F495952

General Info

Members Datasets Scaffolds Average Seq Length
1879 743 1672 157

Family's Representative Sequence

Representative Sequence 3300015262|Ga0182007_10120303|Ga0182007_101203032
Length 183
Sequence MPTTRRQFLSLAGSITAAGTLPIVTLRPLQATPAMLNGAIRNIVGEASVRTGRVKLDIPPLVENGNTVPMTVSVASPMAPEDHVLSIHVFNEKNPQPNIGNFYLGPLAGRAQVSTRIRLADSQKIIAIAKLSDGTFWSASVTTTSATTCQNVSSDIRAIATTFWVSARRMRVETWARPEAGLR

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
10 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
11 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
12 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
13 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
14 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
15 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
16 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
17 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
18 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
19 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
20 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
21 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
22 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
23 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
24 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
25 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
26 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
27 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
28 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
29 2791355199
30 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
31 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
32 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
33 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
34 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
35 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
36 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
37 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
38 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
39 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
40 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
41 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
42 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
43 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
44 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
45 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
46 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
47 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
48 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
49 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
50 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
51 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
52 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
53 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
54 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
55 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
56 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
57 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
58 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
59 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
60 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
61 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
62 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
63 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
64 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
65 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
66 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
67 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
68 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
69 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
70 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
71 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
72 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
73 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
74 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
75 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
76 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
77 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
78 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
79 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
80 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
81 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
82 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
83 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
84 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
85 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
86 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
87 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
88 2904699407
89 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
90 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
91 2906610324
92 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
93 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
94 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
95 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
96 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
97 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
98 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
99 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
100 2922368715
101 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
102 2922425934
103 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
104 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
105 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
106 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
107 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
108 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
109 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
110 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
111 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
112 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
113 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
114 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
115 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
116 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
117 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
118 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
119 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
120 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
121 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
122 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
123 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
124 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
125 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
126 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
127 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
128 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
129 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
130 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
131 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
132 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
133 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
134 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
135 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
136 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
137 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
138 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
139 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
140 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
141 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
142 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
143 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
144 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
145 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
146 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
147 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
148 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
149 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
150 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
151 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
152 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
153 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
154 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
155 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
156 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
157 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
158 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
159 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
160 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
161 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
162 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
163 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
164 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
165 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
166 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
167 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
168 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
169 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
170 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
171 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
172 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
173 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
174 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
175 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
176 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
177 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
178 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
179 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
180 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
181 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
182 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
183 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
184 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
185 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
186 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
187 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
188 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
189 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
190 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
191 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
192 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
193 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
194 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
195 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
196 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
197 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
198 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
199 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
200 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
201 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
202 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
203 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
204 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
205 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
206 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
207 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
208 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
209 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
210 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
211 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
212 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
213 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
214 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
215 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
216 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
217 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
218 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
219 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
220 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
221 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
222 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
223 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
224 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
225 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
226 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
227 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
228 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
229 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
230 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
231 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
232 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
233 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
234 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
235 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
236 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
237 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
238 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
239 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
240 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
241 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
242 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
243 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
244 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
245 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
246 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
247 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
248 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
249 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
250 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
251 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
252 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
253 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
254 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
255 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
256 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
257 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
258 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
259 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
260 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
261 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
262 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
263 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
264 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
265 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
266 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
267 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
268 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
269 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
270 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
271 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
272 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
273 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
274 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
275 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
276 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
277 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
278 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
279 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
280 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
281 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
282 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
283 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
284 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
285 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
286 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
287 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
288 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
289 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
290 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
291 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
292 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
293 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
294 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
295 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
296 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
297 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
298 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
299 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
300 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
301 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
302 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
303 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
304 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
305 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
306 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
307 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
308 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
309 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
310 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
311 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
312 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
313 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
314 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
315 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
316 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
317 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
318 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
319 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
320 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
321 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
322 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
323 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
324 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
325 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
326 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
327 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
328 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
329 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
330 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
331 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
388 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
389 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
390 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
391 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
392 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
393 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
395 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
396 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
397 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
398 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
399 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
400 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
401 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
402 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
403 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
407 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
408 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
409 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
410 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
411 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
412 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
413 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
414 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
415 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
416 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
418 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
419 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
420 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
421 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
422 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
423 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
424 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
425 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
426 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
427 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
428 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
429 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
430 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
431 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
432 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
433 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
434 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
435 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
436 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
437 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
438 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
439 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
440 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
441 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
442 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
443 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
444 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
445 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
446 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
447 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
448 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
449 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
450 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
451 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
452 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
453 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
454 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
455 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
456 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
457 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
458 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
459 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
460 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
461 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
462 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
463 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
464 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
465 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
466 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
467 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
468 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
469 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
470 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
471 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
472 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
473 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
474 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
475 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
476 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
477 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
478 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
479 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
480 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
481 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
482 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
483 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
484 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
485 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
486 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
487 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
488 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
489 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
490 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
491 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
492 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
493 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
494 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
495 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
496 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
497 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
498 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
499 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
500 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
501 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
502 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
503 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
504 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
505 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
506 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
507 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
508 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
509 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
510 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
511 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
512 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
513 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
514 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
515 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
516 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
517 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
518 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
519 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
520 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
521 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
522 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
523 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
524 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
525 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
526 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
527 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
528 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
529 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
530 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
531 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
532 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
533 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
534 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
535 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
536 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
537 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
538 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
539 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
540 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
541 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
542 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
543 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
544 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
545 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
546 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
547 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
548 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
549 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
550 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
551 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
552 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
553 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
554 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
555 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
556 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
557 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
558 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
559 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
560 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
561 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
562 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
563 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
564 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
565 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
566 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
567 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
568 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
569 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
570 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
571 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
572 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
573 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
574 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
575 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
576 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
577 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
578 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
579 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
580 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
581 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
582 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
583 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
584 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
585 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
586 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
587 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
588 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
589 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
590 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
591 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
592 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
593 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
594 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
595 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
596 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
597 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
598 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
599 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
600 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
601 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
602 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
603 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
604 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
605 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
606 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
607 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
608 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
609 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
610 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
611 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
612 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
613 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
614 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
615 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
616 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
617 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
618 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
619 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
620 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
621 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
622 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
623 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
624 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
625 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
626 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
627 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
628 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
629 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
630 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
631 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
632 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
633 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
634 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
635 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
636 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
637 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
638 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
639 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
640 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
641 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
642 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
643 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
644 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
645 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
646 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
647 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
648 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
649 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
650 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
651 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
652 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
653 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
654 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
655 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
656 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
657 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
658 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
659 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
660 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
661 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
662 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
663 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
664 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
665 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
666 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
667 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
668 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
669 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
670 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
671 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
672 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
673 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
674 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
675 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
676 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
677 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
678 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
679 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
680 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
681 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
682 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
683 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
684 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
685 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
686 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
687 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
688 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
689 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
690 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
691 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
692 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
693 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
694 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
695 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
696 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
697 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
698 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
699 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
700 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
701 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
702 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
703 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
704 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
705 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
706 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
707 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
708 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
709 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
710 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
711 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
712 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
713 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
714 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
715 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
716 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
717 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
718 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
719 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
720 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
721 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
722 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
723 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
724 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
725 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
726 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
727 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
728 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
729 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
730 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
731 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
732 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
733 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
734 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
735 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
736 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
737 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
738 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
739 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
740 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
741 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
742 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
743 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.06
Metatranscriptomes 0.16
Isolates 10.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.1
Nodule 8.94
Rhizoplane 6.17
Rhizosphere 61.73
Stem 0
Stem Tuber 0
Unclassified 9.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10200120 3300001990 Bacteria 590
2 JGI24750J21931_1020184 3300002070 Bacteria 928
3 JGI24744J21845_10058110 3300002077 Bacteria 709
4 JGI24742J22300_10020639 3300002244 Bacteria 1123
5 JGI25406J46586_10000138 3300003203 Bacteria 31765
6 JGI25406J46586_10014944 3300003203 Bacteria 3287
7 JGI25165J46597_1012236 3300003214 Bacteria 1204
8 JGI25153J46596_10000317 3300003215 Bacteria 35509
9 JGI25153J46596_10005866 3300003215 Bacteria 6357
10 JGI25153J46596_10007843 3300003215 Bacteria 5184
11 rootH2_10065934 3300003320 Bacteria 2392
12 rootL2_10146216 3300003322 Bacteria 1613
13 rootL2_10158942 3300003322 Bacteria 2631
14 JGI25160J50197_1002533 3300003354 Bacteria 8470
15 JGI25160J50197_1007102 3300003354 Bacteria 4422
16 JGI25160J50197_1024527 3300003354 Bacteria 1709
17 JGI25160J50197_1074341 3300003354 Bacteria 642
18 JGI25404J52841_10000288 3300003659 Bacteria 6507
19 JGI25404J52841_10000871 3300003659 Bacteria 4882
20 JGI25404J52841_10007910 3300003659 Bacteria 2256
21 JGI25404J52841_10008582 3300003659 Bacteria 2178
22 JGI25404J52841_10016633 3300003659 Bacteria 1595
23 JGI25404J52841_10052353 3300003659 Bacteria 857
24 Ga0055526_1046678 3300003771 Bacteria 1024
25 Ga0055531_10008821 3300003794 Bacteria 5250
26 Ga0055543_1014610 3300004625 Bacteria 1528
27 Ga0065165_1000747 3300005262 Bacteria 44635
28 Ga0065165_1004585 3300005262 Bacteria 8426
29 Ga0065165_1010604 3300005262 Bacteria 3956
30 Ga0065165_1028625 3300005262 Bacteria 1796
31 Ga0065165_1077487 3300005262 Bacteria 870
32 Ga0070658_10136673 3300005327 Bacteria 2045
33 Ga0070658_10647016 3300005327 Bacteria 917
34 Ga0070658_10695316 3300005327 Bacteria 882
35 Ga0070658_10914606 3300005327 Bacteria 763
36 Ga0070676_10133797 3300005328 Bacteria 1571
37 Ga0070676_10281597 3300005328 Bacteria 1121
38 Ga0070676_10910005 3300005328 Bacteria 656
39 Ga0070683_100076181 3300005329 Bacteria 3135
40 Ga0070683_100315205 3300005329 Bacteria 1488
41 Ga0070683_100948112 3300005329 Bacteria 826
42 Ga0070690_101119286 3300005330 Bacteria 625
43 Ga0070670_100851133 3300005331 Bacteria 825
44 Ga0068869_100029055 3300005334 Bacteria 3869
45 Ga0068869_100074710 3300005334 Bacteria 2516
46 Ga0068869_100216730 3300005334 Bacteria 1515
47 Ga0068869_100217523 3300005334 Bacteria 1513
48 Ga0068869_101987340 3300005334 Bacteria 522
49 Ga0070666_10561502 3300005335 Bacteria 831
50 Ga0070666_10642834 3300005335 Bacteria 776
51 Ga0070680_100023775 3300005336 Bacteria 4891
52 Ga0070680_100064981 3300005336 Bacteria 2990
53 Ga0070680_100142232 3300005336 Bacteria 2012
54 Ga0070682_100441849 3300005337 Bacteria 994
55 Ga0070682_100522236 3300005337 Bacteria 924
56 Ga0070682_100944304 3300005337 Bacteria 712
57 Ga0068868_100048941 3300005338 Bacteria 3317
58 Ga0068868_100605095 3300005338 Bacteria 971
59 Ga0068868_100986094 3300005338 Bacteria 770
60 Ga0070660_100037797 3300005339 Bacteria 3660
61 Ga0070660_100250674 3300005339 Bacteria 1444
62 Ga0070687_100176927 3300005343 Bacteria 1275
63 Ga0070661_100104163 3300005344 Bacteria 2113
64 Ga0070661_100844170 3300005344 Bacteria 753
65 Ga0070692_10589853 3300005345 Bacteria 734
66 Ga0070668_100027260 3300005347 Bacteria 4337
67 Ga0070668_100113621 3300005347 Bacteria 2157
68 Ga0070668_100205128 3300005347 Bacteria 1620
69 Ga0070668_100218027 3300005347 Bacteria 1572
70 Ga0070668_100273965 3300005347 Bacteria 1407
71 Ga0070668_100397705 3300005347 Bacteria 1176
72 Ga0070668_100645654 3300005347 Bacteria 929
73 Ga0070668_100763064 3300005347 Bacteria 857
74 Ga0070669_100164810 3300005353 Bacteria 1724
75 Ga0070669_100856682 3300005353 Bacteria 774
76 Ga0070675_100392412 3300005354 Bacteria 1237
77 Ga0070671_100044655 3300005355 Bacteria 3682
78 Ga0070671_100104083 3300005355 Bacteria 2382
79 Ga0070671_100244786 3300005355 Bacteria 1522
80 Ga0070671_100250472 3300005355 Bacteria 1505
81 Ga0070674_100046227 3300005356 Bacteria 2977
82 Ga0070674_100297571 3300005356 Bacteria 1285
83 Ga0070674_101057853 3300005356 Bacteria 715
84 Ga0070688_100344133 3300005365 Bacteria 1090
85 Ga0070659_100198649 3300005366 Bacteria 1650
86 Ga0070659_100263299 3300005366 Bacteria 1431
87 Ga0070667_100146893 3300005367 Bacteria 2069
88 Ga0070709_10022160 3300005434 Bacteria 3711
89 Ga0070709_10023003 3300005434 Bacteria 3653
90 Ga0070709_10036355 3300005434 Bacteria 2999
91 Ga0070709_10250031 3300005434 Bacteria 1277
92 Ga0070709_10300833 3300005434 Bacteria 1172
93 Ga0070709_10756016 3300005434 Bacteria 760
94 Ga0070709_10802566 3300005434 Bacteria 739
95 Ga0070714_100002801 3300005435 Bacteria 12865
96 Ga0070714_100017333 3300005435 Bacteria 5833
97 Ga0070714_100107849 3300005435 Bacteria 2462
98 Ga0070714_100995056 3300005435 Bacteria 816
99 Ga0070713_100014026 3300005436 Bacteria 5934
100 Ga0070713_100026138 3300005436 Bacteria 4578
101 Ga0070713_100074105 3300005436 Bacteria 2883
102 Ga0070713_100101308 3300005436 Bacteria 2495
103 Ga0070713_100103599 3300005436 Bacteria 2469
104 Ga0070713_100150597 3300005436 Bacteria 2069
105 Ga0070710_10000678 3300005437 Bacteria 16149
106 Ga0070710_10019013 3300005437 Bacteria 3545
107 Ga0070710_10040951 3300005437 Bacteria 2555
108 Ga0070710_10096625 3300005437 Bacteria 1751
109 Ga0070710_10102231 3300005437 Bacteria 1709
110 Ga0070701_10263977 3300005438 Bacteria 1045
111 Ga0070711_100003772 3300005439 Bacteria 8886
112 Ga0070711_100019549 3300005439 Bacteria 4346
113 Ga0070711_100030578 3300005439 Bacteria 3566
114 Ga0070711_100125685 3300005439 Bacteria 1903
115 Ga0070711_100153631 3300005439 Bacteria 1738
116 Ga0070711_100614519 3300005439 Bacteria 908
117 Ga0070711_100658017 3300005439 Bacteria 879
118 Ga0070711_101126496 3300005439 Bacteria 677
119 Ga0070700_100107452 3300005441 Bacteria 1849
120 Ga0070700_100141268 3300005441 Bacteria 1637
121 Ga0070694_100144776 3300005444 Bacteria 1730
122 Ga0070694_101316300 3300005444 Bacteria 608
123 Ga0070663_100034033 3300005455 Bacteria 3525
124 Ga0070663_100047641 3300005455 Bacteria 3036
125 Ga0070663_100093621 3300005455 Bacteria 2230
126 Ga0070663_100186548 3300005455 Bacteria 1612
127 Ga0070663_100451553 3300005455 Bacteria 1059
128 Ga0070663_101115033 3300005455 Bacteria 690
129 Ga0070678_100060204 3300005456 Bacteria 2794
130 Ga0070678_100235114 3300005456 Bacteria 1529
131 Ga0070678_100313547 3300005456 Bacteria 1337
132 Ga0070678_100680506 3300005456 Bacteria 925
133 Ga0070662_100044307 3300005457 Bacteria 3186
134 Ga0070662_100056074 3300005457 Bacteria 2860
135 Ga0070662_100237999 3300005457 Bacteria 1459
136 Ga0070662_101568324 3300005457 Bacteria 568
137 Ga0070681_10022753 3300005458 Bacteria 6298
138 Ga0070681_10090364 3300005458 Bacteria 3013
139 Ga0070681_10142977 3300005458 Bacteria 2322
140 Ga0070681_10835838 3300005458 Bacteria 838
141 Ga0068867_100009231 3300005459 Bacteria 6961
142 Ga0068867_101336764 3300005459 Bacteria 663
143 Ga0070706_100141178 3300005467 Bacteria 2249
144 Ga0070698_100291619 3300005471 Bacteria 1562
145 Ga0070698_100731917 3300005471 Bacteria 932
146 Ga0070699_100389557 3300005518 Bacteria 1259
147 Ga0070679_100215130 3300005530 Bacteria 1884
148 Ga0070679_100291049 3300005530 Bacteria 1585
149 Ga0070684_100009391 3300005535 Bacteria 7700
150 Ga0070684_100065826 3300005535 Bacteria 3181
151 Ga0070684_100156524 3300005535 Bacteria 2066
152 Ga0070684_100396193 3300005535 Bacteria 1273
153 Ga0070684_100930511 3300005535 Bacteria 815
154 Ga0070697_100355077 3300005536 Bacteria 1266
155 Ga0068853_100068998 3300005539 Bacteria 3074
156 Ga0068853_100211567 3300005539 Bacteria 1768
157 Ga0068853_100244915 3300005539 Bacteria 1644
158 Ga0068853_100262403 3300005539 Bacteria 1588
159 Ga0068853_100483256 3300005539 Bacteria 1168
160 Ga0068853_100919650 3300005539 Bacteria 840
161 Ga0068853_101474006 3300005539 Bacteria 659
162 Ga0070672_100065744 3300005543 Bacteria 2869
163 Ga0070672_100119392 3300005543 Bacteria 2157
164 Ga0070672_100171427 3300005543 Bacteria 1805
165 Ga0070672_100766193 3300005543 Bacteria 848
166 Ga0070695_100189432 3300005545 Bacteria 1463
167 Ga0070693_100264489 3300005547 Bacteria 1145
168 Ga0070693_100448625 3300005547 Bacteria 905
169 Ga0070693_101276071 3300005547 Bacteria 567
170 Ga0070665_100023384 3300005548 Bacteria 6222
171 Ga0070665_100051490 3300005548 Bacteria 4129
172 Ga0070665_100053413 3300005548 Bacteria 4052
173 Ga0070665_100078654 3300005548 Bacteria 3304
174 Ga0070665_100123917 3300005548 Bacteria 2586
175 Ga0070665_100134445 3300005548 Bacteria 2475
176 Ga0070665_100271612 3300005548 Bacteria 1697
177 Ga0070665_100338751 3300005548 Bacteria 1508
178 Ga0070665_100572960 3300005548 Bacteria 1142
179 Ga0070665_100668662 3300005548 Bacteria 1052
180 Ga0070704_100319412 3300005549 Bacteria 1300
181 Ga0068855_100181159 3300005563 Bacteria 2382
182 Ga0068855_100392661 3300005563 Bacteria 1522
183 Ga0068855_101957415 3300005563 Bacteria 593
184 Ga0070664_100107954 3300005564 Bacteria 2427
185 Ga0070664_100177164 3300005564 Bacteria 1893
186 Ga0068857_100037748 3300005577 Bacteria 4280
187 Ga0068857_100059974 3300005577 Bacteria 3380
188 Ga0068857_100291795 3300005577 Bacteria 1502
189 Ga0068857_100384076 3300005577 Bacteria 1304
190 Ga0068854_100097953 3300005578 Bacteria 2193
191 Ga0068854_100475090 3300005578 Bacteria 1049
192 Ga0068854_100649236 3300005578 Bacteria 906
193 Ga0068856_100079699 3300005614 Bacteria 3247
194 Ga0068856_100236559 3300005614 Bacteria 1842
195 Ga0068856_100754975 3300005614 Bacteria 993
196 Ga0068856_101744456 3300005614 Bacteria 635
197 Ga0070702_100239985 3300005615 Bacteria 1223
198 Ga0070702_100672057 3300005615 Bacteria 786
199 Ga0070702_101798201 3300005615 Bacteria 512
200 Ga0068852_100038198 3300005616 Bacteria 4033
201 Ga0068852_100133040 3300005616 Bacteria 2292
202 Ga0068852_100348236 3300005616 Bacteria 1446
203 Ga0068852_100455793 3300005616 Bacteria 1267
204 Ga0068852_101783980 3300005616 Bacteria 638
205 Ga0068859_100103545 3300005617 Bacteria 2904
206 Ga0068859_100181183 3300005617 Bacteria 2189
207 Ga0068859_101012313 3300005617 Bacteria 913
208 Ga0068864_100058929 3300005618 Bacteria 3320
209 Ga0068864_100278065 3300005618 Bacteria 1562
210 Ga0068864_100300154 3300005618 Bacteria 1503
211 Ga0068864_100772554 3300005618 Bacteria 943
212 Ga0068864_101589310 3300005618 Bacteria 658
213 Ga0068866_10121670 3300005718 Bacteria 1471
214 Ga0068866_10544429 3300005718 Bacteria 775
215 Ga0068861_100045277 3300005719 Bacteria 3312
216 Ga0068861_100130900 3300005719 Bacteria 2036
217 Ga0068861_100426495 3300005719 Bacteria 1183
218 Ga0068861_101137133 3300005719 Bacteria 752
219 Ga0068861_101393323 3300005719 Bacteria 685
220 Ga0068861_101554281 3300005719 Bacteria 651
221 Ga0068861_101573860 3300005719 Bacteria 647
222 Ga0068851_10118916 3300005834 Bacteria 1418
223 Ga0068851_10320069 3300005834 Bacteria 896
224 Ga0068870_10075455 3300005840 Bacteria 1849
225 Ga0068863_100234737 3300005841 Bacteria 1770
226 Ga0068863_100290578 3300005841 Bacteria 1584
227 Ga0068863_101985131 3300005841 Bacteria 592
228 Ga0068863_102170036 3300005841 Bacteria 565
229 Ga0068858_100119984 3300005842 Bacteria 2458
230 Ga0068858_100195894 3300005842 Bacteria 1909
231 Ga0068858_100627464 3300005842 Bacteria 1044
232 Ga0068860_100000360 3300005843 Bacteria 60297
233 Ga0068860_100153207 3300005843 Bacteria 2220
234 Ga0068860_100190322 3300005843 Bacteria 1986
235 Ga0068860_101266327 3300005843 Bacteria 758
236 Ga0068862_100034594 3300005844 Bacteria 4276
237 Ga0068862_100207210 3300005844 Bacteria 1770
238 Ga0081455_10005955 3300005937 Bacteria 13226
239 Ga0081455_10030485 3300005937 Bacteria 4897
240 Ga0081455_10045444 3300005937 Bacteria 3821
241 Ga0081455_10080661 3300005937 Bacteria 2667
242 Ga0081455_10456688 3300005937 Bacteria 871
243 Ga0081538_10198308 3300005981 Bacteria 829
244 Ga0081540_1003418 3300005983 Bacteria 12554
245 Ga0081540_1003851 3300005983 Bacteria 11718
246 Ga0081540_1008125 3300005983 Bacteria 7364
247 Ga0081540_1008941 3300005983 Bacteria 6939
248 Ga0081540_1012000 3300005983 Bacteria 5740
249 Ga0081540_1014330 3300005983 Bacteria 5086
250 Ga0081540_1021006 3300005983 Bacteria 3906
251 Ga0081540_1021049 3300005983 Bacteria 3901
252 Ga0081540_1027303 3300005983 Bacteria 3238
253 Ga0081540_1035588 3300005983 Bacteria 2668
254 Ga0081540_1043950 3300005983 Bacteria 2286
255 Ga0081540_1064372 3300005983 Bacteria 1730
256 Ga0081540_1076996 3300005983 Bacteria 1518
257 Ga0081540_1088582 3300005983 Bacteria 1368
258 Ga0081540_1088921 3300005983 Bacteria 1364
259 Ga0081540_1184764 3300005983 Bacteria 775
260 Ga0081540_1230772 3300005983 Bacteria 654
261 Ga0081540_1231189 3300005983 Bacteria 653
262 Ga0081540_1328556 3300005983 Bacteria 524
263 Ga0081539_10000008 3300005985 Bacteria 525071
264 Ga0081539_10000220 3300005985 Bacteria 133834
265 Ga0070717_10001656 3300006028 Bacteria 15473
266 Ga0070717_10007544 3300006028 Bacteria 8083
267 Ga0070717_10128172 3300006028 Bacteria 2180
268 Ga0070717_10382104 3300006028 Bacteria 1263
269 Ga0070717_10619385 3300006028 Bacteria 982
270 Ga0070717_10708124 3300006028 Bacteria 915
271 Ga0070717_10876778 3300006028 Bacteria 817
272 Ga0070717_11096399 3300006028 Bacteria 725
273 Ga0075365_10018590 3300006038 Bacteria 4275
274 Ga0075365_10024652 3300006038 Bacteria 3798
275 Ga0075365_10033778 3300006038 Bacteria 3299
276 Ga0075365_10055451 3300006038 Bacteria 2631
277 Ga0075365_10093391 3300006038 Bacteria 2052
278 Ga0075365_10131425 3300006038 Bacteria 1732
279 Ga0075365_10137263 3300006038 Bacteria 1696
280 Ga0075365_10243968 3300006038 Bacteria 1262
281 Ga0075365_10461200 3300006038 Bacteria 897
282 Ga0075365_10957249 3300006038 Bacteria 603
283 Ga0075365_11039466 3300006038 Bacteria 577
284 Ga0075368_10011424 3300006042 Bacteria 3231
285 Ga0075363_100002488 3300006048 Bacteria 7545
286 Ga0075363_100024676 3300006048 Bacteria 3059
287 Ga0075363_100026304 3300006048 Bacteria 2976
288 Ga0075363_100111587 3300006048 Bacteria 1520
289 Ga0075363_100181370 3300006048 Bacteria 1198
290 Ga0075363_100193705 3300006048 Bacteria 1160
291 Ga0075363_100496097 3300006048 Bacteria 725
292 Ga0075363_100684428 3300006048 Bacteria 619
293 Ga0075364_10024940 3300006051 Bacteria 3802
294 Ga0075364_10215443 3300006051 Bacteria 1302
295 Ga0075364_10869894 3300006051 Bacteria 614
296 Ga0070715_10001127 3300006163 Bacteria 7613
297 Ga0070715_10024843 3300006163 Bacteria 2366
298 Ga0070715_10116926 3300006163 Bacteria 1266
299 Ga0070715_10118381 3300006163 Unclassified 1259
300 Ga0070716_100041694 3300006173 Bacteria 2559
301 Ga0070716_100047412 3300006173 Bacteria 2424
302 Ga0070716_100106258 3300006173 Bacteria 1731
303 Ga0070716_100153302 3300006173 Bacteria 1485
304 Ga0070712_100013240 3300006175 Bacteria 5266
305 Ga0070712_100022680 3300006175 Bacteria 4138
306 Ga0070712_100038780 3300006175 Bacteria 3257
307 Ga0070712_100156096 3300006175 Bacteria 1757
308 Ga0070712_100581041 3300006175 Bacteria 947
309 Ga0070712_100630173 3300006175 Bacteria 910
310 Ga0070712_100660216 3300006175 Bacteria 889
311 Ga0075362_10090506 3300006177 Bacteria 1420
312 Ga0075367_10121791 3300006178 Bacteria 1608
313 Ga0075367_10492498 3300006178 Bacteria 777
314 Ga0075367_10720220 3300006178 Bacteria 635
315 Ga0075367_10789854 3300006178 Bacteria 605
316 Ga0075369_10005844 3300006186 Bacteria 4625
317 Ga0075369_10011717 3300006186 Bacteria 3453
318 Ga0075369_10012874 3300006186 Bacteria 3309
319 Ga0075369_10060284 3300006186 Bacteria 1655
320 Ga0075369_10220726 3300006186 Bacteria 877
321 Ga0075366_10033470 3300006195 Bacteria 3027
322 Ga0075366_10157481 3300006195 Bacteria 1376
323 Ga0075366_10332512 3300006195 Bacteria 931
324 Ga0097621_100359483 3300006237 Bacteria 1297
325 Ga0097621_100860082 3300006237 Bacteria 843
326 Ga0097621_101500008 3300006237 Bacteria 640
327 Ga0097621_101662222 3300006237 Bacteria 608
328 Ga0075370_10038846 3300006353 Bacteria 2679
329 Ga0075370_10082329 3300006353 Bacteria 1851
330 Ga0075370_10238198 3300006353 Bacteria 1077
331 Ga0075370_10251729 3300006353 Bacteria 1047
332 Ga0075370_10309220 3300006353 Bacteria 941
333 Ga0075370_10329161 3300006353 Bacteria 911
334 Ga0068871_100069423 3300006358 Bacteria 2894
335 Ga0068871_100072638 3300006358 Bacteria 2834
336 Ga0068871_100525777 3300006358 Bacteria 1069
337 Ga0068871_100585244 3300006358 Bacteria 1014
338 Ga0068871_101652352 3300006358 Bacteria 607
339 Ga0075428_100208936 3300006844 Bacteria 2110
340 Ga0075428_100341471 3300006844 Bacteria 1608
341 Ga0075431_100682133 3300006847 Bacteria 1006
342 Ga0075434_100642083 3300006871 Bacteria 1080
343 Ga0075434_100737073 3300006871 Bacteria 1003
344 Ga0068865_100190154 3300006881 Bacteria 1587
345 Ga0068865_100541348 3300006881 Bacteria 976
346 Ga0068865_101133321 3300006881 Bacteria 690
347 Ga0097620_100103547 3300006931 Bacteria 2904
348 Ga0097620_100181187 3300006931 Bacteria 2189
349 Ga0097620_101012304 3300006931 Bacteria 913
350 Ga0099825_1047657 3300006941 Bacteria 1006
351 Ga0099824_1018474 3300006942 Bacteria 5716
352 Ga0099822_1021826 3300006943 Bacteria 6137
353 Ga0099822_1065794 3300006943 Bacteria 1098
354 Ga0075435_100129312 3300007076 Bacteria 2113
355 Ga0099794_10106117 3300007265 Bacteria 1405
356 Ga0099794_10228064 3300007265 Bacteria 958
357 Ga0099794_10228415 3300007265 Bacteria 957
358 Ga0099795_10009487 3300007788 Bacteria 2827
359 Ga0099795_10021525 3300007788 Bacteria 2116
360 Ga0099795_10211652 3300007788 Bacteria 822
361 Ga0105250_10073796 3300009092 Bacteria 1380
362 Ga0105250_10179380 3300009092 Bacteria 888
363 Ga0105240_10021941 3300009093 Bacteria 8480
364 Ga0105240_10084695 3300009093 Bacteria 3887
365 Ga0105240_10379621 3300009093 Bacteria 1596
366 Ga0105240_10657936 3300009093 Bacteria 1147
367 Ga0111539_10010769 3300009094 Bacteria 11512
368 Ga0105245_10137591 3300009098 Bacteria 2297
369 Ga0105245_10264619 3300009098 Bacteria 1675
370 Ga0105245_10461621 3300009098 Bacteria 1280
371 Ga0105245_10669447 3300009098 Bacteria 1069
372 Ga0105247_10034754 3300009101 Bacteria 3070
373 Ga0105247_10100789 3300009101 Bacteria 1846
374 Ga0105247_10121990 3300009101 Bacteria 1690
375 Ga0105247_10225649 3300009101 Bacteria 1270
376 Ga0105247_10254543 3300009101 Bacteria 1202
377 Ga0105247_10356318 3300009101 Bacteria 1030
378 Ga0105247_10677871 3300009101 Bacteria 773
379 Ga0105247_11160894 3300009101 Bacteria 613
380 Ga0114129_10368158 3300009147 Bacteria 1900
381 Ga0114129_10640263 3300009147 Bacteria 1373
382 Ga0105243_10373444 3300009148 Bacteria 1316
383 Ga0105243_10387430 3300009148 Bacteria 1295
384 Ga0105243_10518846 3300009148 Bacteria 1133
385 Ga0105241_10029756 3300009174 Bacteria 4077
386 Ga0105241_10050318 3300009174 Bacteria 3175
387 Ga0105241_10082425 3300009174 Bacteria 2521
388 Ga0105241_10232984 3300009174 Bacteria 1553
389 Ga0105241_10435013 3300009174 Bacteria 1157
390 Ga0105241_10684529 3300009174 Bacteria 935
391 Ga0105242_10072771 3300009176 Bacteria 2856
392 Ga0105242_10165539 3300009176 Bacteria 1939
393 Ga0105242_10467047 3300009176 Bacteria 1193
394 Ga0105242_10687051 3300009176 Bacteria 1000
395 Ga0105248_10104172 3300009177 Bacteria 3198
396 Ga0105248_10167112 3300009177 Bacteria 2479
397 Ga0105248_10260394 3300009177 Bacteria 1953
398 Ga0105248_10265805 3300009177 Bacteria 1931
399 Ga0105248_10945710 3300009177 Bacteria 973
400 Ga0105248_11042714 3300009177 Bacteria 924
401 Ga0105237_10009950 3300009545 Bacteria 10145
402 Ga0105237_10021234 3300009545 Bacteria 6678
403 Ga0105237_10047158 3300009545 Bacteria 4332
404 Ga0105237_10110574 3300009545 Bacteria 2740
405 Ga0105237_10558820 3300009545 Bacteria 1151
406 Ga0105237_10683805 3300009545 Bacteria 1033
407 Ga0105237_10750872 3300009545 Bacteria 982
408 Ga0105237_10822256 3300009545 Bacteria 936
409 Ga0105237_10824915 3300009545 Bacteria 934
410 Ga0105238_10027647 3300009551 Bacteria 5781
411 Ga0105238_10135316 3300009551 Bacteria 2442
412 Ga0105238_10151847 3300009551 Bacteria 2291
413 Ga0105238_10331334 3300009551 Bacteria 1509
414 Ga0105238_10377366 3300009551 Bacteria 1409
415 Ga0105238_10686681 3300009551 Bacteria 1035
416 Ga0105238_10754634 3300009551 Bacteria 987
417 Ga0105238_11508599 3300009551 Bacteria 701
418 Ga0105238_11568038 3300009551 Bacteria 688
419 Ga0105249_10074396 3300009553 Bacteria 3144
420 Ga0105249_10177078 3300009553 Bacteria 2072
421 Ga0105249_12073413 3300009553 Bacteria 641
422 Ga0099796_10071633 3300010159 Bacteria 1253
423 Ga0099796_10100427 3300010159 Bacteria 1088
424 Ga0099796_10127917 3300010159 Bacteria 982
425 Ga0105239_10066752 3300010375 Bacteria 3951
426 Ga0105239_10084742 3300010375 Bacteria 3492
427 Ga0105239_10139452 3300010375 Bacteria 2701
428 Ga0105239_10159171 3300010375 Bacteria 2522
429 Ga0105239_10218055 3300010375 Bacteria 2139
430 Ga0105239_10292556 3300010375 Bacteria 1834
431 Ga0105239_10387551 3300010375 Bacteria 1580
432 Ga0105239_10575312 3300010375 Bacteria 1284
433 Ga0105239_10578048 3300010375 Bacteria 1281
434 Ga0105239_11055342 3300010375 Bacteria 935
435 Ga0105246_10013775 3300011119 Bacteria 5074
436 Ga0105246_10045998 3300011119 Bacteria 2975
437 Ga0105246_10104444 3300011119 Bacteria 2069
438 Ga0105246_10228690 3300011119 Bacteria 1463
439 Ga0105246_10266822 3300011119 Bacteria 1366
440 Ga0105246_10268572 3300011119 Bacteria 1362
441 Ga0105246_10350085 3300011119 Bacteria 1210
442 Ga0105246_10694380 3300011119 Bacteria 891
443 Ga0157370_10057618 3300013104 Bacteria 3693
444 Ga0157370_10643066 3300013104 Bacteria 970
445 Ga0157370_10885876 3300013104 Bacteria 810
446 Ga0157369_10012423 3300013105 Bacteria 9667
447 Ga0157369_10195154 3300013105 Bacteria 2126
448 Ga0157369_10348532 3300013105 Bacteria 1538
449 Ga0157369_10616948 3300013105 Bacteria 1119
450 Ga0157374_10024785 3300013296 Bacteria 5379
451 Ga0157374_10040321 3300013296 Bacteria 4299
452 Ga0157374_11755321 3300013296 Bacteria 645
453 Ga0157374_11891070 3300013296 Bacteria 623
454 Ga0157378_10004961 3300013297 Bacteria 11667
455 Ga0157378_10133315 3300013297 Bacteria 2302
456 Ga0157378_10662215 3300013297 Bacteria 1060
457 Ga0157378_10807552 3300013297 Bacteria 964
458 Ga0157378_10934671 3300013297 Bacteria 899
459 Ga0157378_11025692 3300013297 Bacteria 860
460 Ga0163162_10060239 3300013306 Bacteria 3831
461 Ga0163162_10062895 3300013306 Bacteria 3752
462 Ga0163162_10163138 3300013306 Bacteria 2351
463 Ga0163162_10184729 3300013306 Bacteria 2212
464 Ga0163162_10370985 3300013306 Bacteria 1564
465 Ga0163162_10893966 3300013306 Bacteria 1002
466 Ga0163162_11221664 3300013306 Bacteria 853
467 Ga0163162_11419257 3300013306 Bacteria 790
468 Ga0157372_10782245 3300013307 Bacteria 1109
469 Ga0157375_10063269 3300013308 Bacteria 3680
470 Ga0157375_10105710 3300013308 Bacteria 2906
471 Ga0157375_10108399 3300013308 Bacteria 2872
472 Ga0157375_10498328 3300013308 Bacteria 1382
473 Ga0157375_10888727 3300013308 Bacteria 1035
474 Ga0157375_11224732 3300013308 Bacteria 881
475 Ga0157375_11415865 3300013308 Bacteria 819
476 Ga0163163_10009852 3300014325 Bacteria 8564
477 Ga0163163_10060452 3300014325 Bacteria 3752
478 Ga0163163_10060614 3300014325 Bacteria 3747
479 Ga0163163_10177238 3300014325 Bacteria 2178
480 Ga0163163_10352566 3300014325 Bacteria 1528
481 Ga0163163_10927490 3300014325 Bacteria 934
482 Ga0157380_10052368 3300014326 Bacteria 3232
483 Ga0157380_10260620 3300014326 Bacteria 1574
484 Ga0157380_10316878 3300014326 Bacteria 1444
485 Ga0157377_10110199 3300014745 Bacteria 1653
486 Ga0157377_10113067 3300014745 Bacteria 1635
487 Ga0157377_10164552 3300014745 Bacteria 1382
488 Ga0157379_10092888 3300014968 Bacteria 2707
489 Ga0157379_10100952 3300014968 Bacteria 2590
490 Ga0157379_10115038 3300014968 Bacteria 2418
491 Ga0157379_10614098 3300014968 Bacteria 1016
492 Ga0157376_10053421 3300014969 Bacteria 3364
493 Ga0157376_10160876 3300014969 Bacteria 2035
494 Ga0157376_10686731 3300014969 Bacteria 1027
495 Ga0182007_10120303 3300015262 Bacteria 878
496 Ga0163161_10049743 3300017792 Bacteria 3031
497 Ga0163161_10297384 3300017792 Bacteria 1270
498 Ga0163161_10546613 3300017792 Bacteria 949
499 Ga0163161_10566890 3300017792 Bacteria 932
500 Ga0206353_11239574 3300020082 Bacteria 855
501 Ga0214542_1001925 3300021321 Bacteria 42950
502 Ga0214545_1000003 3300021324 Bacteria 720274
503 Ga0214543_1000002 3300021327 Bacteria 712733
504 Ga0213872_10023682 3300021361 Bacteria 2825
505 Ga0213876_10020877 3300021384 Bacteria 3463
506 Ga0213875_10074339 3300021388 Bacteria 1586
507 Ga0224572_1024786 3300024225 Bacteria 1152
508 Ga0228598_1003083 3300024227 Bacteria 3613
509 Ga0209563_100325 3300025230 Bacteria 18742
510 Ga0207425_1030815 3300025245 Bacteria 1072
511 Ga0209677_102346 3300025253 Bacteria 7251
512 Ga0209148_1000812 3300025254 Bacteria 22632
513 Ga0209233_1002884 3300025261 Bacteria 6146
514 Ga0209233_1003610 3300025261 Bacteria 5425
515 Ga0209233_1008563 3300025261 Bacteria 3154
516 Ga0209233_1017593 3300025261 Bacteria 1944
517 Ga0209233_1026199 3300025261 Bacteria 1429
518 Ga0209673_1045625 3300025273 Bacteria 1202
519 Ga0209564_1005325 3300025295 Bacteria 7407
520 Ga0209564_1016531 3300025295 Bacteria 2929
521 Ga0209758_1000011 3300025297 Bacteria 1049685
522 Ga0209758_1000120 3300025297 Bacteria 192212
523 Ga0209758_1001848 3300025297 Bacteria 23245
524 Ga0209758_1002526 3300025297 Bacteria 18502
525 Ga0209758_1002848 3300025297 Bacteria 16788
526 Ga0209758_1008838 3300025297 Bacteria 6412
527 Ga0209758_1018387 3300025297 Bacteria 3426
528 Ga0209758_1069994 3300025297 Bacteria 1109
529 Ga0209758_1075221 3300025297 Bacteria 1045
530 Ga0209256_1010441 3300025299 Bacteria 3886
531 Ga0209256_1040226 3300025299 Bacteria 1196
532 Ga0207426_1000328 3300025302 Bacteria 90659
533 Ga0207426_1000458 3300025302 Bacteria 64019
534 Ga0207426_1006703 3300025302 Bacteria 4942
535 Ga0207426_1066486 3300025302 Bacteria 1018
536 Ga0209051_1089771 3300025303 Bacteria 858
537 Ga0209257_1001101 3300025304 Bacteria 35153
538 Ga0209257_1030664 3300025304 Bacteria 1732
539 Ga0207697_10262449 3300025315 Bacteria 765
540 Ga0207697_10413234 3300025315 Bacteria 599
541 Ga0207656_10107837 3300025321 Bacteria 1284
542 Ga0207656_10147548 3300025321 Bacteria 1112
543 Ga0207653_10027624 3300025885 Bacteria 1822
544 Ga0207692_10000797 3300025898 Bacteria 11223
545 Ga0207692_10034442 3300025898 Bacteria 2452
546 Ga0207692_10040116 3300025898 Bacteria 2309
547 Ga0207692_10108271 3300025898 Bacteria 1537
548 Ga0207692_10751592 3300025898 Bacteria 635
549 Ga0207642_10090132 3300025899 Bacteria 1512
550 Ga0207642_10592054 3300025899 Bacteria 689
551 Ga0207710_10161530 3300025900 Bacteria 1092
552 Ga0207688_10119760 3300025901 Bacteria 1535
553 Ga0207688_10266632 3300025901 Bacteria 1041
554 Ga0207647_10008820 3300025904 Bacteria 7199
555 Ga0207647_10077783 3300025904 Bacteria 1994
556 Ga0207647_10429309 3300025904 Bacteria 742
557 Ga0207647_10532657 3300025904 Bacteria 653
558 Ga0207699_10001610 3300025906 Bacteria 10719
559 Ga0207699_10014207 3300025906 Bacteria 4097
560 Ga0207699_10017213 3300025906 Bacteria 3798
561 Ga0207699_10054282 3300025906 Bacteria 2379
562 Ga0207699_10085855 3300025906 Bacteria 1964
563 Ga0207699_10088282 3300025906 Bacteria 1940
564 Ga0207699_10119427 3300025906 Bacteria 1702
565 Ga0207699_10403897 3300025906 Bacteria 973
566 Ga0207645_10132858 3300025907 Bacteria 1620
567 Ga0207643_10104196 3300025908 Bacteria 1666
568 Ga0207643_10728021 3300025908 Bacteria 642
569 Ga0207705_10125295 3300025909 Bacteria 1909
570 Ga0207705_10195132 3300025909 Bacteria 1532
571 Ga0207705_11134653 3300025909 Bacteria 601
572 Ga0207684_11153938 3300025910 Bacteria 643
573 Ga0207654_10119575 3300025911 Bacteria 1652
574 Ga0207654_10397877 3300025911 Bacteria 957
575 Ga0207654_10488780 3300025911 Bacteria 868
576 Ga0207707_10000886 3300025912 Bacteria 29266
577 Ga0207707_10023656 3300025912 Bacteria 5372
578 Ga0207707_10031075 3300025912 Bacteria 4672
579 Ga0207707_10299929 3300025912 Bacteria 1389
580 Ga0207707_10518469 3300025912 Bacteria 1015
581 Ga0207707_11490262 3300025912 Bacteria 536
582 Ga0207695_10000163 3300025913 Bacteria 197030
583 Ga0207695_10306738 3300025913 Bacteria 1478
584 Ga0207695_10308478 3300025913 Bacteria 1473
585 Ga0207671_10056823 3300025914 Bacteria 2900
586 Ga0207671_10058973 3300025914 Bacteria 2846
587 Ga0207671_10110956 3300025914 Bacteria 2087
588 Ga0207671_10332303 3300025914 Bacteria 1204
589 Ga0207671_10378502 3300025914 Bacteria 1124
590 Ga0207693_10002637 3300025915 Bacteria 15580
591 Ga0207693_10007874 3300025915 Bacteria 8752
592 Ga0207693_10018468 3300025915 Bacteria 5555
593 Ga0207693_10034047 3300025915 Bacteria 4019
594 Ga0207693_10060270 3300025915 Bacteria 2972
595 Ga0207693_10203094 3300025915 Bacteria 1558
596 Ga0207693_10453506 3300025915 Bacteria 1002
597 Ga0207693_10539021 3300025915 Bacteria 910
598 Ga0207663_10006243 3300025916 Bacteria 6080
599 Ga0207663_10011845 3300025916 Bacteria 4695
600 Ga0207663_10028419 3300025916 Bacteria 3273
601 Ga0207663_10044640 3300025916 Bacteria 2722
602 Ga0207663_10121345 3300025916 Bacteria 1790
603 Ga0207663_10140152 3300025916 Bacteria 1683
604 Ga0207663_11006565 3300025916 Bacteria 669
605 Ga0207663_11244168 3300025916 Bacteria 600
606 Ga0207660_10010388 3300025917 Bacteria 6040
607 Ga0207660_10022287 3300025917 Bacteria 4267
608 Ga0207660_10027535 3300025917 Bacteria 3880
609 Ga0207660_10231996 3300025917 Bacteria 1451
610 Ga0207660_10256833 3300025917 Bacteria 1380
611 Ga0207660_10502071 3300025917 Bacteria 984
612 Ga0207662_10177795 3300025918 Bacteria 1368
613 Ga0207657_10008437 3300025919 Bacteria 10455
614 Ga0207649_10040161 3300025920 Bacteria 2842
615 Ga0207649_10684652 3300025920 Bacteria 794
616 Ga0207649_10932267 3300025920 Bacteria 682
617 Ga0207652_10019601 3300025921 Bacteria 5566
618 Ga0207652_10105158 3300025921 Bacteria 2498
619 Ga0207652_10274051 3300025921 Bacteria 1522
620 Ga0207681_10036681 3300025923 Bacteria 3236
621 Ga0207681_10208829 3300025923 Bacteria 1504
622 Ga0207681_10293023 3300025923 Bacteria 1285
623 Ga0207694_10040173 3300025924 Bacteria 3601
624 Ga0207694_10071234 3300025924 Bacteria 2716
625 Ga0207694_10203424 3300025924 Bacteria 1611
626 Ga0207694_10208299 3300025924 Bacteria 1592
627 Ga0207694_10282251 3300025924 Bacteria 1364
628 Ga0207694_10454862 3300025924 Bacteria 1069
629 Ga0207694_11140667 3300025924 Bacteria 660
630 Ga0207650_10527525 3300025925 Bacteria 988
631 Ga0207650_10815484 3300025925 Bacteria 791
632 Ga0207650_10925300 3300025925 Bacteria 741
633 Ga0207659_10789612 3300025926 Bacteria 815
634 Ga0207659_10981193 3300025926 Bacteria 727
635 Ga0207659_11035003 3300025926 Bacteria 706
636 Ga0207687_10053608 3300025927 Bacteria 2818
637 Ga0207687_10218131 3300025927 Bacteria 1500
638 Ga0207687_10327438 3300025927 Bacteria 1242
639 Ga0207700_10007466 3300025928 Bacteria 6681
640 Ga0207700_10011479 3300025928 Bacteria 5650
641 Ga0207700_10052174 3300025928 Bacteria 3056
642 Ga0207700_10095945 3300025928 Bacteria 2353
643 Ga0207700_10304870 3300025928 Bacteria 1376
644 Ga0207664_10002586 3300025929 Bacteria 11979
645 Ga0207664_10007788 3300025929 Bacteria 7438
646 Ga0207664_10267241 3300025929 Bacteria 1497
647 Ga0207664_10276253 3300025929 Bacteria 1473
648 Ga0207664_10276358 3300025929 Bacteria 1473
649 Ga0207664_10378557 3300025929 Bacteria 1256
650 Ga0207644_10188346 3300025931 Bacteria 1621
651 Ga0207644_10272742 3300025931 Bacteria 1356
652 Ga0207644_10448930 3300025931 Bacteria 1059
653 Ga0207690_10014466 3300025932 Bacteria 4767
654 Ga0207690_10522991 3300025932 Bacteria 962
655 Ga0207690_11302912 3300025932 Bacteria 607
656 Ga0207706_10059649 3300025933 Bacteria 3360
657 Ga0207706_10149460 3300025933 Bacteria 2054
658 Ga0207706_10261499 3300025933 Bacteria 1511
659 Ga0207706_10634162 3300025933 Bacteria 916
660 Ga0207706_10855574 3300025933 Bacteria 770
661 Ga0207706_11349173 3300025933 Bacteria 587
662 Ga0207686_10089706 3300025934 Bacteria 2027
663 Ga0207686_10103845 3300025934 Bacteria 1902
664 Ga0207686_10390090 3300025934 Bacteria 1058
665 Ga0207709_10040013 3300025935 Bacteria 2804
666 Ga0207670_10210240 3300025936 Bacteria 1483
667 Ga0207669_10005298 3300025937 Bacteria 5770
668 Ga0207669_10219534 3300025937 Bacteria 1394
669 Ga0207669_10564302 3300025937 Bacteria 920
670 Ga0207669_10972046 3300025937 Bacteria 712
671 Ga0207669_10972372 3300025937 Bacteria 712
672 Ga0207669_11135585 3300025937 Bacteria 660
673 Ga0207704_10175381 3300025938 Bacteria 1543
674 Ga0207704_10222242 3300025938 Bacteria 1398
675 Ga0207704_10390975 3300025938 Bacteria 1094
676 Ga0207665_10001385 3300025939 Bacteria 16335
677 Ga0207665_10021917 3300025939 Bacteria 4201
678 Ga0207665_10065508 3300025939 Bacteria 2471
679 Ga0207665_10116671 3300025939 Bacteria 1882
680 Ga0207665_10172049 3300025939 Bacteria 1565
681 Ga0207665_10910243 3300025939 Bacteria 698
682 Ga0207691_10025303 3300025940 Bacteria 5574
683 Ga0207691_10148496 3300025940 Bacteria 2062
684 Ga0207691_10149913 3300025940 Bacteria 2051
685 Ga0207691_11065095 3300025940 Bacteria 673
686 Ga0207711_10067359 3300025941 Bacteria 3099
687 Ga0207689_10019353 3300025942 Bacteria 5738
688 Ga0207689_10036827 3300025942 Bacteria 4060
689 Ga0207689_10117631 3300025942 Bacteria 2185
690 Ga0207689_10305796 3300025942 Bacteria 1318
691 Ga0207689_10782418 3300025942 Bacteria 805
692 Ga0207689_11596551 3300025942 Bacteria 543
693 Ga0207661_10018951 3300025944 Bacteria 5120
694 Ga0207679_10205321 3300025945 Bacteria 1649
695 Ga0207679_10621109 3300025945 Bacteria 975
696 Ga0207679_10757306 3300025945 Bacteria 883
697 Ga0207667_10019974 3300025949 Bacteria 7463
698 Ga0207667_10113813 3300025949 Bacteria 2789
699 Ga0207667_10168621 3300025949 Bacteria 2250
700 Ga0207667_10189492 3300025949 Bacteria 2111
701 Ga0207667_10230228 3300025949 Bacteria 1898
702 Ga0207667_10474438 3300025949 Bacteria 1270
703 Ga0207667_10536798 3300025949 Bacteria 1184
704 Ga0207667_11684186 3300025949 Bacteria 601
705 Ga0207651_10311328 3300025960 Bacteria 1313
706 Ga0207651_10882550 3300025960 Bacteria 796
707 Ga0207651_11112223 3300025960 Bacteria 708
708 Ga0207712_10082756 3300025961 Bacteria 2341
709 Ga0207712_11310256 3300025961 Bacteria 647
710 Ga0207668_10030855 3300025972 Bacteria 3525
711 Ga0207668_10064631 3300025972 Bacteria 2586
712 Ga0207668_10069258 3300025972 Bacteria 2511
713 Ga0207668_10108642 3300025972 Bacteria 2076
714 Ga0207668_10119579 3300025972 Bacteria 1992
715 Ga0207668_10151383 3300025972 Bacteria 1796
716 Ga0207668_10972115 3300025972 Bacteria 758
717 Ga0207640_10187043 3300025981 Bacteria 1558
718 Ga0207640_10450463 3300025981 Bacteria 1061
719 Ga0207640_10633117 3300025981 Bacteria 909
720 Ga0207640_11197543 3300025981 Bacteria 675
721 Ga0207658_10059201 3300025986 Bacteria 2854
722 Ga0207658_10109147 3300025986 Bacteria 2184
723 Ga0207658_10546621 3300025986 Bacteria 1036
724 Ga0207677_10073769 3300026023 Bacteria 2418
725 Ga0207677_10721331 3300026023 Bacteria 886
726 Ga0207677_10838878 3300026023 Bacteria 825
727 Ga0207677_11112933 3300026023 Bacteria 720
728 Ga0207703_10127440 3300026035 Bacteria 2193
729 Ga0207703_10129128 3300026035 Bacteria 2180
730 Ga0207703_10473656 3300026035 Bacteria 1173
731 Ga0207703_10725421 3300026035 Bacteria 946
732 Ga0207703_10812025 3300026035 Bacteria 893
733 Ga0207703_10992098 3300026035 Bacteria 806
734 Ga0207639_10034032 3300026041 Bacteria 3763
735 Ga0207639_10089016 3300026041 Bacteria 2465
736 Ga0207639_11024210 3300026041 Bacteria 773
737 Ga0207678_10017857 3300026067 Bacteria 6231
738 Ga0207678_10022393 3300026067 Bacteria 5534
739 Ga0207678_10026311 3300026067 Bacteria 5076
740 Ga0207678_10033211 3300026067 Bacteria 4496
741 Ga0207678_10034200 3300026067 Bacteria 4427
742 Ga0207678_10035164 3300026067 Bacteria 4362
743 Ga0207678_10058046 3300026067 Bacteria 3331
744 Ga0207678_10154732 3300026067 Bacteria 1958
745 Ga0207678_10374084 3300026067 Bacteria 1231
746 Ga0207678_10596797 3300026067 Bacteria 968
747 Ga0207678_10849948 3300026067 Bacteria 806
748 Ga0207678_11146906 3300026067 Bacteria 688
749 Ga0207708_10062133 3300026075 Bacteria 2853
750 Ga0207708_10494035 3300026075 Bacteria 1025
751 Ga0207708_10521770 3300026075 Bacteria 998
752 Ga0207702_10087083 3300026078 Bacteria 2725
753 Ga0207702_10762169 3300026078 Bacteria 956
754 Ga0207702_11190195 3300026078 Bacteria 756
755 Ga0207641_10203963 3300026088 Bacteria 1825
756 Ga0207641_11198100 3300026088 Bacteria 759
757 Ga0207648_10032340 3300026089 Bacteria 4619
758 Ga0207648_10605595 3300026089 Bacteria 1010
759 Ga0207648_11862359 3300026089 Bacteria 563
760 Ga0207676_10068020 3300026095 Bacteria 2847
761 Ga0207676_10125942 3300026095 Bacteria 2170
762 Ga0207676_10177406 3300026095 Bacteria 1862
763 Ga0207676_10209105 3300026095 Bacteria 1730
764 Ga0207674_10007720 3300026116 Bacteria 12520
765 Ga0207674_10078663 3300026116 Bacteria 3303
766 Ga0207674_10167564 3300026116 Bacteria 2150
767 Ga0207674_10328757 3300026116 Bacteria 1478
768 Ga0207674_11087386 3300026116 Bacteria 769
769 Ga0207675_100058719 3300026118 Bacteria 3590
770 Ga0207675_100293273 3300026118 Bacteria 1582
771 Ga0207675_100537114 3300026118 Bacteria 1167
772 Ga0207675_100954201 3300026118 Bacteria 875
773 Ga0207675_101079958 3300026118 Bacteria 822
774 Ga0207675_101535517 3300026118 Bacteria 686
775 Ga0207683_10003797 3300026121 Bacteria 13083
776 Ga0207683_10037123 3300026121 Bacteria 4243
777 Ga0207683_10068301 3300026121 Bacteria 3137
778 Ga0207683_10091282 3300026121 Bacteria 2713
779 Ga0207683_10363740 3300026121 Bacteria 1329
780 Ga0207683_10469443 3300026121 Bacteria 1161
781 Ga0207683_10539113 3300026121 Bacteria 1079
782 Ga0207683_10656745 3300026121 Bacteria 971
783 Ga0207683_10865217 3300026121 Bacteria 839
784 Ga0207698_10132646 3300026142 Bacteria 2132
785 Ga0207698_10138196 3300026142 Bacteria 2094
786 Ga0207698_10365103 3300026142 Bacteria 1368
787 Ga0207698_10432956 3300026142 Bacteria 1265
788 Ga0207698_11333200 3300026142 Bacteria 732
789 Ga0209389_1000043 3300027296 Bacteria 123224
790 Ga0209389_1000077 3300027296 Bacteria 91273
791 Ga0209589_1000011 3300027357 Bacteria 236981
792 Ga0209589_1000047 3300027357 Bacteria 118659
793 Ga0209489_100012 3300027361 Bacteria 236981
794 Ga0209489_100075 3300027361 Bacteria 136991
795 Ga0209489_100251 3300027361 Bacteria 91273
796 Ga0209700_100019 3300027363 Bacteria 236981
797 Ga0209700_100271 3300027363 Bacteria 91215
798 Ga0209179_1003275 3300027512 Bacteria 2312
799 Ga0209588_1012656 3300027671 Bacteria 2563
800 Ga0209588_1030031 3300027671 Bacteria 1735
801 Ga0209813_10046981 3300027866 Bacteria 1335
802 Ga0209813_10049013 3300027866 Bacteria 1313
803 Ga0207428_10255880 3300027907 Bacteria 1305
804 Ga0268266_10007625 3300028379 Bacteria 9734
805 Ga0268266_10020198 3300028379 Bacteria 5678
806 Ga0268266_10022295 3300028379 Bacteria 5397
807 Ga0268266_10043720 3300028379 Bacteria 3829
808 Ga0268266_10056470 3300028379 Bacteria 3377
809 Ga0268266_10128490 3300028379 Bacteria 2264
810 Ga0268266_10759427 3300028379 Bacteria 936
811 Ga0268266_11410195 3300028379 Bacteria 672
812 Ga0268266_11808682 3300028379 Bacteria 585
813 Ga0268265_10054843 3300028380 Bacteria 3026
814 Ga0268265_10170480 3300028380 Bacteria 1859
815 Ga0268265_10487539 3300028380 Bacteria 1159
816 Ga0268265_10791405 3300028380 Bacteria 923
817 Ga0268265_11299103 3300028380 Bacteria 727
818 Ga0268264_10000030 3300028381 Bacteria 418542
819 Ga0268264_10140299 3300028381 Bacteria 2154
820 Ga0265337_1006171 3300028556 Bacteria 4658
821 Ga0265319_1011253 3300028563 Bacteria 3676
822 Ga0265334_10010046 3300028573 Bacteria 3999
823 Ga0265323_10000434 3300028653 Bacteria 23913
824 Ga0265322_10017119 3300028654 Bacteria 2089
825 Ga0265336_10000649 3300028666 Bacteria 18964
826 Ga0307517_10000279 3300028786 Bacteria 88025
827 Ga0307515_10118784 3300028794 Bacteria 3014
828 Ga0265338_10000280 3300028800 Bacteria 91942
829 Ga0307512_10162065 3300030522 Bacteria 1307
830 Ga0265762_1030524 3300030760 Bacteria 1023
831 Ga0265330_10006697 3300031235 Bacteria 5683
832 Ga0265330_10016700 3300031235 Bacteria 3384
833 Ga0265330_10047707 3300031235 Bacteria 1884
834 Ga0265332_10013075 3300031238 Bacteria 3679
835 Ga0265332_10252158 3300031238 Bacteria 730
836 Ga0265328_10277413 3300031239 Bacteria 645
837 Ga0265325_10071434 3300031241 Bacteria 1742
838 Ga0265340_10140965 3300031247 Bacteria 1102
839 Ga0265340_10378982 3300031247 Bacteria 624
840 Ga0265339_10173947 3300031249 Bacteria 1076
841 Ga0265339_10198075 3300031249 Bacteria 992
842 Ga0265339_10376988 3300031249 Bacteria 665
843 Ga0265331_10068893 3300031250 Bacteria 1658
844 Ga0265331_10083507 3300031250 Bacteria 1481
845 Ga0265316_10789044 3300031344 Bacteria 666
846 Ga0307513_10530716 3300031456 Bacteria 891
847 Ga0307509_10014245 3300031507 Bacteria 9362
848 Ga0307509_10098111 3300031507 Bacteria 2976
849 Ga0307509_10592549 3300031507 Bacteria 782
850 Ga0307408_100713904 3300031548 Bacteria 902
851 Ga0307408_101558671 3300031548 Bacteria 626
852 Ga0265313_10063475 3300031595 Bacteria 1722
853 Ga0307508_10111858 3300031616 Bacteria 2331
854 Ga0307508_10232923 3300031616 Bacteria 1440
855 Ga0307508_10340520 3300031616 Bacteria 1091
856 Ga0265314_10031072 3300031711 Bacteria 3947
857 Ga0265314_10099606 3300031711 Bacteria 1872
858 Ga0265342_10009847 3300031712 Bacteria 6686
859 Ga0265342_10065315 3300031712 Bacteria 2133
860 Ga0307516_10005995 3300031730 Bacteria 14363
861 Ga0307516_10097075 3300031730 Bacteria 2767
862 Ga0307516_10126545 3300031730 Bacteria 2339
863 Ga0307516_10401264 3300031730 Bacteria 1030
864 Ga0307516_10429131 3300031730 Bacteria 979
865 Ga0307413_10468445 3300031824 Bacteria 1004
866 Ga0307410_10623428 3300031852 Bacteria 902
867 Ga0307406_10744456 3300031901 Bacteria 822
868 Ga0307407_11335175 3300031903 Bacteria 563
869 Ga0307412_10379263 3300031911 Bacteria 1144
870 Ga0307409_101524258 3300031995 Bacteria 696
871 Ga0307409_102086504 3300031995 Bacteria 596
872 Ga0307416_100747531 3300032002 Bacteria 1070
873 Ga0307416_100778753 3300032002 Bacteria 1051
874 Ga0307416_101034913 3300032002 Bacteria 925
875 Ga0307415_100233281 3300032126 Bacteria 1483
876 Ga0307415_100825403 3300032126 Bacteria 848
877 Ga0307415_100925050 3300032126 Bacteria 805
878 Ga0307415_100939741 3300032126 Bacteria 800
879 Ga0307507_10329935 3300033179 Bacteria 912
880 Ga0307510_10006305 3300033180 Bacteria 14151
881 Ga0307510_10041581 3300033180 Bacteria 5022
882 Ga0315911_1000003 3300033442 Bacteria 502217
883 Ga0316215_1013218 3300033544 Bacteria 823
884 Ga0373950_0135823 3300034818 Bacteria 554
885 Ga0373926_0044210 3300035083 Bacteria 1595
886 Ga0373934_0031807 3300035086 Bacteria 2067
887 Ga0373934_0035852 3300035086 Bacteria 1953
888 Ga0373934_0299123 3300035086 Bacteria 667
889 Ga0373944_0357454 3300035089 Bacteria 557
890 Ga0373923_0051442 3300035111 Bacteria 1728
891 Ga0373923_0537138 3300035111 Bacteria 572
892 Ga0373936_0157833 3300035113 Bacteria 987
893 Ga0373941_0028234 3300035115 Bacteria 1646
894 Ga0373945_0057394 3300035116 Bacteria 1446
895 Ga0373953_0003406 3300035117 Bacteria 4946
896 Ga0373953_0150420 3300035117 Bacteria 998
897 Ga0373954_0005974 3300035118 Bacteria 5295
898 Ga0373954_0339928 3300035118 Bacteria 741
899 Ga0373956_0056434 3300035119 Bacteria 1773
900 Ga0373957_0020281 3300035120 Bacteria 2347
901 Ga0373957_0022105 3300035120 Bacteria 2263
902 Ga0373957_0168222 3300035120 Bacteria 905
903 Ga0373943_0000795 3300035170 Bacteria 13844
904 Ga0373943_0153691 3300035170 Bacteria 1248
905 Ga0373946_0006225 3300035171 Bacteria 4322
906 Ga0373946_0210640 3300035171 Bacteria 935
907 Ga0373946_0229166 3300035171 Bacteria 899
908 Ga0373946_0310404 3300035171 Bacteria 782
909 Ga0373955_0159501 3300035172 Bacteria 1330
910 Ga0373955_0179618 3300035172 Bacteria 1255
911 Ga0373955_0627919 3300035172 Bacteria 658
912 Ga0373942_0032763 3300035207 Bacteria 1382
913 Ga0373924_0009206 3300035410 Bacteria 3615
914 Ga0373924_0017906 3300035410 Bacteria 2724
915 Ga0373931_0023469 3300035691 Bacteria 3114
916 Ga0373931_0341514 3300035691 Bacteria 935
917 Ga0373931_0467324 3300035691 Bacteria 809
918 Ga0373931_0505071 3300035691 Bacteria 780
919 Ga0373931_0622424 3300035691 Bacteria 707
920 Ga0373935_0000536 3300035692 Bacteria 19758
921 Ga0373935_0130397 3300035692 Bacteria 1689
922 Ga0373935_0368091 3300035692 Bacteria 1027
923 Ga0373927_0000898 3300035695 Bacteria 22620
924 Ga0373927_0039104 3300035695 Bacteria 3078
925 Ga0373927_0083817 3300035695 Bacteria 2067
926 Ga0373927_0110471 3300035695 Bacteria 1791
927 Ga0373933_0001821 3300035724 Bacteria 12354
928 Ga0373933_0382728 3300035724 Bacteria 916
929 Ga0373947_0010479 3300035725 Bacteria 5318
930 Ga0373947_0032481 3300035725 Bacteria 3076
931 Ga0373937_0064227 3300036401 Bacteria 3377
932 Ga0373937_0092525 3300036401 Bacteria 2803
933 Ga0373937_0095987 3300036401 Bacteria 2749
934 Ga0373937_0142169 3300036401 Bacteria 2245
935 Ga0373937_0285918 3300036401 Bacteria 1558
936 Ga0372808_055570 3300036459 Bacteria 567
937 Ga0373925_0001796 3300037068 Bacteria 17888
938 Ga0373925_0038336 3300037068 Bacteria 3543
939 Ga0373925_0168515 3300037068 Bacteria 1728
940 Ga0373925_0339375 3300037068 Bacteria 1218
941 Ga0373925_0368755 3300037068 Bacteria 1168
942 Ga0373925_0941432 3300037068 Unclassified 712
943 Ga0373925_1159596 3300037068 Bacteria 635
944 Ga0395900_0485656 3300037418 Bacteria 1187
945 Ga0395905_0015460 3300037471 Bacteria 7255
946 Ga0395905_0031994 3300037471 Bacteria 4949
947 Ga0395905_0161613 3300037471 Bacteria 2105
948 Ga0436364_0231314 3300037853 Bacteria 2982
949 Ga0436364_0807757 3300037853 Bacteria 734
950 Ga0436364_1142822 3300037853 Bacteria 1781
951 Ga0395901_0137905 3300038443 Bacteria 2564
952 Ga0436365_0312278 3300039437 Bacteria 749
953 Ga0436365_0339172 3300039437 Bacteria 3745
954 Ga0436365_0679534 3300039437 Bacteria 1226
955 Ga0436365_1425854 3300039437 Bacteria 2723
956 Ga0436360_0588427 3300039438 Bacteria 1472
957 Ga0436360_0619192 3300039438 Bacteria 809
958 Ga0436360_0808748 3300039438 Bacteria 1542
959 Ga0436360_0832371 3300039438 Bacteria 3206
960 Ga0436360_0926138 3300039438 Bacteria 1030
961 Ga0436361_0108686 3300039447 Bacteria 4031
962 Ga0436361_0497086 3300039447 Bacteria 758
963 Ga0436361_0518565 3300039447 Bacteria 1050
964 Ga0436361_1222273 3300039447 Bacteria 2495
965 Ga0436363_0142697 3300039450 Bacteria 666
966 Ga0436363_0923145 3300039450 Bacteria 598
967 Ga0436363_1166057 3300039450 Bacteria 1118
968 Ga0436363_1556276 3300039450 Bacteria 1087
969 Ga0436362_0868287 3300039453 Bacteria 706
970 Ga0451787_768313 3300041441 Bacteria 608
971 Ga0451791_1328224 3300041451 Bacteria 2074
972 Ga0451793_0250726 3300041452 Bacteria 1062
973 Ga0451797_0393201 3300041453 Bacteria 793
974 Ga0451795_1029459 3300041456 Bacteria 1436
975 Ga0451798_0974609 3300041458 Bacteria 630
976 Ga0451802_0275182 3300041460 Bacteria 1388
977 Ga0451802_1139949 3300041460 Bacteria 836
978 Ga0451807_1659583 3300041486 Bacteria 577
979 Ga0451847_0789714 3300041503 Bacteria 861
980 Ga0451843_0345131 3300041509 Bacteria 1395
981 Ga0451843_0534612 3300041509 Bacteria 738
982 Ga0439455_0055061 3300042012 Bacteria 1046
983 Ga0466972_0000079 3300044658 Bacteria 90348
984 Ga0466972_0001061 3300044658 Bacteria 13191
985 Ga0466965_0247552 3300044683 Bacteria 955
986 Ga0466965_0323623 3300044683 Bacteria 840
987 Ga0466965_0532943 3300044683 Bacteria 661
988 Ga0466966_0058132 3300044684 Bacteria 2445
989 Ga0466963_0007491 3300044694 Bacteria 6512
990 Ga0466964_0144189 3300044706 Bacteria 1098
991 Ga0466964_0178972 3300044706 Bacteria 1004
992 Ga0466964_0253871 3300044706 Bacteria 868
993 Ga0466968_0010560 3300044735 Bacteria 3583
994 Ga0466968_0193789 3300044735 Bacteria 949
995 Ga0466957_0093861 3300044842 Bacteria 1884
996 Ga0466957_0145307 3300044842 Bacteria 1530
997 Ga0466957_0284174 3300044842 Bacteria 1108
998 Ga0466957_0472257 3300044842 Bacteria 867
999 Ga0466959_0033466 3300045049 Bacteria 3801
1000 Ga0466959_0040060 3300045049 Bacteria 3462
1001 Ga0451576_0002188 3300045051 Bacteria 30183
1002 Ga0451576_0125392 3300045051 Bacteria 2675
1003 Ga0466958_0642977 3300045836 Bacteria 690
1004 Ga0466967_0144470 3300045976 Bacteria 2218
1005 Ga0466967_0202886 3300045976 Bacteria 1878
1006 Ga0466967_0508568 3300045976 Bacteria 1183
1007 Ga0466967_0593849 3300045976 Bacteria 1092
1008 Ga0495617_079919 3300046452 Bacteria 1071
1009 Ga0495592_0011606 3300046454 Bacteria 6672
1010 Ga0495592_0029907 3300046454 Bacteria 4121
1011 Ga0495592_0207253 3300046454 Bacteria 1319
1012 Ga0495592_0580120 3300046454 Bacteria 686
1013 Ga0495603_0000046 3300046455 Bacteria 53187
1014 Ga0495603_0002778 3300046455 Bacteria 10319
1015 Ga0495603_0040136 3300046455 Bacteria 2802
1016 Ga0495603_0280312 3300046455 Bacteria 958
1017 Ga0495590_0175671 3300046457 Bacteria 782
1018 Ga0495629_0000071 3300046459 Bacteria 88879
1019 Ga0495629_0065563 3300046459 Bacteria 2535
1020 Ga0495629_0177624 3300046459 Bacteria 1476
1021 Ga0495629_0274632 3300046459 Bacteria 1157
1022 Ga0495629_0314481 3300046459 Bacteria 1071
1023 Ga0495629_0410884 3300046459 Bacteria 919
1024 Ga0495629_0636485 3300046459 Bacteria 711
1025 Ga0495638_0020090 3300046460 Bacteria 4414
1026 Ga0495638_0054543 3300046460 Bacteria 2484
1027 Ga0495638_0373896 3300046460 Bacteria 746
1028 Ga0495641_0009896 3300046461 Bacteria 5611
1029 Ga0495641_0029184 3300046461 Bacteria 2659
1030 Ga0495651_0029360 3300046462 Bacteria 4287
1031 Ga0495651_0545205 3300046462 Bacteria 737
1032 Ga0495653_0228910 3300046463 Bacteria 1245
1033 Ga0495653_0702077 3300046463 Bacteria 614
1034 Ga0495580_0000057 3300046472 Bacteria 64650
1035 Ga0495580_0043983 3300046472 Bacteria 3177
1036 Ga0495580_0152884 3300046472 Bacteria 1599
1037 Ga0495582_0000111 3300046473 Bacteria 42751
1038 Ga0495582_0082297 3300046473 Bacteria 1788
1039 Ga0495605_0079481 3300046474 Bacteria 1536
1040 Ga0495605_0174422 3300046474 Bacteria 948
1041 Ga0495639_0000108 3300046475 Bacteria 41656
1042 Ga0495639_0214805 3300046475 Bacteria 944
1043 Ga0495639_0275106 3300046475 Bacteria 836
1044 Ga0495662_0000992 3300046476 Bacteria 13882
1045 Ga0495662_0020305 3300046476 Bacteria 3213
1046 Ga0495664_0002718 3300046477 Bacteria 9505
1047 Ga0495664_0030650 3300046477 Bacteria 3151
1048 Ga0495664_0056145 3300046477 Bacteria 2342
1049 Ga0495664_0092363 3300046477 Bacteria 1820
1050 Ga0495664_0122727 3300046477 Bacteria 1571
1051 Ga0495664_0325560 3300046477 Bacteria 927
1052 Ga0495584_0515486 3300046491 Bacteria 609
1053 Ga0495594_0000133 3300046499 Bacteria 34897
1054 Ga0495594_0137260 3300046499 Bacteria 1386
1055 Ga0495594_0573922 3300046499 Bacteria 640
1056 Ga0495596_0105487 3300046500 Bacteria 1094
1057 Ga0495596_0186849 3300046500 Bacteria 806
1058 Ga0495607_0152369 3300046501 Bacteria 1182
1059 Ga0495607_0210154 3300046501 Bacteria 958
1060 Ga0495606_0006998 3300046507 Bacteria 10238
1061 Ga0495606_0066480 3300046507 Bacteria 2286
1062 Ga0495606_0081284 3300046507 Bacteria 2015
1063 Ga0495606_0082074 3300046507 Bacteria 2003
1064 Ga0495606_0341486 3300046507 Bacteria 797
1065 Ga0495608_0112357 3300046511 Bacteria 1751
1066 Ga0495608_0129691 3300046511 Bacteria 1614
1067 Ga0495608_0642976 3300046511 Bacteria 634
1068 Ga0495610_0285565 3300046512 Bacteria 641
1069 Ga0495610_0300481 3300046512 Bacteria 619
1070 Ga0495616_0260402 3300046513 Bacteria 742
1071 Ga0495616_0272750 3300046513 Bacteria 721
1072 Ga0495616_0320530 3300046513 Bacteria 651
1073 Ga0495618_0064992 3300046514 Bacteria 2318
1074 Ga0495620_0293822 3300046515 Bacteria 618
1075 Ga0495628_0012530 3300046516 Bacteria 7144
1076 Ga0495628_0074053 3300046516 Bacteria 2653
1077 Ga0495628_0121239 3300046516 Bacteria 2005
1078 Ga0495628_0162259 3300046516 Unclassified 1698
1079 Ga0495628_0307226 3300046516 Bacteria 1173
1080 Ga0495630_0000959 3300046517 Bacteria 20201
1081 Ga0495630_0019164 3300046517 Bacteria 5028
1082 Ga0495630_0077623 3300046517 Bacteria 2504
1083 Ga0495632_0085482 3300046519 Bacteria 1501
1084 Ga0495637_0090080 3300046520 Bacteria 1211
1085 Ga0495637_0140225 3300046520 Bacteria 918
1086 Ga0495643_0005954 3300046522 Bacteria 8136
1087 Ga0495643_0049068 3300046522 Bacteria 2278
1088 Ga0495643_0138335 3300046522 Bacteria 1216
1089 Ga0495643_0302495 3300046522 Bacteria 728
1090 Ga0495644_0037867 3300046523 Bacteria 1820
1091 Ga0495644_0079264 3300046523 Bacteria 1237
1092 Ga0495644_0133893 3300046523 Bacteria 945
1093 Ga0495648_0014927 3300046524 Bacteria 5658
1094 Ga0495648_0023584 3300046524 Bacteria 4209
1095 Ga0495648_0037099 3300046524 Bacteria 3136
1096 Ga0495648_0041864 3300046524 Bacteria 2888
1097 Ga0495648_0082027 3300046524 Bacteria 1832
1098 Ga0495648_0156846 3300046524 Bacteria 1181
1099 Ga0495648_0222277 3300046524 Bacteria 930
1100 Ga0495648_0308876 3300046524 Bacteria 738
1101 Ga0495642_0118884 3300046528 Bacteria 1133
1102 Ga0495642_0183959 3300046528 Bacteria 910
1103 Ga0495652_0042099 3300046529 Bacteria 3939
1104 Ga0495652_0155483 3300046529 Bacteria 1781
1105 Ga0495652_0220458 3300046529 Bacteria 1426
1106 Ga0495652_0440217 3300046529 Bacteria 914
1107 Ga0495652_0444358 3300046529 Bacteria 909
1108 Ga0495652_0535283 3300046529 Bacteria 807
1109 Ga0495652_0721299 3300046529 Bacteria 669
1110 Ga0495654_0138148 3300046530 Bacteria 1088
1111 Ga0495654_0235796 3300046530 Bacteria 768
1112 Ga0495665_0000001 3300046531 Bacteria 156121
1113 Ga0495665_0049613 3300046531 Bacteria 2225
1114 Ga0495640_0007124 3300046533 Bacteria 8801
1115 Ga0495640_0012179 3300046533 Bacteria 6583
1116 Ga0495640_0023983 3300046533 Bacteria 4438
1117 Ga0495640_0028223 3300046533 Bacteria 4042
1118 Ga0495640_0085615 3300046533 Bacteria 2088
1119 Ga0495586_0078473 3300046535 Bacteria 1812
1120 Ga0495587_0014340 3300046536 Bacteria 4974
1121 Ga0495587_0066633 3300046536 Bacteria 2100
1122 Ga0495587_0209922 3300046536 Bacteria 1100
1123 Ga0495598_0024640 3300046537 Bacteria 1633
1124 Ga0495598_0065662 3300046537 Bacteria 1130
1125 Ga0495609_0147695 3300046538 Bacteria 1001
1126 Ga0495597_0210216 3300046542 Bacteria 776
1127 Ga0495597_0226892 3300046542 Bacteria 740
1128 Ga0495597_0278015 3300046542 Bacteria 653
1129 Ga0495645_0007155 3300046543 Bacteria 7768
1130 Ga0495645_0065908 3300046543 Bacteria 2620
1131 Ga0495645_0159553 3300046543 Bacteria 1560
1132 Ga0495645_0202750 3300046543 Bacteria 1344
1133 Ga0495645_0417019 3300046543 Bacteria 853
1134 Ga0495622_0001363 3300046557 Bacteria 12492
1135 Ga0495622_0008156 3300046557 Bacteria 4853
1136 Ga0495622_0039374 3300046557 Bacteria 2201
1137 Ga0495622_0052657 3300046557 Bacteria 1888
1138 Ga0495667_0006892 3300046559 Bacteria 7715
1139 Ga0495667_0193047 3300046559 Bacteria 1304
1140 Ga0495667_0210400 3300046559 Bacteria 1243
1141 Ga0495668_0082096 3300046616 Bacteria 1768
1142 Ga0495668_0221511 3300046616 Bacteria 1036
1143 Ga0495668_0236868 3300046616 Bacteria 999
1144 Ga0495668_0282928 3300046616 Bacteria 909
1145 Ga0495668_0361799 3300046616 Bacteria 797
1146 Ga0495634_0000046 3300046642 Bacteria 97947
1147 Ga0495611_0037207 3300046648 Bacteria 2162
1148 Ga0495625_0027298 3300046660 Bacteria 4300
1149 Ga0495625_0116759 3300046660 Bacteria 1820
1150 Ga0495625_0168223 3300046660 Bacteria 1465
1151 Ga0495625_0176247 3300046660 Bacteria 1424
1152 Ga0495625_0228992 3300046660 Bacteria 1214
1153 Ga0495625_0356125 3300046660 Bacteria 924
1154 Ga0495625_0526855 3300046660 Bacteria 719
1155 Ga0495625_0655899 3300046660 Bacteria 624
1156 Ga0495635_0000338 3300046663 Bacteria 29955
1157 Ga0495635_0051638 3300046663 Bacteria 2832
1158 Ga0495635_0307369 3300046663 Bacteria 1062
1159 Ga0495635_0407123 3300046663 Bacteria 903
1160 Ga0495635_0438523 3300046663 Bacteria 864
1161 Ga0495659_0009434 3300046664 Bacteria 3114
1162 Ga0495661_0254082 3300046665 Bacteria 896
1163 Ga0495588_0001464 3300046674 Bacteria 10138
1164 Ga0495588_0011004 3300046674 Bacteria 4233
1165 Ga0495588_0112702 3300046674 Bacteria 1433
1166 Ga0495657_0019556 3300046675 Bacteria 4884
1167 Ga0495657_0054792 3300046675 Bacteria 2662
1168 Ga0495599_0021343 3300046678 Bacteria 4039
1169 Ga0495599_0085667 3300046678 Bacteria 1968
1170 Ga0495623_0032327 3300046679 Bacteria 3363
1171 Ga0495623_0108103 3300046679 Bacteria 1688
1172 Ga0495623_0157199 3300046679 Bacteria 1339
1173 Ga0495623_0224266 3300046679 Bacteria 1069
1174 Ga0495646_0008580 3300046680 Bacteria 6490
1175 Ga0495646_0010341 3300046680 Bacteria 5934
1176 Ga0495646_0055725 3300046680 Bacteria 2372
1177 Ga0495647_0000754 3300046681 Bacteria 9612
1178 Ga0495658_0000994 3300046683 Bacteria 14995
1179 Ga0495658_0074262 3300046683 Bacteria 1981
1180 Ga0495658_0145919 3300046683 Bacteria 1450
1181 Ga0495658_0485641 3300046683 Bacteria 790
1182 Ga0495669_0001990 3300046684 Bacteria 8393
1183 Ga0495669_0227003 3300046684 Bacteria 895
1184 Ga0495669_0233449 3300046684 Bacteria 883
1185 Ga0495669_0337156 3300046684 Bacteria 728
1186 Ga0495613_0005517 3300046689 Bacteria 9500
1187 Ga0495613_0086480 3300046689 Bacteria 2273
1188 Ga0495613_0103256 3300046689 Bacteria 2058
1189 Ga0495613_0162469 3300046689 Bacteria 1588
1190 Ga0495624_0003652 3300046690 Bacteria 11380
1191 Ga0495624_0082595 3300046690 Bacteria 1988
1192 Ga0495624_0092157 3300046690 Bacteria 1869
1193 Ga0495624_0230376 3300046690 Bacteria 1122
1194 Ga0495624_0468409 3300046690 Bacteria 755
1195 Ga0495670_0008405 3300046691 Bacteria 5075
1196 Ga0495670_0161747 3300046691 Bacteria 1176
1197 Ga0495671_0159475 3300046692 Bacteria 1097
1198 Ga0495671_0234698 3300046692 Bacteria 887
1199 Ga0495671_0239628 3300046692 Bacteria 876
1200 Ga0495649_0277609 3300046694 Bacteria 856
1201 Ga0495649_0315524 3300046694 Bacteria 794
1202 Ga0495649_0333935 3300046694 Bacteria 768
1203 Ga0495589_0112277 3300046794 Bacteria 1315
1204 Ga0495600_0091391 3300046809 Bacteria 1985
1205 Ga0495600_0247155 3300046809 Bacteria 1135
1206 Ga0495600_0320588 3300046809 Bacteria 975
1207 Ga0495660_0054850 3300046810 Bacteria 2159
1208 Ga0495660_0206592 3300046810 Bacteria 934
1209 Ga0495581_0000012 3300047315 Bacteria 62886
1210 Ga0495581_0080479 3300047315 Bacteria 1886
1211 Ga0495581_0161447 3300047315 Bacteria 1310
1212 Ga0495581_0250556 3300047315 Bacteria 1036
1213 Ga0495581_0299586 3300047315 Bacteria 940
1214 Ga0495581_0544918 3300047315 Bacteria 673
1215 Ga0495604_0004988 3300047317 Bacteria 10511
1216 Ga0495604_0071062 3300047317 Bacteria 2634
1217 Ga0495604_0192614 3300047317 Bacteria 1420
1218 Ga0495604_0208007 3300047317 Bacteria 1353
1219 Ga0495604_0484019 3300047317 Bacteria 804
1220 Ga0495604_0910490 3300047317 Bacteria 549
1221 Ga0495674_0000031 3300047319 Bacteria 115867
1222 Ga0495674_0042923 3300047319 Bacteria 4029
1223 Ga0495674_0049361 3300047319 Bacteria 3719
1224 Ga0495674_0203809 3300047319 Bacteria 1640
1225 Ga0495674_0204370 3300047319 Bacteria 1638
1226 Ga0495674_0213934 3300047319 Bacteria 1596
1227 Ga0495674_0749626 3300047319 Bacteria 763
1228 Ga0495674_0771308 3300047319 Bacteria 750
1229 Ga0495672_0060458 3300047320 Bacteria 2188
1230 Ga0495672_0078591 3300047320 Bacteria 1845
1231 Ga0495672_0104425 3300047320 Bacteria 1531
1232 Ga0495676_0076470 3300047321 Bacteria 2556
1233 Ga0495676_0399032 3300047321 Bacteria 913
1234 Ga0495676_0447583 3300047321 Bacteria 852
1235 Ga0495676_0783887 3300047321 Unclassified 614
1236 Ga0495680_0025139 3300047322 Bacteria 4933
1237 Ga0495680_0110891 3300047322 Bacteria 2033
1238 Ga0495680_0193852 3300047322 Bacteria 1461
1239 Ga0495680_0359808 3300047322 Bacteria 1012
1240 Ga0495680_0521323 3300047322 Bacteria 804
1241 Ga0495683_0083558 3300047323 Bacteria 1555
1242 Ga0495683_0140443 3300047323 Bacteria 1132
1243 Ga0495683_0246511 3300047323 Bacteria 786
1244 Ga0495687_014302 3300047443 Bacteria 4091
1245 Ga0495675_0027294 3300047444 Bacteria 3638
1246 Ga0495675_0132509 3300047444 Bacteria 1548
1247 Ga0495675_0187240 3300047444 Bacteria 1265
1248 Ga0495675_0325266 3300047444 Bacteria 909
1249 Ga0495677_0015930 3300047445 Bacteria 2729
1250 Ga0495677_0046237 3300047445 Bacteria 1598
1251 Ga0495679_022313 3300047446 Bacteria 2169
1252 Ga0495685_143639 3300047447 Bacteria 777
1253 Ga0495685_174451 3300047447 Bacteria 694
1254 Ga0495673_0079869 3300047469 Bacteria 1357
1255 Ga0495673_0121034 3300047469 Bacteria 1037
1256 Ga0495673_0153952 3300047469 Bacteria 887
1257 Ga0495684_0005641 3300047471 Bacteria 9751
1258 Ga0495684_0203441 3300047471 Bacteria 1459
1259 Ga0495684_0230085 3300047471 Bacteria 1356
1260 Ga0495686_0042652 3300047472 Bacteria 2882
1261 Ga0495686_0057595 3300047472 Bacteria 2425
1262 Ga0495686_0210423 3300047472 Bacteria 1111
1263 Ga0495686_0289914 3300047472 Bacteria 907
1264 Ga0495686_0301996 3300047472 Bacteria 883
1265 Ga0495686_0372181 3300047472 Bacteria 772
1266 Ga0495593_0000008 3300047673 Bacteria 87310
1267 Ga0495593_0316927 3300047673 Bacteria 780
1268 Ga0495602_0011752 3300048088 Bacteria 9041
1269 Ga0495602_0064657 3300048088 Bacteria 3161
1270 Ga0495602_0138088 3300048088 Bacteria 1933
1271 Ga0495615_0018473 3300048090 Bacteria 1535
1272 Ga0495615_0034571 3300048090 Bacteria 1231
1273 Ga0495615_0217610 3300048090 Bacteria 595
1274 Ga0495626_0096064 3300048091 Bacteria 1297
1275 Ga0496100_0038138 3300048903 Bacteria 3043
1276 Ga0496100_0057335 3300048903 Bacteria 2551
1277 Ga0496100_0081519 3300048903 Bacteria 2186
1278 Ga0496100_0213578 3300048903 Bacteria 1412
1279 Ga0496100_0591946 3300048903 Bacteria 861
1280 Ga0496101_0006365 3300048904 Bacteria 7599
1281 Ga0496101_0033698 3300048904 Bacteria 3614
1282 Ga0496101_0147253 3300048904 Bacteria 1799
1283 Ga0496101_0235397 3300048904 Bacteria 1424
1284 Ga0496101_0480347 3300048904 Bacteria 981
1285 Ga0496101_0590532 3300048904 Bacteria 878
1286 Ga0496101_1089009 3300048904 Bacteria 627
1287 Ga0496102_0003595 3300048905 Bacteria 13132
1288 Ga0496102_0067964 3300048905 Bacteria 3269
1289 Ga0496102_0100826 3300048905 Bacteria 2682
1290 Ga0496102_0326950 3300048905 Bacteria 1444
1291 Ga0496102_0332893 3300048905 Bacteria 1430
1292 Ga0496102_0402410 3300048905 Bacteria 1287
1293 Ga0496102_0537843 3300048905 Bacteria 1091
1294 Ga0496102_0680337 3300048905 Bacteria 952
1295 Ga0496102_0735010 3300048905 Unclassified 910
1296 Ga0496102_0817436 3300048905 Bacteria 854
1297 Ga0496102_0910493 3300048905 Bacteria 801
1298 Ga0496103_0013766 3300048906 Bacteria 4802
1299 Ga0496103_0086099 3300048906 Bacteria 1981
1300 Ga0496103_0183494 3300048906 Bacteria 1345
1301 Ga0496103_0205021 3300048906 Bacteria 1268
1302 Ga0496103_0317532 3300048906 Bacteria 1002
1303 Ga0496104_0010574 3300048907 Bacteria 8242
1304 Ga0496104_0056792 3300048907 Bacteria 3703
1305 Ga0496104_0080908 3300048907 Bacteria 3097
1306 Ga0496104_0346005 3300048907 Bacteria 1399
1307 Ga0496104_1267733 3300048907 Bacteria 640
1308 Ga0496105_0051555 3300048908 Bacteria 3399
1309 Ga0496105_0183729 3300048908 Bacteria 1711
1310 Ga0496105_0368735 3300048908 Bacteria 1144
1311 Ga0496106_0001857 3300048909 Bacteria 15809
1312 Ga0496106_0029456 3300048909 Bacteria 4091
1313 Ga0496106_0031714 3300048909 Bacteria 3938
1314 Ga0496106_0048244 3300048909 Bacteria 3207
1315 Ga0496106_0098072 3300048909 Bacteria 2270
1316 Ga0496106_0146926 3300048909 Bacteria 1858
1317 Ga0496106_0200627 3300048909 Bacteria 1587
1318 Ga0496106_0414878 3300048909 Bacteria 1082
1319 Ga0496107_0000947 3300048910 Bacteria 17177
1320 Ga0496107_0104673 3300048910 Bacteria 2077
1321 Ga0496107_0173695 3300048910 Bacteria 1599
1322 Ga0496107_0381294 3300048910 Bacteria 1049
1323 Ga0496107_0410120 3300048910 Bacteria 1008
1324 Ga0496107_0462102 3300048910 Bacteria 942
1325 Ga0496107_0546490 3300048910 Bacteria 858
1326 Ga0496108_0013705 3300048911 Bacteria 6616
1327 Ga0496108_0028679 3300048911 Bacteria 4606
1328 Ga0496108_0053689 3300048911 Bacteria 3380
1329 Ga0496108_0136699 3300048911 Bacteria 2109
1330 Ga0496109_0008951 3300048912 Bacteria 8527
1331 Ga0496109_0048452 3300048912 Bacteria 3866
1332 Ga0496109_0220090 3300048912 Bacteria 1785
1333 Ga0496109_0312979 3300048912 Bacteria 1481
1334 Ga0496109_0506901 3300048912 Bacteria 1139
1335 Ga0496109_0559210 3300048912 Bacteria 1079
1336 Ga0496109_1195045 3300048912 Bacteria 697
1337 Ga0496109_1199216 3300048912 Bacteria 696
1338 Ga0496110_0047060 3300048913 Bacteria 3775
1339 Ga0496110_0062445 3300048913 Bacteria 3290
1340 Ga0496110_0132945 3300048913 Bacteria 2247
1341 Ga0496110_0161087 3300048913 Bacteria 2034
1342 Ga0496110_0164218 3300048913 Bacteria 2013
1343 Ga0496110_0498068 3300048913 Bacteria 1109
1344 Ga0496110_1226028 3300048913 Bacteria 659
1345 Ga0496111_0028576 3300048914 Bacteria 3953
1346 Ga0496111_0039323 3300048914 Bacteria 3391
1347 Ga0496111_0107836 3300048914 Bacteria 2051
1348 Ga0496111_0423490 3300048914 Bacteria 983
1349 Ga0496111_0602203 3300048914 Bacteria 804
1350 Ga0496111_0771113 3300048914 Bacteria 697
1351 Ga0496111_0993871 3300048914 Bacteria 601
1352 Ga0496112_0000008 3300048915 Bacteria 310323
1353 Ga0496112_0012760 3300048915 Bacteria 7731
1354 Ga0496112_0110694 3300048915 Bacteria 2716
1355 Ga0496112_0176405 3300048915 Bacteria 2102
1356 Ga0496112_0336783 3300048915 Bacteria 1452
1357 Ga0496112_0338342 3300048915 Bacteria 1448
1358 Ga0496112_0471865 3300048915 Bacteria 1192
1359 Ga0496112_0594801 3300048915 Bacteria 1038
1360 Ga0496113_0001327 3300048916 Bacteria 13676
1361 Ga0496113_0038477 3300048916 Bacteria 3517
1362 Ga0496113_0039228 3300048916 Bacteria 3485
1363 Ga0496113_0060669 3300048916 Bacteria 2852
1364 Ga0496113_0111008 3300048916 Bacteria 2134
1365 Ga0496113_0153794 3300048916 Bacteria 1816
1366 Ga0496114_0021716 3300048917 Bacteria 5225
1367 Ga0496114_0024353 3300048917 Bacteria 4940
1368 Ga0496114_0376999 3300048917 Bacteria 1256
1369 Ga0496114_0633259 3300048917 Bacteria 942
1370 Ga0496114_0712511 3300048917 Bacteria 879
1371 Ga0496114_0818246 3300048917 Bacteria 811
1372 Ga0496115_0000604 3300048918 Bacteria 27391
1373 Ga0496115_0033862 3300048918 Bacteria 4036
1374 Ga0496115_0058271 3300048918 Bacteria 3108
1375 Ga0496115_0065715 3300048918 Bacteria 2930
1376 Ga0496115_0071313 3300048918 Bacteria 2818
1377 Ga0496115_0144469 3300048918 Bacteria 1963
1378 Ga0496115_0278603 3300048918 Bacteria 1373
1379 Ga0496115_0769491 3300048918 Bacteria 751
1380 Ga0496115_0818251 3300048918 Unclassified 724
1381 Ga0496116_0088080 3300048919 Bacteria 1898
1382 Ga0496116_0274032 3300048919 Bacteria 822
1383 Ga0496117_0010071 3300048920 Bacteria 8683
1384 Ga0496117_0093571 3300048920 Bacteria 1927
1385 Ga0496117_0241697 3300048920 Bacteria 991
1386 Ga0496117_0273014 3300048920 Bacteria 910
1387 Ga0496117_0445527 3300048920 Bacteria 641
1388 Ga0496117_0497679 3300048920 Bacteria 592
1389 Ga0496118_0008611 3300048921 Bacteria 10500
1390 Ga0496118_0033891 3300048921 Bacteria 4179
1391 Ga0496118_0095578 3300048921 Bacteria 2028
1392 Ga0496118_0153750 3300048921 Bacteria 1435
1393 Ga0496118_0161367 3300048921 Bacteria 1386
1394 Ga0496118_0193568 3300048921 Bacteria 1213
1395 Ga0496119_0006875 3300048922 Bacteria 10389
1396 Ga0496119_0093315 3300048922 Bacteria 1705
1397 Ga0496119_0117249 3300048922 Bacteria 1468
1398 Ga0496119_0222562 3300048922 Bacteria 965
1399 Ga0496119_0422530 3300048922 Bacteria 632
1400 Ga0496120_0014529 3300048923 Bacteria 5244
1401 Ga0496120_0070618 3300048923 Bacteria 1920
1402 Ga0496121_0002635 3300048924 Bacteria 27038
1403 Ga0496121_0010213 3300048924 Bacteria 10625
1404 Ga0496121_0017920 3300048924 Bacteria 7184
1405 Ga0496121_0020183 3300048924 Bacteria 6613
1406 Ga0496121_0022241 3300048924 Bacteria 6166
1407 Ga0496121_0037977 3300048924 Bacteria 4271
1408 Ga0496121_0062307 3300048924 Bacteria 3056
1409 Ga0496121_0071091 3300048924 Bacteria 2800
1410 Ga0496121_0115405 3300048924 Bacteria 2039
1411 Ga0496121_0126057 3300048924 Bacteria 1924
1412 Ga0496121_0195694 3300048924 Bacteria 1445
1413 Ga0496121_0224795 3300048924 Bacteria 1319
1414 Ga0496121_0237789 3300048924 Bacteria 1271
1415 Ga0496121_0263104 3300048924 Bacteria 1190
1416 Ga0496121_0348525 3300048924 Bacteria 987
1417 Ga0496121_0651957 3300048924 Bacteria 641
1418 Ga0496121_0801137 3300048924 Bacteria 554
1419 Ga0496122_0018275 3300048925 Bacteria 6489
1420 Ga0496122_0049838 3300048925 Bacteria 3200
1421 Ga0496122_0282027 3300048925 Bacteria 907
1422 Ga0496123_0022282 3300048926 Bacteria 4888
1423 Ga0496123_0335761 3300048926 Bacteria 708
1424 Ga0496124_0011581 3300048927 Bacteria 8801
1425 Ga0496124_0137659 3300048927 Bacteria 1931
1426 Ga0496124_0263152 3300048927 Bacteria 1268
1427 Ga0496124_0346105 3300048927 Bacteria 1053
1428 Ga0496124_0830069 3300048927 Bacteria 569
1429 Ga0496125_0000048 3300048928 Bacteria 290651
1430 Ga0496125_0000746 3300048928 Bacteria 53671
1431 Ga0496125_0004827 3300048928 Bacteria 15320
1432 Ga0496125_0071057 3300048928 Bacteria 2721
1433 Ga0496125_0076359 3300048928 Bacteria 2587
1434 Ga0496125_0131030 3300048928 Bacteria 1765
1435 Ga0496125_0219108 3300048928 Bacteria 1228
1436 Ga0496126_0002122 3300048929 Bacteria 27701
1437 Ga0496126_0008677 3300048929 Bacteria 10918
1438 Ga0496126_0009242 3300048929 Bacteria 10508
1439 Ga0496126_0038000 3300048929 Bacteria 4482
1440 Ga0496126_0066191 3300048929 Bacteria 3231
1441 Ga0496126_0073717 3300048929 Bacteria 3034
1442 Ga0496126_0108022 3300048929 Bacteria 2426
1443 Ga0496126_0117860 3300048929 Bacteria 2306
1444 Ga0496126_0118073 3300048929 Bacteria 2303
1445 Ga0496126_0157082 3300048929 Bacteria 1946
1446 Ga0496126_0173025 3300048929 Bacteria 1838
1447 Ga0496126_0204271 3300048929 Bacteria 1666
1448 Ga0496126_0235255 3300048929 Bacteria 1533
1449 Ga0496126_0244448 3300048929 Bacteria 1498
1450 Ga0496126_0250513 3300048929 Bacteria 1476
1451 Ga0496126_0301634 3300048929 Bacteria 1321
1452 Ga0496126_0422747 3300048929 Bacteria 1077
1453 Ga0496126_0423249 3300048929 Bacteria 1076
1454 Ga0496126_0683564 3300048929 Bacteria 799
1455 Ga0496126_0698614 3300048929 Bacteria 788
1456 Ga0496126_0888035 3300048929 Bacteria 677
1457 Ga0496126_1010822 3300048929 Bacteria 623
1458 Ga0495682_0018342 3300049460 Bacteria 2636
1459 Ga0501036_0114702 3300049572 Bacteria 2277
1460 Ga0501040_0089179 3300049576 Bacteria 2143
1461 Ga0501041_0432056 3300049577 Bacteria 835
1462 Ga0501047_0699862 3300049581 Bacteria 831
1463 Ga0501067_0099416 3300049583 Bacteria 1616
1464 Ga0501067_0174653 3300049583 Bacteria 1197
1465 Ga0501067_0282238 3300049583 Bacteria 925
1466 Ga0501073_0465433 3300049589 Bacteria 874
1467 Ga0501074_0083579 3300049590 Bacteria 2289
1468 Ga0501080_0760834 3300049742 Bacteria 851
1469 Ga0501241_071706 3300049758 Bacteria 709
1470 Ga0501044_0454083 3300049823 Bacteria 1188
1471 nmdc:mga03n38_112793_c1 3300050490 Bacteria 1326
1472 nmdc:mga03n38_1351_c1 3300050490 Bacteria 6942
1473 nmdc:mga03n38_178693_c1 3300050490 Bacteria 1086
1474 nmdc:mga03n38_260384_c1 3300050490 Bacteria 919
1475 nmdc:mga03n38_377530_c1 3300050490 Bacteria 776
1476 nmdc:mga00v17_242288_c1 3300050491 Bacteria 1169
1477 nmdc:mga00v17_4146_c1 3300050491 Bacteria 7505
1478 nmdc:mga00v17_648651_c1 3300050491 Bacteria 679
1479 nmdc:mga0yw44_111096_c1 3300050492 Bacteria 1756
1480 nmdc:mga0yw44_139702_c1 3300050492 Bacteria 1573
1481 nmdc:mga0yw44_16709_c1 3300050492 Bacteria 3973
1482 nmdc:mga0yw44_18431_c1 3300050492 Bacteria 3823
1483 nmdc:mga0yw44_263826_c1 3300050492 Bacteria 1148
1484 nmdc:mga0yw44_452661_c1 3300050492 Bacteria 870
1485 nmdc:mga0yw44_47972_c1 3300050492 Bacteria 2574
1486 nmdc:mga0yw44_5233_c1 3300050492 Bacteria 6085
1487 nmdc:mga0yw44_907756_c1 3300050492 Bacteria 597
1488 nmdc:mga0yw44_99641_c1 3300050492 Bacteria 1849
1489 nmdc:mga0k408_188649_c1 3300050493 Bacteria 1230
1490 nmdc:mga0k408_200248_c1 3300050493 Bacteria 1192
1491 nmdc:mga0k408_444816_c1 3300050493 Bacteria 770
1492 nmdc:mga06z11_15389_c1 3300050494 Bacteria 3414
1493 nmdc:mga06z11_220266_c1 3300050494 Bacteria 1109
1494 nmdc:mga06z11_319944_c1 3300050494 Bacteria 925
1495 nmdc:mga06z11_61386_c1 3300050494 Bacteria 1960
1496 nmdc:mga06z11_93936_c1 3300050494 Bacteria 1634
1497 nmdc:mga04h51_35189_c1 3300050495 Bacteria 1604
1498 nmdc:mga07m45_42075_c1 3300050496 Bacteria 2560
1499 nmdc:mga07m45_44129_c1 3300050496 Bacteria 2501
1500 nmdc:mga07m45_554131_c1 3300050496 Bacteria 665
1501 nmdc:mga05p37_40049_c1 3300050507 Bacteria 5754
1502 nmdc:mga05p37_921676_c1 3300050507 Bacteria 939
1503 nmdc:mga06r32_1126713_c1 3300050510 Bacteria 733
1504 nmdc:mga08y16_261869_c1 3300050511 Bacteria 1786
1505 nmdc:mga08y16_347781_c1 3300050511 Bacteria 1523
1506 nmdc:mga0n895_454902_c1 3300050512 Bacteria 1292
1507 nmdc:mga0n895_743716_c1 3300050512 Bacteria 974
1508 nmdc:mga0rr50_102280_c1 3300050513 Bacteria 2253
1509 nmdc:mga0rr50_472736_c1 3300050513 Bacteria 1064
1510 nmdc:mga0a205_606513_c1 3300050515 Bacteria 947
1511 nmdc:mga0sz30_110075_c1 3300050516 Bacteria 1207
1512 nmdc:mga0sz30_176394_c1 3300050516 Bacteria 948
1513 nmdc:mga0sz30_20155_c1 3300050516 Bacteria 2688
1514 Ga0495601_0035469 3300053077 Bacteria 3114
1515 Ga0495601_0303104 3300053077 Bacteria 1040
1516 Ga0495612_0026650 3300053078 Bacteria 2323
1517 Ga0495612_0146753 3300053078 Unclassified 1025
1518 Ga0500610_0115212 3300053079 Bacteria 1378
1519 Ga0495655_0018190 3300053083 Bacteria 1541
1520 Ga0495655_0112480 3300053083 Bacteria 820
1521 Ga0495595_0009899 3300053084 Bacteria 3952
1522 Ga0495595_0031623 3300053084 Bacteria 2380
1523 Ga0495619_0001789 3300053085 Bacteria 14292
1524 Ga0495619_0017972 3300053085 Bacteria 4484
1525 Ga0495619_0022726 3300053085 Bacteria 4016
1526 Ga0495619_0046671 3300053085 Bacteria 2849
1527 Ga0495619_0297903 3300053085 Unclassified 1117
1528 Ga0495619_0424691 3300053085 Bacteria 917
1529 Ga0500578_0140992 3300053086 Bacteria 1507
1530 Ga0500578_0235380 3300053086 Bacteria 1108
1531 Ga0500578_0375011 3300053086 Bacteria 826
1532 Ga0500578_0505167 3300053086 Bacteria 679
1533 Ga0500643_000150 3300053087 Bacteria 71016
1534 Ga0500581_034767 3300053089 Bacteria 2580
1535 Ga0500646_0012699 3300053090 Bacteria 2176
1536 Ga0500583_0078053 3300053092 Bacteria 1595
1537 Ga0500583_0279806 3300053092 Bacteria 819
1538 Ga0500651_0035391 3300053093 Bacteria 3146
1539 Ga0500651_0095797 3300053093 Bacteria 1824
1540 Ga0500651_0378594 3300053093 Bacteria 798
1541 Ga0500566_0000011 3300053094 Bacteria 118644
1542 Ga0500566_0000293 3300053094 Bacteria 26861
1543 Ga0500566_0001917 3300053094 Bacteria 12244
1544 Ga0500640_001527 3300053095 Bacteria 7094
1545 Ga0500640_077058 3300053095 Bacteria 1421
1546 Ga0500640_246080 3300053095 Bacteria 579
1547 Ga0500641_0007243 3300053096 Bacteria 3954
1548 Ga0500641_0027854 3300053096 Bacteria 2202
1549 Ga0500641_0034843 3300053096 Bacteria 2006
1550 Ga0500641_0207397 3300053096 Bacteria 835
1551 Ga0500641_0351311 3300053096 Bacteria 592
1552 Ga0500650_0000747 3300053098 Bacteria 8809
1553 Ga0500650_0064410 3300053098 Bacteria 1713
1554 Ga0500650_0120302 3300053098 Bacteria 1224
1555 Ga0500650_0251301 3300053098 Bacteria 793
1556 Ga0500554_004219 3300053102 Bacteria 3025
1557 Ga0500555_001186 3300053103 Bacteria 8535
1558 Ga0500556_0000003 3300053104 Bacteria 679379
1559 Ga0500556_0011102 3300053104 Bacteria 2660
1560 Ga0500557_000062 3300053105 Bacteria 43893
1561 Ga0500562_027854 3300053108 Bacteria 1483
1562 Ga0500562_051985 3300053108 Bacteria 1096
1563 Ga0500562_076549 3300053108 Bacteria 904
1564 Ga0500572_000065 3300053111 Bacteria 32713
1565 Ga0500572_001006 3300053111 Bacteria 8512
1566 Ga0500572_041328 3300053111 Bacteria 1338
1567 Ga0500582_086196 3300053114 Bacteria 1083
1568 Ga0500592_002557 3300053116 Bacteria 2918
1569 Ga0500593_156178 3300053117 Bacteria 878
1570 Ga0500595_000395 3300053119 Bacteria 28044
1571 Ga0500595_000496 3300053119 Bacteria 24015
1572 Ga0500595_016246 3300053119 Bacteria 2776
1573 Ga0500595_016839 3300053119 Bacteria 2714
1574 Ga0500595_030732 3300053119 Bacteria 1807
1575 Ga0500607_022647 3300053121 Bacteria 3529
1576 Ga0500607_101781 3300053121 Bacteria 1425
1577 Ga0500608_051222 3300053122 Bacteria 1983
1578 Ga0500614_003255 3300053123 Bacteria 3514
1579 Ga0500614_018221 3300053123 Bacteria 1595
1580 Ga0500621_155658 3300053126 Bacteria 853
1581 Ga0500621_221152 3300053126 Bacteria 656
1582 Ga0500626_033792 3300053128 Bacteria 2311
1583 Ga0500642_0000006 3300053130 Bacteria 350064
1584 Ga0500642_0000127 3300053130 Bacteria 34341
1585 Ga0500642_0042964 3300053130 Bacteria 1962
1586 Ga0500642_0168026 3300053130 Bacteria 1027
1587 Ga0500642_0296984 3300053130 Bacteria 730
1588 Ga0500652_002025 3300053131 Bacteria 6100
1589 Ga0500655_011686 3300053133 Bacteria 1593
1590 Ga0500658_0215062 3300053134 Bacteria 880
1591 Ga0500658_0233060 3300053134 Bacteria 845
1592 Ga0500658_0400032 3300053134 Bacteria 628
1593 Ga0500559_0000308 3300053136 Bacteria 37080
1594 Ga0500559_0001798 3300053136 Bacteria 11758
1595 Ga0500559_0077325 3300053136 Bacteria 1507
1596 Ga0500559_0094578 3300053136 Bacteria 1371
1597 Ga0500559_0310354 3300053136 Bacteria 740
1598 Ga0500559_0328608 3300053136 Bacteria 716
1599 Ga0500561_0253713 3300053137 Bacteria 560
1600 Ga0500568_0000856 3300053139 Bacteria 21406
1601 Ga0500577_0000070 3300053142 Bacteria 23258
1602 Ga0500577_0115812 3300053142 Bacteria 1111
1603 Ga0500577_0314212 3300053142 Bacteria 684
1604 Ga0500577_0317177 3300053142 Bacteria 681
1605 Ga0500585_125663 3300053144 Bacteria 912
1606 Ga0500586_058255 3300053145 Bacteria 1341
1607 Ga0500589_080197 3300053147 Bacteria 1459
1608 Ga0500590_054988 3300053148 Bacteria 2014
1609 Ga0500590_108729 3300053148 Bacteria 1319
1610 Ga0500590_206896 3300053148 Bacteria 824
1611 Ga0500603_000269 3300053150 Bacteria 13789
1612 Ga0500603_006349 3300053150 Bacteria 2567
1613 Ga0500603_223630 3300053150 Bacteria 601
1614 Ga0500604_0003912 3300053151 Bacteria 3978
1615 Ga0500604_0018478 3300053151 Bacteria 1943
1616 Ga0500604_0162847 3300053151 Bacteria 760
1617 Ga0500616_0000033 3300053153 Bacteria 398830
1618 Ga0500616_0042038 3300053153 Bacteria 2449
1619 Ga0500620_016390 3300053155 Bacteria 2117
1620 Ga0500622_0003447 3300053156 Bacteria 10553
1621 Ga0500622_0062318 3300053156 Bacteria 1899
1622 Ga0500622_0063763 3300053156 Bacteria 1875
1623 Ga0500622_0074084 3300053156 Bacteria 1716
1624 Ga0500622_0150890 3300053156 Bacteria 1099
1625 Ga0500624_007439 3300053157 Bacteria 1507
1626 Ga0500627_0018363 3300053158 Bacteria 2767
1627 Ga0500627_0026749 3300053158 Bacteria 2385
1628 Ga0500627_0039239 3300053158 Bacteria 2027
1629 Ga0500627_0247020 3300053158 Bacteria 790
1630 Ga0500630_000832 3300053159 Bacteria 14267
1631 Ga0500634_0143873 3300053161 Bacteria 1125
1632 Ga0500638_000370 3300053162 Bacteria 10477
1633 Ga0500638_015393 3300053162 Bacteria 3509
1634 Ga0500638_022359 3300053162 Bacteria 2996
1635 Ga0500639_000079 3300053163 Bacteria 45631
1636 Ga0500639_004522 3300053163 Bacteria 7069
1637 Ga0500639_028570 3300053163 Bacteria 2947
1638 Ga0500639_178108 3300053163 Bacteria 944
1639 Ga0500636_0000041 3300053177 Bacteria 69687
1640 Ga0500636_0005812 3300053177 Bacteria 7062
1641 Ga0500636_0053870 3300053177 Bacteria 2360
1642 Ga0500636_0088163 3300053177 Bacteria 1780
1643 Ga0500636_0171883 3300053177 Bacteria 1171
1644 Ga0500636_0207473 3300053177 Bacteria 1031
1645 Ga0500637_0000026 3300053178 Bacteria 59050
1646 Ga0500637_0056548 3300053178 Bacteria 2241
1647 Ga0500637_0079586 3300053178 Bacteria 1892
1648 Ga0500637_0082391 3300053178 Bacteria 1859
1649 Ga0500637_0103093 3300053178 Bacteria 1654
1650 Ga0500637_0239292 3300053178 Bacteria 1018
1651 Ga0500637_0274419 3300053178 Bacteria 931
1652 Ga0500637_0391727 3300053178 Bacteria 725
1653 Ga0500649_188904 3300053722 Bacteria 684
1654 Ga0500576_001460 3300053725 Bacteria 7974
1655 Ga0500576_089743 3300053725 Bacteria 1279
1656 Ga0500611_050523 3300053727 Bacteria 951
1657 Ga0500611_099126 3300053727 Bacteria 752
1658 Ga0500645_010714 3300053730 Bacteria 3018
1659 Ga0500645_018852 3300053730 Bacteria 2151
1660 Ga0500645_035199 3300053730 Bacteria 1492
1661 Ga0500609_024025 3300053731 Bacteria 835
1662 Ga0500596_000987 3300053735 Bacteria 5689
1663 Ga0500596_005660 3300053735 Bacteria 2174
1664 Ga0500596_014937 3300053735 Bacteria 1167
1665 Ga0500599_018322 3300053736 Bacteria 978
1666 Ga0500601_000306 3300053737 Bacteria 9164
1667 Ga0500661_001127 3300055283 Bacteria 5003
1668 Ga0500661_011645 3300055283 Bacteria 1589
1669 Ga0500661_032566 3300055283 Bacteria 920
1670 Ga0501082_1175165 3300060353 Bacteria 671
1671 Ga0501082_1273804 3300060353 Bacteria 642
1672 Ga0466962_0232804 3300061719 Bacteria 903

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009553 Ga0105249_12073413 Ga0105249_120734132 147
2 3300035113 Ga0373936_0157833 Ga0373936_0157833_27_473 148
3 iso_pu_bacteria 2513237094 2513636904 148
4 iso_pu_bacteria 2513237104 2513721519 148
5 iso_pu_bacteria 2932794094 2932799649 148
6 iso_pu_bacteria 2932801729 2932808763 148
7 iso_pu_bacteria 2935883170 2935885693 148
8 iso_pu_bacteria 3005594810 3005600527 148
9 iso_pu_bacteria 8019648815 8019649595 148
10 iso_pu_bacteria 2667528175 2671123241 149
11 iso_pu_bacteria 2885374607 2885378215 149
12 iso_pu_bacteria 2908739725 2908741475 149
13 3300009551 Ga0105238_11568038 Ga0105238_115680381 150
14 3300010375 Ga0105239_11055342 Ga0105239_110553422 150
15 3300031238 Ga0265332_10252158 Ga0265332_102521581 150
16 3300041460 Ga0451802_1139949 Ga0451802_1139949_33_515 150
17 iso_pu_bacteria 2513237096 2513657141 150
18 iso_pu_bacteria 2513237137 2513857029 150
19 iso_pu_bacteria 2513237145 2513919149 150
20 iso_pu_bacteria 2517572143 2517891157 150
21 iso_pu_bacteria 2524023228 2524533659 150
22 iso_pu_bacteria 2791355197 2793066500 150
23 iso_pu_bacteria 2903748898 2903752224 150
24 iso_pu_bacteria 2904699407 2904701036 150
25 iso_pu_bacteria 2906610324 2906616337 150
26 iso_pu_bacteria 2906635258 2906641542 150
27 iso_pu_bacteria 2906660503 2906662880 150
28 iso_pu_bacteria 2922425934 2922431665 150
29 iso_pu_bacteria 3005474847 3005481464 150
30 iso_pu_bacteria 8006933436 8006939253 150
31 iso_pu_bacteria 8006973647 8006978911 150
32 iso_pu_bacteria 8019555841 8019565114 150
33 iso_pu_bacteria 8019565922 8019575216 150
34 iso_pu_bacteria 2507262055 2507507461 151
35 iso_pu_bacteria 2508501009 2508541575 151
36 iso_pu_bacteria 2508501042 2508692882 151
37 iso_pu_bacteria 2511231028 2511398977 151
38 iso_pu_bacteria 2513237095 2513651151 151
39 iso_pu_bacteria 2513237102 2513700650 151
40 iso_pu_bacteria 2513237139 2513878360 151
41 iso_pu_bacteria 2513237161 2514011713 151
42 iso_pu_bacteria 2515154112 2515626272 151
43 iso_pu_bacteria 2517093001 2517107854 151
44 iso_pu_bacteria 2524023205 2524436078 151
45 iso_pu_bacteria 2528768022 2528852875 151
46 iso_pu_bacteria 2617270735 2617352716 151
47 iso_pu_bacteria 2744054633 2745080022 151
48 iso_pu_bacteria 2791355196 2793061083 151
49 iso_pu_bacteria 2802429603 2805920583 151
50 iso_pu_bacteria 2816332527 2818236769 151
51 iso_pu_bacteria 2824609381 2824611776 151
52 iso_pu_bacteria 2824617872 2824622033 151
53 iso_pu_bacteria 2824626560 2824629297 151
54 iso_pu_bacteria 2824635225 2824639170 151
55 iso_pu_bacteria 2824644064 2824652639 151
56 iso_pu_bacteria 2824653114 2824655012 151
57 iso_pu_bacteria 2824661429 2824664033 151
58 iso_pu_bacteria 2824671348 2824675201 151
59 iso_pu_bacteria 2824696289 2824701152 151
60 iso_pu_bacteria 2824704595 2824711113 151
61 iso_pu_bacteria 2824714736 2824723189 151
62 iso_pu_bacteria 2824723954 2824731759 151
63 iso_pu_bacteria 2824753945 2824760452 151
64 iso_pu_bacteria 2824763712 2824766559 151
65 iso_pu_bacteria 2824773399 2824776679 151
66 iso_pu_bacteria 2838122688 2838127371 151
67 iso_pu_bacteria 2841941048 2841946390 151
68 iso_pu_bacteria 2841949485 2841957109 151
69 iso_pu_bacteria 2841957949 2841965631 151
70 iso_pu_bacteria 2841966195 2841972900 151
71 iso_pu_bacteria 2841974524 2841978428 151
72 iso_pu_bacteria 2841983080 2841987470 151
73 iso_pu_bacteria 2844315083 2844320214 151
74 iso_pu_bacteria 2847930680 2847937536 151
75 iso_pu_bacteria 2847939898 2847947964 151
76 iso_pu_bacteria 2849076700 2849078188 151
77 iso_pu_bacteria 2857509624 2857511349 151
78 iso_pu_bacteria 2874590934 2874598577 151
79 iso_pu_bacteria 2874612657 2874616762 151
80 iso_pu_bacteria 2874620515 2874628288 151
81 iso_pu_bacteria 2874628541 2874630115 151
82 iso_pu_bacteria 2874645413 2874652030 151
83 iso_pu_bacteria 2876771140 2876778615 151
84 iso_pu_bacteria 2876818435 2876823420 151
85 iso_pu_bacteria 2879074833 2879082408 151
86 iso_pu_bacteria 2879083081 2879084949 151
87 iso_pu_bacteria 2879099564 2879107932 151
88 iso_pu_bacteria 2879127579 2879131811 151
89 iso_pu_bacteria 2879142872 2879150147 151
90 iso_pu_bacteria 2881364244 2881370116 151
91 iso_pu_bacteria 2881665667 2881670116 151
92 iso_pu_bacteria 2885366525 2885370181 151
93 iso_pu_bacteria 2885409591 2885414372 151
94 iso_pu_bacteria 2888378607 2888385692 151
95 iso_pu_bacteria 2888419890 2888425815 151
96 iso_pu_bacteria 2903727486 2903731196 151
97 iso_pu_bacteria 2904666416 2904674093 151
98 iso_pu_bacteria 2904711408 2904711743 151
99 iso_pu_bacteria 2906602504 2906610037 151
100 iso_pu_bacteria 2906626472 2906629222 151
101 iso_pu_bacteria 2906643746 2906651215 151
102 iso_pu_bacteria 2922368715 2922375939 151
103 iso_pu_bacteria 2929615660 2929621252 151
104 iso_pu_bacteria 2929624759 2929625917 151
105 iso_pu_bacteria 2932784394 2932785198 151
106 iso_pu_bacteria 2932809354 2932810232 151
107 iso_pu_bacteria 2932818245 2932821804 151
108 iso_pu_bacteria 2932828146 2932829034 151
109 iso_pu_bacteria 2933577622 2933582879 151
110 iso_pu_bacteria 2935608549 2935610035 151
111 iso_pu_bacteria 2935616580 2935619546 151
112 iso_pu_bacteria 2935638405 2935638526 151
113 iso_pu_bacteria 2935648319 2935656355 151
114 iso_pu_bacteria 2935656913 2935660089 151
115 iso_pu_bacteria 2935665750 2935666622 151
116 iso_pu_bacteria 2935675223 2935682188 151
117 iso_pu_bacteria 2935684952 2935691156 151
118 iso_pu_bacteria 2935694250 2935694419 151
119 iso_pu_bacteria 2935703347 2935703532 151
120 iso_pu_bacteria 2935713505 2935718537 151
121 iso_pu_bacteria 2935722832 2935727483 151
122 iso_pu_bacteria 2935732158 2935736186 151
123 iso_pu_bacteria 2935741537 2935745566 151
124 iso_pu_bacteria 2935750917 2935755947 151
125 iso_pu_bacteria 2935760218 2935760791 151
126 iso_pu_bacteria 2935769743 2935776446 151
127 iso_pu_bacteria 2935777560 2935780839 151
128 iso_pu_bacteria 2935785616 2935792329 151
129 iso_pu_bacteria 2935793552 2935800496 151
130 iso_pu_bacteria 2935801545 2935801669 151
131 iso_pu_bacteria 2935810662 2935814921 151
132 iso_pu_bacteria 2935819856 2935823195 151
133 iso_pu_bacteria 2935827899 2935828020 151
134 iso_pu_bacteria 2935837841 2935842226 151
135 iso_pu_bacteria 2935847175 2935848777 151
136 iso_pu_bacteria 2935855204 2935858138 151
137 iso_pu_bacteria 2935864058 2935868043 151
138 iso_pu_bacteria 2935873716 2935873934 151
139 iso_pu_bacteria 2935908558 2935909421 151
140 iso_pu_bacteria 2935916978 2935917143 151
141 iso_pu_bacteria 2935926038 2935926902 151
142 iso_pu_bacteria 2935934488 2935937254 151
143 iso_pu_bacteria 2935942939 2935944443 151
144 iso_pu_bacteria 2935951376 2935952880 151
145 iso_pu_bacteria 2935967501 2935969720 151
146 iso_pu_bacteria 2935975950 2935976331 151
147 iso_pu_bacteria 2935984226 2935991828 151
148 iso_pu_bacteria 2935992306 2935993142 151
149 iso_pu_bacteria 2936002035 2936003079 151
150 iso_pu_bacteria 2936011229 2936014505 151
151 iso_pu_bacteria 2936019824 2936027828 151
152 iso_pu_bacteria 2936028420 2936031298 151
153 iso_pu_bacteria 2936037263 2936040436 151
154 iso_pu_bacteria 2936046547 2936049611 151
155 iso_pu_bacteria 2936055302 2936061173 151
156 iso_pu_bacteria 2940556831 2940562078 151
157 iso_pu_bacteria 2941531003 2941531404 151
158 iso_pu_bacteria 2941538514 2941542274 151
159 iso_pu_bacteria 3005483717 3005488444 151
160 iso_pu_bacteria 3005506211 3005508229 151
161 iso_pu_bacteria 3005587118 3005588269 151
162 iso_pu_bacteria 3005710791 3005716001 151
163 iso_pu_bacteria 8016511872 8016520427 151
164 iso_pu_bacteria 8016522445 8016528499 151
165 iso_pu_bacteria 8016530956 8016533658 151
166 iso_pu_bacteria 8016539877 8016546880 151
167 iso_pu_bacteria 8016548790 8016555239 151
168 iso_pu_bacteria 8016557553 8016563601 151
169 iso_pu_bacteria 8016566248 8016571988 151
170 iso_pu_bacteria 8016583857 8016594600 151
171 iso_pu_bacteria 8016595262 8016601336 151
172 iso_pu_bacteria 8016603502 8016609094 151
173 iso_pu_bacteria 8016622563 8016625423 151
174 iso_pu_bacteria 8016630954 8016638948 151
175 iso_pu_bacteria 8017057580 8017065148 151
176 iso_pu_bacteria 8019530166 8019533438 151
177 iso_pu_bacteria 8019538911 8019546238 151
178 iso_pu_bacteria 8019547302 8019552470 151
179 iso_pu_bacteria 8019576017 8019584538 151
180 iso_pu_bacteria 8019586578 8019592311 151
181 iso_pu_bacteria 8019597564 8019598976 151
182 iso_pu_bacteria 8019608314 8019609401 151
183 iso_pu_bacteria 8019619141 8019620024 151
184 iso_pu_bacteria 8019638758 8019646821 151
185 iso_pu_bacteria 8019659431 8019660962 151
186 iso_pu_bacteria 8019668869 8019670522 151
187 iso_pu_bacteria 8019678201 8019685710 151
188 iso_pu_bacteria 8019687851 8019691287 151
189 iso_pu_bacteria 8055742211 8055744887 151
190 iso_pu_bacteria 8056967851 8056974856 151
191 3300003203 JGI25406J46586_10014944 JGI25406J46586_100149443 152
192 3300003322 rootL2_10146216 rootL2_101462162 152
193 3300003659 JGI25404J52841_10000288 JGI25404J52841_100002883 152
194 3300003659 JGI25404J52841_10000871 JGI25404J52841_100008713 152
195 3300003659 JGI25404J52841_10007910 JGI25404J52841_100079103 152
196 3300003659 JGI25404J52841_10008582 JGI25404J52841_100085824 152
197 3300005327 Ga0070658_10647016 Ga0070658_106470162 152
198 3300005539 Ga0068853_100244915 Ga0068853_1002449153 152
199 3300005578 Ga0068854_100649236 Ga0068854_1006492362 152
200 3300005615 Ga0070702_101798201 Ga0070702_1017982011 152
201 3300005937 Ga0081455_10005955 Ga0081455_1000595512 152
202 3300005937 Ga0081455_10030485 Ga0081455_100304853 152
203 3300005937 Ga0081455_10080661 Ga0081455_100806612 152
204 3300005937 Ga0081455_10456688 Ga0081455_104566881 152
205 3300005983 Ga0081540_1003418 Ga0081540_10034184 152
206 3300005983 Ga0081540_1003851 Ga0081540_10038515 152
207 3300005983 Ga0081540_1012000 Ga0081540_10120007 152
208 3300005983 Ga0081540_1021006 Ga0081540_10210064 152
209 3300005983 Ga0081540_1021049 Ga0081540_10210494 152
210 3300005983 Ga0081540_1035588 Ga0081540_10355884 152
211 3300005983 Ga0081540_1043950 Ga0081540_10439502 152
212 3300005983 Ga0081540_1088921 Ga0081540_10889212 152
213 3300005983 Ga0081540_1230772 Ga0081540_12307722 152
214 3300005983 Ga0081540_1231189 Ga0081540_12311892 152
215 3300005985 Ga0081539_10000220 Ga0081539_1000022058 152
216 3300006353 Ga0075370_10251729 Ga0075370_102517292 152
217 3300006871 Ga0075434_100642083 Ga0075434_1006420832 152
218 3300009093 Ga0105240_10021941 Ga0105240_100219412 152
219 3300009098 Ga0105245_10461621 Ga0105245_104616213 152
220 3300009147 Ga0114129_10368158 Ga0114129_103681582 152
221 3300009174 Ga0105241_10050318 Ga0105241_100503184 152
222 3300010375 Ga0105239_10066752 Ga0105239_100667524 152
223 3300010375 Ga0105239_10139452 Ga0105239_101394523 152
224 3300025261 Ga0209233_1026199 Ga0209233_10261991 152
225 3300025297 Ga0209758_1002848 Ga0209758_100284810 152
226 3300025913 Ga0207695_10000163 Ga0207695_100001638 152
227 3300025914 Ga0207671_10058973 Ga0207671_100589733 152
228 3300025945 Ga0207679_10621109 Ga0207679_106211092 152
229 3300026041 Ga0207639_11024210 Ga0207639_110242102 152
230 3300026142 Ga0207698_10432956 Ga0207698_104329562 152
231 3300034818 Ga0373950_0135823 Ga0373950_0135823_38_496 152
232 3300035691 Ga0373931_0341514 Ga0373931_0341514_445_903 152
233 3300045051 Ga0451576_0002188 Ga0451576_0002188_15647_16105 152
234 3300045051 Ga0451576_0125392 Ga0451576_0125392_1093_1551 152
235 3300046454 Ga0495592_0207253 Ga0495592_0207253_405_863 152
236 3300046459 Ga0495629_0636485 Ga0495629_0636485_64_522 152
237 3300046511 Ga0495608_0642976 Ga0495608_0642976_16_474 152
238 3300046516 Ga0495628_0307226 Ga0495628_0307226_192_650 152
239 3300046529 Ga0495652_0155483 Ga0495652_0155483_137_595 152
240 3300046533 Ga0495640_0085615 Ga0495640_0085615_368_826 152
241 3300046557 Ga0495622_0039374 Ga0495622_0039374_260_718 152
242 3300046616 Ga0495668_0221511 Ga0495668_0221511_126_584 152
243 3300046684 Ga0495669_0337156 Ga0495669_0337156_257_715 152
244 3300046690 Ga0495624_0082595 Ga0495624_0082595_398_856 152
245 3300047315 Ga0495581_0299586 Ga0495581_0299586_44_502 152
246 3300047317 Ga0495604_0484019 Ga0495604_0484019_183_641 152
247 3300047321 Ga0495676_0076470 Ga0495676_0076470_143_601 152
248 3300047469 Ga0495673_0153952 Ga0495673_0153952_340_798 152
249 3300047471 Ga0495684_0203441 Ga0495684_0203441_856_1314 152
250 3300047472 Ga0495686_0210423 Ga0495686_0210423_562_1020 152
251 3300048904 Ga0496101_0480347 Ga0496101_0480347_352_810 152
252 3300048907 Ga0496104_0010574 Ga0496104_0010574_1763_2221 152
253 3300048908 Ga0496105_0183729 Ga0496105_0183729_653_1111 152
254 3300048916 Ga0496113_0060669 Ga0496113_0060669_1490_1948 152
255 3300048917 Ga0496114_0712511 Ga0496114_0712511_312_770 152
256 3300048918 Ga0496115_0058271 Ga0496115_0058271_1333_1791 152
257 3300048921 Ga0496118_0193568 Ga0496118_0193568_305_763 152
258 3300048922 Ga0496119_0006875 Ga0496119_0006875_3799_4257 152
259 3300048923 Ga0496120_0014529 Ga0496120_0014529_983_1441 152
260 3300048925 Ga0496122_0282027 Ga0496122_0282027_82_540 152
261 3300048927 Ga0496124_0346105 Ga0496124_0346105_208_666 152
262 3300048929 Ga0496126_0301634 Ga0496126_0301634_65_523 152
263 3300049583 Ga0501067_0282238 Ga0501067_0282238_134_592 152
264 3300049589 Ga0501073_0465433 Ga0501073_0465433_323_781 152
265 3300050507 nmdc:mga05p37_921676_c1 nmdc:mga05p37_921676_c1_223_681 152
266 3300050512 nmdc:mga0n895_454902_c1 nmdc:mga0n895_454902_c1_472_930 152
267 3300050512 nmdc:mga0n895_743716_c1 nmdc:mga0n895_743716_c1_373_831 152
268 3300053095 Ga0500640_246080 Ga0500640_246080_107_565 152
269 3300053119 Ga0500595_016246 Ga0500595_016246_1680_2138 152
270 3300053136 Ga0500559_0328608 Ga0500559_0328608_18_476 152
271 3300053178 Ga0500637_0274419 Ga0500637_0274419_280_738 152
272 3300053722 Ga0500649_188904 Ga0500649_188904_205_663 152
273 3300055283 Ga0500661_011645 Ga0500661_011645_648_1106 152
274 3300005329 Ga0070683_100948112 Ga0070683_1009481122 153
275 3300005337 Ga0070682_100944304 Ga0070682_1009443041 153
276 3300005338 Ga0068868_100986094 Ga0068868_1009860941 153
277 3300005618 Ga0068864_100772554 Ga0068864_1007725542 153
278 3300005981 Ga0081538_10198308 Ga0081538_101983082 153
279 3300006358 Ga0068871_101652352 Ga0068871_1016523522 153
280 3300011119 Ga0105246_10694380 Ga0105246_106943802 153
281 3300013297 Ga0157378_10004961 Ga0157378_100049615 153
282 3300013306 Ga0163162_11419257 Ga0163162_114192572 153
283 3300013308 Ga0157375_10888727 Ga0157375_108887272 153
284 3300014325 Ga0163163_10927490 Ga0163163_109274902 153
285 3300015262 Ga0182007_10120303 Ga0182007_101203032 153
286 3300017792 Ga0163161_10546613 Ga0163161_105466132 153
287 3300025315 Ga0207697_10262449 Ga0207697_102624492 153
288 3300025900 Ga0207710_10161530 Ga0207710_101615303 153
289 3300025925 Ga0207650_10815484 Ga0207650_108154842 153
290 3300026075 Ga0207708_10494035 Ga0207708_104940353 153
291 3300026095 Ga0207676_10125942 Ga0207676_101259423 153
292 3300031548 Ga0307408_100713904 Ga0307408_1007139042 153
293 3300046542 Ga0495597_0278015 Ga0495597_0278015_98_559 153
294 3300046694 Ga0495649_0333935 Ga0495649_0333935_183_644 153
295 3300048922 Ga0496119_0117249 Ga0496119_0117249_904_1365 153
296 3300048929 Ga0496126_0422747 Ga0496126_0422747_108_569 153
297 3300050492 nmdc:mga0yw44_452661_c1 nmdc:mga0yw44_452661_c1_121_582 153
298 3300053096 Ga0500641_0027854 Ga0500641_0027854_140_604 153
299 3300005434 Ga0070709_10802566 Ga0070709_108025662 154
300 3300005435 Ga0070714_100017333 Ga0070714_1000173332 154
301 3300005437 Ga0070710_10102231 Ga0070710_101022312 154
302 3300006028 Ga0070717_10128172 Ga0070717_101281723 154
303 3300006163 Ga0070715_10024843 Ga0070715_100248433 154
304 3300021388 Ga0213875_10074339 Ga0213875_100743393 154
305 3300025261 Ga0209233_1003610 Ga0209233_10036103 154
306 3300025261 Ga0209233_1017593 Ga0209233_10175933 154
307 3300025898 Ga0207692_10108271 Ga0207692_101082712 154
308 3300025904 Ga0207647_10429309 Ga0207647_104293092 154
309 3300025929 Ga0207664_10002586 Ga0207664_100025867 154
310 3300033442 Ga0315911_1000003 Ga0315911_1000003445 154
311 3300037853 Ga0436364_1142822 Ga0436364_1142822_93_578 154
312 3300048905 Ga0496102_0332893 Ga0496102_0332893_830_1294 154
313 3300048907 Ga0496104_1267733 Ga0496104_1267733_86_550 154
314 3300048910 Ga0496107_0410120 Ga0496107_0410120_226_690 154
315 3300048924 Ga0496121_0115405 Ga0496121_0115405_1038_1502 154
316 3300048924 Ga0496121_0348525 Ga0496121_0348525_459_923 154
317 3300048929 Ga0496126_0235255 Ga0496126_0235255_349_813 154
318 3300048929 Ga0496126_0423249 Ga0496126_0423249_245_709 154
319 3300053094 Ga0500566_0000011 Ga0500566_0000011_68180_68644 154
320 3300053095 Ga0500640_001527 Ga0500640_001527_1705_2169 154
321 3300053111 Ga0500572_000065 Ga0500572_000065_1774_2238 154
322 3300053122 Ga0500608_051222 Ga0500608_051222_794_1258 154
323 3300053123 Ga0500614_003255 Ga0500614_003255_1814_2278 154
324 3300053136 Ga0500559_0001798 Ga0500559_0001798_7206_7670 154
325 3300053144 Ga0500585_125663 Ga0500585_125663_383_847 154
326 3300053150 Ga0500603_000269 Ga0500603_000269_8106_8570 154
327 3300053159 Ga0500630_000832 Ga0500630_000832_7755_8219 154
328 3300053162 Ga0500638_015393 Ga0500638_015393_2270_2734 154
329 3300053163 Ga0500639_000079 Ga0500639_000079_10394_10858 154
330 3300053725 Ga0500576_089743 Ga0500576_089743_304_768 154
331 3300053735 Ga0500596_000987 Ga0500596_000987_1900_2364 154
332 3300055283 Ga0500661_032566 Ga0500661_032566_416_880 154
333 iso_pu_bacteria 2508501128 2509152285 154
334 iso_pu_bacteria 2513237141 2513892565 154
335 iso_pu_bacteria 2857524615 2857525124 154
336 iso_pu_bacteria 2893066018 2893069707 154
337 iso_pu_bacteria 2919073203 2919079012 154
338 3300003214 JGI25165J46597_1012236 JGI25165J46597_10122362 155
339 3300003215 JGI25153J46596_10000317 JGI25153J46596_1000031710 155
340 3300003215 JGI25153J46596_10005866 JGI25153J46596_100058666 155
341 3300003320 rootH2_10065934 rootH2_100659343 155
342 3300003354 JGI25160J50197_1002533 JGI25160J50197_10025338 155
343 3300003354 JGI25160J50197_1007102 JGI25160J50197_10071025 155
344 3300003354 JGI25160J50197_1024527 JGI25160J50197_10245273 155
345 3300003354 JGI25160J50197_1074341 JGI25160J50197_10743411 155
346 3300003771 Ga0055526_1046678 Ga0055526_10466781 155
347 3300003794 Ga0055531_10008821 Ga0055531_100088214 155
348 3300004625 Ga0055543_1014610 Ga0055543_10146103 155
349 3300005262 Ga0065165_1000747 Ga0065165_100074718 155
350 3300005262 Ga0065165_1004585 Ga0065165_10045854 155
351 3300005262 Ga0065165_1010604 Ga0065165_10106042 155
352 3300005262 Ga0065165_1028625 Ga0065165_10286252 155
353 3300005262 Ga0065165_1077487 Ga0065165_10774872 155
354 3300005327 Ga0070658_10136673 Ga0070658_101366733 155
355 3300005327 Ga0070658_10695316 Ga0070658_106953162 155
356 3300005328 Ga0070676_10910005 Ga0070676_109100051 155
357 3300005335 Ga0070666_10561502 Ga0070666_105615021 155
358 3300005339 Ga0070660_100250674 Ga0070660_1002506743 155
359 3300005344 Ga0070661_100844170 Ga0070661_1008441702 155
360 3300005353 Ga0070669_100856682 Ga0070669_1008566821 155
361 3300005355 Ga0070671_100044655 Ga0070671_1000446554 155
362 3300005434 Ga0070709_10250031 Ga0070709_102500312 155
363 3300005437 Ga0070710_10040951 Ga0070710_100409513 155
364 3300005439 Ga0070711_100030578 Ga0070711_1000305783 155
365 3300005455 Ga0070663_100034033 Ga0070663_1000340334 155
366 3300005455 Ga0070663_100451553 Ga0070663_1004515531 155
367 3300005456 Ga0070678_100313547 Ga0070678_1003135471 155
368 3300005457 Ga0070662_100237999 Ga0070662_1002379993 155
369 3300005535 Ga0070684_100396193 Ga0070684_1003961931 155
370 3300005539 Ga0068853_100211567 Ga0068853_1002115672 155
371 3300005539 Ga0068853_100483256 Ga0068853_1004832563 155
372 3300005547 Ga0070693_100448625 Ga0070693_1004486251 155
373 3300005548 Ga0070665_100051490 Ga0070665_1000514906 155
374 3300005563 Ga0068855_101957415 Ga0068855_1019574151 155
375 3300005614 Ga0068856_100079699 Ga0068856_1000796992 155
376 3300005614 Ga0068856_101744456 Ga0068856_1017444561 155
377 3300005615 Ga0070702_100672057 Ga0070702_1006720572 155
378 3300005616 Ga0068852_100038198 Ga0068852_1000381984 155
379 3300005618 Ga0068864_100278065 Ga0068864_1002780653 155
380 3300005718 Ga0068866_10121670 Ga0068866_101216702 155
381 3300005719 Ga0068861_101137133 Ga0068861_1011371332 155
382 3300005719 Ga0068861_101573860 Ga0068861_1015738602 155
383 3300005983 Ga0081540_1076996 Ga0081540_10769963 155
384 3300006038 Ga0075365_10033778 Ga0075365_100337782 155
385 3300006038 Ga0075365_10055451 Ga0075365_100554512 155
386 3300006038 Ga0075365_10243968 Ga0075365_102439682 155
387 3300006042 Ga0075368_10011424 Ga0075368_100114244 155
388 3300006048 Ga0075363_100002488 Ga0075363_1000024882 155
389 3300006048 Ga0075363_100024676 Ga0075363_1000246763 155
390 3300006051 Ga0075364_10215443 Ga0075364_102154432 155
391 3300006051 Ga0075364_10869894 Ga0075364_108698941 155
392 3300006173 Ga0070716_100153302 Ga0070716_1001533023 155
393 3300006175 Ga0070712_100630173 Ga0070712_1006301732 155
394 3300006178 Ga0075367_10720220 Ga0075367_107202201 155
395 3300006186 Ga0075369_10005844 Ga0075369_100058441 155
396 3300006186 Ga0075369_10011717 Ga0075369_100117173 155
397 3300006186 Ga0075369_10220726 Ga0075369_102207262 155
398 3300006195 Ga0075366_10033470 Ga0075366_100334702 155
399 3300006353 Ga0075370_10038846 Ga0075370_100388464 155
400 3300006353 Ga0075370_10082329 Ga0075370_100823293 155
401 3300006881 Ga0068865_101133321 Ga0068865_1011333212 155
402 3300006943 Ga0099822_1065794 Ga0099822_10657942 155
403 3300009101 Ga0105247_10034754 Ga0105247_100347544 155
404 3300009101 Ga0105247_10121990 Ga0105247_101219903 155
405 3300009148 Ga0105243_10387430 Ga0105243_103874303 155
406 3300009174 Ga0105241_10082425 Ga0105241_100824253 155
407 3300009177 Ga0105248_10167112 Ga0105248_101671123 155
408 3300009177 Ga0105248_10945710 Ga0105248_109457102 155
409 3300009177 Ga0105248_11042714 Ga0105248_110427142 155
410 3300009545 Ga0105237_10047158 Ga0105237_100471586 155
411 3300009545 Ga0105237_10683805 Ga0105237_106838052 155
412 3300009545 Ga0105237_10824915 Ga0105237_108249152 155
413 3300009551 Ga0105238_10151847 Ga0105238_101518472 155
414 3300009551 Ga0105238_10754634 Ga0105238_107546341 155
415 3300010375 Ga0105239_10578048 Ga0105239_105780483 155
416 3300011119 Ga0105246_10013775 Ga0105246_100137754 155
417 3300013104 Ga0157370_10643066 Ga0157370_106430662 155
418 3300013105 Ga0157369_10616948 Ga0157369_106169482 155
419 3300013296 Ga0157374_10040321 Ga0157374_100403213 155
420 3300013297 Ga0157378_10662215 Ga0157378_106622153 155
421 3300013297 Ga0157378_10934671 Ga0157378_109346711 155
422 3300013306 Ga0163162_10163138 Ga0163162_101631383 155
423 3300013307 Ga0157372_10782245 Ga0157372_107822452 155
424 3300013308 Ga0157375_10063269 Ga0157375_100632695 155
425 3300014325 Ga0163163_10177238 Ga0163163_101772383 155
426 3300014968 Ga0157379_10614098 Ga0157379_106140982 155
427 3300017792 Ga0163161_10566890 Ga0163161_105668902 155
428 3300021321 Ga0214542_1001925 Ga0214542_100192533 155
429 3300021324 Ga0214545_1000003 Ga0214545_1000003216 155
430 3300021327 Ga0214543_1000002 Ga0214543_1000002550 155
431 3300024227 Ga0228598_1003083 Ga0228598_10030835 155
432 3300025230 Ga0209563_100325 Ga0209563_1003254 155
433 3300025245 Ga0207425_1030815 Ga0207425_10308152 155
434 3300025253 Ga0209677_102346 Ga0209677_1023466 155
435 3300025254 Ga0209148_1000812 Ga0209148_100081217 155
436 3300025261 Ga0209233_1002884 Ga0209233_10028847 155
437 3300025261 Ga0209233_1008563 Ga0209233_10085632 155
438 3300025273 Ga0209673_1045625 Ga0209673_10456252 155
439 3300025295 Ga0209564_1005325 Ga0209564_10053258 155
440 3300025295 Ga0209564_1016531 Ga0209564_10165313 155
441 3300025297 Ga0209758_1000011 Ga0209758_1000011537 155
442 3300025297 Ga0209758_1000120 Ga0209758_100012036 155
443 3300025297 Ga0209758_1001848 Ga0209758_100184814 155
444 3300025297 Ga0209758_1008838 Ga0209758_10088383 155
445 3300025297 Ga0209758_1018387 Ga0209758_10183874 155
446 3300025297 Ga0209758_1069994 Ga0209758_10699943 155
447 3300025297 Ga0209758_1075221 Ga0209758_10752212 155
448 3300025299 Ga0209256_1010441 Ga0209256_10104413 155
449 3300025299 Ga0209256_1040226 Ga0209256_10402261 155
450 3300025302 Ga0207426_1000328 Ga0207426_10003287 155
451 3300025302 Ga0207426_1000458 Ga0207426_100045815 155
452 3300025302 Ga0207426_1006703 Ga0207426_10067033 155
453 3300025302 Ga0207426_1066486 Ga0207426_10664862 155
454 3300025303 Ga0209051_1089771 Ga0209051_10897711 155
455 3300025304 Ga0209257_1001101 Ga0209257_10011019 155
456 3300025304 Ga0209257_1030664 Ga0209257_10306643 155
457 3300025315 Ga0207697_10413234 Ga0207697_104132342 155
458 3300025321 Ga0207656_10147548 Ga0207656_101475482 155
459 3300025898 Ga0207692_10040116 Ga0207692_100401163 155
460 3300025904 Ga0207647_10008820 Ga0207647_100088204 155
461 3300025904 Ga0207647_10532657 Ga0207647_105326571 155
462 3300025906 Ga0207699_10085855 Ga0207699_100858553 155
463 3300025908 Ga0207643_10728021 Ga0207643_107280211 155
464 3300025909 Ga0207705_10195132 Ga0207705_101951323 155
465 3300025914 Ga0207671_10056823 Ga0207671_100568233 155
466 3300025915 Ga0207693_10539021 Ga0207693_105390212 155
467 3300025916 Ga0207663_10140152 Ga0207663_101401522 155
468 3300025920 Ga0207649_10684652 Ga0207649_106846522 155
469 3300025924 Ga0207694_10071234 Ga0207694_100712342 155
470 3300025924 Ga0207694_10208299 Ga0207694_102082993 155
471 3300025924 Ga0207694_11140667 Ga0207694_111406671 155
472 3300025929 Ga0207664_10378557 Ga0207664_103785572 155
473 3300025932 Ga0207690_11302912 Ga0207690_113029121 155
474 3300025933 Ga0207706_10261499 Ga0207706_102614992 155
475 3300025939 Ga0207665_10116671 Ga0207665_101166713 155
476 3300025942 Ga0207689_11596551 Ga0207689_115965511 155
477 3300025949 Ga0207667_10189492 Ga0207667_101894923 155
478 3300025949 Ga0207667_11684186 Ga0207667_116841862 155
479 3300025961 Ga0207712_11310256 Ga0207712_113102561 155
480 3300025972 Ga0207668_10030855 Ga0207668_100308552 155
481 3300026035 Ga0207703_10812025 Ga0207703_108120252 155
482 3300026067 Ga0207678_10022393 Ga0207678_100223934 155
483 3300026067 Ga0207678_10034200 Ga0207678_100342004 155
484 3300026067 Ga0207678_10154732 Ga0207678_101547323 155
485 3300026078 Ga0207702_10087083 Ga0207702_100870832 155
486 3300026078 Ga0207702_11190195 Ga0207702_111901952 155
487 3300026095 Ga0207676_10209105 Ga0207676_102091053 155
488 3300026116 Ga0207674_10167564 Ga0207674_101675644 155
489 3300026118 Ga0207675_100537114 Ga0207675_1005371142 155
490 3300026118 Ga0207675_101535517 Ga0207675_1015355172 155
491 3300026121 Ga0207683_10469443 Ga0207683_104694432 155
492 3300026142 Ga0207698_10138196 Ga0207698_101381962 155
493 3300027296 Ga0209389_1000043 Ga0209389_100004318 155
494 3300027296 Ga0209389_1000077 Ga0209389_100007784 155
495 3300027357 Ga0209589_1000047 Ga0209589_100004793 155
496 3300027361 Ga0209489_100075 Ga0209489_100075125 155
497 3300027361 Ga0209489_100251 Ga0209489_10025184 155
498 3300027363 Ga0209700_100271 Ga0209700_10027184 155
499 3300027866 Ga0209813_10049013 Ga0209813_100490132 155
500 3300028379 Ga0268266_10022295 Ga0268266_100222952 155
501 3300028379 Ga0268266_10759427 Ga0268266_107594273 155
502 3300028379 Ga0268266_11808682 Ga0268266_118086821 155
503 3300031616 Ga0307508_10340520 Ga0307508_103405203 155
504 3300035089 Ga0373944_0357454 Ga0373944_0357454_16_483 155
505 3300035695 Ga0373927_0083817 Ga0373927_0083817_1408_1875 155
506 3300037068 Ga0373925_0038336 Ga0373925_0038336_1178_1645 155
507 3300037418 Ga0395900_0485656 Ga0395900_0485656_155_622 155
508 3300037471 Ga0395905_0015460 Ga0395905_0015460_494_961 155
509 3300037471 Ga0395905_0031994 Ga0395905_0031994_1912_2379 155
510 3300039437 Ga0436365_0312278 Ga0436365_0312278_206_682 155
511 3300039438 Ga0436360_0926138 Ga0436360_0926138_56_532 155
512 3300041453 Ga0451797_0393201 Ga0451797_0393201_63_530 155
513 3300041456 Ga0451795_1029459 Ga0451795_1029459_188_655 155
514 3300041460 Ga0451802_0275182 Ga0451802_0275182_154_621 155
515 3300041503 Ga0451847_0789714 Ga0451847_0789714_246_713 155
516 3300042012 Ga0439455_0055061 Ga0439455_0055061_419_886 155
517 3300044658 Ga0466972_0000079 Ga0466972_0000079_68203_68670 155
518 3300044658 Ga0466972_0001061 Ga0466972_0001061_1831_2298 155
519 3300044683 Ga0466965_0247552 Ga0466965_0247552_285_752 155
520 3300044683 Ga0466965_0323623 Ga0466965_0323623_62_529 155
521 3300044683 Ga0466965_0532943 Ga0466965_0532943_159_626 155
522 3300044684 Ga0466966_0058132 Ga0466966_0058132_491_958 155
523 3300044706 Ga0466964_0144189 Ga0466964_0144189_362_829 155
524 3300044706 Ga0466964_0178972 Ga0466964_0178972_456_923 155
525 3300044706 Ga0466964_0253871 Ga0466964_0253871_228_695 155
526 3300044735 Ga0466968_0010560 Ga0466968_0010560_2092_2559 155
527 3300044735 Ga0466968_0193789 Ga0466968_0193789_125_592 155
528 3300044842 Ga0466957_0093861 Ga0466957_0093861_771_1238 155
529 3300044842 Ga0466957_0284174 Ga0466957_0284174_400_867 155
530 3300045049 Ga0466959_0040060 Ga0466959_0040060_357_824 155
531 3300045836 Ga0466958_0642977 Ga0466958_0642977_179_646 155
532 3300045976 Ga0466967_0202886 Ga0466967_0202886_190_657 155
533 3300046454 Ga0495592_0011606 Ga0495592_0011606_2641_3108 155
534 3300046455 Ga0495603_0280312 Ga0495603_0280312_216_683 155
535 3300046457 Ga0495590_0175671 Ga0495590_0175671_65_532 155
536 3300046459 Ga0495629_0274632 Ga0495629_0274632_509_976 155
537 3300046460 Ga0495638_0020090 Ga0495638_0020090_2076_2543 155
538 3300046462 Ga0495651_0029360 Ga0495651_0029360_3351_3818 155
539 3300046474 Ga0495605_0174422 Ga0495605_0174422_246_713 155
540 3300046475 Ga0495639_0275106 Ga0495639_0275106_194_661 155
541 3300046477 Ga0495664_0056145 Ga0495664_0056145_544_1011 155
542 3300046477 Ga0495664_0092363 Ga0495664_0092363_313_780 155
543 3300046500 Ga0495596_0186849 Ga0495596_0186849_282_749 155
544 3300046507 Ga0495606_0006998 Ga0495606_0006998_3759_4226 155
545 3300046507 Ga0495606_0066480 Ga0495606_0066480_307_774 155
546 3300046511 Ga0495608_0112357 Ga0495608_0112357_1042_1509 155
547 3300046512 Ga0495610_0300481 Ga0495610_0300481_99_566 155
548 3300046513 Ga0495616_0260402 Ga0495616_0260402_85_552 155
549 3300046513 Ga0495616_0272750 Ga0495616_0272750_133_600 155
550 3300046513 Ga0495616_0320530 Ga0495616_0320530_86_553 155
551 3300046516 Ga0495628_0012530 Ga0495628_0012530_4708_5175 155
552 3300046522 Ga0495643_0005954 Ga0495643_0005954_7636_8103 155
553 3300046522 Ga0495643_0138335 Ga0495643_0138335_488_955 155
554 3300046524 Ga0495648_0037099 Ga0495648_0037099_312_779 155
555 3300046524 Ga0495648_0041864 Ga0495648_0041864_1037_1504 155
556 3300046524 Ga0495648_0156846 Ga0495648_0156846_604_1071 155
557 3300046524 Ga0495648_0222277 Ga0495648_0222277_105_572 155
558 3300046529 Ga0495652_0440217 Ga0495652_0440217_217_684 155
559 3300046533 Ga0495640_0028223 Ga0495640_0028223_3154_3621 155
560 3300046536 Ga0495587_0014340 Ga0495587_0014340_3377_3844 155
561 3300046543 Ga0495645_0007155 Ga0495645_0007155_3009_3476 155
562 3300046543 Ga0495645_0202750 Ga0495645_0202750_470_937 155
563 3300046557 Ga0495622_0052657 Ga0495622_0052657_172_639 155
564 3300046559 Ga0495667_0006892 Ga0495667_0006892_4122_4589 155
565 3300046616 Ga0495668_0282928 Ga0495668_0282928_299_766 155
566 3300046648 Ga0495611_0037207 Ga0495611_0037207_1282_1749 155
567 3300046660 Ga0495625_0116759 Ga0495625_0116759_118_585 155
568 3300046660 Ga0495625_0168223 Ga0495625_0168223_594_1061 155
569 3300046663 Ga0495635_0051638 Ga0495635_0051638_2091_2558 155
570 3300046665 Ga0495661_0254082 Ga0495661_0254082_406_873 155
571 3300046674 Ga0495588_0011004 Ga0495588_0011004_1104_1571 155
572 3300046674 Ga0495588_0112702 Ga0495588_0112702_950_1417 155
573 3300046675 Ga0495657_0019556 Ga0495657_0019556_4054_4521 155
574 3300046679 Ga0495623_0032327 Ga0495623_0032327_1360_1827 155
575 3300046680 Ga0495646_0010341 Ga0495646_0010341_773_1240 155
576 3300046683 Ga0495658_0485641 Ga0495658_0485641_226_693 155
577 3300046689 Ga0495613_0086480 Ga0495613_0086480_195_662 155
578 3300046692 Ga0495671_0234698 Ga0495671_0234698_103_570 155
579 3300046692 Ga0495671_0239628 Ga0495671_0239628_71_538 155
580 3300046694 Ga0495649_0315524 Ga0495649_0315524_66_533 155
581 3300046809 Ga0495600_0091391 Ga0495600_0091391_1021_1488 155
582 3300047315 Ga0495581_0250556 Ga0495581_0250556_106_573 155
583 3300047317 Ga0495604_0004988 Ga0495604_0004988_9805_10272 155
584 3300047319 Ga0495674_0042923 Ga0495674_0042923_3019_3486 155
585 3300047319 Ga0495674_0749626 Ga0495674_0749626_89_556 155
586 3300047321 Ga0495676_0447583 Ga0495676_0447583_314_781 155
587 3300047322 Ga0495680_0025139 Ga0495680_0025139_3077_3544 155
588 3300047323 Ga0495683_0083558 Ga0495683_0083558_379_846 155
589 3300047323 Ga0495683_0246511 Ga0495683_0246511_133_600 155
590 3300047443 Ga0495687_014302 Ga0495687_014302_3522_3989 155
591 3300047444 Ga0495675_0027294 Ga0495675_0027294_877_1344 155
592 3300047445 Ga0495677_0046237 Ga0495677_0046237_39_506 155
593 3300047469 Ga0495673_0079869 Ga0495673_0079869_687_1154 155
594 3300047472 Ga0495686_0057595 Ga0495686_0057595_113_580 155
595 3300047472 Ga0495686_0301996 Ga0495686_0301996_239_706 155
596 3300047472 Ga0495686_0372181 Ga0495686_0372181_37_504 155
597 3300048088 Ga0495602_0011752 Ga0495602_0011752_240_707 155
598 3300048903 Ga0496100_0038138 Ga0496100_0038138_2401_2868 155
599 3300048903 Ga0496100_0081519 Ga0496100_0081519_47_514 155
600 3300048903 Ga0496100_0213578 Ga0496100_0213578_234_701 155
601 3300048904 Ga0496101_0033698 Ga0496101_0033698_2390_2857 155
602 3300048904 Ga0496101_0235397 Ga0496101_0235397_213_680 155
603 3300048905 Ga0496102_0067964 Ga0496102_0067964_2308_2775 155
604 3300048906 Ga0496103_0317532 Ga0496103_0317532_407_874 155
605 3300048907 Ga0496104_0080908 Ga0496104_0080908_948_1415 155
606 3300048907 Ga0496104_0346005 Ga0496104_0346005_746_1213 155
607 3300048908 Ga0496105_0051555 Ga0496105_0051555_348_815 155
608 3300048908 Ga0496105_0368735 Ga0496105_0368735_500_967 155
609 3300048909 Ga0496106_0098072 Ga0496106_0098072_1055_1522 155
610 3300048909 Ga0496106_0200627 Ga0496106_0200627_40_507 155
611 3300048911 Ga0496108_0028679 Ga0496108_0028679_2780_3247 155
612 3300048913 Ga0496110_0062445 Ga0496110_0062445_1140_1607 155
613 3300048913 Ga0496110_0164218 Ga0496110_0164218_1438_1905 155
614 3300048914 Ga0496111_0028576 Ga0496111_0028576_1249_1716 155
615 3300048915 Ga0496112_0336783 Ga0496112_0336783_922_1389 155
616 3300048915 Ga0496112_0594801 Ga0496112_0594801_262_729 155
617 3300048916 Ga0496113_0039228 Ga0496113_0039228_2046_2513 155
618 3300048918 Ga0496115_0065715 Ga0496115_0065715_2331_2798 155
619 3300048918 Ga0496115_0144469 Ga0496115_0144469_1484_1951 155
620 3300048918 Ga0496115_0769491 Ga0496115_0769491_45_512 155
621 3300048919 Ga0496116_0088080 Ga0496116_0088080_859_1326 155
622 3300048920 Ga0496117_0273014 Ga0496117_0273014_161_628 155
623 3300048921 Ga0496118_0095578 Ga0496118_0095578_1352_1819 155
624 3300048921 Ga0496118_0153750 Ga0496118_0153750_799_1266 155
625 3300048921 Ga0496118_0161367 Ga0496118_0161367_369_836 155
626 3300048922 Ga0496119_0093315 Ga0496119_0093315_921_1388 155
627 3300048922 Ga0496119_0422530 Ga0496119_0422530_99_566 155
628 3300048923 Ga0496120_0070618 Ga0496120_0070618_828_1295 155
629 3300048924 Ga0496121_0037977 Ga0496121_0037977_593_1060 155
630 3300048924 Ga0496121_0126057 Ga0496121_0126057_877_1344 155
631 3300048924 Ga0496121_0651957 Ga0496121_0651957_88_555 155
632 3300048924 Ga0496121_0801137 Ga0496121_0801137_72_539 155
633 3300048926 Ga0496123_0335761 Ga0496123_0335761_64_531 155
634 3300048928 Ga0496125_0219108 Ga0496125_0219108_656_1123 155
635 3300048929 Ga0496126_0009242 Ga0496126_0009242_4419_4904 155
636 3300048929 Ga0496126_0250513 Ga0496126_0250513_589_1056 155
637 3300048929 Ga0496126_0888035 Ga0496126_0888035_65_532 155
638 3300049460 Ga0495682_0018342 Ga0495682_0018342_1759_2226 155
639 3300049583 Ga0501067_0174653 Ga0501067_0174653_390_857 155
640 3300050490 nmdc:mga03n38_260384_c1 nmdc:mga03n38_260384_c1_113_589 155
641 3300050491 nmdc:mga00v17_242288_c1 nmdc:mga00v17_242288_c1_646_1113 155
642 3300050492 nmdc:mga0yw44_139702_c1 nmdc:mga0yw44_139702_c1_765_1232 155
643 3300050492 nmdc:mga0yw44_16709_c1 nmdc:mga0yw44_16709_c1_2560_3027 155
644 3300050492 nmdc:mga0yw44_47972_c1 nmdc:mga0yw44_47972_c1_418_885 155
645 3300050492 nmdc:mga0yw44_99641_c1 nmdc:mga0yw44_99641_c1_541_1008 155
646 3300050493 nmdc:mga0k408_444816_c1 nmdc:mga0k408_444816_c1_37_504 155
647 3300050494 nmdc:mga06z11_15389_c1 nmdc:mga06z11_15389_c1_620_1096 155
648 3300050494 nmdc:mga06z11_319944_c1 nmdc:mga06z11_319944_c1_440_907 155
649 3300050494 nmdc:mga06z11_93936_c1 nmdc:mga06z11_93936_c1_156_623 155
650 3300050496 nmdc:mga07m45_44129_c1 nmdc:mga07m45_44129_c1_895_1362 155
651 3300050516 nmdc:mga0sz30_176394_c1 nmdc:mga0sz30_176394_c1_103_570 155
652 3300050516 nmdc:mga0sz30_20155_c1 nmdc:mga0sz30_20155_c1_239_715 155
653 3300053077 Ga0495601_0035469 Ga0495601_0035469_1708_2175 155
654 3300053078 Ga0495612_0146753 Ga0495612_0146753_143_613 155
655 3300053085 Ga0495619_0022726 Ga0495619_0022726_1501_1968 155
656 3300053086 Ga0500578_0140992 Ga0500578_0140992_490_957 155
657 3300053086 Ga0500578_0235380 Ga0500578_0235380_234_701 155
658 3300053086 Ga0500578_0375011 Ga0500578_0375011_300_767 155
659 3300053086 Ga0500578_0505167 Ga0500578_0505167_136_603 155
660 3300053087 Ga0500643_000150 Ga0500643_000150_66628_67095 155
661 3300053092 Ga0500583_0279806 Ga0500583_0279806_11_478 155
662 3300053095 Ga0500640_077058 Ga0500640_077058_916_1383 155
663 3300053096 Ga0500641_0351311 Ga0500641_0351311_39_506 155
664 3300053098 Ga0500650_0120302 Ga0500650_0120302_441_917 155
665 3300053103 Ga0500555_001186 Ga0500555_001186_6958_7425 155
666 3300053104 Ga0500556_0011102 Ga0500556_0011102_2154_2621 155
667 3300053105 Ga0500557_000062 Ga0500557_000062_39056_39523 155
668 3300053108 Ga0500562_027854 Ga0500562_027854_213_680 155
669 3300053111 Ga0500572_041328 Ga0500572_041328_804_1271 155
670 3300053119 Ga0500595_030732 Ga0500595_030732_360_827 155
671 3300053121 Ga0500607_022647 Ga0500607_022647_2707_3174 155
672 3300053123 Ga0500614_018221 Ga0500614_018221_382_849 155
673 3300053126 Ga0500621_221152 Ga0500621_221152_29_496 155
674 3300053128 Ga0500626_033792 Ga0500626_033792_1302_1769 155
675 3300053130 Ga0500642_0000127 Ga0500642_0000127_20644_21111 155
676 3300053130 Ga0500642_0168026 Ga0500642_0168026_318_785 155
677 3300053134 Ga0500658_0233060 Ga0500658_0233060_101_568 155
678 3300053136 Ga0500559_0077325 Ga0500559_0077325_107_574 155
679 3300053137 Ga0500561_0253713 Ga0500561_0253713_74_541 155
680 3300053142 Ga0500577_0115812 Ga0500577_0115812_156_623 155
681 3300053142 Ga0500577_0314212 Ga0500577_0314212_57_524 155
682 3300053145 Ga0500586_058255 Ga0500586_058255_71_538 155
683 3300053147 Ga0500589_080197 Ga0500589_080197_11_478 155
684 3300053148 Ga0500590_206896 Ga0500590_206896_300_767 155
685 3300053151 Ga0500604_0018478 Ga0500604_0018478_1143_1610 155
686 3300053153 Ga0500616_0042038 Ga0500616_0042038_605_1072 155
687 3300053155 Ga0500620_016390 Ga0500620_016390_285_752 155
688 3300053156 Ga0500622_0062318 Ga0500622_0062318_680_1147 155
689 3300053157 Ga0500624_007439 Ga0500624_007439_395_862 155
690 3300053158 Ga0500627_0018363 Ga0500627_0018363_1046_1513 155
691 3300053162 Ga0500638_022359 Ga0500638_022359_2259_2726 155
692 3300053163 Ga0500639_178108 Ga0500639_178108_237_704 155
693 3300053177 Ga0500636_0000041 Ga0500636_0000041_17468_17935 155
694 3300053177 Ga0500636_0088163 Ga0500636_0088163_1173_1640 155
695 3300053178 Ga0500637_0391727 Ga0500637_0391727_186_653 155
696 3300053727 Ga0500611_099126 Ga0500611_099126_240_707 155
697 3300053730 Ga0500645_010714 Ga0500645_010714_2178_2645 155
698 3300053730 Ga0500645_018852 Ga0500645_018852_953_1429 155
699 3300053736 Ga0500599_018322 Ga0500599_018322_101_568 155
700 3300053737 Ga0500601_000306 Ga0500601_000306_534_1001 155
701 3300061719 Ga0466962_0232804 Ga0466962_0232804_16_483 155
702 iso_pu_bacteria 2513237101 2513693726 155
703 iso_pu_bacteria 2728368998 2728755522 155
704 iso_pu_bacteria 2791355199 2793083972 155
705 iso_pu_bacteria 2874604998 2874611590 155
706 iso_pu_bacteria 2876808645 2876813624 155
707 iso_pu_bacteria 2879110137 2879117447 155
708 iso_pu_bacteria 2889033259 2889037809 155
709 iso_pu_bacteria 2904690495 2904698943 155
710 iso_pu_bacteria 2908756301 2908758740 155
711 iso_pu_bacteria 2922361189 2922361756 155
712 iso_pu_bacteria 2922386360 2922386999 155
713 iso_pu_bacteria 2941507105 2941512378 155
714 iso_pu_bacteria 2941515067 2941520117 155
715 iso_pu_bacteria 2941523033 2941528266 155
716 iso_pu_bacteria 8006964411 8006966870 155
717 iso_pu_bacteria 8006984368 8006984622 155
718 iso_pu_bacteria 8006994254 8006994622 155
719 iso_pu_bacteria 8056673599 8056680911 155
720 3300006038 Ga0075365_11039466 Ga0075365_110394662 156
721 3300031247 Ga0265340_10378982 Ga0265340_103789822 156
722 3300048927 Ga0496124_0830069 Ga0496124_0830069_31_501 156
723 3300048929 Ga0496126_0157082 Ga0496126_0157082_35_505 156
724 3300050492 nmdc:mga0yw44_907756_c1 nmdc:mga0yw44_907756_c1_14_484 156
725 3300003322 rootL2_10158942 rootL2_101589421 157
726 3300005331 Ga0070670_100851133 Ga0070670_1008511332 157
727 3300005456 Ga0070678_100060204 Ga0070678_1000602043 157
728 3300005539 Ga0068853_100068998 Ga0068853_1000689982 157
729 3300005543 Ga0070672_100119392 Ga0070672_1001193923 157
730 3300005548 Ga0070665_100053413 Ga0070665_1000534134 157
731 3300006038 Ga0075365_10131425 Ga0075365_101314253 157
732 3300009545 Ga0105237_10021234 Ga0105237_100212345 157
733 3300009551 Ga0105238_10027647 Ga0105238_100276475 157
734 3300010159 Ga0099796_10071633 Ga0099796_100716332 157
735 3300025920 Ga0207649_10932267 Ga0207649_109322672 157
736 3300025924 Ga0207694_10040173 Ga0207694_100401733 157
737 3300025925 Ga0207650_10925300 Ga0207650_109253001 157
738 3300025940 Ga0207691_10149913 Ga0207691_101499133 157
739 3300025949 Ga0207667_10168621 Ga0207667_101686214 157
740 3300026041 Ga0207639_10089016 Ga0207639_100890162 157
741 3300026121 Ga0207683_10037123 Ga0207683_100371233 157
742 3300047320 Ga0495672_0078591 Ga0495672_0078591_1242_1715 157
743 3300048917 Ga0496114_0376999 Ga0496114_0376999_203_676 157
744 3300048925 Ga0496122_0049838 Ga0496122_0049838_1662_2138 157
745 3300048928 Ga0496125_0000048 Ga0496125_0000048_157605_158081 157
746 3300050492 nmdc:mga0yw44_263826_c1 nmdc:mga0yw44_263826_c1_348_821 157
747 3300005336 Ga0070680_100142232 Ga0070680_1001422323 158
748 3300005347 Ga0070668_100397705 Ga0070668_1003977052 158
749 3300005434 Ga0070709_10022160 Ga0070709_100221603 158
750 3300005434 Ga0070709_10300833 Ga0070709_103008333 158
751 3300005435 Ga0070714_100995056 Ga0070714_1009950561 158
752 3300005436 Ga0070713_100074105 Ga0070713_1000741053 158
753 3300005439 Ga0070711_100003772 Ga0070711_1000037724 158
754 3300005439 Ga0070711_101126496 Ga0070711_1011264962 158
755 3300005455 Ga0070663_100093621 Ga0070663_1000936213 158
756 3300005458 Ga0070681_10090364 Ga0070681_100903644 158
757 3300005458 Ga0070681_10142977 Ga0070681_101429773 158
758 3300005535 Ga0070684_100009391 Ga0070684_1000093915 158
759 3300005548 Ga0070665_100338751 Ga0070665_1003387512 158
760 3300005548 Ga0070665_100572960 Ga0070665_1005729602 158
761 3300005548 Ga0070665_100668662 Ga0070665_1006686622 158
762 3300005577 Ga0068857_100059974 Ga0068857_1000599744 158
763 3300005616 Ga0068852_100348236 Ga0068852_1003482363 158
764 3300005718 Ga0068866_10544429 Ga0068866_105444291 158
765 3300005719 Ga0068861_101393323 Ga0068861_1013933231 158
766 3300006028 Ga0070717_10876778 Ga0070717_108767781 158
767 3300006038 Ga0075365_10018590 Ga0075365_100185905 158
768 3300006038 Ga0075365_10093391 Ga0075365_100933913 158
769 3300006038 Ga0075365_10957249 Ga0075365_109572491 158
770 3300006048 Ga0075363_100193705 Ga0075363_1001937051 158
771 3300006048 Ga0075363_100496097 Ga0075363_1004960972 158
772 3300006048 Ga0075363_100684428 Ga0075363_1006844282 158
773 3300006173 Ga0070716_100041694 Ga0070716_1000416944 158
774 3300006175 Ga0070712_100156096 Ga0070712_1001560962 158
775 3300006178 Ga0075367_10789854 Ga0075367_107898542 158
776 3300006186 Ga0075369_10060284 Ga0075369_100602841 158
777 3300009093 Ga0105240_10657936 Ga0105240_106579363 158
778 3300009101 Ga0105247_10356318 Ga0105247_103563182 158
779 3300009177 Ga0105248_10104172 Ga0105248_101041723 158
780 3300013104 Ga0157370_10885876 Ga0157370_108858762 158
781 3300014968 Ga0157379_10115038 Ga0157379_101150382 158
782 3300021361 Ga0213872_10023682 Ga0213872_100236824 158
783 3300021384 Ga0213876_10020877 Ga0213876_100208774 158
784 3300024225 Ga0224572_1024786 Ga0224572_10247861 158
785 3300025906 Ga0207699_10088282 Ga0207699_100882823 158
786 3300025906 Ga0207699_10403897 Ga0207699_104038972 158
787 3300025912 Ga0207707_10031075 Ga0207707_100310754 158
788 3300025912 Ga0207707_11490262 Ga0207707_114902621 158
789 3300025915 Ga0207693_10060270 Ga0207693_100602704 158
790 3300025916 Ga0207663_10028419 Ga0207663_100284193 158
791 3300025917 Ga0207660_10256833 Ga0207660_102568333 158
792 3300025921 Ga0207652_10274051 Ga0207652_102740513 158
793 3300025924 Ga0207694_10454862 Ga0207694_104548622 158
794 3300025928 Ga0207700_10095945 Ga0207700_100959453 158
795 3300025931 Ga0207644_10448930 Ga0207644_104489303 158
796 3300025939 Ga0207665_10172049 Ga0207665_101720492 158
797 3300025941 Ga0207711_10067359 Ga0207711_100673594 158
798 3300025949 Ga0207667_10230228 Ga0207667_102302283 158
799 3300026067 Ga0207678_10058046 Ga0207678_100580463 158
800 3300026067 Ga0207678_11146906 Ga0207678_111469061 158
801 3300026089 Ga0207648_11862359 Ga0207648_118623591 158
802 3300026116 Ga0207674_10078663 Ga0207674_100786633 158
803 3300028379 Ga0268266_10043720 Ga0268266_100437203 158
804 3300028379 Ga0268266_11410195 Ga0268266_114101952 158
805 3300028786 Ga0307517_10000279 Ga0307517_1000027918 158
806 3300028794 Ga0307515_10118784 Ga0307515_101187843 158
807 3300031456 Ga0307513_10530716 Ga0307513_105307162 158
808 3300031711 Ga0265314_10031072 Ga0265314_100310724 158
809 3300031730 Ga0307516_10429131 Ga0307516_104291312 158
810 3300032126 Ga0307415_100939741 Ga0307415_1009397412 158
811 3300035724 Ga0373933_0001821 Ga0373933_0001821_7845_8321 158
812 3300037068 Ga0373925_0941432 Ga0373925_0941432_76_564 158
813 3300039437 Ga0436365_0339172 Ga0436365_0339172_1534_2010 158
814 3300039438 Ga0436360_0619192 Ga0436360_0619192_26_502 158
815 3300039438 Ga0436360_0808748 Ga0436360_0808748_760_1248 158
816 3300039438 Ga0436360_0832371 Ga0436360_0832371_295_783 158
817 3300039447 Ga0436361_0108686 Ga0436361_0108686_478_954 158
818 3300039447 Ga0436361_0497086 Ga0436361_0497086_35_511 158
819 3300039447 Ga0436361_1222273 Ga0436361_1222273_510_998 158
820 3300039450 Ga0436363_1166057 Ga0436363_1166057_378_854 158
821 3300041509 Ga0451843_0534612 Ga0451843_0534612_197_673 158
822 3300044694 Ga0466963_0007491 Ga0466963_0007491_5466_5942 158
823 3300044842 Ga0466957_0472257 Ga0466957_0472257_123_599 158
824 3300045049 Ga0466959_0033466 Ga0466959_0033466_1280_1768 158
825 3300045976 Ga0466967_0144470 Ga0466967_0144470_42_518 158
826 3300045976 Ga0466967_0508568 Ga0466967_0508568_134_610 158
827 3300045976 Ga0466967_0593849 Ga0466967_0593849_596_1072 158
828 3300046460 Ga0495638_0054543 Ga0495638_0054543_1645_2121 158
829 3300046507 Ga0495606_0081284 Ga0495606_0081284_1031_1507 158
830 3300046512 Ga0495610_0285565 Ga0495610_0285565_154_630 158
831 3300046516 Ga0495628_0162259 Ga0495628_0162259_1073_1561 158
832 3300046522 Ga0495643_0049068 Ga0495643_0049068_766_1242 158
833 3300046524 Ga0495648_0023584 Ga0495648_0023584_2784_3260 158
834 3300046530 Ga0495654_0138148 Ga0495654_0138148_530_1006 158
835 3300046530 Ga0495654_0235796 Ga0495654_0235796_80_556 158
836 3300046542 Ga0495597_0210216 Ga0495597_0210216_88_564 158
837 3300046557 Ga0495622_0008156 Ga0495622_0008156_1698_2174 158
838 3300046559 Ga0495667_0210400 Ga0495667_0210400_417_905 158
839 3300046660 Ga0495625_0027298 Ga0495625_0027298_3768_4244 158
840 3300046660 Ga0495625_0176247 Ga0495625_0176247_292_768 158
841 3300046660 Ga0495625_0655899 Ga0495625_0655899_74_550 158
842 3300046691 Ga0495670_0008405 Ga0495670_0008405_1032_1508 158
843 3300046810 Ga0495660_0054850 Ga0495660_0054850_1618_2094 158
844 3300047320 Ga0495672_0060458 Ga0495672_0060458_604_1080 158
845 3300047472 Ga0495686_0042652 Ga0495686_0042652_2117_2593 158
846 3300048905 Ga0496102_0735010 Ga0496102_0735010_206_694 158
847 3300048918 Ga0496115_0818251 Ga0496115_0818251_56_544 158
848 3300048920 Ga0496117_0093571 Ga0496117_0093571_846_1322 158
849 3300048920 Ga0496117_0445527 Ga0496117_0445527_82_558 158
850 3300048921 Ga0496118_0033891 Ga0496118_0033891_355_831 158
851 3300048924 Ga0496121_0022241 Ga0496121_0022241_741_1217 158
852 3300048924 Ga0496121_0071091 Ga0496121_0071091_211_687 158
853 3300048924 Ga0496121_0224795 Ga0496121_0224795_432_908 158
854 3300048925 Ga0496122_0018275 Ga0496122_0018275_2668_3144 158
855 3300048926 Ga0496123_0022282 Ga0496123_0022282_1640_2116 158
856 3300048927 Ga0496124_0263152 Ga0496124_0263152_423_899 158
857 3300048928 Ga0496125_0000746 Ga0496125_0000746_37579_38055 158
858 3300048928 Ga0496125_0004827 Ga0496125_0004827_5216_5692 158
859 3300048929 Ga0496126_0108022 Ga0496126_0108022_937_1413 158
860 3300048929 Ga0496126_0118073 Ga0496126_0118073_238_714 158
861 3300048929 Ga0496126_0204271 Ga0496126_0204271_824_1300 158
862 3300048929 Ga0496126_0683564 Ga0496126_0683564_291_767 158
863 3300049581 Ga0501047_0699862 Ga0501047_0699862_98_574 158
864 3300049590 Ga0501074_0083579 Ga0501074_0083579_912_1388 158
865 3300049742 Ga0501080_0760834 Ga0501080_0760834_157_633 158
866 3300049823 Ga0501044_0454083 Ga0501044_0454083_518_994 158
867 3300050490 nmdc:mga03n38_377530_c1 nmdc:mga03n38_377530_c1_250_726 158
868 3300050492 nmdc:mga0yw44_18431_c1 nmdc:mga0yw44_18431_c1_1977_2453 158
869 3300053085 Ga0495619_0297903 Ga0495619_0297903_137_625 158
870 3300053089 Ga0500581_034767 Ga0500581_034767_1092_1568 158
871 3300053090 Ga0500646_0012699 Ga0500646_0012699_325_801 158
872 3300053092 Ga0500583_0078053 Ga0500583_0078053_257_736 158
873 3300053093 Ga0500651_0095797 Ga0500651_0095797_467_943 158
874 3300053094 Ga0500566_0001917 Ga0500566_0001917_2381_2857 158
875 3300053098 Ga0500650_0000747 Ga0500650_0000747_3280_3756 158
876 3300053098 Ga0500650_0251301 Ga0500650_0251301_13_492 158
877 3300053104 Ga0500556_0000003 Ga0500556_0000003_318729_319205 158
878 3300053108 Ga0500562_051985 Ga0500562_051985_438_914 158
879 3300053108 Ga0500562_076549 Ga0500562_076549_323_799 158
880 3300053116 Ga0500592_002557 Ga0500592_002557_354_830 158
881 3300053117 Ga0500593_156178 Ga0500593_156178_31_507 158
882 3300053119 Ga0500595_000496 Ga0500595_000496_16236_16715 158
883 3300053121 Ga0500607_101781 Ga0500607_101781_700_1176 158
884 3300053130 Ga0500642_0000006 Ga0500642_0000006_12978_13454 158
885 3300053131 Ga0500652_002025 Ga0500652_002025_3635_4111 158
886 3300053134 Ga0500658_0215062 Ga0500658_0215062_177_653 158
887 3300053134 Ga0500658_0400032 Ga0500658_0400032_40_516 158
888 3300053136 Ga0500559_0000308 Ga0500559_0000308_6963_7439 158
889 3300053139 Ga0500568_0000856 Ga0500568_0000856_2043_2519 158
890 3300053142 Ga0500577_0000070 Ga0500577_0000070_15533_16012 158
891 3300053148 Ga0500590_054988 Ga0500590_054988_1306_1782 158
892 3300053151 Ga0500604_0003912 Ga0500604_0003912_748_1224 158
893 3300053151 Ga0500604_0162847 Ga0500604_0162847_88_564 158
894 3300053153 Ga0500616_0000033 Ga0500616_0000033_146522_146998 158
895 3300053156 Ga0500622_0003447 Ga0500622_0003447_599_1075 158
896 3300053156 Ga0500622_0150890 Ga0500622_0150890_463_939 158
897 3300053158 Ga0500627_0247020 Ga0500627_0247020_154_630 158
898 3300053161 Ga0500634_0143873 Ga0500634_0143873_516_992 158
899 3300053177 Ga0500636_0005812 Ga0500636_0005812_3641_4117 158
900 3300053178 Ga0500637_0239292 Ga0500637_0239292_379_855 158
901 3300053735 Ga0500596_014937 Ga0500596_014937_166_642 158
902 3300001990 JGI24737J22298_10200120 JGI24737J22298_102001201 159
903 3300002070 JGI24750J21931_1020184 JGI24750J21931_10201843 159
904 3300002077 JGI24744J21845_10058110 JGI24744J21845_100581102 159
905 3300002244 JGI24742J22300_10020639 JGI24742J22300_100206392 159
906 3300003203 JGI25406J46586_10000138 JGI25406J46586_100001384 159
907 3300003215 JGI25153J46596_10007843 JGI25153J46596_100078435 159
908 3300003659 JGI25404J52841_10016633 JGI25404J52841_100166332 159
909 3300003659 JGI25404J52841_10052353 JGI25404J52841_100523531 159
910 3300005327 Ga0070658_10914606 Ga0070658_109146062 159
911 3300005328 Ga0070676_10133797 Ga0070676_101337973 159
912 3300005328 Ga0070676_10281597 Ga0070676_102815972 159
913 3300005329 Ga0070683_100076181 Ga0070683_1000761813 159
914 3300005329 Ga0070683_100315205 Ga0070683_1003152053 159
915 3300005330 Ga0070690_101119286 Ga0070690_1011192861 159
916 3300005334 Ga0068869_100029055 Ga0068869_1000290553 159
917 3300005334 Ga0068869_100074710 Ga0068869_1000747103 159
918 3300005334 Ga0068869_100216730 Ga0068869_1002167302 159
919 3300005334 Ga0068869_100217523 Ga0068869_1002175233 159
920 3300005334 Ga0068869_101987340 Ga0068869_1019873401 159
921 3300005335 Ga0070666_10642834 Ga0070666_106428341 159
922 3300005336 Ga0070680_100023775 Ga0070680_1000237755 159
923 3300005336 Ga0070680_100064981 Ga0070680_1000649814 159
924 3300005337 Ga0070682_100441849 Ga0070682_1004418491 159
925 3300005337 Ga0070682_100522236 Ga0070682_1005222362 159
926 3300005338 Ga0068868_100048941 Ga0068868_1000489413 159
927 3300005338 Ga0068868_100605095 Ga0068868_1006050952 159
928 3300005339 Ga0070660_100037797 Ga0070660_1000377974 159
929 3300005343 Ga0070687_100176927 Ga0070687_1001769272 159
930 3300005344 Ga0070661_100104163 Ga0070661_1001041633 159
931 3300005345 Ga0070692_10589853 Ga0070692_105898531 159
932 3300005347 Ga0070668_100027260 Ga0070668_1000272604 159
933 3300005347 Ga0070668_100113621 Ga0070668_1001136213 159
934 3300005347 Ga0070668_100205128 Ga0070668_1002051283 159
935 3300005347 Ga0070668_100218027 Ga0070668_1002180271 159
936 3300005347 Ga0070668_100273965 Ga0070668_1002739653 159
937 3300005347 Ga0070668_100645654 Ga0070668_1006456542 159
938 3300005347 Ga0070668_100763064 Ga0070668_1007630642 159
939 3300005353 Ga0070669_100164810 Ga0070669_1001648102 159
940 3300005354 Ga0070675_100392412 Ga0070675_1003924121 159
941 3300005355 Ga0070671_100104083 Ga0070671_1001040834 159
942 3300005355 Ga0070671_100244786 Ga0070671_1002447861 159
943 3300005355 Ga0070671_100250472 Ga0070671_1002504721 159
944 3300005356 Ga0070674_100046227 Ga0070674_1000462274 159
945 3300005356 Ga0070674_100297571 Ga0070674_1002975712 159
946 3300005356 Ga0070674_101057853 Ga0070674_1010578532 159
947 3300005365 Ga0070688_100344133 Ga0070688_1003441332 159
948 3300005366 Ga0070659_100198649 Ga0070659_1001986493 159
949 3300005366 Ga0070659_100263299 Ga0070659_1002632991 159
950 3300005367 Ga0070667_100146893 Ga0070667_1001468932 159
951 3300005434 Ga0070709_10023003 Ga0070709_100230034 159
952 3300005434 Ga0070709_10036355 Ga0070709_100363555 159
953 3300005434 Ga0070709_10756016 Ga0070709_107560162 159
954 3300005435 Ga0070714_100002801 Ga0070714_1000028013 159
955 3300005435 Ga0070714_100107849 Ga0070714_1001078493 159
956 3300005436 Ga0070713_100014026 Ga0070713_1000140265 159
957 3300005436 Ga0070713_100026138 Ga0070713_1000261384 159
958 3300005436 Ga0070713_100101308 Ga0070713_1001013084 159
959 3300005436 Ga0070713_100103599 Ga0070713_1001035993 159
960 3300005436 Ga0070713_100150597 Ga0070713_1001505973 159
961 3300005437 Ga0070710_10000678 Ga0070710_100006782 159
962 3300005437 Ga0070710_10019013 Ga0070710_100190133 159
963 3300005437 Ga0070710_10096625 Ga0070710_100966253 159
964 3300005438 Ga0070701_10263977 Ga0070701_102639771 159
965 3300005439 Ga0070711_100019549 Ga0070711_1000195491 159
966 3300005439 Ga0070711_100125685 Ga0070711_1001256853 159
967 3300005439 Ga0070711_100153631 Ga0070711_1001536312 159
968 3300005439 Ga0070711_100614519 Ga0070711_1006145191 159
969 3300005439 Ga0070711_100658017 Ga0070711_1006580172 159
970 3300005441 Ga0070700_100107452 Ga0070700_1001074523 159
971 3300005441 Ga0070700_100141268 Ga0070700_1001412683 159
972 3300005444 Ga0070694_100144776 Ga0070694_1001447761 159
973 3300005444 Ga0070694_101316300 Ga0070694_1013163001 159
974 3300005455 Ga0070663_100047641 Ga0070663_1000476414 159
975 3300005455 Ga0070663_100186548 Ga0070663_1001865482 159
976 3300005455 Ga0070663_101115033 Ga0070663_1011150331 159
977 3300005456 Ga0070678_100235114 Ga0070678_1002351142 159
978 3300005456 Ga0070678_100680506 Ga0070678_1006805061 159
979 3300005457 Ga0070662_100044307 Ga0070662_1000443071 159
980 3300005457 Ga0070662_100056074 Ga0070662_1000560744 159
981 3300005457 Ga0070662_101568324 Ga0070662_1015683241 159
982 3300005458 Ga0070681_10022753 Ga0070681_100227536 159
983 3300005458 Ga0070681_10835838 Ga0070681_108358382 159
984 3300005459 Ga0068867_100009231 Ga0068867_1000092311 159
985 3300005459 Ga0068867_101336764 Ga0068867_1013367642 159
986 3300005467 Ga0070706_100141178 Ga0070706_1001411783 159
987 3300005471 Ga0070698_100291619 Ga0070698_1002916192 159
988 3300005471 Ga0070698_100731917 Ga0070698_1007319171 159
989 3300005518 Ga0070699_100389557 Ga0070699_1003895573 159
990 3300005530 Ga0070679_100215130 Ga0070679_1002151303 159
991 3300005530 Ga0070679_100291049 Ga0070679_1002910493 159
992 3300005535 Ga0070684_100065826 Ga0070684_1000658264 159
993 3300005535 Ga0070684_100156524 Ga0070684_1001565242 159
994 3300005535 Ga0070684_100930511 Ga0070684_1009305112 159
995 3300005536 Ga0070697_100355077 Ga0070697_1003550772 159
996 3300005539 Ga0068853_100262403 Ga0068853_1002624033 159
997 3300005539 Ga0068853_100919650 Ga0068853_1009196501 159
998 3300005539 Ga0068853_101474006 Ga0068853_1014740061 159
999 3300005543 Ga0070672_100065744 Ga0070672_1000657443 159
1000 3300005543 Ga0070672_100171427 Ga0070672_1001714273 159
1001 3300005543 Ga0070672_100766193 Ga0070672_1007661932 159
1002 3300005545 Ga0070695_100189432 Ga0070695_1001894322 159
1003 3300005547 Ga0070693_100264489 Ga0070693_1002644893 159
1004 3300005547 Ga0070693_101276071 Ga0070693_1012760711 159
1005 3300005548 Ga0070665_100023384 Ga0070665_1000233846 159
1006 3300005548 Ga0070665_100078654 Ga0070665_1000786545 159
1007 3300005548 Ga0070665_100123917 Ga0070665_1001239173 159
1008 3300005548 Ga0070665_100134445 Ga0070665_1001344453 159
1009 3300005548 Ga0070665_100271612 Ga0070665_1002716123 159
1010 3300005549 Ga0070704_100319412 Ga0070704_1003194122 159
1011 3300005563 Ga0068855_100181159 Ga0068855_1001811594 159
1012 3300005563 Ga0068855_100392661 Ga0068855_1003926612 159
1013 3300005564 Ga0070664_100107954 Ga0070664_1001079543 159
1014 3300005564 Ga0070664_100177164 Ga0070664_1001771643 159
1015 3300005577 Ga0068857_100037748 Ga0068857_1000377483 159
1016 3300005577 Ga0068857_100291795 Ga0068857_1002917953 159
1017 3300005577 Ga0068857_100384076 Ga0068857_1003840762 159
1018 3300005578 Ga0068854_100097953 Ga0068854_1000979532 159
1019 3300005578 Ga0068854_100475090 Ga0068854_1004750903 159
1020 3300005614 Ga0068856_100236559 Ga0068856_1002365593 159
1021 3300005614 Ga0068856_100754975 Ga0068856_1007549752 159
1022 3300005615 Ga0070702_100239985 Ga0070702_1002399852 159
1023 3300005616 Ga0068852_100133040 Ga0068852_1001330403 159
1024 3300005616 Ga0068852_100455793 Ga0068852_1004557932 159
1025 3300005616 Ga0068852_101783980 Ga0068852_1017839802 159
1026 3300005617 Ga0068859_100103545 Ga0068859_1001035453 159
1027 3300005617 Ga0068859_100181183 Ga0068859_1001811832 159
1028 3300005617 Ga0068859_101012313 Ga0068859_1010123132 159
1029 3300005618 Ga0068864_100058929 Ga0068864_1000589294 159
1030 3300005618 Ga0068864_100300154 Ga0068864_1003001543 159
1031 3300005618 Ga0068864_101589310 Ga0068864_1015893101 159
1032 3300005719 Ga0068861_100045277 Ga0068861_1000452773 159
1033 3300005719 Ga0068861_100130900 Ga0068861_1001309001 159
1034 3300005719 Ga0068861_100426495 Ga0068861_1004264952 159
1035 3300005719 Ga0068861_101554281 Ga0068861_1015542811 159
1036 3300005834 Ga0068851_10118916 Ga0068851_101189163 159
1037 3300005834 Ga0068851_10320069 Ga0068851_103200691 159
1038 3300005840 Ga0068870_10075455 Ga0068870_100754552 159
1039 3300005841 Ga0068863_100234737 Ga0068863_1002347373 159
1040 3300005841 Ga0068863_100290578 Ga0068863_1002905782 159
1041 3300005841 Ga0068863_101985131 Ga0068863_1019851312 159
1042 3300005841 Ga0068863_102170036 Ga0068863_1021700361 159
1043 3300005842 Ga0068858_100119984 Ga0068858_1001199844 159
1044 3300005842 Ga0068858_100195894 Ga0068858_1001958943 159
1045 3300005842 Ga0068858_100627464 Ga0068858_1006274642 159
1046 3300005843 Ga0068860_100000360 Ga0068860_10000036043 159
1047 3300005843 Ga0068860_100153207 Ga0068860_1001532072 159
1048 3300005843 Ga0068860_100190322 Ga0068860_1001903223 159
1049 3300005843 Ga0068860_101266327 Ga0068860_1012663272 159
1050 3300005844 Ga0068862_100034594 Ga0068862_1000345944 159
1051 3300005844 Ga0068862_100207210 Ga0068862_1002072103 159
1052 3300005937 Ga0081455_10045444 Ga0081455_100454444 159
1053 3300005983 Ga0081540_1008125 Ga0081540_10081254 159
1054 3300005983 Ga0081540_1008941 Ga0081540_10089413 159
1055 3300005983 Ga0081540_1014330 Ga0081540_10143304 159
1056 3300005983 Ga0081540_1027303 Ga0081540_10273034 159
1057 3300005983 Ga0081540_1064372 Ga0081540_10643723 159
1058 3300005983 Ga0081540_1088582 Ga0081540_10885822 159
1059 3300005983 Ga0081540_1184764 Ga0081540_11847642 159
1060 3300005983 Ga0081540_1328556 Ga0081540_13285561 159
1061 3300005985 Ga0081539_10000008 Ga0081539_1000000868 159
1062 3300006028 Ga0070717_10001656 Ga0070717_1000165613 159
1063 3300006028 Ga0070717_10007544 Ga0070717_100075444 159
1064 3300006028 Ga0070717_10382104 Ga0070717_103821043 159
1065 3300006028 Ga0070717_10619385 Ga0070717_106193851 159
1066 3300006028 Ga0070717_10708124 Ga0070717_107081241 159
1067 3300006028 Ga0070717_11096399 Ga0070717_110963991 159
1068 3300006038 Ga0075365_10024652 Ga0075365_100246523 159
1069 3300006038 Ga0075365_10137263 Ga0075365_101372632 159
1070 3300006038 Ga0075365_10461200 Ga0075365_104612002 159
1071 3300006048 Ga0075363_100026304 Ga0075363_1000263042 159
1072 3300006048 Ga0075363_100111587 Ga0075363_1001115872 159
1073 3300006048 Ga0075363_100181370 Ga0075363_1001813702 159
1074 3300006051 Ga0075364_10024940 Ga0075364_100249403 159
1075 3300006163 Ga0070715_10001127 Ga0070715_100011278 159
1076 3300006163 Ga0070715_10116926 Ga0070715_101169262 159
1077 3300006163 Ga0070715_10118381 Ga0070715_101183812 159
1078 3300006173 Ga0070716_100047412 Ga0070716_1000474121 159
1079 3300006173 Ga0070716_100106258 Ga0070716_1001062583 159
1080 3300006175 Ga0070712_100013240 Ga0070712_1000132405 159
1081 3300006175 Ga0070712_100022680 Ga0070712_1000226804 159
1082 3300006175 Ga0070712_100038780 Ga0070712_1000387804 159
1083 3300006175 Ga0070712_100581041 Ga0070712_1005810411 159
1084 3300006175 Ga0070712_100660216 Ga0070712_1006602161 159
1085 3300006177 Ga0075362_10090506 Ga0075362_100905062 159
1086 3300006178 Ga0075367_10121791 Ga0075367_101217913 159
1087 3300006178 Ga0075367_10492498 Ga0075367_104924982 159
1088 3300006186 Ga0075369_10012874 Ga0075369_100128742 159
1089 3300006195 Ga0075366_10157481 Ga0075366_101574812 159
1090 3300006195 Ga0075366_10332512 Ga0075366_103325121 159
1091 3300006237 Ga0097621_100359483 Ga0097621_1003594833 159
1092 3300006237 Ga0097621_100860082 Ga0097621_1008600822 159
1093 3300006237 Ga0097621_101500008 Ga0097621_1015000081 159
1094 3300006237 Ga0097621_101662222 Ga0097621_1016622221 159
1095 3300006353 Ga0075370_10238198 Ga0075370_102381982 159
1096 3300006353 Ga0075370_10309220 Ga0075370_103092202 159
1097 3300006353 Ga0075370_10329161 Ga0075370_103291612 159
1098 3300006358 Ga0068871_100069423 Ga0068871_1000694235 159
1099 3300006358 Ga0068871_100072638 Ga0068871_1000726383 159
1100 3300006358 Ga0068871_100525777 Ga0068871_1005257773 159
1101 3300006358 Ga0068871_100585244 Ga0068871_1005852442 159
1102 3300006844 Ga0075428_100208936 Ga0075428_1002089363 159
1103 3300006844 Ga0075428_100341471 Ga0075428_1003414713 159
1104 3300006847 Ga0075431_100682133 Ga0075431_1006821332 159
1105 3300006871 Ga0075434_100737073 Ga0075434_1007370732 159
1106 3300006881 Ga0068865_100190154 Ga0068865_1001901543 159
1107 3300006881 Ga0068865_100541348 Ga0068865_1005413482 159
1108 3300006931 Ga0097620_100103547 Ga0097620_1001035474 159
1109 3300006931 Ga0097620_100181187 Ga0097620_1001811874 159
1110 3300006931 Ga0097620_101012304 Ga0097620_1010123042 159
1111 3300006941 Ga0099825_1047657 Ga0099825_10476571 159
1112 3300006942 Ga0099824_1018474 Ga0099824_10184742 159
1113 3300006943 Ga0099822_1021826 Ga0099822_10218266 159
1114 3300007076 Ga0075435_100129312 Ga0075435_1001293123 159
1115 3300007265 Ga0099794_10106117 Ga0099794_101061172 159
1116 3300007265 Ga0099794_10228064 Ga0099794_102280642 159
1117 3300007265 Ga0099794_10228415 Ga0099794_102284152 159
1118 3300007788 Ga0099795_10009487 Ga0099795_100094874 159
1119 3300007788 Ga0099795_10021525 Ga0099795_100215251 159
1120 3300007788 Ga0099795_10211652 Ga0099795_102116522 159
1121 3300009092 Ga0105250_10073796 Ga0105250_100737962 159
1122 3300009092 Ga0105250_10179380 Ga0105250_101793802 159
1123 3300009093 Ga0105240_10084695 Ga0105240_100846953 159
1124 3300009093 Ga0105240_10379621 Ga0105240_103796213 159
1125 3300009094 Ga0111539_10010769 Ga0111539_100107698 159
1126 3300009098 Ga0105245_10137591 Ga0105245_101375912 159
1127 3300009098 Ga0105245_10264619 Ga0105245_102646192 159
1128 3300009098 Ga0105245_10669447 Ga0105245_106694472 159
1129 3300009101 Ga0105247_10100789 Ga0105247_101007894 159
1130 3300009101 Ga0105247_10225649 Ga0105247_102256493 159
1131 3300009101 Ga0105247_10254543 Ga0105247_102545431 159
1132 3300009101 Ga0105247_10677871 Ga0105247_106778712 159
1133 3300009101 Ga0105247_11160894 Ga0105247_111608942 159
1134 3300009147 Ga0114129_10640263 Ga0114129_106402633 159
1135 3300009148 Ga0105243_10373444 Ga0105243_103734442 159
1136 3300009148 Ga0105243_10518846 Ga0105243_105188462 159
1137 3300009174 Ga0105241_10029756 Ga0105241_100297563 159
1138 3300009174 Ga0105241_10232984 Ga0105241_102329843 159
1139 3300009174 Ga0105241_10435013 Ga0105241_104350133 159
1140 3300009174 Ga0105241_10684529 Ga0105241_106845292 159
1141 3300009176 Ga0105242_10072771 Ga0105242_100727711 159
1142 3300009176 Ga0105242_10165539 Ga0105242_101655393 159
1143 3300009176 Ga0105242_10467047 Ga0105242_104670472 159
1144 3300009176 Ga0105242_10687051 Ga0105242_106870512 159
1145 3300009177 Ga0105248_10260394 Ga0105248_102603942 159
1146 3300009177 Ga0105248_10265805 Ga0105248_102658051 159
1147 3300009545 Ga0105237_10009950 Ga0105237_100099508 159
1148 3300009545 Ga0105237_10110574 Ga0105237_101105742 159
1149 3300009545 Ga0105237_10558820 Ga0105237_105588202 159
1150 3300009545 Ga0105237_10750872 Ga0105237_107508723 159
1151 3300009545 Ga0105237_10822256 Ga0105237_108222563 159
1152 3300009551 Ga0105238_10135316 Ga0105238_101353163 159
1153 3300009551 Ga0105238_10331334 Ga0105238_103313343 159
1154 3300009551 Ga0105238_10377366 Ga0105238_103773663 159
1155 3300009551 Ga0105238_10686681 Ga0105238_106866812 159
1156 3300009551 Ga0105238_11508599 Ga0105238_115085991 159
1157 3300009553 Ga0105249_10074396 Ga0105249_100743965 159
1158 3300009553 Ga0105249_10177078 Ga0105249_101770783 159
1159 3300010159 Ga0099796_10100427 Ga0099796_101004273 159
1160 3300010159 Ga0099796_10127917 Ga0099796_101279172 159
1161 3300010375 Ga0105239_10084742 Ga0105239_100847424 159
1162 3300010375 Ga0105239_10159171 Ga0105239_101591714 159
1163 3300010375 Ga0105239_10218055 Ga0105239_102180552 159
1164 3300010375 Ga0105239_10292556 Ga0105239_102925563 159
1165 3300010375 Ga0105239_10387551 Ga0105239_103875512 159
1166 3300010375 Ga0105239_10575312 Ga0105239_105753121 159
1167 3300011119 Ga0105246_10045998 Ga0105246_100459983 159
1168 3300011119 Ga0105246_10104444 Ga0105246_101044442 159
1169 3300011119 Ga0105246_10228690 Ga0105246_102286903 159
1170 3300011119 Ga0105246_10266822 Ga0105246_102668222 159
1171 3300011119 Ga0105246_10268572 Ga0105246_102685722 159
1172 3300011119 Ga0105246_10350085 Ga0105246_103500852 159
1173 3300013104 Ga0157370_10057618 Ga0157370_100576183 159
1174 3300013105 Ga0157369_10012423 Ga0157369_100124235 159
1175 3300013105 Ga0157369_10195154 Ga0157369_101951543 159
1176 3300013105 Ga0157369_10348532 Ga0157369_103485322 159
1177 3300013296 Ga0157374_10024785 Ga0157374_100247854 159
1178 3300013296 Ga0157374_11755321 Ga0157374_117553212 159
1179 3300013296 Ga0157374_11891070 Ga0157374_118910701 159
1180 3300013297 Ga0157378_10133315 Ga0157378_101333153 159
1181 3300013297 Ga0157378_10807552 Ga0157378_108075522 159
1182 3300013297 Ga0157378_11025692 Ga0157378_110256922 159
1183 3300013306 Ga0163162_10060239 Ga0163162_100602393 159
1184 3300013306 Ga0163162_10062895 Ga0163162_100628953 159
1185 3300013306 Ga0163162_10184729 Ga0163162_101847293 159
1186 3300013306 Ga0163162_10370985 Ga0163162_103709852 159
1187 3300013306 Ga0163162_10893966 Ga0163162_108939662 159
1188 3300013306 Ga0163162_11221664 Ga0163162_112216642 159
1189 3300013308 Ga0157375_10105710 Ga0157375_101057102 159
1190 3300013308 Ga0157375_10108399 Ga0157375_101083994 159
1191 3300013308 Ga0157375_10498328 Ga0157375_104983281 159
1192 3300013308 Ga0157375_11224732 Ga0157375_112247321 159
1193 3300013308 Ga0157375_11415865 Ga0157375_114158652 159
1194 3300014325 Ga0163163_10009852 Ga0163163_100098524 159
1195 3300014325 Ga0163163_10060452 Ga0163163_100604524 159
1196 3300014325 Ga0163163_10060614 Ga0163163_100606143 159
1197 3300014325 Ga0163163_10352566 Ga0163163_103525662 159
1198 3300014326 Ga0157380_10052368 Ga0157380_100523683 159
1199 3300014326 Ga0157380_10260620 Ga0157380_102606203 159
1200 3300014326 Ga0157380_10316878 Ga0157380_103168783 159
1201 3300014745 Ga0157377_10110199 Ga0157377_101101992 159
1202 3300014745 Ga0157377_10113067 Ga0157377_101130673 159
1203 3300014745 Ga0157377_10164552 Ga0157377_101645522 159
1204 3300014968 Ga0157379_10092888 Ga0157379_100928883 159
1205 3300014968 Ga0157379_10100952 Ga0157379_101009522 159
1206 3300014969 Ga0157376_10053421 Ga0157376_100534212 159
1207 3300014969 Ga0157376_10160876 Ga0157376_101608762 159
1208 3300014969 Ga0157376_10686731 Ga0157376_106867312 159
1209 3300017792 Ga0163161_10049743 Ga0163161_100497433 159
1210 3300017792 Ga0163161_10297384 Ga0163161_102973843 159
1211 3300020082 Ga0206353_11239574 Ga0206353_112395742 159
1212 3300025297 Ga0209758_1002526 Ga0209758_100252614 159
1213 3300025321 Ga0207656_10107837 Ga0207656_101078373 159
1214 3300025885 Ga0207653_10027624 Ga0207653_100276241 159
1215 3300025898 Ga0207692_10000797 Ga0207692_100007974 159
1216 3300025898 Ga0207692_10034442 Ga0207692_100344425 159
1217 3300025898 Ga0207692_10751592 Ga0207692_107515922 159
1218 3300025899 Ga0207642_10090132 Ga0207642_100901322 159
1219 3300025899 Ga0207642_10592054 Ga0207642_105920541 159
1220 3300025901 Ga0207688_10119760 Ga0207688_101197603 159
1221 3300025901 Ga0207688_10266632 Ga0207688_102666323 159
1222 3300025904 Ga0207647_10077783 Ga0207647_100777833 159
1223 3300025906 Ga0207699_10001610 Ga0207699_100016105 159
1224 3300025906 Ga0207699_10014207 Ga0207699_100142073 159
1225 3300025906 Ga0207699_10017213 Ga0207699_100172132 159
1226 3300025906 Ga0207699_10054282 Ga0207699_100542823 159
1227 3300025906 Ga0207699_10119427 Ga0207699_101194273 159
1228 3300025907 Ga0207645_10132858 Ga0207645_101328582 159
1229 3300025908 Ga0207643_10104196 Ga0207643_101041962 159
1230 3300025909 Ga0207705_10125295 Ga0207705_101252953 159
1231 3300025909 Ga0207705_11134653 Ga0207705_111346532 159
1232 3300025910 Ga0207684_11153938 Ga0207684_111539382 159
1233 3300025911 Ga0207654_10119575 Ga0207654_101195753 159
1234 3300025911 Ga0207654_10397877 Ga0207654_103978772 159
1235 3300025911 Ga0207654_10488780 Ga0207654_104887802 159
1236 3300025912 Ga0207707_10000886 Ga0207707_1000088621 159
1237 3300025912 Ga0207707_10023656 Ga0207707_100236566 159
1238 3300025912 Ga0207707_10299929 Ga0207707_102999293 159
1239 3300025912 Ga0207707_10518469 Ga0207707_105184693 159
1240 3300025913 Ga0207695_10306738 Ga0207695_103067383 159
1241 3300025913 Ga0207695_10308478 Ga0207695_103084782 159
1242 3300025914 Ga0207671_10110956 Ga0207671_101109563 159
1243 3300025914 Ga0207671_10332303 Ga0207671_103323032 159
1244 3300025914 Ga0207671_10378502 Ga0207671_103785022 159
1245 3300025915 Ga0207693_10002637 Ga0207693_100026372 159
1246 3300025915 Ga0207693_10007874 Ga0207693_100078745 159
1247 3300025915 Ga0207693_10018468 Ga0207693_100184684 159
1248 3300025915 Ga0207693_10034047 Ga0207693_100340474 159
1249 3300025915 Ga0207693_10203094 Ga0207693_102030943 159
1250 3300025915 Ga0207693_10453506 Ga0207693_104535061 159
1251 3300025916 Ga0207663_10006243 Ga0207663_100062433 159
1252 3300025916 Ga0207663_10011845 Ga0207663_100118452 159
1253 3300025916 Ga0207663_10044640 Ga0207663_100446403 159
1254 3300025916 Ga0207663_10121345 Ga0207663_101213453 159
1255 3300025916 Ga0207663_11006565 Ga0207663_110065652 159
1256 3300025916 Ga0207663_11244168 Ga0207663_112441681 159
1257 3300025917 Ga0207660_10010388 Ga0207660_100103886 159
1258 3300025917 Ga0207660_10022287 Ga0207660_100222874 159
1259 3300025917 Ga0207660_10027535 Ga0207660_100275356 159
1260 3300025917 Ga0207660_10231996 Ga0207660_102319963 159
1261 3300025917 Ga0207660_10502071 Ga0207660_105020712 159
1262 3300025918 Ga0207662_10177795 Ga0207662_101777952 159
1263 3300025919 Ga0207657_10008437 Ga0207657_1000843711 159
1264 3300025920 Ga0207649_10040161 Ga0207649_100401614 159
1265 3300025921 Ga0207652_10019601 Ga0207652_100196012 159
1266 3300025921 Ga0207652_10105158 Ga0207652_101051583 159
1267 3300025923 Ga0207681_10036681 Ga0207681_100366814 159
1268 3300025923 Ga0207681_10208829 Ga0207681_102088292 159
1269 3300025923 Ga0207681_10293023 Ga0207681_102930232 159
1270 3300025924 Ga0207694_10203424 Ga0207694_102034243 159
1271 3300025924 Ga0207694_10282251 Ga0207694_102822512 159
1272 3300025925 Ga0207650_10527525 Ga0207650_105275251 159
1273 3300025926 Ga0207659_10789612 Ga0207659_107896122 159
1274 3300025926 Ga0207659_10981193 Ga0207659_109811932 159
1275 3300025926 Ga0207659_11035003 Ga0207659_110350032 159
1276 3300025927 Ga0207687_10053608 Ga0207687_100536082 159
1277 3300025927 Ga0207687_10218131 Ga0207687_102181312 159
1278 3300025927 Ga0207687_10327438 Ga0207687_103274382 159
1279 3300025928 Ga0207700_10007466 Ga0207700_100074663 159
1280 3300025928 Ga0207700_10011479 Ga0207700_100114796 159
1281 3300025928 Ga0207700_10052174 Ga0207700_100521743 159
1282 3300025928 Ga0207700_10304870 Ga0207700_103048702 159
1283 3300025929 Ga0207664_10007788 Ga0207664_100077883 159
1284 3300025929 Ga0207664_10267241 Ga0207664_102672412 159
1285 3300025929 Ga0207664_10276253 Ga0207664_102762532 159
1286 3300025929 Ga0207664_10276358 Ga0207664_102763582 159
1287 3300025931 Ga0207644_10188346 Ga0207644_101883463 159
1288 3300025931 Ga0207644_10272742 Ga0207644_102727422 159
1289 3300025932 Ga0207690_10014466 Ga0207690_100144665 159
1290 3300025932 Ga0207690_10522991 Ga0207690_105229912 159
1291 3300025933 Ga0207706_10059649 Ga0207706_100596493 159
1292 3300025933 Ga0207706_10149460 Ga0207706_101494603 159
1293 3300025933 Ga0207706_10634162 Ga0207706_106341622 159
1294 3300025933 Ga0207706_10855574 Ga0207706_108555742 159
1295 3300025933 Ga0207706_11349173 Ga0207706_113491731 159
1296 3300025934 Ga0207686_10089706 Ga0207686_100897062 159
1297 3300025934 Ga0207686_10103845 Ga0207686_101038453 159
1298 3300025934 Ga0207686_10390090 Ga0207686_103900902 159
1299 3300025935 Ga0207709_10040013 Ga0207709_100400135 159
1300 3300025936 Ga0207670_10210240 Ga0207670_102102401 159
1301 3300025937 Ga0207669_10005298 Ga0207669_100052983 159
1302 3300025937 Ga0207669_10219534 Ga0207669_102195341 159
1303 3300025937 Ga0207669_10564302 Ga0207669_105643022 159
1304 3300025937 Ga0207669_10972046 Ga0207669_109720462 159
1305 3300025937 Ga0207669_10972372 Ga0207669_109723721 159
1306 3300025937 Ga0207669_11135585 Ga0207669_111355852 159
1307 3300025938 Ga0207704_10175381 Ga0207704_101753813 159
1308 3300025938 Ga0207704_10222242 Ga0207704_102222423 159
1309 3300025938 Ga0207704_10390975 Ga0207704_103909752 159
1310 3300025939 Ga0207665_10001385 Ga0207665_100013856 159
1311 3300025939 Ga0207665_10021917 Ga0207665_100219174 159
1312 3300025939 Ga0207665_10065508 Ga0207665_100655084 159
1313 3300025939 Ga0207665_10910243 Ga0207665_109102432 159
1314 3300025940 Ga0207691_10025303 Ga0207691_100253036 159
1315 3300025940 Ga0207691_10148496 Ga0207691_101484961 159
1316 3300025940 Ga0207691_11065095 Ga0207691_110650952 159
1317 3300025942 Ga0207689_10019353 Ga0207689_100193537 159
1318 3300025942 Ga0207689_10036827 Ga0207689_100368274 159
1319 3300025942 Ga0207689_10117631 Ga0207689_101176313 159
1320 3300025942 Ga0207689_10305796 Ga0207689_103057962 159
1321 3300025942 Ga0207689_10782418 Ga0207689_107824182 159
1322 3300025944 Ga0207661_10018951 Ga0207661_100189513 159
1323 3300025945 Ga0207679_10205321 Ga0207679_102053212 159
1324 3300025945 Ga0207679_10757306 Ga0207679_107573062 159
1325 3300025949 Ga0207667_10019974 Ga0207667_100199746 159
1326 3300025949 Ga0207667_10113813 Ga0207667_101138133 159
1327 3300025949 Ga0207667_10474438 Ga0207667_104744382 159
1328 3300025949 Ga0207667_10536798 Ga0207667_105367982 159
1329 3300025960 Ga0207651_10311328 Ga0207651_103113282 159
1330 3300025960 Ga0207651_10882550 Ga0207651_108825502 159
1331 3300025960 Ga0207651_11112223 Ga0207651_111122232 159
1332 3300025961 Ga0207712_10082756 Ga0207712_100827563 159
1333 3300025972 Ga0207668_10064631 Ga0207668_100646314 159
1334 3300025972 Ga0207668_10069258 Ga0207668_100692583 159
1335 3300025972 Ga0207668_10108642 Ga0207668_101086423 159
1336 3300025972 Ga0207668_10119579 Ga0207668_101195793 159
1337 3300025972 Ga0207668_10151383 Ga0207668_101513833 159
1338 3300025972 Ga0207668_10972115 Ga0207668_109721152 159
1339 3300025981 Ga0207640_10187043 Ga0207640_101870433 159
1340 3300025981 Ga0207640_10450463 Ga0207640_104504632 159
1341 3300025981 Ga0207640_10633117 Ga0207640_106331172 159
1342 3300025981 Ga0207640_11197543 Ga0207640_111975432 159
1343 3300025986 Ga0207658_10059201 Ga0207658_100592013 159
1344 3300025986 Ga0207658_10109147 Ga0207658_101091474 159
1345 3300025986 Ga0207658_10546621 Ga0207658_105466212 159
1346 3300026023 Ga0207677_10073769 Ga0207677_100737694 159
1347 3300026023 Ga0207677_10721331 Ga0207677_107213312 159
1348 3300026023 Ga0207677_10838878 Ga0207677_108388782 159
1349 3300026023 Ga0207677_11112933 Ga0207677_111129331 159
1350 3300026035 Ga0207703_10127440 Ga0207703_101274404 159
1351 3300026035 Ga0207703_10129128 Ga0207703_101291284 159
1352 3300026035 Ga0207703_10473656 Ga0207703_104736562 159
1353 3300026035 Ga0207703_10725421 Ga0207703_107254212 159
1354 3300026035 Ga0207703_10992098 Ga0207703_109920982 159
1355 3300026041 Ga0207639_10034032 Ga0207639_100340323 159
1356 3300026067 Ga0207678_10017857 Ga0207678_100178576 159
1357 3300026067 Ga0207678_10026311 Ga0207678_100263113 159
1358 3300026067 Ga0207678_10033211 Ga0207678_100332115 159
1359 3300026067 Ga0207678_10035164 Ga0207678_100351643 159
1360 3300026067 Ga0207678_10374084 Ga0207678_103740842 159
1361 3300026067 Ga0207678_10596797 Ga0207678_105967972 159
1362 3300026067 Ga0207678_10849948 Ga0207678_108499482 159
1363 3300026075 Ga0207708_10062133 Ga0207708_100621333 159
1364 3300026075 Ga0207708_10521770 Ga0207708_105217702 159
1365 3300026078 Ga0207702_10762169 Ga0207702_107621692 159
1366 3300026088 Ga0207641_10203963 Ga0207641_102039632 159
1367 3300026088 Ga0207641_11198100 Ga0207641_111981001 159
1368 3300026089 Ga0207648_10032340 Ga0207648_100323404 159
1369 3300026089 Ga0207648_10605595 Ga0207648_106055952 159
1370 3300026095 Ga0207676_10068020 Ga0207676_100680202 159
1371 3300026095 Ga0207676_10177406 Ga0207676_101774062 159
1372 3300026116 Ga0207674_10007720 Ga0207674_100077206 159
1373 3300026116 Ga0207674_10328757 Ga0207674_103287573 159
1374 3300026116 Ga0207674_11087386 Ga0207674_110873862 159
1375 3300026118 Ga0207675_100058719 Ga0207675_1000587193 159
1376 3300026118 Ga0207675_100293273 Ga0207675_1002932733 159
1377 3300026118 Ga0207675_100954201 Ga0207675_1009542012 159
1378 3300026118 Ga0207675_101079958 Ga0207675_1010799582 159
1379 3300026121 Ga0207683_10003797 Ga0207683_100037975 159
1380 3300026121 Ga0207683_10068301 Ga0207683_100683016 159
1381 3300026121 Ga0207683_10091282 Ga0207683_100912824 159
1382 3300026121 Ga0207683_10363740 Ga0207683_103637402 159
1383 3300026121 Ga0207683_10539113 Ga0207683_105391132 159
1384 3300026121 Ga0207683_10656745 Ga0207683_106567452 159
1385 3300026121 Ga0207683_10865217 Ga0207683_108652172 159
1386 3300026142 Ga0207698_10132646 Ga0207698_101326464 159
1387 3300026142 Ga0207698_10365103 Ga0207698_103651031 159
1388 3300026142 Ga0207698_11333200 Ga0207698_113332002 159
1389 3300027357 Ga0209589_1000011 Ga0209589_100001139 159
1390 3300027361 Ga0209489_100012 Ga0209489_10001239 159
1391 3300027363 Ga0209700_100019 Ga0209700_10001939 159
1392 3300027512 Ga0209179_1003275 Ga0209179_10032753 159
1393 3300027671 Ga0209588_1012656 Ga0209588_10126563 159
1394 3300027671 Ga0209588_1030031 Ga0209588_10300313 159
1395 3300027866 Ga0209813_10046981 Ga0209813_100469813 159
1396 3300027907 Ga0207428_10255880 Ga0207428_102558803 159
1397 3300028379 Ga0268266_10007625 Ga0268266_100076255 159
1398 3300028379 Ga0268266_10020198 Ga0268266_100201986 159
1399 3300028379 Ga0268266_10056470 Ga0268266_100564705 159
1400 3300028379 Ga0268266_10128490 Ga0268266_101284903 159
1401 3300028380 Ga0268265_10054843 Ga0268265_100548434 159
1402 3300028380 Ga0268265_10170480 Ga0268265_101704803 159
1403 3300028380 Ga0268265_10487539 Ga0268265_104875393 159
1404 3300028380 Ga0268265_10791405 Ga0268265_107914052 159
1405 3300028380 Ga0268265_11299103 Ga0268265_112991031 159
1406 3300028381 Ga0268264_10000030 Ga0268264_10000030240 159
1407 3300028381 Ga0268264_10140299 Ga0268264_101402994 159
1408 3300028556 Ga0265337_1006171 Ga0265337_10061714 159
1409 3300028563 Ga0265319_1011253 Ga0265319_10112534 159
1410 3300028573 Ga0265334_10010046 Ga0265334_100100464 159
1411 3300028653 Ga0265323_10000434 Ga0265323_1000043423 159
1412 3300028654 Ga0265322_10017119 Ga0265322_100171192 159
1413 3300028666 Ga0265336_10000649 Ga0265336_1000064916 159
1414 3300028800 Ga0265338_10000280 Ga0265338_1000028049 159
1415 3300030522 Ga0307512_10162065 Ga0307512_101620653 159
1416 3300030760 Ga0265762_1030524 Ga0265762_10305242 159
1417 3300031235 Ga0265330_10006697 Ga0265330_100066976 159
1418 3300031235 Ga0265330_10016700 Ga0265330_100167004 159
1419 3300031235 Ga0265330_10047707 Ga0265330_100477072 159
1420 3300031238 Ga0265332_10013075 Ga0265332_100130753 159
1421 3300031239 Ga0265328_10277413 Ga0265328_102774131 159
1422 3300031241 Ga0265325_10071434 Ga0265325_100714342 159
1423 3300031247 Ga0265340_10140965 Ga0265340_101409653 159
1424 3300031249 Ga0265339_10173947 Ga0265339_101739472 159
1425 3300031249 Ga0265339_10198075 Ga0265339_101980751 159
1426 3300031249 Ga0265339_10376988 Ga0265339_103769882 159
1427 3300031250 Ga0265331_10068893 Ga0265331_100688933 159
1428 3300031250 Ga0265331_10083507 Ga0265331_100835072 159
1429 3300031344 Ga0265316_10789044 Ga0265316_107890442 159
1430 3300031507 Ga0307509_10014245 Ga0307509_100142452 159
1431 3300031507 Ga0307509_10098111 Ga0307509_100981113 159
1432 3300031507 Ga0307509_10592549 Ga0307509_105925492 159
1433 3300031548 Ga0307408_101558671 Ga0307408_1015586712 159
1434 3300031595 Ga0265313_10063475 Ga0265313_100634753 159
1435 3300031616 Ga0307508_10111858 Ga0307508_101118584 159
1436 3300031616 Ga0307508_10232923 Ga0307508_102329233 159
1437 3300031711 Ga0265314_10099606 Ga0265314_100996063 159
1438 3300031712 Ga0265342_10009847 Ga0265342_100098472 159
1439 3300031712 Ga0265342_10065315 Ga0265342_100653151 159
1440 3300031730 Ga0307516_10005995 Ga0307516_100059958 159
1441 3300031730 Ga0307516_10097075 Ga0307516_100970752 159
1442 3300031730 Ga0307516_10126545 Ga0307516_101265453 159
1443 3300031730 Ga0307516_10401264 Ga0307516_104012642 159
1444 3300031824 Ga0307413_10468445 Ga0307413_104684452 159
1445 3300031852 Ga0307410_10623428 Ga0307410_106234282 159
1446 3300031901 Ga0307406_10744456 Ga0307406_107444562 159
1447 3300031903 Ga0307407_11335175 Ga0307407_113351751 159
1448 3300031911 Ga0307412_10379263 Ga0307412_103792633 159
1449 3300031995 Ga0307409_101524258 Ga0307409_1015242582 159
1450 3300031995 Ga0307409_102086504 Ga0307409_1020865041 159
1451 3300032002 Ga0307416_100747531 Ga0307416_1007475311 159
1452 3300032002 Ga0307416_100778753 Ga0307416_1007787532 159
1453 3300032002 Ga0307416_101034913 Ga0307416_1010349132 159
1454 3300032126 Ga0307415_100233281 Ga0307415_1002332812 159
1455 3300032126 Ga0307415_100825403 Ga0307415_1008254032 159
1456 3300032126 Ga0307415_100925050 Ga0307415_1009250502 159
1457 3300033179 Ga0307507_10329935 Ga0307507_103299351 159
1458 3300033180 Ga0307510_10006305 Ga0307510_1000630510 159
1459 3300033180 Ga0307510_10041581 Ga0307510_100415813 159
1460 3300033544 Ga0316215_1013218 Ga0316215_10132182 159
1461 3300035083 Ga0373926_0044210 Ga0373926_0044210_388_876 159
1462 3300035086 Ga0373934_0031807 Ga0373934_0031807_14_499 159
1463 3300035086 Ga0373934_0035852 Ga0373934_0035852_1102_1590 159
1464 3300035086 Ga0373934_0299123 Ga0373934_0299123_69_548 159
1465 3300035111 Ga0373923_0051442 Ga0373923_0051442_357_845 159
1466 3300035111 Ga0373923_0537138 Ga0373923_0537138_69_560 159
1467 3300035115 Ga0373941_0028234 Ga0373941_0028234_458_937 159
1468 3300035116 Ga0373945_0057394 Ga0373945_0057394_115_606 159
1469 3300035117 Ga0373953_0003406 Ga0373953_0003406_2335_2823 159
1470 3300035117 Ga0373953_0150420 Ga0373953_0150420_209_688 159
1471 3300035118 Ga0373954_0005974 Ga0373954_0005974_3008_3496 159
1472 3300035118 Ga0373954_0339928 Ga0373954_0339928_71_550 159
1473 3300035119 Ga0373956_0056434 Ga0373956_0056434_275_763 159
1474 3300035120 Ga0373957_0020281 Ga0373957_0020281_1757_2245 159
1475 3300035120 Ga0373957_0022105 Ga0373957_0022105_1197_1682 159
1476 3300035120 Ga0373957_0168222 Ga0373957_0168222_86_577 159
1477 3300035170 Ga0373943_0000795 Ga0373943_0000795_11185_11676 159
1478 3300035170 Ga0373943_0153691 Ga0373943_0153691_68_556 159
1479 3300035171 Ga0373946_0006225 Ga0373946_0006225_2899_3390 159
1480 3300035171 Ga0373946_0210640 Ga0373946_0210640_71_550 159
1481 3300035171 Ga0373946_0229166 Ga0373946_0229166_231_719 159
1482 3300035171 Ga0373946_0310404 Ga0373946_0310404_18_497 159
1483 3300035172 Ga0373955_0159501 Ga0373955_0159501_746_1234 159
1484 3300035172 Ga0373955_0179618 Ga0373955_0179618_360_851 159
1485 3300035172 Ga0373955_0627919 Ga0373955_0627919_86_565 159
1486 3300035207 Ga0373942_0032763 Ga0373942_0032763_430_909 159
1487 3300035410 Ga0373924_0009206 Ga0373924_0009206_2889_3380 159
1488 3300035410 Ga0373924_0017906 Ga0373924_0017906_1427_1912 159
1489 3300035691 Ga0373931_0023469 Ga0373931_0023469_587_1066 159
1490 3300035691 Ga0373931_0467324 Ga0373931_0467324_297_776 159
1491 3300035691 Ga0373931_0505071 Ga0373931_0505071_31_522 159
1492 3300035691 Ga0373931_0622424 Ga0373931_0622424_89_568 159
1493 3300035692 Ga0373935_0000536 Ga0373935_0000536_8212_8703 159
1494 3300035692 Ga0373935_0130397 Ga0373935_0130397_883_1362 159
1495 3300035692 Ga0373935_0368091 Ga0373935_0368091_157_645 159
1496 3300035695 Ga0373927_0000898 Ga0373927_0000898_7237_7728 159
1497 3300035695 Ga0373927_0039104 Ga0373927_0039104_1137_1616 159
1498 3300035695 Ga0373927_0110471 Ga0373927_0110471_262_741 159
1499 3300035724 Ga0373933_0382728 Ga0373933_0382728_108_593 159
1500 3300035725 Ga0373947_0010479 Ga0373947_0010479_2717_3208 159
1501 3300035725 Ga0373947_0032481 Ga0373947_0032481_380_868 159
1502 3300036401 Ga0373937_0064227 Ga0373937_0064227_1486_1977 159
1503 3300036401 Ga0373937_0092525 Ga0373937_0092525_1767_2258 159
1504 3300036401 Ga0373937_0095987 Ga0373937_0095987_1145_1624 159
1505 3300036401 Ga0373937_0142169 Ga0373937_0142169_694_1182 159
1506 3300036401 Ga0373937_0285918 Ga0373937_0285918_344_823 159
1507 3300036459 Ga0372808_055570 Ga0372808_055570_48_527 159
1508 3300037068 Ga0373925_0001796 Ga0373925_0001796_1390_1881 159
1509 3300037068 Ga0373925_0168515 Ga0373925_0168515_819_1298 159
1510 3300037068 Ga0373925_0339375 Ga0373925_0339375_303_791 159
1511 3300037068 Ga0373925_0368755 Ga0373925_0368755_651_1139 159
1512 3300037068 Ga0373925_1159596 Ga0373925_1159596_104_589 159
1513 3300037471 Ga0395905_0161613 Ga0395905_0161613_1480_1959 159
1514 3300037853 Ga0436364_0231314 Ga0436364_0231314_1736_2215 159
1515 3300037853 Ga0436364_0807757 Ga0436364_0807757_13_492 159
1516 3300038443 Ga0395901_0137905 Ga0395901_0137905_194_673 159
1517 3300039437 Ga0436365_0679534 Ga0436365_0679534_491_976 159
1518 3300039437 Ga0436365_1425854 Ga0436365_1425854_2164_2652 159
1519 3300039438 Ga0436360_0588427 Ga0436360_0588427_867_1346 159
1520 3300039447 Ga0436361_0518565 Ga0436361_0518565_205_684 159
1521 3300039450 Ga0436363_0142697 Ga0436363_0142697_26_505 159
1522 3300039450 Ga0436363_0923145 Ga0436363_0923145_52_534 159
1523 3300039450 Ga0436363_1556276 Ga0436363_1556276_389_880 159
1524 3300039453 Ga0436362_0868287 Ga0436362_0868287_185_673 159
1525 3300041441 Ga0451787_768313 Ga0451787_768313_105_584 159
1526 3300041451 Ga0451791_1328224 Ga0451791_1328224_64_546 159
1527 3300041452 Ga0451793_0250726 Ga0451793_0250726_468_947 159
1528 3300041458 Ga0451798_0974609 Ga0451798_0974609_87_566 159
1529 3300041486 Ga0451807_1659583 Ga0451807_1659583_72_554 159
1530 3300041509 Ga0451843_0345131 Ga0451843_0345131_15_497 159
1531 3300044842 Ga0466957_0145307 Ga0466957_0145307_570_1049 159
1532 3300046452 Ga0495617_079919 Ga0495617_079919_296_778 159
1533 3300046454 Ga0495592_0029907 Ga0495592_0029907_3182_3673 159
1534 3300046454 Ga0495592_0580120 Ga0495592_0580120_100_585 159
1535 3300046455 Ga0495603_0000046 Ga0495603_0000046_45852_46343 159
1536 3300046455 Ga0495603_0002778 Ga0495603_0002778_4974_5456 159
1537 3300046455 Ga0495603_0040136 Ga0495603_0040136_312_791 159
1538 3300046459 Ga0495629_0000071 Ga0495629_0000071_24346_24837 159
1539 3300046459 Ga0495629_0065563 Ga0495629_0065563_1327_1806 159
1540 3300046459 Ga0495629_0177624 Ga0495629_0177624_972_1457 159
1541 3300046459 Ga0495629_0314481 Ga0495629_0314481_539_1018 159
1542 3300046459 Ga0495629_0410884 Ga0495629_0410884_275_763 159
1543 3300046460 Ga0495638_0373896 Ga0495638_0373896_205_684 159
1544 3300046461 Ga0495641_0009896 Ga0495641_0009896_2293_2784 159
1545 3300046461 Ga0495641_0029184 Ga0495641_0029184_176_658 159
1546 3300046462 Ga0495651_0545205 Ga0495651_0545205_20_505 159
1547 3300046463 Ga0495653_0228910 Ga0495653_0228910_714_1199 159
1548 3300046463 Ga0495653_0702077 Ga0495653_0702077_114_593 159
1549 3300046472 Ga0495580_0000057 Ga0495580_0000057_38065_38556 159
1550 3300046472 Ga0495580_0043983 Ga0495580_0043983_1702_2190 159
1551 3300046472 Ga0495580_0152884 Ga0495580_0152884_146_625 159
1552 3300046473 Ga0495582_0000111 Ga0495582_0000111_16324_16815 159
1553 3300046473 Ga0495582_0082297 Ga0495582_0082297_1021_1509 159
1554 3300046474 Ga0495605_0079481 Ga0495605_0079481_353_832 159
1555 3300046475 Ga0495639_0000108 Ga0495639_0000108_15859_16350 159
1556 3300046475 Ga0495639_0214805 Ga0495639_0214805_165_647 159
1557 3300046476 Ga0495662_0000992 Ga0495662_0000992_1406_1897 159
1558 3300046476 Ga0495662_0020305 Ga0495662_0020305_2546_3034 159
1559 3300046477 Ga0495664_0002718 Ga0495664_0002718_4346_4837 159
1560 3300046477 Ga0495664_0030650 Ga0495664_0030650_2508_2996 159
1561 3300046477 Ga0495664_0122727 Ga0495664_0122727_234_719 159
1562 3300046477 Ga0495664_0325560 Ga0495664_0325560_339_818 159
1563 3300046491 Ga0495584_0515486 Ga0495584_0515486_114_593 159
1564 3300046499 Ga0495594_0000133 Ga0495594_0000133_10878_11369 159
1565 3300046499 Ga0495594_0137260 Ga0495594_0137260_640_1122 159
1566 3300046499 Ga0495594_0573922 Ga0495594_0573922_60_539 159
1567 3300046500 Ga0495596_0105487 Ga0495596_0105487_527_1009 159
1568 3300046501 Ga0495607_0152369 Ga0495607_0152369_422_901 159
1569 3300046501 Ga0495607_0210154 Ga0495607_0210154_350_829 159
1570 3300046507 Ga0495606_0082074 Ga0495606_0082074_443_922 159
1571 3300046507 Ga0495606_0341486 Ga0495606_0341486_58_540 159
1572 3300046511 Ga0495608_0129691 Ga0495608_0129691_116_607 159
1573 3300046514 Ga0495618_0064992 Ga0495618_0064992_1299_1784 159
1574 3300046515 Ga0495620_0293822 Ga0495620_0293822_93_575 159
1575 3300046516 Ga0495628_0074053 Ga0495628_0074053_1327_1818 159
1576 3300046516 Ga0495628_0121239 Ga0495628_0121239_702_1187 159
1577 3300046517 Ga0495630_0000959 Ga0495630_0000959_8774_9265 159
1578 3300046517 Ga0495630_0019164 Ga0495630_0019164_429_917 159
1579 3300046517 Ga0495630_0077623 Ga0495630_0077623_1270_1749 159
1580 3300046519 Ga0495632_0085482 Ga0495632_0085482_173_652 159
1581 3300046520 Ga0495637_0090080 Ga0495637_0090080_629_1108 159
1582 3300046520 Ga0495637_0140225 Ga0495637_0140225_119_601 159
1583 3300046522 Ga0495643_0302495 Ga0495643_0302495_52_534 159
1584 3300046523 Ga0495644_0037867 Ga0495644_0037867_351_830 159
1585 3300046523 Ga0495644_0079264 Ga0495644_0079264_241_726 159
1586 3300046523 Ga0495644_0133893 Ga0495644_0133893_409_891 159
1587 3300046524 Ga0495648_0014927 Ga0495648_0014927_409_888 159
1588 3300046524 Ga0495648_0082027 Ga0495648_0082027_1046_1525 159
1589 3300046524 Ga0495648_0308876 Ga0495648_0308876_11_490 159
1590 3300046528 Ga0495642_0118884 Ga0495642_0118884_13_495 159
1591 3300046528 Ga0495642_0183959 Ga0495642_0183959_206_685 159
1592 3300046529 Ga0495652_0042099 Ga0495652_0042099_1508_1999 159
1593 3300046529 Ga0495652_0220458 Ga0495652_0220458_350_829 159
1594 3300046529 Ga0495652_0444358 Ga0495652_0444358_114_605 159
1595 3300046529 Ga0495652_0535283 Ga0495652_0535283_231_716 159
1596 3300046529 Ga0495652_0721299 Ga0495652_0721299_151_639 159
1597 3300046531 Ga0495665_0000001 Ga0495665_0000001_55443_55934 159
1598 3300046531 Ga0495665_0049613 Ga0495665_0049613_1055_1543 159
1599 3300046533 Ga0495640_0007124 Ga0495640_0007124_5402_5893 159
1600 3300046533 Ga0495640_0012179 Ga0495640_0012179_2730_3221 159
1601 3300046533 Ga0495640_0023983 Ga0495640_0023983_820_1305 159
1602 3300046535 Ga0495586_0078473 Ga0495586_0078473_923_1408 159
1603 3300046536 Ga0495587_0066633 Ga0495587_0066633_1226_1717 159
1604 3300046536 Ga0495587_0209922 Ga0495587_0209922_395_874 159
1605 3300046537 Ga0495598_0024640 Ga0495598_0024640_694_1173 159
1606 3300046537 Ga0495598_0065662 Ga0495598_0065662_371_850 159
1607 3300046538 Ga0495609_0147695 Ga0495609_0147695_178_657 159
1608 3300046542 Ga0495597_0226892 Ga0495597_0226892_183_665 159
1609 3300046543 Ga0495645_0065908 Ga0495645_0065908_1523_2011 159
1610 3300046543 Ga0495645_0159553 Ga0495645_0159553_720_1199 159
1611 3300046543 Ga0495645_0417019 Ga0495645_0417019_93_572 159
1612 3300046557 Ga0495622_0001363 Ga0495622_0001363_9299_9790 159
1613 3300046559 Ga0495667_0193047 Ga0495667_0193047_139_624 159
1614 3300046616 Ga0495668_0082096 Ga0495668_0082096_45_524 159
1615 3300046616 Ga0495668_0236868 Ga0495668_0236868_169_651 159
1616 3300046616 Ga0495668_0361799 Ga0495668_0361799_30_509 159
1617 3300046642 Ga0495634_0000046 Ga0495634_0000046_25888_26379 159
1618 3300046660 Ga0495625_0228992 Ga0495625_0228992_100_582 159
1619 3300046660 Ga0495625_0356125 Ga0495625_0356125_132_614 159
1620 3300046660 Ga0495625_0526855 Ga0495625_0526855_58_540 159
1621 3300046663 Ga0495635_0000338 Ga0495635_0000338_25439_25930 159
1622 3300046663 Ga0495635_0307369 Ga0495635_0307369_36_521 159
1623 3300046663 Ga0495635_0407123 Ga0495635_0407123_107_586 159
1624 3300046663 Ga0495635_0438523 Ga0495635_0438523_295_774 159
1625 3300046664 Ga0495659_0009434 Ga0495659_0009434_1291_1770 159
1626 3300046674 Ga0495588_0001464 Ga0495588_0001464_5231_5722 159
1627 3300046675 Ga0495657_0054792 Ga0495657_0054792_1777_2262 159
1628 3300046678 Ga0495599_0021343 Ga0495599_0021343_559_1050 159
1629 3300046678 Ga0495599_0085667 Ga0495599_0085667_387_878 159
1630 3300046679 Ga0495623_0108103 Ga0495623_0108103_896_1375 159
1631 3300046679 Ga0495623_0157199 Ga0495623_0157199_827_1306 159
1632 3300046679 Ga0495623_0224266 Ga0495623_0224266_439_930 159
1633 3300046680 Ga0495646_0008580 Ga0495646_0008580_3223_3714 159
1634 3300046680 Ga0495646_0055725 Ga0495646_0055725_638_1129 159
1635 3300046681 Ga0495647_0000754 Ga0495647_0000754_5332_5823 159
1636 3300046683 Ga0495658_0000994 Ga0495658_0000994_3522_4013 159
1637 3300046683 Ga0495658_0074262 Ga0495658_0074262_422_901 159
1638 3300046683 Ga0495658_0145919 Ga0495658_0145919_260_748 159
1639 3300046684 Ga0495669_0001990 Ga0495669_0001990_3842_4321 159
1640 3300046684 Ga0495669_0227003 Ga0495669_0227003_251_733 159
1641 3300046684 Ga0495669_0233449 Ga0495669_0233449_365_844 159
1642 3300046689 Ga0495613_0005517 Ga0495613_0005517_181_672 159
1643 3300046689 Ga0495613_0103256 Ga0495613_0103256_1165_1656 159
1644 3300046689 Ga0495613_0162469 Ga0495613_0162469_68_556 159
1645 3300046690 Ga0495624_0003652 Ga0495624_0003652_8075_8566 159
1646 3300046690 Ga0495624_0092157 Ga0495624_0092157_330_821 159
1647 3300046690 Ga0495624_0230376 Ga0495624_0230376_260_748 159
1648 3300046690 Ga0495624_0468409 Ga0495624_0468409_189_671 159
1649 3300046691 Ga0495670_0161747 Ga0495670_0161747_94_573 159
1650 3300046692 Ga0495671_0159475 Ga0495671_0159475_226_708 159
1651 3300046694 Ga0495649_0277609 Ga0495649_0277609_247_729 159
1652 3300046794 Ga0495589_0112277 Ga0495589_0112277_361_840 159
1653 3300046809 Ga0495600_0247155 Ga0495600_0247155_463_951 159
1654 3300046809 Ga0495600_0320588 Ga0495600_0320588_420_911 159
1655 3300046810 Ga0495660_0206592 Ga0495660_0206592_102_584 159
1656 3300047315 Ga0495581_0000012 Ga0495581_0000012_17433_17924 159
1657 3300047315 Ga0495581_0080479 Ga0495581_0080479_1285_1767 159
1658 3300047315 Ga0495581_0161447 Ga0495581_0161447_156_635 159
1659 3300047315 Ga0495581_0544918 Ga0495581_0544918_133_621 159
1660 3300047317 Ga0495604_0071062 Ga0495604_0071062_1431_1922 159
1661 3300047317 Ga0495604_0192614 Ga0495604_0192614_637_1125 159
1662 3300047317 Ga0495604_0208007 Ga0495604_0208007_530_1015 159
1663 3300047317 Ga0495604_0910490 Ga0495604_0910490_35_514 159
1664 3300047319 Ga0495674_0000031 Ga0495674_0000031_23050_23541 159
1665 3300047319 Ga0495674_0049361 Ga0495674_0049361_921_1409 159
1666 3300047319 Ga0495674_0203809 Ga0495674_0203809_91_576 159
1667 3300047319 Ga0495674_0204370 Ga0495674_0204370_992_1471 159
1668 3300047319 Ga0495674_0213934 Ga0495674_0213934_204_683 159
1669 3300047319 Ga0495674_0771308 Ga0495674_0771308_136_627 159
1670 3300047320 Ga0495672_0104425 Ga0495672_0104425_249_731 159
1671 3300047321 Ga0495676_0399032 Ga0495676_0399032_156_644 159
1672 3300047321 Ga0495676_0783887 Ga0495676_0783887_72_563 159
1673 3300047322 Ga0495680_0110891 Ga0495680_0110891_542_1033 159
1674 3300047322 Ga0495680_0193852 Ga0495680_0193852_221_709 159
1675 3300047322 Ga0495680_0359808 Ga0495680_0359808_497_976 159
1676 3300047322 Ga0495680_0521323 Ga0495680_0521323_289_777 159
1677 3300047323 Ga0495683_0140443 Ga0495683_0140443_156_638 159
1678 3300047444 Ga0495675_0132509 Ga0495675_0132509_726_1211 159
1679 3300047444 Ga0495675_0187240 Ga0495675_0187240_640_1131 159
1680 3300047444 Ga0495675_0325266 Ga0495675_0325266_237_716 159
1681 3300047445 Ga0495677_0015930 Ga0495677_0015930_950_1429 159
1682 3300047446 Ga0495679_022313 Ga0495679_022313_513_995 159
1683 3300047447 Ga0495685_143639 Ga0495685_143639_13_492 159
1684 3300047447 Ga0495685_174451 Ga0495685_174451_32_514 159
1685 3300047469 Ga0495673_0121034 Ga0495673_0121034_295_774 159
1686 3300047471 Ga0495684_0005641 Ga0495684_0005641_4279_4767 159
1687 3300047471 Ga0495684_0230085 Ga0495684_0230085_237_728 159
1688 3300047472 Ga0495686_0289914 Ga0495686_0289914_111_590 159
1689 3300047673 Ga0495593_0000008 Ga0495593_0000008_32363_32854 159
1690 3300047673 Ga0495593_0316927 Ga0495593_0316927_250_729 159
1691 3300048088 Ga0495602_0064657 Ga0495602_0064657_1502_1993 159
1692 3300048088 Ga0495602_0138088 Ga0495602_0138088_1389_1874 159
1693 3300048090 Ga0495615_0018473 Ga0495615_0018473_342_821 159
1694 3300048090 Ga0495615_0034571 Ga0495615_0034571_408_887 159
1695 3300048090 Ga0495615_0217610 Ga0495615_0217610_94_573 159
1696 3300048091 Ga0495626_0096064 Ga0495626_0096064_548_1030 159
1697 3300048903 Ga0496100_0057335 Ga0496100_0057335_70_549 159
1698 3300048903 Ga0496100_0591946 Ga0496100_0591946_363_842 159
1699 3300048904 Ga0496101_0006365 Ga0496101_0006365_6079_6558 159
1700 3300048904 Ga0496101_0147253 Ga0496101_0147253_1140_1619 159
1701 3300048904 Ga0496101_0590532 Ga0496101_0590532_64_543 159
1702 3300048904 Ga0496101_1089009 Ga0496101_1089009_52_543 159
1703 3300048905 Ga0496102_0003595 Ga0496102_0003595_5487_5966 159
1704 3300048905 Ga0496102_0100826 Ga0496102_0100826_732_1211 159
1705 3300048905 Ga0496102_0326950 Ga0496102_0326950_112_591 159
1706 3300048905 Ga0496102_0402410 Ga0496102_0402410_583_1062 159
1707 3300048905 Ga0496102_0537843 Ga0496102_0537843_300_779 159
1708 3300048905 Ga0496102_0680337 Ga0496102_0680337_270_749 159
1709 3300048905 Ga0496102_0817436 Ga0496102_0817436_29_520 159
1710 3300048905 Ga0496102_0910493 Ga0496102_0910493_250_729 159
1711 3300048906 Ga0496103_0013766 Ga0496103_0013766_654_1133 159
1712 3300048906 Ga0496103_0086099 Ga0496103_0086099_377_856 159
1713 3300048906 Ga0496103_0183494 Ga0496103_0183494_291_773 159
1714 3300048906 Ga0496103_0205021 Ga0496103_0205021_161_652 159
1715 3300048907 Ga0496104_0056792 Ga0496104_0056792_733_1224 159
1716 3300048909 Ga0496106_0001857 Ga0496106_0001857_4551_5030 159
1717 3300048909 Ga0496106_0029456 Ga0496106_0029456_1749_2228 159
1718 3300048909 Ga0496106_0031714 Ga0496106_0031714_2520_3011 159
1719 3300048909 Ga0496106_0048244 Ga0496106_0048244_196_675 159
1720 3300048909 Ga0496106_0146926 Ga0496106_0146926_800_1279 159
1721 3300048909 Ga0496106_0414878 Ga0496106_0414878_80_562 159
1722 3300048910 Ga0496107_0000947 Ga0496107_0000947_5980_6459 159
1723 3300048910 Ga0496107_0104673 Ga0496107_0104673_946_1428 159
1724 3300048910 Ga0496107_0173695 Ga0496107_0173695_876_1355 159
1725 3300048910 Ga0496107_0381294 Ga0496107_0381294_299_781 159
1726 3300048910 Ga0496107_0462102 Ga0496107_0462102_319_798 159
1727 3300048910 Ga0496107_0546490 Ga0496107_0546490_263_742 159
1728 3300048911 Ga0496108_0013705 Ga0496108_0013705_3003_3482 159
1729 3300048911 Ga0496108_0053689 Ga0496108_0053689_1604_2083 159
1730 3300048911 Ga0496108_0136699 Ga0496108_0136699_226_717 159
1731 3300048912 Ga0496109_0008951 Ga0496109_0008951_5958_6437 159
1732 3300048912 Ga0496109_0048452 Ga0496109_0048452_390_869 159
1733 3300048912 Ga0496109_0220090 Ga0496109_0220090_327_809 159
1734 3300048912 Ga0496109_0312979 Ga0496109_0312979_72_563 159
1735 3300048912 Ga0496109_0506901 Ga0496109_0506901_603_1088 159
1736 3300048912 Ga0496109_0559210 Ga0496109_0559210_119_598 159
1737 3300048912 Ga0496109_1195045 Ga0496109_1195045_185_664 159
1738 3300048912 Ga0496109_1199216 Ga0496109_1199216_60_539 159
1739 3300048913 Ga0496110_0047060 Ga0496110_0047060_1979_2458 159
1740 3300048913 Ga0496110_0132945 Ga0496110_0132945_1094_1585 159
1741 3300048913 Ga0496110_0161087 Ga0496110_0161087_768_1250 159
1742 3300048913 Ga0496110_0498068 Ga0496110_0498068_195_677 159
1743 3300048913 Ga0496110_1226028 Ga0496110_1226028_25_504 159
1744 3300048914 Ga0496111_0039323 Ga0496111_0039323_916_1395 159
1745 3300048914 Ga0496111_0107836 Ga0496111_0107836_1450_1932 159
1746 3300048914 Ga0496111_0423490 Ga0496111_0423490_152_631 159
1747 3300048914 Ga0496111_0602203 Ga0496111_0602203_26_505 159
1748 3300048914 Ga0496111_0771113 Ga0496111_0771113_97_588 159
1749 3300048914 Ga0496111_0993871 Ga0496111_0993871_109_588 159
1750 3300048915 Ga0496112_0000008 Ga0496112_0000008_111238_111717 159
1751 3300048915 Ga0496112_0012760 Ga0496112_0012760_6063_6542 159
1752 3300048915 Ga0496112_0110694 Ga0496112_0110694_869_1351 159
1753 3300048915 Ga0496112_0176405 Ga0496112_0176405_1306_1791 159
1754 3300048915 Ga0496112_0338342 Ga0496112_0338342_680_1159 159
1755 3300048915 Ga0496112_0471865 Ga0496112_0471865_35_514 159
1756 3300048916 Ga0496113_0001327 Ga0496113_0001327_6811_7290 159
1757 3300048916 Ga0496113_0038477 Ga0496113_0038477_2055_2534 159
1758 3300048916 Ga0496113_0111008 Ga0496113_0111008_243_734 159
1759 3300048916 Ga0496113_0153794 Ga0496113_0153794_579_1061 159
1760 3300048917 Ga0496114_0021716 Ga0496114_0021716_4438_4917 159
1761 3300048917 Ga0496114_0024353 Ga0496114_0024353_3230_3709 159
1762 3300048917 Ga0496114_0633259 Ga0496114_0633259_77_562 159
1763 3300048917 Ga0496114_0818246 Ga0496114_0818246_70_552 159
1764 3300048918 Ga0496115_0000604 Ga0496115_0000604_6020_6499 159
1765 3300048918 Ga0496115_0033862 Ga0496115_0033862_1126_1617 159
1766 3300048918 Ga0496115_0071313 Ga0496115_0071313_2121_2603 159
1767 3300048918 Ga0496115_0278603 Ga0496115_0278603_293_772 159
1768 3300048919 Ga0496116_0274032 Ga0496116_0274032_39_521 159
1769 3300048920 Ga0496117_0010071 Ga0496117_0010071_477_956 159
1770 3300048920 Ga0496117_0241697 Ga0496117_0241697_389_871 159
1771 3300048920 Ga0496117_0497679 Ga0496117_0497679_14_496 159
1772 3300048921 Ga0496118_0008611 Ga0496118_0008611_2610_3089 159
1773 3300048922 Ga0496119_0222562 Ga0496119_0222562_395_877 159
1774 3300048924 Ga0496121_0002635 Ga0496121_0002635_18408_18887 159
1775 3300048924 Ga0496121_0010213 Ga0496121_0010213_21_515 159
1776 3300048924 Ga0496121_0017920 Ga0496121_0017920_2008_2490 159
1777 3300048924 Ga0496121_0020183 Ga0496121_0020183_5264_5746 159
1778 3300048924 Ga0496121_0062307 Ga0496121_0062307_1849_2328 159
1779 3300048924 Ga0496121_0195694 Ga0496121_0195694_347_826 159
1780 3300048924 Ga0496121_0237789 Ga0496121_0237789_488_970 159
1781 3300048924 Ga0496121_0263104 Ga0496121_0263104_586_1068 159
1782 3300048927 Ga0496124_0011581 Ga0496124_0011581_4052_4531 159
1783 3300048927 Ga0496124_0137659 Ga0496124_0137659_1009_1488 159
1784 3300048928 Ga0496125_0071057 Ga0496125_0071057_1989_2477 159
1785 3300048928 Ga0496125_0076359 Ga0496125_0076359_1546_2034 159
1786 3300048928 Ga0496125_0131030 Ga0496125_0131030_886_1365 159
1787 3300048929 Ga0496126_0002122 Ga0496126_0002122_25709_26188 159
1788 3300048929 Ga0496126_0008677 Ga0496126_0008677_4224_4706 159
1789 3300048929 Ga0496126_0038000 Ga0496126_0038000_1608_2087 159
1790 3300048929 Ga0496126_0066191 Ga0496126_0066191_398_877 159
1791 3300048929 Ga0496126_0073717 Ga0496126_0073717_184_663 159
1792 3300048929 Ga0496126_0117860 Ga0496126_0117860_711_1193 159
1793 3300048929 Ga0496126_0173025 Ga0496126_0173025_1168_1647 159
1794 3300048929 Ga0496126_0244448 Ga0496126_0244448_151_633 159
1795 3300048929 Ga0496126_0698614 Ga0496126_0698614_138_620 159
1796 3300048929 Ga0496126_1010822 Ga0496126_1010822_38_520 159
1797 3300049572 Ga0501036_0114702 Ga0501036_0114702_918_1400 159
1798 3300049576 Ga0501040_0089179 Ga0501040_0089179_1460_1942 159
1799 3300049577 Ga0501041_0432056 Ga0501041_0432056_315_797 159
1800 3300049583 Ga0501067_0099416 Ga0501067_0099416_1022_1501 159
1801 3300049758 Ga0501241_071706 Ga0501241_071706_104_583 159
1802 3300050490 nmdc:mga03n38_112793_c1 nmdc:mga03n38_112793_c1_652_1131 159
1803 3300050490 nmdc:mga03n38_1351_c1 nmdc:mga03n38_1351_c1_5348_5827 159
1804 3300050490 nmdc:mga03n38_178693_c1 nmdc:mga03n38_178693_c1_23_502 159
1805 3300050491 nmdc:mga00v17_4146_c1 nmdc:mga00v17_4146_c1_3075_3554 159
1806 3300050491 nmdc:mga00v17_648651_c1 nmdc:mga00v17_648651_c1_12_491 159
1807 3300050492 nmdc:mga0yw44_111096_c1 nmdc:mga0yw44_111096_c1_969_1451 159
1808 3300050492 nmdc:mga0yw44_5233_c1 nmdc:mga0yw44_5233_c1_3176_3655 159
1809 3300050493 nmdc:mga0k408_188649_c1 nmdc:mga0k408_188649_c1_534_1013 159
1810 3300050493 nmdc:mga0k408_200248_c1 nmdc:mga0k408_200248_c1_696_1175 159
1811 3300050494 nmdc:mga06z11_220266_c1 nmdc:mga06z11_220266_c1_152_631 159
1812 3300050494 nmdc:mga06z11_61386_c1 nmdc:mga06z11_61386_c1_1441_1920 159
1813 3300050495 nmdc:mga04h51_35189_c1 nmdc:mga04h51_35189_c1_201_680 159
1814 3300050496 nmdc:mga07m45_42075_c1 nmdc:mga07m45_42075_c1_1646_2125 159
1815 3300050496 nmdc:mga07m45_554131_c1 nmdc:mga07m45_554131_c1_141_623 159
1816 3300050507 nmdc:mga05p37_40049_c1 nmdc:mga05p37_40049_c1_1737_2216 159
1817 3300050510 nmdc:mga06r32_1126713_c1 nmdc:mga06r32_1126713_c1_104_583 159
1818 3300050511 nmdc:mga08y16_261869_c1 nmdc:mga08y16_261869_c1_215_694 159
1819 3300050511 nmdc:mga08y16_347781_c1 nmdc:mga08y16_347781_c1_119_598 159
1820 3300050513 nmdc:mga0rr50_102280_c1 nmdc:mga0rr50_102280_c1_1295_1777 159
1821 3300050513 nmdc:mga0rr50_472736_c1 nmdc:mga0rr50_472736_c1_462_947 159
1822 3300050515 nmdc:mga0a205_606513_c1 nmdc:mga0a205_606513_c1_384_866 159
1823 3300050516 nmdc:mga0sz30_110075_c1 nmdc:mga0sz30_110075_c1_569_1051 159
1824 3300053077 Ga0495601_0303104 Ga0495601_0303104_153_638 159
1825 3300053078 Ga0495612_0026650 Ga0495612_0026650_1262_1750 159
1826 3300053079 Ga0500610_0115212 Ga0500610_0115212_367_849 159
1827 3300053083 Ga0495655_0018190 Ga0495655_0018190_1010_1489 159
1828 3300053083 Ga0495655_0112480 Ga0495655_0112480_164_643 159
1829 3300053084 Ga0495595_0009899 Ga0495595_0009899_1696_2187 159
1830 3300053084 Ga0495595_0031623 Ga0495595_0031623_1447_1926 159
1831 3300053085 Ga0495619_0001789 Ga0495619_0001789_2065_2556 159
1832 3300053085 Ga0495619_0017972 Ga0495619_0017972_879_1370 159
1833 3300053085 Ga0495619_0046671 Ga0495619_0046671_2250_2741 159
1834 3300053085 Ga0495619_0424691 Ga0495619_0424691_98_577 159
1835 3300053093 Ga0500651_0035391 Ga0500651_0035391_1249_1731 159
1836 3300053093 Ga0500651_0378594 Ga0500651_0378594_276_758 159
1837 3300053094 Ga0500566_0000293 Ga0500566_0000293_14297_14776 159
1838 3300053096 Ga0500641_0007243 Ga0500641_0007243_2569_3048 159
1839 3300053096 Ga0500641_0034843 Ga0500641_0034843_473_955 159
1840 3300053096 Ga0500641_0207397 Ga0500641_0207397_283_765 159
1841 3300053098 Ga0500650_0064410 Ga0500650_0064410_345_827 159
1842 3300053102 Ga0500554_004219 Ga0500554_004219_2125_2604 159
1843 3300053111 Ga0500572_001006 Ga0500572_001006_2149_2637 159
1844 3300053114 Ga0500582_086196 Ga0500582_086196_542_1024 159
1845 3300053119 Ga0500595_000395 Ga0500595_000395_25749_26228 159
1846 3300053119 Ga0500595_016839 Ga0500595_016839_1743_2225 159
1847 3300053126 Ga0500621_155658 Ga0500621_155658_342_824 159
1848 3300053130 Ga0500642_0042964 Ga0500642_0042964_1218_1700 159
1849 3300053130 Ga0500642_0296984 Ga0500642_0296984_180_662 159
1850 3300053133 Ga0500655_011686 Ga0500655_011686_674_1156 159
1851 3300053136 Ga0500559_0094578 Ga0500559_0094578_777_1256 159
1852 3300053136 Ga0500559_0310354 Ga0500559_0310354_176_655 159
1853 3300053142 Ga0500577_0317177 Ga0500577_0317177_150_632 159
1854 3300053148 Ga0500590_108729 Ga0500590_108729_50_529 159
1855 3300053150 Ga0500603_006349 Ga0500603_006349_1201_1680 159
1856 3300053150 Ga0500603_223630 Ga0500603_223630_45_524 159
1857 3300053156 Ga0500622_0063763 Ga0500622_0063763_279_761 159
1858 3300053156 Ga0500622_0074084 Ga0500622_0074084_1126_1608 159
1859 3300053158 Ga0500627_0026749 Ga0500627_0026749_975_1457 159
1860 3300053158 Ga0500627_0039239 Ga0500627_0039239_857_1339 159
1861 3300053162 Ga0500638_000370 Ga0500638_000370_7713_8192 159
1862 3300053163 Ga0500639_004522 Ga0500639_004522_4408_4896 159
1863 3300053163 Ga0500639_028570 Ga0500639_028570_592_1071 159
1864 3300053177 Ga0500636_0053870 Ga0500636_0053870_1768_2250 159
1865 3300053177 Ga0500636_0171883 Ga0500636_0171883_680_1159 159
1866 3300053177 Ga0500636_0207473 Ga0500636_0207473_509_988 159
1867 3300053178 Ga0500637_0000026 Ga0500637_0000026_36551_37030 159
1868 3300053178 Ga0500637_0056548 Ga0500637_0056548_97_576 159
1869 3300053178 Ga0500637_0079586 Ga0500637_0079586_198_680 159
1870 3300053178 Ga0500637_0082391 Ga0500637_0082391_1179_1658 159
1871 3300053178 Ga0500637_0103093 Ga0500637_0103093_101_580 159
1872 3300053725 Ga0500576_001460 Ga0500576_001460_5864_6352 159
1873 3300053727 Ga0500611_050523 Ga0500611_050523_239_721 159
1874 3300053730 Ga0500645_035199 Ga0500645_035199_18_500 159
1875 3300053731 Ga0500609_024025 Ga0500609_024025_282_764 159
1876 3300053735 Ga0500596_005660 Ga0500596_005660_1004_1483 159
1877 3300055283 Ga0500661_001127 Ga0500661_001127_517_996 159
1878 3300060353 Ga0501082_1175165 Ga0501082_1175165_89_568 159
1879 3300060353 Ga0501082_1273804 Ga0501082_1273804_41_523 159

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13501

SoxY

Sulfur oxidation protein SoxY

40

149

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oxh-assembly3.cif.gz_D the soxyz complex of paracoccus pantotrophus 0.8964 40 151
2nnc-assembly1.cif.gz_A structure of the sulfur carrier protein soxy from chlorobium limicola f thiosulfatophilum 0.8831 36 150
2nnc-assembly1.cif.gz_A structure of the sulfur carrier protein soxy from chlorobium limicola f thiosulfatophilum 0.8683 36 150
2oxg-assembly4.cif.gz_E the soxyz complex of paracoccus pantotrophus 0.8665 57 150
2ox5-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.8661 57 150
ID Description Score Start End Superfamily
2ox5B00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.9056 40 151 2.60.40.2470
2nncA00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.8831 36 150 2.60.40.2470
2nncA00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.8683 36 150 2.60.40.2470
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8665 57 150 2.60.40.10
2ox5B00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.8588 40 151 2.60.40.2470
ID Description Score Start End GO Terms
AF-A0A526YJA9-F1-model_v4 Sulfur oxidation protein SoxY 0.9134 45 134
AF-A0A6N8XHY5-F1-model_v4 Thiosulfate oxidation carrier protein SoxY 0.9038 38 154
AF-A0A364NYZ9-F1-model_v4 Thiosulfate oxidation carrier protein SoxY 0.9002 41 154
AF-A0A258JGA4-F1-model_v4 Thiosulfate oxidation carrier protein SoxY 0.8979 33 155
AF-A0A4V1P8P7-F1-model_v4 Thiosulfate oxidation carrier protein SoxY 0.8976 33 154

Feature Viewer

pLDDT pTM Quality
82.54 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map