0006225_2899_3390 | 159 |
| 1480 | 3300035171 | Ga0373946_0210640 | Ga0373946_0210640_71_550 | 159 |
| 1481 | 3300035171 | Ga0373946_0229166 | Ga0373946_0229166_231_719 | 159 |
| 1482 | 3300035171 | Ga0373946_0310404 | Ga0373946_0310404_18_497 | 159 |
| 1483 | 3300035172 | Ga0373955_0159501 | Ga0373955_0159501_746_1234 | 159 |
| 1484 | 3300035172 | Ga0373955_0179618 | Ga0373955_0179618_360_851 | 159 |
| 1485 | 3300035172 | Ga0373955_0627919 | Ga0373955_0627919_86_565 | 159 |
| 1486 | 3300035207 | Ga0373942_0032763 | Ga0373942_0032763_430_909 | 159 |
| 1487 | 3300035410 | Ga0373924_0009206 | Ga0373924_0009206_2889_3380 | 159 |
| 1488 | 3300035410 | Ga0373924_0017906 | Ga0373924_0017906_1427_1912 | 159 |
| 1489 | 3300035691 | Ga0373931_0023469 | Ga0373931_0023469_587_1066 | 159 |
| 1490 | 3300035691 | Ga0373931_0467324 | Ga0373931_0467324_297_776 | 159 |
| 1491 | 3300035691 | Ga0373931_0505071 | Ga0373931_0505071_31_522 | 159 |
| 1492 | 3300035691 | Ga0373931_0622424 | Ga0373931_0622424_89_568 | 159 |
| 1493 | 3300035692 | Ga0373935_0000536 | Ga0373935_0000536_8212_8703 | 159 |
| 1494 | 3300035692 | Ga0373935_0130397 | Ga0373935_0130397_883_1362 | 159 |
| 1495 | 3300035692 | Ga0373935_0368091 | Ga0373935_0368091_157_645 | 159 |
| 1496 | 3300035695 | Ga0373927_0000898 | Ga0373927_0000898_7237_7728 | 159 |
| 1497 | 3300035695 | Ga0373927_0039104 | Ga0373927_0039104_1137_1616 | 159 |
| 1498 | 3300035695 | Ga0373927_0110471 | Ga0373927_0110471_262_741 | 159 |
| 1499 | 3300035724 | Ga0373933_0382728 | Ga0373933_0382728_108_593 | 159 |
| 1500 | 3300035725 | Ga0373947_0010479 | Ga0373947_0010479_2717_3208 | 159 |
| 1501 | 3300035725 | Ga0373947_0032481 | Ga0373947_0032481_380_868 | 159 |
| 1502 | 3300036401 | Ga0373937_0064227 | Ga0373937_0064227_1486_1977 | 159 |
| 1503 | 3300036401 | Ga0373937_0092525 | Ga0373937_0092525_1767_2258 | 159 |
| 1504 | 3300036401 | Ga0373937_0095987 | Ga0373937_0095987_1145_1624 | 159 |
| 1505 | 3300036401 | Ga0373937_0142169 | Ga0373937_0142169_694_1182 | 159 |
| 1506 | 3300036401 | Ga0373937_0285918 | Ga0373937_0285918_344_823 | 159 |
| 1507 | 3300036459 | Ga0372808_055570 | Ga0372808_055570_48_527 | 159 |
| 1508 | 3300037068 | Ga0373925_0001796 | Ga0373925_0001796_1390_1881 | 159 |
| 1509 | 3300037068 | Ga0373925_0168515 | Ga0373925_0168515_819_1298 | 159 |
| 1510 | 3300037068 | Ga0373925_0339375 | Ga0373925_0339375_303_791 | 159 |
| 1511 | 3300037068 | Ga0373925_0368755 | Ga0373925_0368755_651_1139 | 159 |
| 1512 | 3300037068 | Ga0373925_1159596 | Ga0373925_1159596_104_589 | 159 |
| 1513 | 3300037471 | Ga0395905_0161613 | Ga0395905_0161613_1480_1959 | 159 |
| 1514 | 3300037853 | Ga0436364_0231314 | Ga0436364_0231314_1736_2215 | 159 |
| 1515 | 3300037853 | Ga0436364_0807757 | Ga0436364_0807757_13_492 | 159 |
| 1516 | 3300038443 | Ga0395901_0137905 | Ga0395901_0137905_194_673 | 159 |
| 1517 | 3300039437 | Ga0436365_0679534 | Ga0436365_0679534_491_976 | 159 |
| 1518 | 3300039437 | Ga0436365_1425854 | Ga0436365_1425854_2164_2652 | 159 |
| 1519 | 3300039438 | Ga0436360_0588427 | Ga0436360_0588427_867_1346 | 159 |
| 1520 | 3300039447 | Ga0436361_0518565 | Ga0436361_0518565_205_684 | 159 |
| 1521 | 3300039450 | Ga0436363_0142697 | Ga0436363_0142697_26_505 | 159 |
| 1522 | 3300039450 | Ga0436363_0923145 | Ga0436363_0923145_52_534 | 159 |
| 1523 | 3300039450 | Ga0436363_1556276 | Ga0436363_1556276_389_880 | 159 |
| 1524 | 3300039453 | Ga0436362_0868287 | Ga0436362_0868287_185_673 | 159 |
| 1525 | 3300041441 | Ga0451787_768313 | Ga0451787_768313_105_584 | 159 |
| 1526 | 3300041451 | Ga0451791_1328224 | Ga0451791_1328224_64_546 | 159 |
| 1527 | 3300041452 | Ga0451793_0250726 | Ga0451793_0250726_468_947 | 159 |
| 1528 | 3300041458 | Ga0451798_0974609 | Ga0451798_0974609_87_566 | 159 |
| 1529 | 3300041486 | Ga0451807_1659583 | Ga0451807_1659583_72_554 | 159 |
| 1530 | 3300041509 | Ga0451843_0345131 | Ga0451843_0345131_15_497 | 159 |
| 1531 | 3300044842 | Ga0466957_0145307 | Ga0466957_0145307_570_1049 | 159 |
| 1532 | 3300046452 | Ga0495617_079919 | Ga0495617_079919_296_778 | 159 |
| 1533 | 3300046454 | Ga0495592_0029907 | Ga0495592_0029907_3182_3673 | 159 |
| 1534 | 3300046454 | Ga0495592_0580120 | Ga0495592_0580120_100_585 | 159 |
| 1535 | 3300046455 | Ga0495603_0000046 | Ga0495603_0000046_45852_46343 | 159 |
| 1536 | 3300046455 | Ga0495603_0002778 | Ga0495603_0002778_4974_5456 | 159 |
| 1537 | 3300046455 | Ga0495603_0040136 | Ga0495603_0040136_312_791 | 159 |
| 1538 | 3300046459 | Ga0495629_0000071 | Ga0495629_0000071_24346_24837 | 159 |
| 1539 | 3300046459 | Ga0495629_0065563 | Ga0495629_0065563_1327_1806 | 159 |
| 1540 | 3300046459 | Ga0495629_0177624 | Ga0495629_0177624_972_1457 | 159 |
| 1541 | 3300046459 | Ga0495629_0314481 | Ga0495629_0314481_539_1018 | 159 |
| 1542 | 3300046459 | Ga0495629_0410884 | Ga0495629_0410884_275_763 | 159 |
| 1543 | 3300046460 | Ga0495638_0373896 | Ga0495638_0373896_205_684 | 159 |
| 1544 | 3300046461 | Ga0495641_0009896 | Ga0495641_0009896_2293_2784 | 159 |
| 1545 | 3300046461 | Ga0495641_0029184 | Ga0495641_0029184_176_658 | 159 |
| 1546 | 3300046462 | Ga0495651_0545205 | Ga0495651_0545205_20_505 | 159 |
| 1547 | 3300046463 | Ga0495653_0228910 | Ga0495653_0228910_714_1199 | 159 |
| 1548 | 3300046463 | Ga0495653_0702077 | Ga0495653_0702077_114_593 | 159 |
| 1549 | 3300046472 | Ga0495580_0000057 | Ga0495580_0000057_38065_38556 | 159 |
| 1550 | 3300046472 | Ga0495580_0043983 | Ga0495580_0043983_1702_2190 | 159 |
| 1551 | 3300046472 | Ga0495580_0152884 | Ga0495580_0152884_146_625 | 159 |
| 1552 | 3300046473 | Ga0495582_0000111 | Ga0495582_0000111_16324_16815 | 159 |
| 1553 | 3300046473 | Ga0495582_0082297 | Ga0495582_0082297_1021_1509 | 159 |
| 1554 | 3300046474 | Ga0495605_0079481 | Ga0495605_0079481_353_832 | 159 |
| 1555 | 3300046475 | Ga0495639_0000108 | Ga0495639_0000108_15859_16350 | 159 |
| 1556 | 3300046475 | Ga0495639_0214805 | Ga0495639_0214805_165_647 | 159 |
| 1557 | 3300046476 | Ga0495662_0000992 | Ga0495662_0000992_1406_1897 | 159 |
| 1558 | 3300046476 | Ga0495662_0020305 | Ga0495662_0020305_2546_3034 | 159 |
| 1559 | 3300046477 | Ga0495664_0002718 | Ga0495664_0002718_4346_4837 | 159 |
| 1560 | 3300046477 | Ga0495664_0030650 | Ga0495664_0030650_2508_2996 | 159 |
| 1561 | 3300046477 | Ga0495664_0122727 | Ga0495664_0122727_234_719 | 159 |
| 1562 | 3300046477 | Ga0495664_0325560 | Ga0495664_0325560_339_818 | 159 |
| 1563 | 3300046491 | Ga0495584_0515486 | Ga0495584_0515486_114_593 | 159 |
| 1564 | 3300046499 | Ga0495594_0000133 | Ga0495594_0000133_10878_11369 | 159 |
| 1565 | 3300046499 | Ga0495594_0137260 | Ga0495594_0137260_640_1122 | 159 |
| 1566 | 3300046499 | Ga0495594_0573922 | Ga0495594_0573922_60_539 | 159 |
| 1567 | 3300046500 | Ga0495596_0105487 | Ga0495596_0105487_527_1009 | 159 |
| 1568 | 3300046501 | Ga0495607_0152369 | Ga0495607_0152369_422_901 | 159 |
| 1569 | 3300046501 | Ga0495607_0210154 | Ga0495607_0210154_350_829 | 159 |
| 1570 | 3300046507 | Ga0495606_0082074 | Ga0495606_0082074_443_922 | 159 |
| 1571 | 3300046507 | Ga0495606_0341486 | Ga0495606_0341486_58_540 | 159 |
| 1572 | 3300046511 | Ga0495608_0129691 | Ga0495608_0129691_116_607 | 159 |
| 1573 | 3300046514 | Ga0495618_0064992 | Ga0495618_0064992_1299_1784 | 159 |
| 1574 | 3300046515 | Ga0495620_0293822 | Ga0495620_0293822_93_575 | 159 |
| 1575 | 3300046516 | Ga0495628_0074053 | Ga0495628_0074053_1327_1818 | 159 |
| 1576 | 3300046516 | Ga0495628_0121239 | Ga0495628_0121239_702_1187 | 159 |
| 1577 | 3300046517 | Ga0495630_0000959 | Ga0495630_0000959_8774_9265 | 159 |
| 1578 | 3300046517 | Ga0495630_0019164 | Ga0495630_0019164_429_917 | 159 |
| 1579 | 3300046517 | Ga0495630_0077623 | Ga0495630_0077623_1270_1749 | 159 |
| 1580 | 3300046519 | Ga0495632_0085482 | Ga0495632_0085482_173_652 | 159 |
| 1581 | 3300046520 | Ga0495637_0090080 | Ga0495637_0090080_629_1108 | 159 |
| 1582 | 3300046520 | Ga0495637_0140225 | Ga0495637_0140225_119_601 | 159 |
| 1583 | 3300046522 | Ga0495643_0302495 | Ga0495643_0302495_52_534 | 159 |
| 1584 | 3300046523 | Ga0495644_0037867 | Ga0495644_0037867_351_830 | 159 |
| 1585 | 3300046523 | Ga0495644_0079264 | Ga0495644_0079264_241_726 | 159 |
| 1586 | 3300046523 | Ga0495644_0133893 | Ga0495644_0133893_409_891 | 159 |
| 1587 | 3300046524 | Ga0495648_0014927 | Ga0495648_0014927_409_888 | 159 |
| 1588 | 3300046524 | Ga0495648_0082027 | Ga0495648_0082027_1046_1525 | 159 |
| 1589 | 3300046524 | Ga0495648_0308876 | Ga0495648_0308876_11_490 | 159 |
| 1590 | 3300046528 | Ga0495642_0118884 | Ga0495642_0118884_13_495 | 159 |
| 1591 | 3300046528 | Ga0495642_0183959 | Ga0495642_0183959_206_685 | 159 |
| 1592 | 3300046529 | Ga0495652_0042099 | Ga0495652_0042099_1508_1999 | 159 |
| 1593 | 3300046529 | Ga0495652_0220458 | Ga0495652_0220458_350_829 | 159 |
| 1594 | 3300046529 | Ga0495652_0444358 | Ga0495652_0444358_114_605 | 159 |
| 1595 | 3300046529 | Ga0495652_0535283 | Ga0495652_0535283_231_716 | 159 |
| 1596 | 3300046529 | Ga0495652_0721299 | Ga0495652_0721299_151_639 | 159 |
| 1597 | 3300046531 | Ga0495665_0000001 | Ga0495665_0000001_55443_55934 | 159 |
| 1598 | 3300046531 | Ga0495665_0049613 | Ga0495665_0049613_1055_1543 | 159 |
| 1599 | 3300046533 | Ga0495640_0007124 | Ga0495640_0007124_5402_5893 | 159 |
| 1600 | 3300046533 | Ga0495640_0012179 | Ga0495640_0012179_2730_3221 | 159 |
| 1601 | 3300046533 | Ga0495640_0023983 | Ga0495640_0023983_820_1305 | 159 |
| 1602 | 3300046535 | Ga0495586_0078473 | Ga0495586_0078473_923_1408 | 159 |
| 1603 | 3300046536 | Ga0495587_0066633 | Ga0495587_0066633_1226_1717 | 159 |
| 1604 | 3300046536 | Ga0495587_0209922 | Ga0495587_0209922_395_874 | 159 |
| 1605 | 3300046537 | Ga0495598_0024640 | Ga0495598_0024640_694_1173 | 159 |
| 1606 | 3300046537 | Ga0495598_0065662 | Ga0495598_0065662_371_850 | 159 |
| 1607 | 3300046538 | Ga0495609_0147695 | Ga0495609_0147695_178_657 | 159 |
| 1608 | 3300046542 | Ga0495597_0226892 | Ga0495597_0226892_183_665 | 159 |
| 1609 | 3300046543 | Ga0495645_0065908 | Ga0495645_0065908_1523_2011 | 159 |
| 1610 | 3300046543 | Ga0495645_0159553 | Ga0495645_0159553_720_1199 | 159 |
| 1611 | 3300046543 | Ga0495645_0417019 | Ga0495645_0417019_93_572 | 159 |
| 1612 | 3300046557 | Ga0495622_0001363 | Ga0495622_0001363_9299_9790 | 159 |
| 1613 | 3300046559 | Ga0495667_0193047 | Ga0495667_0193047_139_624 | 159 |
| 1614 | 3300046616 | Ga0495668_0082096 | Ga0495668_0082096_45_524 | 159 |
| 1615 | 3300046616 | Ga0495668_0236868 | Ga0495668_0236868_169_651 | 159 |
| 1616 | 3300046616 | Ga0495668_0361799 | Ga0495668_0361799_30_509 | 159 |
| 1617 | 3300046642 | Ga0495634_0000046 | Ga0495634_0000046_25888_26379 | 159 |
| 1618 | 3300046660 | Ga0495625_0228992 | Ga0495625_0228992_100_582 | 159 |
| 1619 | 3300046660 | Ga0495625_0356125 | Ga0495625_0356125_132_614 | 159 |
| 1620 | 3300046660 | Ga0495625_0526855 | Ga0495625_0526855_58_540 | 159 |
| 1621 | 3300046663 | Ga0495635_0000338 | Ga0495635_0000338_25439_25930 | 159 |
| 1622 | 3300046663 | Ga0495635_0307369 | Ga0495635_0307369_36_521 | 159 |
| 1623 | 3300046663 | Ga0495635_0407123 | Ga0495635_0407123_107_586 | 159 |
| 1624 | 3300046663 | Ga0495635_0438523 | Ga0495635_0438523_295_774 | 159 |
| 1625 | 3300046664 | Ga0495659_0009434 | Ga0495659_0009434_1291_1770 | 159 |
| 1626 | 3300046674 | Ga0495588_0001464 | Ga0495588_0001464_5231_5722 | 159 |
| 1627 | 3300046675 | Ga0495657_0054792 | Ga0495657_0054792_1777_2262 | 159 |
| 1628 | 3300046678 | Ga0495599_0021343 | Ga0495599_0021343_559_1050 | 159 |
| 1629 | 3300046678 | Ga0495599_0085667 | Ga0495599_0085667_387_878 | 159 |
| 1630 | 3300046679 | Ga0495623_0108103 | Ga0495623_0108103_896_1375 | 159 |
| 1631 | 3300046679 | Ga0495623_0157199 | Ga0495623_0157199_827_1306 | 159 |
| 1632 | 3300046679 | Ga0495623_0224266 | Ga0495623_0224266_439_930 | 159 |
| 1633 | 3300046680 | Ga0495646_0008580 | Ga0495646_0008580_3223_3714 | 159 |
| 1634 | 3300046680 | Ga0495646_0055725 | Ga0495646_0055725_638_1129 | 159 |
| 1635 | 3300046681 | Ga0495647_0000754 | Ga0495647_0000754_5332_5823 | 159 |
| 1636 | 3300046683 | Ga0495658_0000994 | Ga0495658_0000994_3522_4013 | 159 |
| 1637 | 3300046683 | Ga0495658_0074262 | Ga0495658_0074262_422_901 | 159 |
| 1638 | 3300046683 | Ga0495658_0145919 | Ga0495658_0145919_260_748 | 159 |
| 1639 | 3300046684 | Ga0495669_0001990 | Ga0495669_0001990_3842_4321 | 159 |
| 1640 | 3300046684 | Ga0495669_0227003 | Ga0495669_0227003_251_733 | 159 |
| 1641 | 3300046684 | Ga0495669_0233449 | Ga0495669_0233449_365_844 | 159 |
| 1642 | 3300046689 | Ga0495613_0005517 | Ga0495613_0005517_181_672 | 159 |
| 1643 | 3300046689 | Ga0495613_0103256 | Ga0495613_0103256_1165_1656 | 159 |
| 1644 | 3300046689 | Ga0495613_0162469 | Ga0495613_0162469_68_556 | 159 |
| 1645 | 3300046690 | Ga0495624_0003652 | Ga0495624_0003652_8075_8566 | 159 |
| 1646 | 3300046690 | Ga0495624_0092157 | Ga0495624_0092157_330_821 | 159 |
| 1647 | 3300046690 | Ga0495624_0230376 | Ga0495624_0230376_260_748 | 159 |
| 1648 | 3300046690 | Ga0495624_0468409 | Ga0495624_0468409_189_671 | 159 |
| 1649 | 3300046691 | Ga0495670_0161747 | Ga0495670_0161747_94_573 | 159 |
| 1650 | 3300046692 | Ga0495671_0159475 | Ga0495671_0159475_226_708 | 159 |
| 1651 | 3300046694 | Ga0495649_0277609 | Ga0495649_0277609_247_729 | 159 |
| 1652 | 3300046794 | Ga0495589_0112277 | Ga0495589_0112277_361_840 | 159 |
| 1653 | 3300046809 | Ga0495600_0247155 | Ga0495600_0247155_463_951 | 159 |
| 1654 | 3300046809 | Ga0495600_0320588 | Ga0495600_0320588_420_911 | 159 |
| 1655 | 3300046810 | Ga0495660_0206592 | Ga0495660_0206592_102_584 | 159 |
| 1656 | 3300047315 | Ga0495581_0000012 | Ga0495581_0000012_17433_17924 | 159 |
| 1657 | 3300047315 | Ga0495581_0080479 | Ga0495581_0080479_1285_1767 | 159 |
| 1658 | 3300047315 | Ga0495581_0161447 | Ga0495581_0161447_156_635 | 159 |
| 1659 | 3300047315 | Ga0495581_0544918 | Ga0495581_0544918_133_621 | 159 |
| 1660 | 3300047317 | Ga0495604_0071062 | Ga0495604_0071062_1431_1922 | 159 |
| 1661 | 3300047317 | Ga0495604_0192614 | Ga0495604_0192614_637_1125 | 159 |
| 1662 | 3300047317 | Ga0495604_0208007 | Ga0495604_0208007_530_1015 | 159 |
| 1663 | 3300047317 | Ga0495604_0910490 | Ga0495604_0910490_35_514 | 159 |
| 1664 | 3300047319 | Ga0495674_0000031 | Ga0495674_0000031_23050_23541 | 159 |
| 1665 | 3300047319 | Ga0495674_0049361 | Ga0495674_0049361_921_1409 | 159 |
| 1666 | 3300047319 | Ga0495674_0203809 | Ga0495674_0203809_91_576 | 159 |
| 1667 | 3300047319 | Ga0495674_0204370 | Ga0495674_0204370_992_1471 | 159 |
| 1668 | 3300047319 | Ga0495674_0213934 | Ga0495674_0213934_204_683 | 159 |
| 1669 | 3300047319 | Ga0495674_0771308 | Ga0495674_0771308_136_627 | 159 |
| 1670 | 3300047320 | Ga0495672_0104425 | Ga0495672_0104425_249_731 | 159 |
| 1671 | 3300047321 | Ga0495676_0399032 | Ga0495676_0399032_156_644 | 159 |
| 1672 | 3300047321 | Ga0495676_0783887 | Ga0495676_0783887_72_563 | 159 |
| 1673 | 3300047322 | Ga0495680_0110891 | Ga0495680_0110891_542_1033 | 159 |
| 1674 | 3300047322 | Ga0495680_0193852 | Ga0495680_0193852_221_709 | 159 |
| 1675 | 3300047322 | Ga0495680_0359808 | Ga0495680_0359808_497_976 | 159 |
| 1676 | 3300047322 | Ga0495680_0521323 | Ga0495680_0521323_289_777 | 159 |
| 1677 | 3300047323 | Ga0495683_0140443 | Ga0495683_0140443_156_638 | 159 |
| 1678 | 3300047444 | Ga0495675_0132509 | Ga0495675_0132509_726_1211 | 159 |
| 1679 | 3300047444 | Ga0495675_0187240 | Ga0495675_0187240_640_1131 | 159 |
| 1680 | 3300047444 | Ga0495675_0325266 | Ga0495675_0325266_237_716 | 159 |
| 1681 | 3300047445 | Ga0495677_0015930 | Ga0495677_0015930_950_1429 | 159 |
| 1682 | 3300047446 | Ga0495679_022313 | Ga0495679_022313_513_995 | 159 |
| 1683 | 3300047447 | Ga0495685_143639 | Ga0495685_143639_13_492 | 159 |
| 1684 | 3300047447 | Ga0495685_174451 | Ga0495685_174451_32_514 | 159 |
| 1685 | 3300047469 | Ga0495673_0121034 | Ga0495673_0121034_295_774 | 159 |
| 1686 | 3300047471 | Ga0495684_0005641 | Ga0495684_0005641_4279_4767 | 159 |
| 1687 | 3300047471 | Ga0495684_0230085 | Ga0495684_0230085_237_728 | 159 |
| 1688 | 3300047472 | Ga0495686_0289914 | Ga0495686_0289914_111_590 | 159 |
| 1689 | 3300047673 | Ga0495593_0000008 | Ga0495593_0000008_32363_32854 | 159 |
| 1690 | 3300047673 | Ga0495593_0316927 | Ga0495593_0316927_250_729 | 159 |
| 1691 | 3300048088 | Ga0495602_0064657 | Ga0495602_0064657_1502_1993 | 159 |
| 1692 | 3300048088 | Ga0495602_0138088 | Ga0495602_0138088_1389_1874 | 159 |
| 1693 | 3300048090 | Ga0495615_0018473 | Ga0495615_0018473_342_821 | 159 |
| 1694 | 3300048090 | Ga0495615_0034571 | Ga0495615_0034571_408_887 | 159 |
| 1695 | 3300048090 | Ga0495615_0217610 | Ga0495615_0217610_94_573 | 159 |
| 1696 | 3300048091 | Ga0495626_0096064 | Ga0495626_0096064_548_1030 | 159 |
| 1697 | 3300048903 | Ga0496100_0057335 | Ga0496100_0057335_70_549 | 159 |
| 1698 | 3300048903 | Ga0496100_0591946 | Ga0496100_0591946_363_842 | 159 |
| 1699 | 3300048904 | Ga0496101_0006365 | Ga0496101_0006365_6079_6558 | 159 |
| 1700 | 3300048904 | Ga0496101_0147253 | Ga0496101_0147253_1140_1619 | 159 |
| 1701 | 3300048904 | Ga0496101_0590532 | Ga0496101_0590532_64_543 | 159 |
| 1702 | 3300048904 | Ga0496101_1089009 | Ga0496101_1089009_52_543 | 159 |
| 1703 | 3300048905 | Ga0496102_0003595 | Ga0496102_0003595_5487_5966 | 159 |
| 1704 | 3300048905 | Ga0496102_0100826 | Ga0496102_0100826_732_1211 | 159 |
| 1705 | 3300048905 | Ga0496102_0326950 | Ga0496102_0326950_112_591 | 159 |
| 1706 | 3300048905 | Ga0496102_0402410 | Ga0496102_0402410_583_1062 | 159 |
| 1707 | 3300048905 | Ga0496102_0537843 | Ga0496102_0537843_300_779 | 159 |
| 1708 | 3300048905 | Ga0496102_0680337 | Ga0496102_0680337_270_749 | 159 |
| 1709 | 3300048905 | Ga0496102_0817436 | Ga0496102_0817436_29_520 | 159 |
| 1710 | 3300048905 | Ga0496102_0910493 | Ga0496102_0910493_250_729 | 159 |
| 1711 | 3300048906 | Ga0496103_0013766 | Ga0496103_0013766_654_1133 | 159 |
| 1712 | 3300048906 | Ga0496103_0086099 | Ga0496103_0086099_377_856 | 159 |
| 1713 | 3300048906 | Ga0496103_0183494 | Ga0496103_0183494_291_773 | 159 |
| 1714 | 3300048906 | Ga0496103_0205021 | Ga0496103_0205021_161_652 | 159 |
| 1715 | 3300048907 | Ga0496104_0056792 | Ga0496104_0056792_733_1224 | 159 |
| 1716 | 3300048909 | Ga0496106_0001857 | Ga0496106_0001857_4551_5030 | 159 |
| 1717 | 3300048909 | Ga0496106_0029456 | Ga0496106_0029456_1749_2228 | 159 |
| 1718 | 3300048909 | Ga0496106_0031714 | Ga0496106_0031714_2520_3011 | 159 |
| 1719 | 3300048909 | Ga0496106_0048244 | Ga0496106_0048244_196_675 | 159 |
| 1720 | 3300048909 | Ga0496106_0146926 | Ga0496106_0146926_800_1279 | 159 |
| 1721 | 3300048909 | Ga0496106_0414878 | Ga0496106_0414878_80_562 | 159 |
| 1722 | 3300048910 | Ga0496107_0000947 | Ga0496107_0000947_5980_6459 | 159 |
| 1723 | 3300048910 | Ga0496107_0104673 | Ga0496107_0104673_946_1428 | 159 |
| 1724 | 3300048910 | Ga0496107_0173695 | Ga0496107_0173695_876_1355 | 159 |
| 1725 | 3300048910 | Ga0496107_0381294 | Ga0496107_0381294_299_781 | 159 |
| 1726 | 3300048910 | Ga0496107_0462102 | Ga0496107_0462102_319_798 | 159 |
| 1727 | 3300048910 | Ga0496107_0546490 | Ga0496107_0546490_263_742 | 159 |
| 1728 | 3300048911 | Ga0496108_0013705 | Ga0496108_0013705_3003_3482 | 159 |
| 1729 | 3300048911 | Ga0496108_0053689 | Ga0496108_0053689_1604_2083 | 159 |
| 1730 | 3300048911 | Ga0496108_0136699 | Ga0496108_0136699_226_717 | 159 |
| 1731 | 3300048912 | Ga0496109_0008951 | Ga0496109_0008951_5958_6437 | 159 |
| 1732 | 3300048912 | Ga0496109_0048452 | Ga0496109_0048452_390_869 | 159 |
| 1733 | 3300048912 | Ga0496109_0220090 | Ga0496109_0220090_327_809 | 159 |
| 1734 | 3300048912 | Ga0496109_0312979 | Ga0496109_0312979_72_563 | 159 |
| 1735 | 3300048912 | Ga0496109_0506901 | Ga0496109_0506901_603_1088 | 159 |
| 1736 | 3300048912 | Ga0496109_0559210 | Ga0496109_0559210_119_598 | 159 |
| 1737 | 3300048912 | Ga0496109_1195045 | Ga0496109_1195045_185_664 | 159 |
| 1738 | 3300048912 | Ga0496109_1199216 | Ga0496109_1199216_60_539 | 159 |
| 1739 | 3300048913 | Ga0496110_0047060 | Ga0496110_0047060_1979_2458 | 159 |
| 1740 | 3300048913 | Ga0496110_0132945 | Ga0496110_0132945_1094_1585 | 159 |
| 1741 | 3300048913 | Ga0496110_0161087 | Ga0496110_0161087_768_1250 | 159 |
| 1742 | 3300048913 | Ga0496110_0498068 | Ga0496110_0498068_195_677 | 159 |
| 1743 | 3300048913 | Ga0496110_1226028 | Ga0496110_1226028_25_504 | 159 |
| 1744 | 3300048914 | Ga0496111_0039323 | Ga0496111_0039323_916_1395 | 159 |
| 1745 | 3300048914 | Ga0496111_0107836 | Ga0496111_0107836_1450_1932 | 159 |
| 1746 | 3300048914 | Ga0496111_0423490 | Ga0496111_0423490_152_631 | 159 |
| 1747 | 3300048914 | Ga0496111_0602203 | Ga0496111_0602203_26_505 | 159 |
| 1748 | 3300048914 | Ga0496111_0771113 | Ga0496111_0771113_97_588 | 159 |
| 1749 | 3300048914 | Ga0496111_0993871 | Ga0496111_0993871_109_588 | 159 |
| 1750 | 3300048915 | Ga0496112_0000008 | Ga0496112_0000008_111238_111717 | 159 |
| 1751 | 3300048915 | Ga0496112_0012760 | Ga0496112_0012760_6063_6542 | 159 |
| 1752 | 3300048915 | Ga0496112_0110694 | Ga0496112_0110694_869_1351 | 159 |
| 1753 | 3300048915 | Ga0496112_0176405 | Ga0496112_0176405_1306_1791 | 159 |
| 1754 | 3300048915 | Ga0496112_0338342 | Ga0496112_0338342_680_1159 | 159 |
| 1755 | 3300048915 | Ga0496112_0471865 | Ga0496112_0471865_35_514 | 159 |
| 1756 | 3300048916 | Ga0496113_0001327 | Ga0496113_0001327_6811_7290 | 159 |
| 1757 | 3300048916 | Ga0496113_0038477 | Ga0496113_0038477_2055_2534 | 159 |
| 1758 | 3300048916 | Ga0496113_0111008 | Ga0496113_0111008_243_734 | 159 |
| 1759 | 3300048916 | Ga0496113_0153794 | Ga0496113_0153794_579_1061 | 159 |
| 1760 | 3300048917 | Ga0496114_0021716 | Ga0496114_0021716_4438_4917 | 159 |
| 1761 | 3300048917 | Ga0496114_0024353 | Ga0496114_0024353_3230_3709 | 159 |
| 1762 | 3300048917 | Ga0496114_0633259 | Ga0496114_0633259_77_562 | 159 |
| 1763 | 3300048917 | Ga0496114_0818246 | Ga0496114_0818246_70_552 | 159 |
| 1764 | 3300048918 | Ga0496115_0000604 | Ga0496115_0000604_6020_6499 | 159 |
| 1765 | 3300048918 | Ga0496115_0033862 | Ga0496115_0033862_1126_1617 | 159 |
| 1766 | 3300048918 | Ga0496115_0071313 | Ga0496115_0071313_2121_2603 | 159 |
| 1767 | 3300048918 | Ga0496115_0278603 | Ga0496115_0278603_293_772 | 159 |
| 1768 | 3300048919 | Ga0496116_0274032 | Ga0496116_0274032_39_521 | 159 |
| 1769 | 3300048920 | Ga0496117_0010071 | Ga0496117_0010071_477_956 | 159 |
| 1770 | 3300048920 | Ga0496117_0241697 | Ga0496117_0241697_389_871 | 159 |
| 1771 | 3300048920 | Ga0496117_0497679 | Ga0496117_0497679_14_496 | 159 |
| 1772 | 3300048921 | Ga0496118_0008611 | Ga0496118_0008611_2610_3089 | 159 |
| 1773 | 3300048922 | Ga0496119_0222562 | Ga0496119_0222562_395_877 | 159 |
| 1774 | 3300048924 | Ga0496121_0002635 | Ga0496121_0002635_18408_18887 | 159 |
| 1775 | 3300048924 | Ga0496121_0010213 | Ga0496121_0010213_21_515 | 159 |
| 1776 | 3300048924 | Ga0496121_0017920 | Ga0496121_0017920_2008_2490 | 159 |
| 1777 | 3300048924 | Ga0496121_0020183 | Ga0496121_0020183_5264_5746 | 159 |
| 1778 | 3300048924 | Ga0496121_0062307 | Ga0496121_0062307_1849_2328 | 159 |
| 1779 | 3300048924 | Ga0496121_0195694 | Ga0496121_0195694_347_826 | 159 |
| 1780 | 3300048924 | Ga0496121_0237789 | Ga0496121_0237789_488_970 | 159 |
| 1781 | 3300048924 | Ga0496121_0263104 | Ga0496121_0263104_586_1068 | 159 |
| 1782 | 3300048927 | Ga0496124_0011581 | Ga0496124_0011581_4052_4531 | 159 |
| 1783 | 3300048927 | Ga0496124_0137659 | Ga0496124_0137659_1009_1488 | 159 |
| 1784 | 3300048928 | Ga0496125_0071057 | Ga0496125_0071057_1989_2477 | 159 |
| 1785 | 3300048928 | Ga0496125_0076359 | Ga0496125_0076359_1546_2034 | 159 |
| 1786 | 3300048928 | Ga0496125_0131030 | Ga0496125_0131030_886_1365 | 159 |
| 1787 | 3300048929 | Ga0496126_0002122 | Ga0496126_0002122_25709_26188 | 159 |
| 1788 | 3300048929 | Ga0496126_0008677 | Ga0496126_0008677_4224_4706 | 159 |
| 1789 | 3300048929 | Ga0496126_0038000 | Ga0496126_0038000_1608_2087 | 159 |
| 1790 | 3300048929 | Ga0496126_0066191 | Ga0496126_0066191_398_877 | 159 |
| 1791 | 3300048929 | Ga0496126_0073717 | Ga0496126_0073717_184_663 | 159 |
| 1792 | 3300048929 | Ga0496126_0117860 | Ga0496126_0117860_711_1193 | 159 |
| 1793 | 3300048929 | Ga0496126_0173025 | Ga0496126_0173025_1168_1647 | 159 |
| 1794 | 3300048929 | Ga0496126_0244448 | Ga0496126_0244448_151_633 | 159 |
| 1795 | 3300048929 | Ga0496126_0698614 | Ga0496126_0698614_138_620 | 159 |
| 1796 | 3300048929 | Ga0496126_1010822 | Ga0496126_1010822_38_520 | 159 |
| 1797 | 3300049572 | Ga0501036_0114702 | Ga0501036_0114702_918_1400 | 159 |
| 1798 | 3300049576 | Ga0501040_0089179 | Ga0501040_0089179_1460_1942 | 159 |
| 1799 | 3300049577 | Ga0501041_0432056 | Ga0501041_0432056_315_797 | 159 |
| 1800 | 3300049583 | Ga0501067_0099416 | Ga0501067_0099416_1022_1501 | 159 |
| 1801 | 3300049758 | Ga0501241_071706 | Ga0501241_071706_104_583 | 159 |
| 1802 | 3300050490 | nmdc:mga03n38_112793_c1 | nmdc:mga03n38_112793_c1_652_1131 | 159 |
| 1803 | 3300050490 | nmdc:mga03n38_1351_c1 | nmdc:mga03n38_1351_c1_5348_5827 | 159 |
| 1804 | 3300050490 | nmdc:mga03n38_178693_c1 | nmdc:mga03n38_178693_c1_23_502 | 159 |
| 1805 | 3300050491 | nmdc:mga00v17_4146_c1 | nmdc:mga00v17_4146_c1_3075_3554 | 159 |
| 1806 | 3300050491 | nmdc:mga00v17_648651_c1 | nmdc:mga00v17_648651_c1_12_491 | 159 |
| 1807 | 3300050492 | nmdc:mga0yw44_111096_c1 | nmdc:mga0yw44_111096_c1_969_1451 | 159 |
| 1808 | 3300050492 | nmdc:mga0yw44_5233_c1 | nmdc:mga0yw44_5233_c1_3176_3655 | 159 |
| 1809 | 3300050493 | nmdc:mga0k408_188649_c1 | nmdc:mga0k408_188649_c1_534_1013 | 159 |
| 1810 | 3300050493 | nmdc:mga0k408_200248_c1 | nmdc:mga0k408_200248_c1_696_1175 | 159 |
| 1811 | 3300050494 | nmdc:mga06z11_220266_c1 | nmdc:mga06z11_220266_c1_152_631 | 159 |
| 1812 | 3300050494 | nmdc:mga06z11_61386_c1 | nmdc:mga06z11_61386_c1_1441_1920 | 159 |
| 1813 | 3300050495 | nmdc:mga04h51_35189_c1 | nmdc:mga04h51_35189_c1_201_680 | 159 |
| 1814 | 3300050496 | nmdc:mga07m45_42075_c1 | nmdc:mga07m45_42075_c1_1646_2125 | 159 |
| 1815 | 3300050496 | nmdc:mga07m45_554131_c1 | nmdc:mga07m45_554131_c1_141_623 | 159 |
| 1816 | 3300050507 | nmdc:mga05p37_40049_c1 | nmdc:mga05p37_40049_c1_1737_2216 | 159 |
| 1817 | 3300050510 | nmdc:mga06r32_1126713_c1 | nmdc:mga06r32_1126713_c1_104_583 | 159 |
| 1818 | 3300050511 | nmdc:mga08y16_261869_c1 | nmdc:mga08y16_261869_c1_215_694 | 159 |
| 1819 | 3300050511 | nmdc:mga08y16_347781_c1 | nmdc:mga08y16_347781_c1_119_598 | 159 |
| 1820 | 3300050513 | nmdc:mga0rr50_102280_c1 | nmdc:mga0rr50_102280_c1_1295_1777 | 159 |
| 1821 | 3300050513 | nmdc:mga0rr50_472736_c1 | nmdc:mga0rr50_472736_c1_462_947 | 159 |
| 1822 | 3300050515 | nmdc:mga0a205_606513_c1 | nmdc:mga0a205_606513_c1_384_866 | 159 |
| 1823 | 3300050516 | nmdc:mga0sz30_110075_c1 | nmdc:mga0sz30_110075_c1_569_1051 | 159 |
| 1824 | 3300053077 | Ga0495601_0303104 | Ga0495601_0303104_153_638 | 159 |
| 1825 | 3300053078 | Ga0495612_0026650 | Ga0495612_0026650_1262_1750 | 159 |
| 1826 | 3300053079 | Ga0500610_0115212 | Ga0500610_0115212_367_849 | 159 |
| 1827 | 3300053083 | Ga0495655_0018190 | Ga0495655_0018190_1010_1489 | 159 |
| 1828 | 3300053083 | Ga0495655_0112480 | Ga0495655_0112480_164_643 | 159 |
| 1829 | 3300053084 | Ga0495595_0009899 | Ga0495595_0009899_1696_2187 | 159 |
| 1830 | 3300053084 | Ga0495595_0031623 | Ga0495595_0031623_1447_1926 | 159 |
| 1831 | 3300053085 | Ga0495619_0001789 | Ga0495619_0001789_2065_2556 | 159 |
| 1832 | 3300053085 | Ga0495619_0017972 | Ga0495619_0017972_879_1370 | 159 |
| 1833 | 3300053085 | Ga0495619_0046671 | Ga0495619_0046671_2250_2741 | 159 |
| 1834 | 3300053085 | Ga0495619_0424691 | Ga0495619_0424691_98_577 | 159 |
| 1835 | 3300053093 | Ga0500651_0035391 | Ga0500651_0035391_1249_1731 | 159 |
| 1836 | 3300053093 | Ga0500651_0378594 | Ga0500651_0378594_276_758 | 159 |
| 1837 | 3300053094 | Ga0500566_0000293 | Ga0500566_0000293_14297_14776 | 159 |
| 1838 | 3300053096 | Ga0500641_0007243 | Ga0500641_0007243_2569_3048 | 159 |
| 1839 | 3300053096 | Ga0500641_0034843 | Ga0500641_0034843_473_955 | 159 |
| 1840 | 3300053096 | Ga0500641_0207397 | Ga0500641_0207397_283_765 | 159 |
| 1841 | 3300053098 | Ga0500650_0064410 | Ga0500650_0064410_345_827 | 159 |
| 1842 | 3300053102 | Ga0500554_004219 | Ga0500554_004219_2125_2604 | 159 |
| 1843 | 3300053111 | Ga0500572_001006 | Ga0500572_001006_2149_2637 | 159 |
| 1844 | 3300053114 | Ga0500582_086196 | Ga0500582_086196_542_1024 | 159 |
| 1845 | 3300053119 | Ga0500595_000395 | Ga0500595_000395_25749_26228 | 159 |
| 1846 | 3300053119 | Ga0500595_016839 | Ga0500595_016839_1743_2225 | 159 |
| 1847 | 3300053126 | Ga0500621_155658 | Ga0500621_155658_342_824 | 159 |
| 1848 | 3300053130 | Ga0500642_0042964 | Ga0500642_0042964_1218_1700 | 159 |
| 1849 | 3300053130 | Ga0500642_0296984 | Ga0500642_0296984_180_662 | 159 |
| 1850 | 3300053133 | Ga0500655_011686 | Ga0500655_011686_674_1156 | 159 |
| 1851 | 3300053136 | Ga0500559_0094578 | Ga0500559_0094578_777_1256 | 159 |
| 1852 | 3300053136 | Ga0500559_0310354 | Ga0500559_0310354_176_655 | 159 |
| 1853 | 3300053142 | Ga0500577_0317177 | Ga0500577_0317177_150_632 | 159 |
| 1854 | 3300053148 | Ga0500590_108729 | Ga0500590_108729_50_529 | 159 |
| 1855 | 3300053150 | Ga0500603_006349 | Ga0500603_006349_1201_1680 | 159 |
| 1856 | 3300053150 | Ga0500603_223630 | Ga0500603_223630_45_524 | 159 |
| 1857 | 3300053156 | Ga0500622_0063763 | Ga0500622_0063763_279_761 | 159 |
| 1858 | 3300053156 | Ga0500622_0074084 | Ga0500622_0074084_1126_1608 | 159 |
| 1859 | 3300053158 | Ga0500627_0026749 | Ga0500627_0026749_975_1457 | 159 |
| 1860 | 3300053158 | Ga0500627_0039239 | Ga0500627_0039239_857_1339 | 159 |
| 1861 | 3300053162 | Ga0500638_000370 | Ga0500638_000370_7713_8192 | 159 |
| 1862 | 3300053163 | Ga0500639_004522 | Ga0500639_004522_4408_4896 | 159 |
| 1863 | 3300053163 | Ga0500639_028570 | Ga0500639_028570_592_1071 | 159 |
| 1864 | 3300053177 | Ga0500636_0053870 | Ga0500636_0053870_1768_2250 | 159 |
| 1865 | 3300053177 | Ga0500636_0171883 | Ga0500636_0171883_680_1159 | 159 |
| 1866 | 3300053177 | Ga0500636_0207473 | Ga0500636_0207473_509_988 | 159 |
| 1867 | 3300053178 | Ga0500637_0000026 | Ga0500637_0000026_36551_37030 | 159 |
| 1868 | 3300053178 | Ga0500637_0056548 | Ga0500637_0056548_97_576 | 159 |
| 1869 | 3300053178 | Ga0500637_0079586 | Ga0500637_0079586_198_680 | 159 |
| 1870 | 3300053178 | Ga0500637_0082391 | Ga0500637_0082391_1179_1658 | 159 |
| 1871 | 3300053178 | Ga0500637_0103093 | Ga0500637_0103093_101_580 | 159 |
| 1872 | 3300053725 | Ga0500576_001460 | Ga0500576_001460_5864_6352 | 159 |
| 1873 | 3300053727 | Ga0500611_050523 | Ga0500611_050523_239_721 | 159 |
| 1874 | 3300053730 | Ga0500645_035199 | Ga0500645_035199_18_500 | 159 |
| 1875 | 3300053731 | Ga0500609_024025 | Ga0500609_024025_282_764 | 159 |
| 1876 | 3300053735 | Ga0500596_005660 | Ga0500596_005660_1004_1483 | 159 |
| 1877 | 3300055283 | Ga0500661_001127 | Ga0500661_001127_517_996 | 159 |
| 1878 | 3300060353 | Ga0501082_1175165 | Ga0501082_1175165_89_568 | 159 |
| 1879 | 3300060353 | Ga0501082_1273804 | Ga0501082_1273804_41_523 | 159 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2oxh-assembly3.cif.gz_D | the soxyz complex of paracoccus pantotrophus | 0.8964 | 40 | 151 |
| 2nnc-assembly1.cif.gz_A | structure of the sulfur carrier protein soxy from chlorobium limicola f thiosulfatophilum | 0.8831 | 36 | 150 |
| 2nnc-assembly1.cif.gz_A | structure of the sulfur carrier protein soxy from chlorobium limicola f thiosulfatophilum | 0.8683 | 36 | 150 |
| 2oxg-assembly4.cif.gz_E | the soxyz complex of paracoccus pantotrophus | 0.8665 | 57 | 150 |
| 2ox5-assembly3.cif.gz_C | the soxyz complex of paracoccus pantotrophus | 0.8661 | 57 | 150 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ox5B00 | Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain | 0.9056 | 40 | 151 | 2.60.40.2470 |
| 2nncA00 | Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain | 0.8831 | 36 | 150 | 2.60.40.2470 |
| 2nncA00 | Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain | 0.8683 | 36 | 150 | 2.60.40.2470 |
| 2oxgE00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.8665 | 57 | 150 | 2.60.40.10 |
| 2ox5B00 | Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain | 0.8588 | 40 | 151 | 2.60.40.2470 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A526YJA9-F1-model_v4 | Sulfur oxidation protein SoxY | 0.9134 | 45 | 134 |
|
| AF-A0A6N8XHY5-F1-model_v4 | Thiosulfate oxidation carrier protein SoxY | 0.9038 | 38 | 154 |
|
| AF-A0A364NYZ9-F1-model_v4 | Thiosulfate oxidation carrier protein SoxY | 0.9002 | 41 | 154 |
|
| AF-A0A258JGA4-F1-model_v4 | Thiosulfate oxidation carrier protein SoxY | 0.8979 | 33 | 155 |
|
| AF-A0A4V1P8P7-F1-model_v4 | Thiosulfate oxidation carrier protein SoxY | 0.8976 | 33 | 154 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar