metagRoot

F495790

General Info

Members	Datasets	Scaffolds	Average Seq Length
1820	605	1815	131

Family's Representative Sequence

Representative Sequence	3300005467\|Ga0070706_100369668\|Ga0070706_1003696682
Length	160
Sequence	MRHRHGLRKLNRTSSHRLAMLRNMTNSLFTHEAIRTTLPKAKELRRVAEPLITLGKIPTLSNRRLAFDRLRDKEVVYKLFNELGPRYAKRPGGYLRILKFGFRIGDNAPMALVELMDRPEPGVEGEADAAAGEKPAAKGKPRKXXTAEKRRPKARTAAAA

Samples

	Sample ID	Description	Type	Environment
1	2511231002	Polaromonas sp. CF318	Isolate	Rhizosphere
2	2842747753	Variovorax sp. R-72060	Isolate	Unclassified
3	2885192300	Variovorax sp. MHTC-1	Isolate	Rhizosphere
4	2904541872	Variovorax sp. 1615	Isolate	Rhizosphere
5	2929160207	Variovorax sp. R-72349 Hybrid assembly	Isolate	Unclassified
6	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
7	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
8	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
9	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
10	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
11	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
12	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
13	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
14	3300002155	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7	Metagenome	Rhizosphere
15	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
16	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
17	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
18	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
19	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
20	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
21	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
22	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
23	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
24	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
25	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
26	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
27	3300003300	Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
28	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
29	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
30	3300003479	Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
31	3300003565	Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
32	3300003567	Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
33	3300003577	Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
34	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
35	3300003579	Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
36	3300003693	Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
37	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
38	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
39	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
40	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
41	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
42	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
43	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
44	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
45	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
46	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
47	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
48	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
49	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
50	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
51	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
52	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
53	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
54	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
55	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
56	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
57	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
58	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
59	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
60	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
61	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
62	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
63	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
64	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
65	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
66	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
67	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
68	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
69	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
70	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
71	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
72	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
73	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
74	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
75	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
76	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
77	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
78	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
79	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
80	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
81	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
82	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
83	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
84	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
85	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
86	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
87	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
88	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
89	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
90	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
91	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
92	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
93	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
94	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
95	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
96	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
97	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
98	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
99	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
100	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
101	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
102	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
103	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
104	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
105	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
106	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
107	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
108	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
109	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
110	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
111	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
112	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
113	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
114	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
115	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
116	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
117	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
118	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
119	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
120	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
121	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
122	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
123	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
124	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
125	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
126	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
127	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
128	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
129	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
130	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
131	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
132	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
133	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
134	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
135	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
136	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
137	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
138	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
139	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
140	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
141	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
142	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
143	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
144	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
145	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
146	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
147	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
148	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
149	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
150	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
151	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
152	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
153	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
154	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
155	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
156	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
157	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
158	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
159	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
160	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
161	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
162	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
163	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
164	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
165	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
166	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
167	3300012502	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610	Metagenome	Rhizosphere
168	3300012505	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610	Metagenome	Rhizosphere
169	3300012508	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510	Metagenome	Rhizosphere
170	3300012513	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510	Metagenome	Rhizosphere
171	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
172	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
173	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
174	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
175	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
176	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
177	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
178	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
179	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
180	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
181	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
182	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
183	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
184	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
185	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
186	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
187	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
188	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
189	3300015683	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04	Metagenome	Rhizosphere
190	3300016635	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10	Metagenome	Rhizosphere
191	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
192	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
193	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
194	3300020076	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3)	Metatranscriptome	Rhizosphere
195	3300020077	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
196	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
197	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
198	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
199	3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
200	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
201	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
202	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
203	3300023564	Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI4 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
204	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
205	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
206	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
207	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
208	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
209	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
210	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
211	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
212	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
213	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
214	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
215	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
216	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
217	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
218	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
219	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
220	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
221	3300025271	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
223	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
224	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
225	3300025290	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2)	Metagenome	Rhizosphere
226	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
227	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
228	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
229	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
230	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
231	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
232	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
233	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
234	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
235	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
236	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
254	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
255	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
256	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
257	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
258	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
259	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
260	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
261	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
262	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
263	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
264	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
265	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
266	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
267	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
268	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
269	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
270	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
271	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
272	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
273	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
274	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
275	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
276	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
277	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
278	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
279	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
280	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
281	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
282	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
283	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
284	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
285	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
286	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
287	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
288	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
289	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
290	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
291	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
292	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
293	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
294	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
295	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
296	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
297	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
298	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
299	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
300	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
301	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
302	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
303	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
304	3300027252	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
305	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
306	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
307	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
308	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
309	3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
310	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
311	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
312	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
313	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
314	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
315	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
316	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
317	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
318	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
319	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
320	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
321	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
322	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
323	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
324	3300030732	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1	Metagenome	Rhizosphere
325	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
326	3300030734	Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5	Metagenome	Rhizosphere
327	3300030735	Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4	Metagenome	Rhizosphere
328	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
329	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
330	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
331	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
332	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
333	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
334	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
335	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
336	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
337	3300031667	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
338	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
339	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
340	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
341	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
342	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
343	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
344	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
345	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
346	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
347	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
348	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
349	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
350	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
351	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
352	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
353	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
354	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
355	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
356	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
357	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
358	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
359	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
360	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
361	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
362	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
363	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
364	3300036534	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
365	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
366	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
367	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
368	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
369	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
370	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
371	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
372	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
373	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
374	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
375	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
376	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
377	3300041458	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG	Metagenome	Rhizoplane
378	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
379	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
380	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
381	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
382	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
383	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
384	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
385	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
386	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
387	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
388	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
389	3300042121	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398	Metagenome	Rhizosphere
390	3300042126	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87	Metagenome	Rhizosphere
391	3300042135	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127	Metagenome	Rhizosphere
392	3300042144	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89	Metagenome	Rhizosphere
393	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
394	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
395	3300042185	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592	Metagenome	Rhizosphere
396	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
397	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
398	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
399	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
400	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
401	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
402	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
403	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
404	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
405	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
406	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
407	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
408	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
409	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
410	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
411	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
412	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
413	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
414	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
415	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
416	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
417	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
418	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
419	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
420	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
421	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
422	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
423	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
424	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
425	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
426	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
427	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
428	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
429	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
430	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
431	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
432	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
433	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
434	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
435	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
436	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
437	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
438	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
439	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
440	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
441	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
442	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
443	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
444	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
445	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
446	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
447	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
448	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
449	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
450	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
451	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
452	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
453	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
454	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
455	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
456	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
457	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
458	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
459	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
460	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
461	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
462	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
463	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
464	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
465	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
466	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
467	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
468	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
469	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
470	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
471	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
472	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
473	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
474	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
475	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
476	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
477	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
478	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
479	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
480	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
481	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
482	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
483	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
484	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
485	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
486	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
487	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
488	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
489	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
490	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
491	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
492	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
493	3300048986	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E	Metagenome	Unclassified
494	3300049127	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
495	3300049129	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
496	3300049130	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
497	3300049131	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
498	3300049160	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
499	3300049161	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
500	3300049162	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
501	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
502	3300049527	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
503	3300049528	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
504	3300049530	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
505	3300049531	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
506	3300049532	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
507	3300049533	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
508	3300049534	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
509	3300049535	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
510	3300049536	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
511	3300049537	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
512	3300049539	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
513	3300049540	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
514	3300049541	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
515	3300049547	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
516	3300049549	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
517	3300049551	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
518	3300049552	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
519	3300049553	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
520	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
521	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
522	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
523	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
524	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
525	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
526	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
527	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
528	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
529	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
530	3300049653	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control	Metagenome	Rhizosphere
531	3300049660	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control	Metagenome	Rhizosphere
532	3300049663	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought	Metagenome	Rhizosphere
533	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
534	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
535	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
536	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
537	3300049759	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought	Metagenome	Rhizosphere
538	3300049763	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control	Metagenome	Rhizosphere
539	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
540	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
541	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
542	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
543	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
544	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
545	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
546	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
547	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
548	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
549	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
550	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
551	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
552	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
553	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
554	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
555	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
556	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
557	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
558	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
559	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
560	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
561	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
562	3300053110	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere	Metagenome	Endosphere
563	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
564	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
565	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
566	3300053120	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere	Metagenome	Endosphere
567	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
568	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
569	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
570	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
571	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
572	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
573	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
574	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
575	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
576	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
577	3300053141	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere	Metagenome	Endosphere
578	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
579	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
580	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
581	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
582	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
583	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
584	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
585	3300053734	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere	Metagenome	Endosphere
586	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
587	3300059477	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
588	3300059491	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
589	3300059503	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
590	3300059504	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
591	3300059505	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
592	3300059506	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
593	3300059511	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
594	3300059512	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
595	3300059604	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
596	3300059627	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
597	3300059630	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
598	3300059643	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
599	3300059645	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
600	3300059647	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
601	3300059652	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
602	3300060344	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
603	3300060346	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
604	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
605	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	94.23
Metatranscriptomes	5.49
Isolates	0.27

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	12.86
Nodule	0.11
Rhizoplane	2.47
Rhizosphere	80.55
Stem	0
Stem Tuber	0
Unclassified	4.01

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10000716	3300001979	Bacteria	14401
2	JGI24740J21852_10005834	3300001979	Bacteria	5166
3	JGI24740J21852_10011491	3300001979	Bacteria	3369
4	JGI24740J21852_10011547	3300001979	Bacteria	3359
5	JGI24740J21852_10011575	3300001979	Bacteria	3355
6	JGI24740J21852_10064486	3300001979	Bacteria	999
7	JGI24740J21852_10148927	3300001979	Bacteria	582
8	JGI24739J22299_10007473	3300001989	Bacteria	4098
9	JGI24739J22299_10007854	3300001989	Bacteria	3991
10	JGI24739J22299_10009692	3300001989	Bacteria	3585
11	JGI24739J22299_10027431	3300001989	Bacteria	1990
12	JGI24737J22298_10008217	3300001990	Bacteria	3501
13	JGI24737J22298_10008286	3300001990	Bacteria	3485
14	JGI24737J22298_10029964	3300001990	Bacteria	1704
15	JGI24735J21928_10002193	3300002067	Bacteria	6859
16	JGI24735J21928_10005321	3300002067	Bacteria	4271
17	JGI24735J21928_10011200	3300002067	Bacteria	2847
18	JGI24735J21928_10053916	3300002067	Bacteria	1158
19	JGI24750J21931_1080679	3300002070	Bacteria	541
20	JGI24738J21930_10002092	3300002075	Bacteria	5342
21	JGI24738J21930_10077393	3300002075	Bacteria	694
22	JGI24749J21850_1071379	3300002076	Bacteria	537
23	JGI24744J21845_10033802	3300002077	Bacteria	972
24	JGI24033J26618_1001626	3300002155	Bacteria	2233
25	JGI24034J26672_10024192	3300002239	Bacteria	966
26	JGI24742J22300_10101625	3300002244	Bacteria	557
27	JGI25156J39149_1000085	3300002705	Bacteria	69953
28	JGI25156J39149_1003704	3300002705	Bacteria	4895
29	JGI25156J39149_1056363	3300002705	Bacteria	505
30	JGI25154J39366_1000112	3300002738	Bacteria	69961
31	JGI25158J39367_1029465	3300002739	Bacteria	627
32	JGI25157J39369_1000109	3300002741	Bacteria	69961
33	JGI25164J39214_1012390	3300002772	Bacteria	807
34	JGI25152J39213_1010337	3300002773	Bacteria	2144
35	JGI25150J39212_1007029	3300002774	Bacteria	2285
36	JGI25150J39212_1015771	3300002774	Bacteria	1251
37	JGI25159J45721_1000105	3300002987	Bacteria	39991
38	JGI25151J46595_10003596	3300003187	Bacteria	8494
39	JGI25151J46595_10043484	3300003187	Bacteria	1607
40	JGI25151J46595_10108902	3300003187	Bacteria	728
41	JGI25165J46597_1002750	3300003214	Bacteria	5164
42	Ga0006758J48902_1022226	3300003300	Bacteria	1001
43	JGI25160J50197_1000204	3300003354	Bacteria	49352
44	JGI25160J50197_1014365	3300003354	Bacteria	2652
45	JGI25160J50197_1024894	3300003354	Bacteria	1688
46	JGI25161J50226_1000036	3300003374	Bacteria	133407
47	JGI25161J50226_1007514	3300003374	Bacteria	1817
48	JGI25161J50226_1015965	3300003374	Bacteria	811
49	Ga0006556J51387_1013500	3300003479	Bacteria	15419
50	Ga0006560J51390_1020307	3300003565	Bacteria	14892
51	Ga0006554J51385_1017299	3300003567	Bacteria	14985
52	Ga0007416J51690_1051518	3300003577	Bacteria	761
53	Ga0006562J51391_1076814	3300003578	Bacteria	560
54	Ga0007429J51699_1068999	3300003579	Bacteria	822
55	Ga0032354_1013175	3300003693	Bacteria	5546
56	Ga0032354_1094894	3300003693	Bacteria	556
57	Ga0032354_1110879	3300003693	Bacteria	608
58	Ga0055533_1000655	3300003756	Bacteria	11575
59	Ga0055532_1000261	3300003758	Bacteria	35339
60	Ga0055532_1001878	3300003758	Bacteria	5079
61	Ga0055527_1000035	3300003760	Bacteria	138481
62	Ga0055527_1004604	3300003760	Bacteria	1873
63	Ga0055535_1000050	3300003761	Bacteria	138481
64	Ga0055535_1000874	3300003761	Bacteria	21113
65	Ga0055542_1000003	3300003762	Bacteria	582721
66	Ga0055542_1000512	3300003762	Bacteria	35339
67	Ga0055529_1000089	3300003763	Bacteria	138481
68	Ga0055526_1042006	3300003771	Bacteria	1132
69	Ga0055526_1046455	3300003771	Bacteria	1028
70	Ga0055526_1066652	3300003771	Bacteria	745
71	Ga0055526_1066856	3300003771	Bacteria	743
72	Ga0055537_1000615	3300003773	Bacteria	19568
73	Ga0055537_1000800	3300003773	Bacteria	15618
74	Ga0055537_1005335	3300003773	Bacteria	3466
75	Ga0055524_1000145	3300003775	Bacteria	84202
76	Ga0055524_1050814	3300003775	Bacteria	942
77	Ga0055536_1016731	3300003781	Bacteria	2438
78	Ga0055536_1042517	3300003781	Bacteria	1062
79	Ga0055536_1075132	3300003781	Bacteria	655
80	Ga0055534_1000565	3300003784	Bacteria	19573
81	Ga0055534_1001443	3300003784	Bacteria	9457
82	Ga0055534_1006286	3300003784	Bacteria	3013
83	Ga0055534_1020269	3300003784	Bacteria	1127
84	Ga0055528_1000489	3300003790	Bacteria	31350
85	Ga0055528_1000762	3300003790	Bacteria	22492
86	Ga0055528_1012584	3300003790	Bacteria	3271
87	Ga0055528_1028583	3300003790	Bacteria	1534
88	Ga0055530_10002021	3300003791	Bacteria	13714
89	Ga0055530_10025615	3300003791	Bacteria	1644
90	Ga0055530_10061355	3300003791	Bacteria	837
91	Ga0055540_1000137	3300003792	Bacteria	73229
92	Ga0055540_1013421	3300003792	Bacteria	2502
93	Ga0055531_10002851	3300003794	Bacteria	11286
94	Ga0055531_10004613	3300003794	Bacteria	8286
95	Ga0055531_10037274	3300003794	Bacteria	1482
96	Ga0055531_10079012	3300003794	Bacteria	731
97	Ga0055541_1010086	3300003841	Bacteria	1435
98	Ga0058692_1003682	3300003856	Bacteria	4681
99	Ga0055543_1000157	3300004625	Bacteria	57172
100	Ga0065165_1000885	3300005262	Bacteria	38659
101	Ga0065165_1015803	3300005262	Bacteria	2860
102	Ga0065165_1020181	3300005262	Bacteria	2353
103	Ga0065165_1028476	3300005262	Bacteria	1803
104	Ga0065165_1110876	3300005262	Bacteria	675
105	Ga0065714_10297130	3300005288	Bacteria	644
106	Ga0065714_10441357	3300005288	Bacteria	546
107	Ga0065704_10018258	3300005289	Bacteria	1377
108	Ga0065715_10098485	3300005293	Bacteria	3540
109	Ga0070658_10019083	3300005327	Bacteria	5492
110	Ga0070658_10031440	3300005327	Bacteria	4262
111	Ga0070658_10067485	3300005327	Bacteria	2922
112	Ga0070658_10187030	3300005327	Bacteria	1745
113	Ga0070658_10231738	3300005327	Bacteria	1564
114	Ga0070658_10330455	3300005327	Bacteria	1303
115	Ga0070658_10600718	3300005327	Bacteria	954
116	Ga0070658_11223859	3300005327	Bacteria	653
117	Ga0070658_11333962	3300005327	Bacteria	623
118	Ga0070676_10000304	3300005328	Bacteria	22103
119	Ga0070676_10011859	3300005328	Bacteria	4747
120	Ga0070676_10042665	3300005328	Bacteria	2635
121	Ga0070676_10445171	3300005328	Bacteria	910
122	Ga0070676_10976607	3300005328	Bacteria	634
123	Ga0070676_11522016	3300005328	Bacteria	515
124	Ga0070683_100021958	3300005329	Bacteria	5698
125	Ga0070683_100203983	3300005329	Bacteria	1878
126	Ga0070683_100636061	3300005329	Bacteria	1021
127	Ga0070690_100032680	3300005330	Bacteria	3251
128	Ga0070690_100078894	3300005330	Bacteria	2152
129	Ga0070670_100000715	3300005331	Bacteria	25793
130	Ga0070670_100025395	3300005331	Bacteria	5098
131	Ga0070670_100111565	3300005331	Bacteria	2357
132	Ga0070670_100117500	3300005331	Bacteria	2293
133	Ga0070670_100131564	3300005331	Bacteria	2161
134	Ga0070670_100163686	3300005331	Bacteria	1928
135	Ga0070670_100289373	3300005331	Bacteria	1431
136	Ga0070670_100344849	3300005331	Bacteria	1308
137	Ga0070670_100611574	3300005331	Bacteria	976
138	Ga0070670_101459431	3300005331	Bacteria	628
139	Ga0070677_10000489	3300005333	Bacteria	13647
140	Ga0070677_10017840	3300005333	Bacteria	2547
141	Ga0070677_10253535	3300005333	Bacteria	875
142	Ga0068869_100001730	3300005334	Bacteria	13036
143	Ga0068869_100011497	3300005334	Bacteria	5807
144	Ga0068869_100085286	3300005334	Bacteria	2365
145	Ga0068869_100922795	3300005334	Bacteria	757
146	Ga0068869_101504713	3300005334	Bacteria	598
147	Ga0070666_10019754	3300005335	Bacteria	4353
148	Ga0070666_10059174	3300005335	Bacteria	2591
149	Ga0070666_10094322	3300005335	Bacteria	2059
150	Ga0070666_10201346	3300005335	Bacteria	1401
151	Ga0070666_10556378	3300005335	Bacteria	834
152	Ga0070666_11037380	3300005335	Bacteria	609
153	Ga0070680_100315946	3300005336	Bacteria	1326
154	Ga0070680_100333100	3300005336	Bacteria	1289
155	Ga0070680_100500637	3300005336	Bacteria	1039
156	Ga0070682_100720997	3300005337	Bacteria	802
157	Ga0070682_101259012	3300005337	Bacteria	627
158	Ga0068868_100011298	3300005338	Bacteria	6501
159	Ga0068868_100020504	3300005338	Bacteria	4969
160	Ga0068868_100052562	3300005338	Bacteria	3207
161	Ga0068868_100074415	3300005338	Bacteria	2713
162	Ga0068868_100166070	3300005338	Bacteria	1826
163	Ga0068868_100824019	3300005338	Bacteria	839
164	Ga0068868_100869026	3300005338	Bacteria	818
165	Ga0068868_100935386	3300005338	Bacteria	790
166	Ga0068868_101060186	3300005338	Bacteria	744
167	Ga0070660_100000025	3300005339	Bacteria	90277
168	Ga0070660_100006994	3300005339	Bacteria	7831
169	Ga0070660_100017595	3300005339	Bacteria	5211
170	Ga0070660_100028918	3300005339	Bacteria	4150
171	Ga0070660_100033307	3300005339	Bacteria	3884
172	Ga0070660_100104773	3300005339	Bacteria	2244
173	Ga0070660_100115365	3300005339	Bacteria	2141
174	Ga0070660_100772145	3300005339	Bacteria	807
175	Ga0070660_101188259	3300005339	Bacteria	646
176	Ga0070689_100160532	3300005340	Bacteria	1817
177	Ga0070689_101474670	3300005340	Bacteria	616
178	Ga0070687_100021912	3300005343	Bacteria	3012
179	Ga0070661_100009066	3300005344	Bacteria	6883
180	Ga0070661_100022855	3300005344	Bacteria	4477
181	Ga0070661_100028880	3300005344	Bacteria	4002
182	Ga0070661_100058231	3300005344	Bacteria	2831
183	Ga0070661_100103115	3300005344	Bacteria	2124
184	Ga0070661_100103571	3300005344	Bacteria	2120
185	Ga0070661_100118870	3300005344	Bacteria	1978
186	Ga0070661_100203119	3300005344	Bacteria	1515
187	Ga0070661_100280408	3300005344	Bacteria	1293
188	Ga0070661_100302329	3300005344	Bacteria	1246
189	Ga0070661_100302939	3300005344	Bacteria	1244
190	Ga0070661_100513142	3300005344	Bacteria	961
191	Ga0070692_10041318	3300005345	Bacteria	2361
192	Ga0070692_10329338	3300005345	Bacteria	942
193	Ga0070668_100000779	3300005347	Bacteria	21987
194	Ga0070668_100001341	3300005347	Bacteria	17586
195	Ga0070668_100002853	3300005347	Bacteria	12739
196	Ga0070668_100045758	3300005347	Bacteria	3358
197	Ga0070668_100100555	3300005347	Bacteria	2291
198	Ga0070668_100142075	3300005347	Bacteria	1935
199	Ga0070668_100642392	3300005347	Bacteria	932
200	Ga0070668_101281690	3300005347	Bacteria	666
201	Ga0070669_100000668	3300005353	Bacteria	25208
202	Ga0070669_100044244	3300005353	Bacteria	3244
203	Ga0070669_100049498	3300005353	Bacteria	3067
204	Ga0070669_100081657	3300005353	Bacteria	2409
205	Ga0070669_100127117	3300005353	Bacteria	1951
206	Ga0070669_100876952	3300005353	Bacteria	766
207	Ga0070669_100886421	3300005353	Bacteria	761
208	Ga0070675_100001258	3300005354	Bacteria	18530
209	Ga0070675_100007692	3300005354	Bacteria	8341
210	Ga0070675_100118924	3300005354	Bacteria	2243
211	Ga0070675_100137932	3300005354	Bacteria	2083
212	Ga0070675_100714742	3300005354	Bacteria	913
213	Ga0070675_100981130	3300005354	Bacteria	775
214	Ga0070675_101697624	3300005354	Bacteria	583
215	Ga0070671_100003196	3300005355	Bacteria	12775
216	Ga0070671_100004906	3300005355	Bacteria	10647
217	Ga0070671_100010289	3300005355	Bacteria	7504
218	Ga0070671_100063047	3300005355	Bacteria	3086
219	Ga0070671_100083572	3300005355	Bacteria	2670
220	Ga0070671_100182356	3300005355	Bacteria	1777
221	Ga0070671_100202028	3300005355	Bacteria	1685
222	Ga0070671_100406083	3300005355	Bacteria	1166
223	Ga0070671_100579364	3300005355	Bacteria	969
224	Ga0070671_100768612	3300005355	Bacteria	838
225	Ga0070671_100833901	3300005355	Bacteria	804
226	Ga0070671_100857179	3300005355	Bacteria	793
227	Ga0070674_100000737	3300005356	Bacteria	16729
228	Ga0070674_100027353	3300005356	Bacteria	3737
229	Ga0070674_100136747	3300005356	Bacteria	1834
230	Ga0070674_100387427	3300005356	Bacteria	1138
231	Ga0070674_100905593	3300005356	Bacteria	769
232	Ga0070674_101402484	3300005356	Bacteria	626
233	Ga0070673_100000729	3300005364	Bacteria	18191
234	Ga0070673_100154263	3300005364	Bacteria	1948
235	Ga0070673_100175971	3300005364	Bacteria	1829
236	Ga0070673_100637192	3300005364	Bacteria	974
237	Ga0070673_100654868	3300005364	Bacteria	962
238	Ga0070673_100899439	3300005364	Bacteria	821
239	Ga0070673_101005268	3300005364	Bacteria	776
240	Ga0070673_101866686	3300005364	Bacteria	570
241	Ga0070673_102407646	3300005364	Bacteria	501
242	Ga0070688_100078708	3300005365	Bacteria	2127
243	Ga0070688_100182762	3300005365	Bacteria	1456
244	Ga0070688_100486270	3300005365	Bacteria	929
245	Ga0070659_100000426	3300005366	Bacteria	31940
246	Ga0070659_100019728	3300005366	Bacteria	5115
247	Ga0070659_100020070	3300005366	Bacteria	5074
248	Ga0070659_100027593	3300005366	Bacteria	4377
249	Ga0070659_100091948	3300005366	Bacteria	2432
250	Ga0070659_100185032	3300005366	Bacteria	1710
251	Ga0070659_100560429	3300005366	Bacteria	979
252	Ga0070659_100661077	3300005366	Bacteria	901
253	Ga0070659_100773428	3300005366	Bacteria	834
254	Ga0070659_101545748	3300005366	Bacteria	592
255	Ga0070667_100004919	3300005367	Bacteria	11200
256	Ga0070667_100005264	3300005367	Bacteria	10819
257	Ga0070667_100037796	3300005367	Bacteria	4047
258	Ga0070667_100089806	3300005367	Bacteria	2639
259	Ga0070667_100119215	3300005367	Bacteria	2294
260	Ga0070667_100232076	3300005367	Bacteria	1646
261	Ga0070667_100253290	3300005367	Bacteria	1574
262	Ga0070667_100327852	3300005367	Bacteria	1382
263	Ga0070667_100512002	3300005367	Bacteria	1101
264	Ga0070667_101397522	3300005367	Bacteria	656
265	Ga0070667_102158284	3300005367	Bacteria	525
266	Ga0070709_10067143	3300005434	Bacteria	2302
267	Ga0070709_10204907	3300005434	Bacteria	1399
268	Ga0070714_100009061	3300005435	Bacteria	7801
269	Ga0070714_100183866	3300005435	Bacteria	1903
270	Ga0070714_100208931	3300005435	Bacteria	1788
271	Ga0070714_100554553	3300005435	Bacteria	1100
272	Ga0070713_100000028	3300005436	Bacteria	93227
273	Ga0070713_100120010	3300005436	Bacteria	2304
274	Ga0070713_101524478	3300005436	Bacteria	649
275	Ga0070710_10052959	3300005437	Bacteria	2284
276	Ga0070710_10862464	3300005437	Bacteria	651
277	Ga0070701_10182430	3300005438	Bacteria	1230
278	Ga0070711_100030431	3300005439	Bacteria	3573
279	Ga0070711_100910655	3300005439	Bacteria	751
280	Ga0070711_101114990	3300005439	Bacteria	680
281	Ga0070705_100529230	3300005440	Bacteria	900
282	Ga0070705_101020331	3300005440	Bacteria	672
283	Ga0070700_100041749	3300005441	Bacteria	2813
284	Ga0070700_100466931	3300005441	Bacteria	964
285	Ga0070700_100505199	3300005441	Bacteria	931
286	Ga0070700_100938288	3300005441	Bacteria	707
287	Ga0070708_100291271	3300005445	Bacteria	1537
288	Ga0070663_100001396	3300005455	Bacteria	13185
289	Ga0070663_100022370	3300005455	Bacteria	4227
290	Ga0070663_100026432	3300005455	Bacteria	3932
291	Ga0070663_100035325	3300005455	Bacteria	3468
292	Ga0070663_100060645	3300005455	Bacteria	2722
293	Ga0070663_100142929	3300005455	Bacteria	1828
294	Ga0070663_100195837	3300005455	Bacteria	1575
295	Ga0070663_100394663	3300005455	Bacteria	1130
296	Ga0070663_100732787	3300005455	Bacteria	843
297	Ga0070663_101198865	3300005455	Bacteria	667
298	Ga0070663_101461669	3300005455	Bacteria	607
299	Ga0070678_100003201	3300005456	Bacteria	9087
300	Ga0070678_100081176	3300005456	Bacteria	2458
301	Ga0070678_100120070	3300005456	Bacteria	2071
302	Ga0070678_100546173	3300005456	Bacteria	1028
303	Ga0070678_100896397	3300005456	Bacteria	810
304	Ga0070678_101027408	3300005456	Bacteria	758
305	Ga0070678_101172064	3300005456	Bacteria	712
306	Ga0070662_100008353	3300005457	Bacteria	6747
307	Ga0070662_100079370	3300005457	Bacteria	2440
308	Ga0070662_100418381	3300005457	Bacteria	1108
309	Ga0070662_100691223	3300005457	Bacteria	862
310	Ga0070662_100772581	3300005457	Bacteria	816
311	Ga0070662_100793765	3300005457	Bacteria	805
312	Ga0070662_101532189	3300005457	Bacteria	575
313	Ga0070662_101637478	3300005457	Bacteria	556
314	Ga0070681_10016094	3300005458	Bacteria	7454
315	Ga0070681_10038903	3300005458	Bacteria	4769
316	Ga0070681_10545894	3300005458	Bacteria	1073
317	Ga0068867_100000975	3300005459	Bacteria	19545
318	Ga0068867_100041796	3300005459	Bacteria	3351
319	Ga0068867_100055511	3300005459	Bacteria	2929
320	Ga0068867_100145055	3300005459	Bacteria	1859
321	Ga0068867_100283415	3300005459	Bacteria	1359
322	Ga0068867_100324715	3300005459	Bacteria	1276
323	Ga0068867_100617122	3300005459	Bacteria	948
324	Ga0068867_101182597	3300005459	Bacteria	701
325	Ga0068867_101601436	3300005459	Bacteria	609
326	Ga0068867_101731653	3300005459	Bacteria	586
327	Ga0068867_101919921	3300005459	Bacteria	558
328	Ga0070685_10238839	3300005466	Bacteria	1199
329	Ga0070685_10457887	3300005466	Bacteria	895
330	Ga0070685_10788049	3300005466	Bacteria	700
331	Ga0070706_100369668	3300005467	Bacteria	1336
332	Ga0070707_101618021	3300005468	Bacteria	615
333	Ga0070698_100290312	3300005471	Bacteria	1567
334	Ga0070699_100008010	3300005518	Bacteria	9174
335	Ga0070699_100164052	3300005518	Bacteria	1967
336	Ga0070699_100317831	3300005518	Bacteria	1399
337	Ga0070679_100014871	3300005530	Bacteria	7476
338	Ga0070679_100070200	3300005530	Bacteria	3495
339	Ga0070679_100091345	3300005530	Bacteria	3033
340	Ga0070679_100362091	3300005530	Bacteria	1398
341	Ga0070679_100713692	3300005530	Bacteria	945
342	Ga0070679_100882671	3300005530	Bacteria	838
343	Ga0070679_101303203	3300005530	Bacteria	672
344	Ga0070684_100012246	3300005535	Bacteria	6867
345	Ga0070684_100035140	3300005535	Bacteria	4288
346	Ga0070684_100039795	3300005535	Bacteria	4045
347	Ga0068853_100038086	3300005539	Bacteria	4094
348	Ga0068853_100063561	3300005539	Bacteria	3197
349	Ga0068853_100066150	3300005539	Bacteria	3138
350	Ga0068853_100070402	3300005539	Bacteria	3045
351	Ga0068853_100091266	3300005539	Bacteria	2679
352	Ga0068853_100144788	3300005539	Bacteria	2135
353	Ga0068853_100237452	3300005539	Bacteria	1669
354	Ga0068853_100239411	3300005539	Bacteria	1663
355	Ga0068853_100535941	3300005539	Bacteria	1108
356	Ga0068853_100612465	3300005539	Bacteria	1035
357	Ga0068853_101135968	3300005539	Bacteria	754
358	Ga0070672_100000287	3300005543	Bacteria	28567
359	Ga0070672_100001456	3300005543	Bacteria	14663
360	Ga0070672_100013687	3300005543	Bacteria	5736
361	Ga0070672_100014087	3300005543	Bacteria	5659
362	Ga0070672_100041046	3300005543	Bacteria	3554
363	Ga0070672_100139452	3300005543	Bacteria	1999
364	Ga0070672_100603466	3300005543	Bacteria	956
365	Ga0070672_100606598	3300005543	Bacteria	954
366	Ga0070672_100959866	3300005543	Bacteria	757
367	Ga0070672_101298809	3300005543	Bacteria	650
368	Ga0070672_101762477	3300005543	Bacteria	556
369	Ga0070686_100155249	3300005544	Bacteria	1606
370	Ga0070686_100540978	3300005544	Bacteria	910
371	Ga0070695_101009461	3300005545	Bacteria	677
372	Ga0070696_101205323	3300005546	Bacteria	640
373	Ga0070693_100018179	3300005547	Bacteria	3668
374	Ga0070693_100468266	3300005547	Bacteria	888
375	Ga0070693_100636295	3300005547	Bacteria	774
376	Ga0070693_101251835	3300005547	Bacteria	572
377	Ga0070665_100008986	3300005548	Bacteria	10122
378	Ga0070665_100023377	3300005548	Bacteria	6222
379	Ga0070665_100031122	3300005548	Bacteria	5371
380	Ga0070665_100088437	3300005548	Bacteria	3104
381	Ga0070665_100289454	3300005548	Bacteria	1640
382	Ga0070665_100463687	3300005548	Bacteria	1277
383	Ga0070665_100464622	3300005548	Bacteria	1276
384	Ga0070665_100472350	3300005548	Bacteria	1265
385	Ga0070665_102048719	3300005548	Bacteria	577
386	Ga0070665_102248317	3300005548	Bacteria	549
387	Ga0070665_102521810	3300005548	Bacteria	515
388	Ga0070704_100518537	3300005549	Bacteria	1037
389	Ga0070704_101221087	3300005549	Bacteria	686
390	Ga0068855_100004098	3300005563	Bacteria	17773
391	Ga0068855_100008244	3300005563	Bacteria	12596
392	Ga0068855_100012991	3300005563	Bacteria	10049
393	Ga0068855_100039037	3300005563	Bacteria	5638
394	Ga0068855_100073653	3300005563	Bacteria	3967
395	Ga0068855_100115082	3300005563	Bacteria	3083
396	Ga0068855_100414341	3300005563	Bacteria	1475
397	Ga0068855_100626532	3300005563	Bacteria	1157
398	Ga0068855_100770386	3300005563	Bacteria	1025
399	Ga0068855_101620985	3300005563	Bacteria	662
400	Ga0068855_101905996	3300005563	Bacteria	602
401	Ga0070664_100003932	3300005564	Bacteria	11986
402	Ga0070664_100004481	3300005564	Bacteria	11210
403	Ga0070664_100004905	3300005564	Bacteria	10711
404	Ga0070664_100024940	3300005564	Bacteria	4955
405	Ga0070664_100051820	3300005564	Bacteria	3475
406	Ga0070664_100083520	3300005564	Bacteria	2756
407	Ga0070664_100088917	3300005564	Bacteria	2671
408	Ga0070664_100259708	3300005564	Bacteria	1563
409	Ga0068857_100007509	3300005577	Bacteria	9380
410	Ga0068857_100015199	3300005577	Bacteria	6717
411	Ga0068857_100055544	3300005577	Bacteria	3514
412	Ga0068857_100056433	3300005577	Bacteria	3485
413	Ga0068857_100069137	3300005577	Bacteria	3145
414	Ga0068857_100101427	3300005577	Bacteria	2583
415	Ga0068857_100104299	3300005577	Bacteria	2545
416	Ga0068857_100171287	3300005577	Bacteria	1974
417	Ga0068857_100417307	3300005577	Bacteria	1251
418	Ga0068857_102091267	3300005577	Bacteria	555
419	Ga0068854_100002741	3300005578	Bacteria	10930
420	Ga0068854_100081572	3300005578	Bacteria	2389
421	Ga0068854_100115116	3300005578	Bacteria	2034
422	Ga0068854_100188090	3300005578	Bacteria	1617
423	Ga0068854_100204620	3300005578	Bacteria	1554
424	Ga0068854_100775733	3300005578	Bacteria	834
425	Ga0068854_100798173	3300005578	Bacteria	823
426	Ga0068854_100976328	3300005578	Bacteria	749
427	Ga0068856_100002683	3300005614	Bacteria	18238
428	Ga0068856_100017956	3300005614	Bacteria	6859
429	Ga0068856_100019473	3300005614	Bacteria	6587
430	Ga0068856_100057802	3300005614	Bacteria	3829
431	Ga0068856_100064452	3300005614	Bacteria	3621
432	Ga0068856_100083208	3300005614	Bacteria	3177
433	Ga0068856_100626601	3300005614	Bacteria	1096
434	Ga0068856_100889365	3300005614	Bacteria	909
435	Ga0068856_101004254	3300005614	Bacteria	853
436	Ga0068856_101137585	3300005614	Bacteria	798
437	Ga0068856_102255771	3300005614	Bacteria	553
438	Ga0070702_100088741	3300005615	Bacteria	1870
439	Ga0070702_100098753	3300005615	Bacteria	1787
440	Ga0070702_101594100	3300005615	Bacteria	540
441	Ga0068852_100001757	3300005616	Bacteria	14754
442	Ga0068852_100007549	3300005616	Bacteria	7942
443	Ga0068852_100014733	3300005616	Bacteria	6033
444	Ga0068852_100017738	3300005616	Bacteria	5592
445	Ga0068852_100021453	3300005616	Bacteria	5158
446	Ga0068852_100219697	3300005616	Bacteria	1807
447	Ga0068852_100259054	3300005616	Bacteria	1669
448	Ga0068852_100308501	3300005616	Bacteria	1534
449	Ga0068852_100384772	3300005616	Bacteria	1377
450	Ga0068852_100396534	3300005616	Bacteria	1357
451	Ga0068852_100472585	3300005616	Bacteria	1245
452	Ga0068852_100531442	3300005616	Bacteria	1174
453	Ga0068852_100689698	3300005616	Bacteria	1031
454	Ga0068852_100750969	3300005616	Bacteria	988
455	Ga0068852_100971597	3300005616	Bacteria	868
456	Ga0068852_101318101	3300005616	Bacteria	744
457	Ga0068859_100050936	3300005617	Bacteria	4161
458	Ga0068859_100160882	3300005617	Bacteria	2324
459	Ga0068859_100197722	3300005617	Bacteria	2095
460	Ga0068859_100281196	3300005617	Bacteria	1757
461	Ga0068859_100497274	3300005617	Bacteria	1314
462	Ga0068864_100005258	3300005618	Bacteria	10611
463	Ga0068864_100006639	3300005618	Bacteria	9472
464	Ga0068864_100009015	3300005618	Bacteria	8226
465	Ga0068864_100018523	3300005618	Bacteria	5818
466	Ga0068864_100247859	3300005618	Bacteria	1653
467	Ga0068864_101041033	3300005618	Bacteria	813
468	Ga0068864_102055295	3300005618	Bacteria	578
469	Ga0068866_10070397	3300005718	Bacteria	1846
470	Ga0068861_100021611	3300005719	Bacteria	4626
471	Ga0068861_100037620	3300005719	Bacteria	3597
472	Ga0068861_100071706	3300005719	Bacteria	2685
473	Ga0068861_100220211	3300005719	Bacteria	1604
474	Ga0068861_100972192	3300005719	Bacteria	809
475	Ga0068861_101155139	3300005719	Bacteria	747
476	Ga0068851_10003210	3300005834	Bacteria	7248
477	Ga0068851_10007131	3300005834	Bacteria	5120
478	Ga0068851_10010332	3300005834	Bacteria	4354
479	Ga0068851_10020569	3300005834	Bacteria	3196
480	Ga0068851_10084675	3300005834	Bacteria	1661
481	Ga0068870_10001701	3300005840	Bacteria	8995
482	Ga0068870_10039615	3300005840	Bacteria	2439
483	Ga0068870_10229005	3300005840	Bacteria	1142
484	Ga0068863_100001368	3300005841	Bacteria	24235
485	Ga0068863_100007567	3300005841	Bacteria	10624
486	Ga0068863_100066660	3300005841	Bacteria	3405
487	Ga0068863_100144528	3300005841	Bacteria	2274
488	Ga0068863_100158088	3300005841	Bacteria	2170
489	Ga0068863_101370525	3300005841	Bacteria	715
490	Ga0068863_101634474	3300005841	Bacteria	653
491	Ga0068863_102300674	3300005841	Bacteria	549
492	Ga0068863_102635447	3300005841	Bacteria	512
493	Ga0068858_100006176	3300005842	Bacteria	11684
494	Ga0068858_100016320	3300005842	Bacteria	6976
495	Ga0068858_100054558	3300005842	Bacteria	3695
496	Ga0068858_100058258	3300005842	Bacteria	3571
497	Ga0068858_100114974	3300005842	Bacteria	2514
498	Ga0068858_100176226	3300005842	Bacteria	2018
499	Ga0068858_100216406	3300005842	Bacteria	1814
500	Ga0068858_100232085	3300005842	Bacteria	1750
501	Ga0068860_100004808	3300005843	Bacteria	13752
502	Ga0068860_100046459	3300005843	Bacteria	4139
503	Ga0068860_100106931	3300005843	Bacteria	2673
504	Ga0068860_100198684	3300005843	Bacteria	1943
505	Ga0068860_100220259	3300005843	Bacteria	1843
506	Ga0068860_100270456	3300005843	Bacteria	1658
507	Ga0068860_100519424	3300005843	Bacteria	1191
508	Ga0068860_100808836	3300005843	Bacteria	951
509	Ga0068860_101505309	3300005843	Bacteria	695
510	Ga0068862_100044946	3300005844	Bacteria	3767
511	Ga0068862_100053525	3300005844	Bacteria	3455
512	Ga0068862_100092760	3300005844	Bacteria	2632
513	Ga0068862_100175010	3300005844	Bacteria	1923
514	Ga0068862_100250316	3300005844	Bacteria	1614
515	Ga0068862_100295944	3300005844	Bacteria	1488
516	Ga0068862_100444729	3300005844	Bacteria	1221
517	Ga0068862_100474970	3300005844	Bacteria	1183
518	Ga0081455_10308360	3300005937	Bacteria	1132
519	Ga0081539_10037624	3300005985	Bacteria	2880
520	Ga0075365_10035693	3300006038	Bacteria	3218
521	Ga0075365_10048049	3300006038	Bacteria	2807
522	Ga0075365_10171372	3300006038	Bacteria	1515
523	Ga0075363_100083709	3300006048	Bacteria	1748
524	Ga0075363_100223054	3300006048	Bacteria	1081
525	Ga0075364_10253781	3300006051	Bacteria	1195
526	Ga0075364_11053543	3300006051	Bacteria	552
527	Ga0075432_10036299	3300006058	Bacteria	1713
528	Ga0070716_100284348	3300006173	Bacteria	1143
529	Ga0070716_101192622	3300006173	Bacteria	611
530	Ga0070712_100536218	3300006175	Bacteria	985
531	Ga0075367_10169768	3300006178	Bacteria	1358
532	Ga0075367_10494831	3300006178	Bacteria	775
533	Ga0075369_10369275	3300006186	Bacteria	674
534	Ga0075366_10003125	3300006195	Bacteria	8659
535	Ga0075366_10005640	3300006195	Bacteria	6787
536	Ga0075366_10005712	3300006195	Bacteria	6752
537	Ga0075366_10102974	3300006195	Bacteria	1714
538	Ga0075366_10148842	3300006195	Bacteria	1417
539	Ga0075366_10269707	3300006195	Bacteria	1039
540	Ga0075366_10576949	3300006195	Bacteria	697
541	Ga0097621_100076468	3300006237	Bacteria	2777
542	Ga0097621_100142028	3300006237	Bacteria	2052
543	Ga0097621_100175104	3300006237	Bacteria	1851
544	Ga0097621_100367022	3300006237	Bacteria	1283
545	Ga0075370_10190644	3300006353	Bacteria	1208
546	Ga0075370_10470926	3300006353	Bacteria	757
547	Ga0068871_100000834	3300006358	Bacteria	20645
548	Ga0068871_100172216	3300006358	Bacteria	1856
549	Ga0068871_100289609	3300006358	Bacteria	1435
550	Ga0068871_100401412	3300006358	Bacteria	1221
551	Ga0068871_100977504	3300006358	Bacteria	787
552	Ga0068871_101317402	3300006358	Bacteria	679
553	Ga0075428_100879861	3300006844	Bacteria	951
554	Ga0075428_102279329	3300006844	Bacteria	558
555	Ga0075430_100966888	3300006846	Bacteria	702
556	Ga0075433_10697968	3300006852	Bacteria	889
557	Ga0075433_11202607	3300006852	Bacteria	658
558	Ga0075434_100497693	3300006871	Bacteria	1240
559	Ga0075434_100585678	3300006871	Bacteria	1135
560	Ga0075434_101337986	3300006871	Bacteria	727
561	Ga0075434_102525765	3300006871	Bacteria	515
562	Ga0068865_100007501	3300006881	Bacteria	6711
563	Ga0068865_100038461	3300006881	Bacteria	3239
564	Ga0068865_100088857	3300006881	Bacteria	2236
565	Ga0068865_100113385	3300006881	Bacteria	2004
566	Ga0068865_100696766	3300006881	Bacteria	868
567	Ga0068865_101365905	3300006881	Bacteria	632
568	Ga0075436_100232751	3300006914	Bacteria	1309
569	Ga0097620_100050936	3300006931	Bacteria	4161
570	Ga0097620_100160876	3300006931	Bacteria	2324
571	Ga0097620_100197724	3300006931	Bacteria	2095
572	Ga0097620_100281184	3300006931	Bacteria	1757
573	Ga0097620_100497249	3300006931	Bacteria	1314
574	Ga0099826_10398077	3300006948	Bacteria	670
575	Ga0075435_100550916	3300007076	Bacteria	999
576	Ga0075435_100696909	3300007076	Bacteria	883
577	Ga0075435_100781998	3300007076	Bacteria	831
578	Ga0105251_10001215	3300009011	Bacteria	22270
579	Ga0105244_10001068	3300009036	Bacteria	22905
580	Ga0105244_10309767	3300009036	Bacteria	730
581	Ga0105240_10002428	3300009093	Bacteria	29958
582	Ga0105240_10694035	3300009093	Bacteria	1112
583	Ga0105240_11684434	3300009093	Bacteria	662
584	Ga0111539_10445508	3300009094	Bacteria	1508
585	Ga0111539_10537749	3300009094	Bacteria	1361
586	Ga0111539_10947844	3300009094	Bacteria	1001
587	Ga0105247_10094065	3300009101	Bacteria	1906
588	Ga0105247_10292303	3300009101	Bacteria	1127
589	Ga0105243_11409194	3300009148	Bacteria	718
590	Ga0105241_10045213	3300009174	Bacteria	3340
591	Ga0105241_10086666	3300009174	Bacteria	2463
592	Ga0105241_10616345	3300009174	Bacteria	982
593	Ga0105242_10382134	3300009176	Bacteria	1309
594	Ga0105242_12046814	3300009176	Bacteria	616
595	Ga0105248_10017795	3300009177	Bacteria	7842
596	Ga0105248_10034376	3300009177	Bacteria	5668
597	Ga0105248_10081139	3300009177	Bacteria	3646
598	Ga0105248_10731674	3300009177	Bacteria	1116
599	Ga0105237_10054506	3300009545	Bacteria	4006
600	Ga0105237_10238550	3300009545	Bacteria	1819
601	Ga0105237_11798968	3300009545	Bacteria	620
602	Ga0105238_10001044	3300009551	Bacteria	28027
603	Ga0105238_10114298	3300009551	Bacteria	2679
604	Ga0105238_10147898	3300009551	Bacteria	2325
605	Ga0105238_10179482	3300009551	Bacteria	2094
606	Ga0105238_10381411	3300009551	Bacteria	1401
607	Ga0105238_11194808	3300009551	Bacteria	785
608	Ga0105249_10039985	3300009553	Bacteria	4259
609	Ga0105249_10165292	3300009553	Bacteria	2142
610	Ga0105249_10403331	3300009553	Bacteria	1398
611	Ga0105249_10880916	3300009553	Bacteria	962
612	Ga0105249_11271925	3300009553	Bacteria	807
613	Ga0105239_10217199	3300010375	Bacteria	2144
614	Ga0105239_10702366	3300010375	Bacteria	1156
615	Ga0105239_12844731	3300010375	Bacteria	565
616	Ga0105246_10069162	3300011119	Bacteria	2479
617	Ga0105246_10110856	3300011119	Bacteria	2016
618	Ga0105246_11627674	3300011119	Bacteria	611
619	Ga0157347_1004314	3300012502	Bacteria	1313
620	Ga0157339_1021150	3300012505	Bacteria	692
621	Ga0157315_1024230	3300012508	Bacteria	666
622	Ga0157326_1000234	3300012513	Bacteria	6422
623	Ga0157326_1020498	3300012513	Bacteria	813
624	Ga0157373_10154216	3300013100	Bacteria	1616
625	Ga0157373_10311465	3300013100	Bacteria	1119
626	Ga0157371_10025310	3300013102	Bacteria	4326
627	Ga0157371_11353340	3300013102	Bacteria	552
628	Ga0157370_10036594	3300013104	Bacteria	4761
629	Ga0157370_10102144	3300013104	Bacteria	2685
630	Ga0157370_10266529	3300013104	Bacteria	1583
631	Ga0157369_10018025	3300013105	Bacteria	7921
632	Ga0157369_10024139	3300013105	Bacteria	6767
633	Ga0157369_10048697	3300013105	Bacteria	4598
634	Ga0157369_10142232	3300013105	Bacteria	2538
635	Ga0157369_10331601	3300013105	Bacteria	1581
636	Ga0157374_10003813	3300013296	Bacteria	12661
637	Ga0157374_10205688	3300013296	Bacteria	1929
638	Ga0157374_10242224	3300013296	Bacteria	1773
639	Ga0157374_11051065	3300013296	Bacteria	834
640	Ga0157378_10007092	3300013297	Bacteria	9785
641	Ga0157378_10060018	3300013297	Bacteria	3394
642	Ga0157378_10148795	3300013297	Bacteria	2180
643	Ga0157378_10388715	3300013297	Bacteria	1372
644	Ga0157378_10529615	3300013297	Bacteria	1181
645	Ga0157378_11758428	3300013297	Bacteria	668
646	Ga0157378_12612805	3300013297	Bacteria	557
647	Ga0163162_10003831	3300013306	Bacteria	14422
648	Ga0163162_10370240	3300013306	Bacteria	1566
649	Ga0163162_11184190	3300013306	Bacteria	867
650	Ga0163162_11321900	3300013306	Bacteria	819
651	Ga0163162_11514200	3300013306	Bacteria	764
652	Ga0163162_12029834	3300013306	Bacteria	659
653	Ga0163162_12877302	3300013306	Bacteria	554
654	Ga0157372_10079216	3300013307	Bacteria	3715
655	Ga0157372_10080771	3300013307	Bacteria	3680
656	Ga0157372_10087974	3300013307	Bacteria	3526
657	Ga0157372_10141862	3300013307	Bacteria	2769
658	Ga0157372_10201235	3300013307	Bacteria	2307
659	Ga0157372_10608610	3300013307	Bacteria	1273
660	Ga0157372_11028179	3300013307	Bacteria	954
661	Ga0157372_11205527	3300013307	Bacteria	875
662	Ga0157372_12043148	3300013307	Bacteria	659
663	Ga0157375_10003753	3300013308	Bacteria	13176
664	Ga0157375_10049224	3300013308	Bacteria	4128
665	Ga0157375_10246005	3300013308	Bacteria	1949
666	Ga0157375_10347293	3300013308	Bacteria	1649
667	Ga0157375_10373302	3300013308	Bacteria	1593
668	Ga0157375_10443331	3300013308	Bacteria	1464
669	Ga0157375_10558302	3300013308	Bacteria	1306
670	Ga0157375_11450503	3300013308	Bacteria	809
671	Ga0157375_12352234	3300013308	Bacteria	636
672	Ga0157375_12665339	3300013308	Bacteria	597
673	Ga0157375_13745679	3300013308	Bacteria	505
674	Ga0163163_10014074	3300014325	Bacteria	7345
675	Ga0163163_10043512	3300014325	Bacteria	4403
676	Ga0163163_10197576	3300014325	Bacteria	2059
677	Ga0157380_10033021	3300014326	Bacteria	3983
678	Ga0157380_10119555	3300014326	Bacteria	2229
679	Ga0157380_11940916	3300014326	Bacteria	650
680	Ga0157380_12617527	3300014326	Bacteria	571
681	Ga0182008_10007518	3300014497	Bacteria	6012
682	Ga0182008_10032875	3300014497	Bacteria	2604
683	Ga0182008_10114128	3300014497	Bacteria	1339
684	Ga0182008_10249713	3300014497	Bacteria	915
685	Ga0182008_10380839	3300014497	Bacteria	754
686	Ga0157377_10139187	3300014745	Bacteria	1490
687	Ga0157377_10189836	3300014745	Bacteria	1298
688	Ga0157379_10018178	3300014968	Bacteria	6194
689	Ga0157379_10040933	3300014968	Bacteria	4136
690	Ga0157379_10419202	3300014968	Bacteria	1233
691	Ga0157376_10000986	3300014969	Bacteria	18545
692	Ga0157376_10498082	3300014969	Bacteria	1197
693	Ga0157376_10525417	3300014969	Bacteria	1167
694	Ga0157376_10533647	3300014969	Bacteria	1159
695	Ga0157376_10917361	3300014969	Bacteria	895
696	Ga0157376_11272382	3300014969	Bacteria	765
697	Ga0157376_12089299	3300014969	Bacteria	605
698	Ga0157376_12685256	3300014969	Bacteria	538
699	Ga0182006_1110076	3300015261	Bacteria	967
700	Ga0182007_10001322	3300015262	Bacteria	13378
701	Ga0182007_10001550	3300015262	Bacteria	12241
702	Ga0182005_1026496	3300015265	Bacteria	1582
703	Ga0182005_1238534	3300015265	Bacteria	559
704	Ga0183362_10007	3300015683	Bacteria	240101
705	Ga0183361_10015	3300016635	Bacteria	166772
706	Ga0163161_10027860	3300017792	Bacteria	4009
707	Ga0163161_10070374	3300017792	Bacteria	2558
708	Ga0163161_10312290	3300017792	Bacteria	1241
709	Ga0163161_10582032	3300017792	Bacteria	921
710	Ga0163161_10659699	3300017792	Bacteria	867
711	Ga0163161_10682230	3300017792	Bacteria	854
712	Ga0163161_11735990	3300017792	Bacteria	554
713	Ga0197907_11172527	3300020069	Bacteria	2353
714	Ga0206356_10165197	3300020070	Bacteria	2640
715	Ga0206356_10656905	3300020070	Bacteria	2991
716	Ga0206356_11626061	3300020070	Bacteria	667
717	Ga0206356_11693459	3300020070	Bacteria	623
718	Ga0206355_1659039	3300020076	Bacteria	2567
719	Ga0206351_10247005	3300020077	Bacteria	908
720	Ga0206350_10085980	3300020080	Bacteria	722
721	Ga0206350_10225711	3300020080	Bacteria	1643
722	Ga0206354_10521870	3300020081	Bacteria	779
723	Ga0206354_10894414	3300020081	Bacteria	2935
724	Ga0206353_10824682	3300020082	Bacteria	1859
725	Ga0206353_11198635	3300020082	Bacteria	2215
726	Ga0206353_11257227	3300020082	Bacteria	1635
727	Ga0206353_11342394	3300020082	Bacteria	856
728	Ga0154015_1142689	3300020610	Bacteria	734
729	Ga0213876_10076913	3300021384	Bacteria	1763
730	Ga0213871_10179786	3300021441	Bacteria	654
731	Ga0224712_10000642	3300022467	Bacteria	7149
732	Ga0224712_10603196	3300022467	Bacteria	536
733	Ga0247515_121331	3300023564	Bacteria	554
734	Ga0209435_100002	3300025206	Bacteria	794178
735	Ga0209435_105249	3300025206	Bacteria	1452
736	Ga0209435_111149	3300025206	Bacteria	968
737	Ga0209436_111154	3300025208	Bacteria	1595
738	Ga0209436_111782	3300025208	Bacteria	1516
739	Ga0209566_100801	3300025225	Bacteria	16448
740	Ga0209674_100153	3300025226	Bacteria	94333
741	Ga0209674_101740	3300025226	Bacteria	5347
742	Ga0209672_100054	3300025228	Bacteria	222217
743	Ga0209672_100072	3300025228	Bacteria	167942
744	Ga0209672_100073	3300025228	Bacteria	166621
745	Ga0209672_100460	3300025228	Bacteria	23072
746	Ga0209672_101899	3300025228	Bacteria	6044
747	Ga0209147_100093	3300025229	Bacteria	167196
748	Ga0209147_100328	3300025229	Bacteria	35916
749	Ga0209147_100840	3300025229	Bacteria	14431
750	Ga0209563_100373	3300025230	Bacteria	16406
751	Ga0207427_101666	3300025231	Bacteria	7454
752	Ga0209258_100015	3300025242	Bacteria	706310
753	Ga0209258_100140	3300025242	Bacteria	167245
754	Ga0209258_100579	3300025242	Bacteria	30754
755	Ga0209258_100581	3300025242	Bacteria	30706
756	Ga0207425_1001631	3300025245	Bacteria	9047
757	Ga0207425_1006991	3300025245	Bacteria	3031
758	Ga0207425_1013709	3300025245	Bacteria	1862
759	Ga0209646_1000001	3300025246	Bacteria	3092932
760	Ga0209026_1000121	3300025250	Bacteria	126801
761	Ga0209148_1000028	3300025254	Bacteria	582773
762	Ga0209148_1000119	3300025254	Bacteria	188079
763	Ga0209148_1000140	3300025254	Bacteria	166819
764	Ga0209759_1000001	3300025256	Bacteria	2799452
765	Ga0209759_1000281	3300025256	Bacteria	71594
766	Ga0209759_1001723	3300025256	Bacteria	11286
767	Ga0209759_1001789	3300025256	Bacteria	10896
768	Ga0209759_1003170	3300025256	Bacteria	6707
769	Ga0209759_1003216	3300025256	Bacteria	6616
770	Ga0209759_1037913	3300025256	Bacteria	861
771	Ga0209759_1052699	3300025256	Bacteria	616
772	Ga0209129_1000049	3300025258	Bacteria	268086
773	Ga0209129_1000908	3300025258	Bacteria	18128
774	Ga0209129_1001763	3300025258	Bacteria	11583
775	Ga0209233_1000173	3300025261	Bacteria	145995
776	Ga0209565_1000026	3300025263	Bacteria	365910
777	Ga0209565_1000259	3300025263	Bacteria	56285
778	Ga0209565_1001138	3300025263	Bacteria	12796
779	Ga0209565_1006925	3300025263	Bacteria	3117
780	Ga0209565_1011763	3300025263	Bacteria	2115
781	Ga0209565_1044316	3300025263	Bacteria	818
782	Ga0207666_1000954	3300025271	Bacteria	3430
783	Ga0209455_1000125	3300025272	Bacteria	166819
784	Ga0209455_1000244	3300025272	Bacteria	67136
785	Ga0209673_1000009	3300025273	Bacteria	620735
786	Ga0209673_1000098	3300025273	Bacteria	193352
787	Ga0209673_1000193	3300025273	Bacteria	123134
788	Ga0209673_1000477	3300025273	Bacteria	66849
789	Ga0209673_1027930	3300025273	Bacteria	1826
790	Ga0209673_1051516	3300025273	Bacteria	1085
791	Ga0209130_1000109	3300025284	Bacteria	133520
792	Ga0209130_1000307	3300025284	Bacteria	58849
793	Ga0209130_1004489	3300025284	Bacteria	5271
794	Ga0209130_1013476	3300025284	Bacteria	2091
795	Ga0207673_1001230	3300025290	Bacteria	2762
796	Ga0209675_1000683	3300025291	Bacteria	23657
797	Ga0209675_1000796	3300025291	Bacteria	20857
798	Ga0209675_1002624	3300025291	Bacteria	9104
799	Ga0209675_1007284	3300025291	Bacteria	4277
800	Ga0209675_1012711	3300025291	Bacteria	2689
801	Ga0209675_1017433	3300025291	Bacteria	2051
802	Ga0209676_1000013	3300025292	Bacteria	816080
803	Ga0209676_1000137	3300025292	Bacteria	179437
804	Ga0209676_1000903	3300025292	Bacteria	37397
805	Ga0209676_1007174	3300025292	Bacteria	5316
806	Ga0209676_1086093	3300025292	Bacteria	702
807	Ga0209025_1000707	3300025294	Bacteria	56879
808	Ga0209025_1003616	3300025294	Bacteria	14395
809	Ga0209025_1006489	3300025294	Bacteria	9052
810	Ga0209025_1027283	3300025294	Bacteria	2835
811	Ga0209025_1131532	3300025294	Bacteria	726
812	Ga0209025_1190070	3300025294	Bacteria	517
813	Ga0209564_1000243	3300025295	Bacteria	118066
814	Ga0209564_1000387	3300025295	Bacteria	79895
815	Ga0209564_1001368	3300025295	Bacteria	25567
816	Ga0209564_1006136	3300025295	Bacteria	6590
817	Ga0209564_1006738	3300025295	Bacteria	6100
818	Ga0209564_1011244	3300025295	Bacteria	4030
819	Ga0209758_1040184	3300025297	Bacteria	1768
820	Ga0209050_1000008	3300025298	Bacteria	1144179
821	Ga0209050_1000015	3300025298	Bacteria	759102
822	Ga0209050_1000936	3300025298	Bacteria	38151
823	Ga0209050_1003163	3300025298	Bacteria	12539
824	Ga0209050_1006345	3300025298	Bacteria	7031
825	Ga0209256_1000003	3300025299	Bacteria	1661127
826	Ga0207426_1000062	3300025302	Bacteria	362040
827	Ga0207426_1000199	3300025302	Bacteria	145826
828	Ga0207426_1007030	3300025302	Bacteria	4775
829	Ga0207426_1009336	3300025302	Bacteria	3890
830	Ga0209051_1000005	3300025303	Bacteria	1142353
831	Ga0209051_1000010	3300025303	Bacteria	641298
832	Ga0209051_1000137	3300025303	Bacteria	137784
833	Ga0209257_1000026	3300025304	Bacteria	723225
834	Ga0209257_1000048	3300025304	Bacteria	455536
835	Ga0209257_1000205	3300025304	Bacteria	143735
836	Ga0209257_1006892	3300025304	Bacteria	7117
837	Ga0207697_10000810	3300025315	Bacteria	17713
838	Ga0207697_10050439	3300025315	Bacteria	1718
839	Ga0207697_10057007	3300025315	Bacteria	1621
840	Ga0207697_10145017	3300025315	Bacteria	1031
841	Ga0207697_10477191	3300025315	Bacteria	552
842	Ga0207656_10001788	3300025321	Bacteria	7157
843	Ga0207656_10015220	3300025321	Bacteria	2974
844	Ga0207656_10017249	3300025321	Bacteria	2825
845	Ga0207656_10019570	3300025321	Bacteria	2679
846	Ga0207656_10034423	3300025321	Bacteria	2115
847	Ga0207656_10048559	3300025321	Bacteria	1828
848	Ga0207656_10128399	3300025321	Bacteria	1186
849	Ga0207656_10144556	3300025321	Bacteria	1123
850	Ga0207696_1003988	3300025711	Bacteria	6485
851	Ga0207655_1000800	3300025728	Bacteria	34234
852	Ga0207655_1152763	3300025728	Bacteria	729
853	Ga0207713_1085146	3300025735	Bacteria	1126
854	Ga0207682_10000501	3300025893	Bacteria	17998
855	Ga0207682_10001872	3300025893	Bacteria	9586
856	Ga0207682_10045019	3300025893	Bacteria	1810
857	Ga0207692_10025346	3300025898	Bacteria	2769
858	Ga0207692_10292263	3300025898	Bacteria	989
859	Ga0207692_10682076	3300025898	Bacteria	666
860	Ga0207642_10632062	3300025899	Bacteria	669
861	Ga0207688_10013022	3300025901	Bacteria	4523
862	Ga0207688_10172850	3300025901	Bacteria	1285
863	Ga0207688_10662708	3300025901	Bacteria	659
864	Ga0207680_10005324	3300025903	Bacteria	6142
865	Ga0207680_10025437	3300025903	Bacteria	3264
866	Ga0207680_10041023	3300025903	Bacteria	2698
867	Ga0207680_10076097	3300025903	Bacteria	2095
868	Ga0207680_10305879	3300025903	Bacteria	1109
869	Ga0207680_10430207	3300025903	Bacteria	935
870	Ga0207680_10602556	3300025903	Bacteria	786
871	Ga0207647_10000362	3300025904	Bacteria	36989
872	Ga0207647_10004870	3300025904	Bacteria	9917
873	Ga0207647_10076243	3300025904	Bacteria	2017
874	Ga0207647_10109706	3300025904	Bacteria	1632
875	Ga0207699_10018722	3300025906	Bacteria	3676
876	Ga0207699_10617686	3300025906	Bacteria	790
877	Ga0207645_10000157	3300025907	Bacteria	53374
878	Ga0207645_10000661	3300025907	Bacteria	28611
879	Ga0207645_10033194	3300025907	Bacteria	3318
880	Ga0207645_10050166	3300025907	Bacteria	2664
881	Ga0207645_10379337	3300025907	Bacteria	949
882	Ga0207645_10469755	3300025907	Bacteria	850
883	Ga0207643_10000515	3300025908	Bacteria	24751
884	Ga0207643_10061318	3300025908	Bacteria	2148
885	Ga0207643_10061388	3300025908	Bacteria	2147
886	Ga0207643_10189601	3300025908	Bacteria	1248
887	Ga0207705_10008686	3300025909	Bacteria	7400
888	Ga0207705_10015106	3300025909	Bacteria	5550
889	Ga0207705_10128454	3300025909	Bacteria	1885
890	Ga0207705_10139451	3300025909	Bacteria	1810
891	Ga0207705_10166750	3300025909	Bacteria	1657
892	Ga0207705_10298065	3300025909	Bacteria	1236
893	Ga0207705_10422818	3300025909	Bacteria	1032
894	Ga0207705_10479847	3300025909	Bacteria	965
895	Ga0207705_10593463	3300025909	Bacteria	861
896	Ga0207705_11453324	3300025909	Bacteria	520
897	Ga0207684_10231133	3300025910	Bacteria	1596
898	Ga0207654_10087072	3300025911	Bacteria	1895
899	Ga0207654_10364651	3300025911	Bacteria	997
900	Ga0207654_10683427	3300025911	Bacteria	737
901	Ga0207707_10003975	3300025912	Bacteria	13125
902	Ga0207707_10015618	3300025912	Bacteria	6615
903	Ga0207695_10030782	3300025913	Bacteria	5904
904	Ga0207695_10058845	3300025913	Bacteria	3988
905	Ga0207695_10061639	3300025913	Bacteria	3876
906	Ga0207695_10128713	3300025913	Bacteria	2491
907	Ga0207695_10155617	3300025913	Bacteria	2221
908	Ga0207695_10157033	3300025913	Bacteria	2209
909	Ga0207695_10278781	3300025913	Bacteria	1566
910	Ga0207671_10004456	3300025914	Bacteria	13379
911	Ga0207671_10018111	3300025914	Bacteria	5411
912	Ga0207671_10045547	3300025914	Bacteria	3244
913	Ga0207671_10721712	3300025914	Bacteria	792
914	Ga0207671_11051160	3300025914	Bacteria	641
915	Ga0207693_10100972	3300025915	Bacteria	2262
916	Ga0207693_10519475	3300025915	Bacteria	929
917	Ga0207693_10704308	3300025915	Bacteria	782
918	Ga0207663_10042488	3300025916	Bacteria	2777
919	Ga0207663_10510347	3300025916	Bacteria	935
920	Ga0207660_10017282	3300025917	Bacteria	4790
921	Ga0207660_10285619	3300025917	Bacteria	1311
922	Ga0207660_10369754	3300025917	Bacteria	1151
923	Ga0207662_10031485	3300025918	Bacteria	3082
924	Ga0207657_10000065	3300025919	Bacteria	98751
925	Ga0207657_10003501	3300025919	Bacteria	16765
926	Ga0207657_10003529	3300025919	Bacteria	16707
927	Ga0207657_10005149	3300025919	Bacteria	13708
928	Ga0207657_10005254	3300025919	Bacteria	13564
929	Ga0207657_10044265	3300025919	Bacteria	3914
930	Ga0207657_10130195	3300025919	Bacteria	2063
931	Ga0207657_10169683	3300025919	Bacteria	1768
932	Ga0207657_11206176	3300025919	Bacteria	575
933	Ga0207649_10011009	3300025920	Bacteria	4976
934	Ga0207649_10060103	3300025920	Bacteria	2387
935	Ga0207649_10098085	3300025920	Bacteria	1933
936	Ga0207649_10111001	3300025920	Bacteria	1832
937	Ga0207649_10115561	3300025920	Bacteria	1800
938	Ga0207649_10177341	3300025920	Bacteria	1489
939	Ga0207649_10473906	3300025920	Bacteria	948
940	Ga0207649_10552483	3300025920	Bacteria	881
941	Ga0207649_10609593	3300025920	Bacteria	840
942	Ga0207649_10670191	3300025920	Bacteria	803
943	Ga0207652_10092423	3300025921	Bacteria	2661
944	Ga0207652_10113951	3300025921	Bacteria	2400
945	Ga0207652_10509343	3300025921	Bacteria	1083
946	Ga0207652_10654407	3300025921	Bacteria	939
947	Ga0207652_11908279	3300025921	Bacteria	500
948	Ga0207646_11143746	3300025922	Bacteria	684
949	Ga0207681_10019167	3300025923	Bacteria	4320
950	Ga0207681_10027377	3300025923	Bacteria	3685
951	Ga0207681_10034153	3300025923	Bacteria	3341
952	Ga0207681_10040135	3300025923	Bacteria	3112
953	Ga0207681_10042336	3300025923	Bacteria	3042
954	Ga0207681_10062817	3300025923	Bacteria	2559
955	Ga0207681_10251816	3300025923	Bacteria	1379
956	Ga0207681_10386805	3300025923	Bacteria	1127
957	Ga0207694_10002385	3300025924	Bacteria	15364
958	Ga0207694_10012472	3300025924	Bacteria	6408
959	Ga0207694_10025661	3300025924	Bacteria	4479
960	Ga0207694_10050454	3300025924	Bacteria	3223
961	Ga0207694_10064854	3300025924	Bacteria	2847
962	Ga0207694_10108476	3300025924	Bacteria	2206
963	Ga0207694_10355755	3300025924	Bacteria	1213
964	Ga0207694_10621801	3300025924	Bacteria	909
965	Ga0207694_11258530	3300025924	Bacteria	626
966	Ga0207694_11705808	3300025924	Bacteria	530
967	Ga0207650_10008016	3300025925	Bacteria	7198
968	Ga0207650_10035463	3300025925	Bacteria	3623
969	Ga0207650_10051611	3300025925	Bacteria	3044
970	Ga0207650_10060973	3300025925	Bacteria	2815
971	Ga0207650_10078784	3300025925	Bacteria	2494
972	Ga0207650_10099957	3300025925	Bacteria	2231
973	Ga0207650_10158791	3300025925	Bacteria	1790
974	Ga0207650_10281464	3300025925	Bacteria	1354
975	Ga0207650_10360634	3300025925	Bacteria	1197
976	Ga0207650_10730874	3300025925	Bacteria	837
977	Ga0207650_11213438	3300025925	Bacteria	642
978	Ga0207650_11656607	3300025925	Bacteria	543
979	Ga0207659_10006435	3300025926	Bacteria	7196
980	Ga0207659_10014188	3300025926	Bacteria	5129
981	Ga0207659_10111696	3300025926	Bacteria	2079
982	Ga0207659_10177981	3300025926	Bacteria	1683
983	Ga0207659_11029115	3300025926	Bacteria	709
984	Ga0207659_11116138	3300025926	Bacteria	678
985	Ga0207659_11447406	3300025926	Bacteria	588
986	Ga0207659_11771916	3300025926	Bacteria	525
987	Ga0207659_11849984	3300025926	Bacteria	512
988	Ga0207687_10375638	3300025927	Bacteria	1163
989	Ga0207687_11706414	3300025927	Bacteria	540
990	Ga0207700_10000077	3300025928	Bacteria	60197
991	Ga0207700_10013466	3300025928	Bacteria	5324
992	Ga0207700_10467031	3300025928	Bacteria	1114
993	Ga0207700_10973459	3300025928	Bacteria	759
994	Ga0207664_10003371	3300025929	Bacteria	10625
995	Ga0207664_10044722	3300025929	Bacteria	3469
996	Ga0207664_10052351	3300025929	Bacteria	3228
997	Ga0207664_10447842	3300025929	Bacteria	1152
998	Ga0207644_10004394	3300025931	Bacteria	9143
999	Ga0207644_10012783	3300025931	Bacteria	5582
1000	Ga0207644_10015225	3300025931	Bacteria	5160
1001	Ga0207644_10030257	3300025931	Bacteria	3763
1002	Ga0207644_10075404	3300025931	Bacteria	2478
1003	Ga0207644_10111134	3300025931	Bacteria	2072
1004	Ga0207644_10168834	3300025931	Bacteria	1706
1005	Ga0207644_10190892	3300025931	Bacteria	1610
1006	Ga0207644_10211435	3300025931	Bacteria	1534
1007	Ga0207644_10694537	3300025931	Bacteria	848
1008	Ga0207644_11212233	3300025931	Bacteria	634
1009	Ga0207644_11275970	3300025931	Bacteria	617
1010	Ga0207644_11386845	3300025931	Bacteria	590
1011	Ga0207690_10000040	3300025932	Bacteria	130300
1012	Ga0207690_10003167	3300025932	Bacteria	9890
1013	Ga0207690_10070880	3300025932	Bacteria	2402
1014	Ga0207690_10073662	3300025932	Bacteria	2363
1015	Ga0207690_10193560	3300025932	Bacteria	1539
1016	Ga0207690_11393680	3300025932	Bacteria	586
1017	Ga0207706_10002095	3300025933	Bacteria	19518
1018	Ga0207706_10018751	3300025933	Bacteria	6224
1019	Ga0207706_10119077	3300025933	Bacteria	2322
1020	Ga0207706_10577320	3300025933	Bacteria	967
1021	Ga0207706_11061523	3300025933	Bacteria	678
1022	Ga0207686_10125313	3300025934	Bacteria	1754
1023	Ga0207709_10000947	3300025935	Bacteria	21689
1024	Ga0207709_10002316	3300025935	Bacteria	12049
1025	Ga0207709_10599886	3300025935	Bacteria	872
1026	Ga0207670_10054191	3300025936	Bacteria	2705
1027	Ga0207670_10867444	3300025936	Bacteria	755
1028	Ga0207669_10002272	3300025937	Bacteria	8176
1029	Ga0207669_10097079	3300025937	Bacteria	1936
1030	Ga0207669_10266758	3300025937	Bacteria	1283
1031	Ga0207669_10441486	3300025937	Bacteria	1029
1032	Ga0207669_10540696	3300025937	Bacteria	938
1033	Ga0207669_10755844	3300025937	Bacteria	803
1034	Ga0207704_10060135	3300025938	Bacteria	2349
1035	Ga0207704_10083542	3300025938	Bacteria	2072
1036	Ga0207704_10185921	3300025938	Bacteria	1506
1037	Ga0207704_10863206	3300025938	Bacteria	759
1038	Ga0207704_11560520	3300025938	Bacteria	567
1039	Ga0207665_10649121	3300025939	Bacteria	827
1040	Ga0207665_11180141	3300025939	Bacteria	611
1041	Ga0207691_10000249	3300025940	Bacteria	53276
1042	Ga0207691_10001733	3300025940	Bacteria	21505
1043	Ga0207691_10009525	3300025940	Bacteria	9327
1044	Ga0207691_10023580	3300025940	Bacteria	5794
1045	Ga0207691_10062471	3300025940	Bacteria	3379
1046	Ga0207691_10424260	3300025940	Bacteria	1133
1047	Ga0207691_10635017	3300025940	Bacteria	903
1048	Ga0207691_11691239	3300025940	Bacteria	512
1049	Ga0207711_10026251	3300025941	Bacteria	4887
1050	Ga0207711_10043413	3300025941	Bacteria	3835
1051	Ga0207711_10048001	3300025941	Bacteria	3652
1052	Ga0207711_10082942	3300025941	Bacteria	2803
1053	Ga0207711_10125417	3300025941	Bacteria	2296
1054	Ga0207711_10397370	3300025941	Bacteria	1280
1055	Ga0207711_10412528	3300025941	Bacteria	1255
1056	Ga0207711_10562973	3300025941	Bacteria	1063
1057	Ga0207711_11791332	3300025941	Bacteria	557
1058	Ga0207711_11935165	3300025941	Bacteria	532
1059	Ga0207689_10002125	3300025942	Bacteria	18643
1060	Ga0207689_10002775	3300025942	Bacteria	16194
1061	Ga0207689_10019553	3300025942	Bacteria	5707
1062	Ga0207689_10033026	3300025942	Bacteria	4302
1063	Ga0207689_10172504	3300025942	Bacteria	1783
1064	Ga0207689_10345699	3300025942	Bacteria	1236
1065	Ga0207661_10028665	3300025944	Bacteria	4266
1066	Ga0207661_10081152	3300025944	Bacteria	2678
1067	Ga0207661_10178986	3300025944	Bacteria	1851
1068	Ga0207661_10489047	3300025944	Bacteria	1124
1069	Ga0207661_11044148	3300025944	Bacteria	752
1070	Ga0207661_11349596	3300025944	Bacteria	655
1071	Ga0207679_10004856	3300025945	Bacteria	8382
1072	Ga0207679_10005962	3300025945	Bacteria	7667
1073	Ga0207679_10033217	3300025945	Bacteria	3629
1074	Ga0207679_10034919	3300025945	Bacteria	3553
1075	Ga0207679_10057913	3300025945	Bacteria	2868
1076	Ga0207679_10062339	3300025945	Bacteria	2778
1077	Ga0207679_10195676	3300025945	Bacteria	1685
1078	Ga0207679_10272773	3300025945	Bacteria	1447
1079	Ga0207679_10510534	3300025945	Bacteria	1074
1080	Ga0207679_11299984	3300025945	Bacteria	667
1081	Ga0207667_10003792	3300025949	Bacteria	18611
1082	Ga0207667_10006131	3300025949	Bacteria	14607
1083	Ga0207667_10007228	3300025949	Bacteria	13400
1084	Ga0207667_10009212	3300025949	Bacteria	11656
1085	Ga0207667_10012405	3300025949	Bacteria	9822
1086	Ga0207667_10012581	3300025949	Bacteria	9734
1087	Ga0207667_10058785	3300025949	Bacteria	4030
1088	Ga0207667_10166593	3300025949	Bacteria	2265
1089	Ga0207667_10293133	3300025949	Bacteria	1662
1090	Ga0207667_10352811	3300025949	Bacteria	1500
1091	Ga0207667_10502740	3300025949	Bacteria	1229
1092	Ga0207667_10532525	3300025949	Bacteria	1189
1093	Ga0207667_11240350	3300025949	Bacteria	724
1094	Ga0207651_10002900	3300025960	Bacteria	8279
1095	Ga0207651_10005983	3300025960	Bacteria	6305
1096	Ga0207651_10044919	3300025960	Bacteria	2960
1097	Ga0207651_10070216	3300025960	Bacteria	2477
1098	Ga0207651_10321829	3300025960	Bacteria	1293
1099	Ga0207651_10821674	3300025960	Bacteria	825
1100	Ga0207651_11278811	3300025960	Bacteria	659
1101	Ga0207712_10337304	3300025961	Bacteria	1249
1102	Ga0207712_10474714	3300025961	Bacteria	1065
1103	Ga0207712_11046751	3300025961	Bacteria	725
1104	Ga0207712_11788189	3300025961	Bacteria	551
1105	Ga0207712_12138560	3300025961	Bacteria	501
1106	Ga0207668_10005279	3300025972	Bacteria	7602
1107	Ga0207668_10005330	3300025972	Bacteria	7564
1108	Ga0207668_10021602	3300025972	Bacteria	4107
1109	Ga0207668_10042346	3300025972	Bacteria	3083
1110	Ga0207668_10046004	3300025972	Bacteria	2979
1111	Ga0207668_10050091	3300025972	Bacteria	2875
1112	Ga0207668_10086296	3300025972	Bacteria	2292
1113	Ga0207668_10341499	3300025972	Bacteria	1249
1114	Ga0207668_10414184	3300025972	Bacteria	1142
1115	Ga0207668_10629417	3300025972	Bacteria	937
1116	Ga0207668_10744430	3300025972	Bacteria	864
1117	Ga0207640_10104659	3300025981	Bacteria	1993
1118	Ga0207640_10117293	3300025981	Bacteria	1899
1119	Ga0207640_10154206	3300025981	Bacteria	1691
1120	Ga0207640_10312883	3300025981	Bacteria	1247
1121	Ga0207640_10442732	3300025981	Bacteria	1069
1122	Ga0207640_10470448	3300025981	Bacteria	1040
1123	Ga0207640_10775846	3300025981	Bacteria	828
1124	Ga0207640_12177168	3300025981	Bacteria	503
1125	Ga0207658_10002265	3300025986	Bacteria	14232
1126	Ga0207658_10028692	3300025986	Bacteria	3922
1127	Ga0207658_10057416	3300025986	Bacteria	2892
1128	Ga0207658_10069682	3300025986	Bacteria	2658
1129	Ga0207658_10083183	3300025986	Bacteria	2459
1130	Ga0207658_10130377	3300025986	Bacteria	2019
1131	Ga0207658_10209742	3300025986	Bacteria	1632
1132	Ga0207658_10458707	3300025986	Bacteria	1129
1133	Ga0207658_11542229	3300025986	Bacteria	607
1134	Ga0207677_10110258	3300026023	Bacteria	2048
1135	Ga0207677_10371911	3300026023	Bacteria	1204
1136	Ga0207677_10552693	3300026023	Bacteria	1004
1137	Ga0207677_10645633	3300026023	Bacteria	933
1138	Ga0207677_10647596	3300026023	Bacteria	932
1139	Ga0207677_10828996	3300026023	Bacteria	830
1140	Ga0207677_11093676	3300026023	Bacteria	726
1141	Ga0207677_12120612	3300026023	Bacteria	523
1142	Ga0207677_12153069	3300026023	Bacteria	519
1143	Ga0207703_10002253	3300026035	Bacteria	16857
1144	Ga0207703_10010384	3300026035	Bacteria	7284
1145	Ga0207703_10012560	3300026035	Bacteria	6602
1146	Ga0207703_10067166	3300026035	Bacteria	2951
1147	Ga0207703_10138301	3300026035	Bacteria	2111
1148	Ga0207703_10145277	3300026035	Bacteria	2062
1149	Ga0207703_10185945	3300026035	Bacteria	1836
1150	Ga0207703_10204574	3300026035	Bacteria	1756
1151	Ga0207703_11126363	3300026035	Bacteria	754
1152	Ga0207703_11305358	3300026035	Bacteria	698
1153	Ga0207703_11429687	3300026035	Bacteria	665
1154	Ga0207703_11727567	3300026035	Bacteria	602
1155	Ga0207639_10049081	3300026041	Bacteria	3198
1156	Ga0207639_10061908	3300026041	Bacteria	2892
1157	Ga0207639_10113819	3300026041	Bacteria	2210
1158	Ga0207639_10201273	3300026041	Bacteria	1708
1159	Ga0207639_10250568	3300026041	Bacteria	1544
1160	Ga0207639_10395458	3300026041	Bacteria	1244
1161	Ga0207639_10566265	3300026041	Bacteria	1045
1162	Ga0207639_10573309	3300026041	Bacteria	1038
1163	Ga0207639_10845958	3300026041	Bacteria	854
1164	Ga0207678_10002359	3300026067	Bacteria	17124
1165	Ga0207678_10012240	3300026067	Bacteria	7533
1166	Ga0207678_10012406	3300026067	Bacteria	7479
1167	Ga0207678_10042665	3300026067	Bacteria	3928
1168	Ga0207678_10044092	3300026067	Bacteria	3859
1169	Ga0207678_10065923	3300026067	Bacteria	3109
1170	Ga0207678_10076999	3300026067	Bacteria	2857
1171	Ga0207678_10094242	3300026067	Bacteria	2558
1172	Ga0207678_10101714	3300026067	Bacteria	2454
1173	Ga0207678_10157526	3300026067	Bacteria	1939
1174	Ga0207678_10212887	3300026067	Bacteria	1653
1175	Ga0207678_10352674	3300026067	Bacteria	1269
1176	Ga0207678_10503316	3300026067	Bacteria	1056
1177	Ga0207678_10878342	3300026067	Bacteria	792
1178	Ga0207708_10007131	3300026075	Bacteria	8260
1179	Ga0207708_10342124	3300026075	Bacteria	1225
1180	Ga0207708_10389682	3300026075	Bacteria	1150
1181	Ga0207702_10007599	3300026078	Bacteria	9228
1182	Ga0207702_10014083	3300026078	Bacteria	6640
1183	Ga0207702_10026484	3300026078	Bacteria	4813
1184	Ga0207702_10029015	3300026078	Bacteria	4601
1185	Ga0207702_10488284	3300026078	Bacteria	1199
1186	Ga0207702_10665287	3300026078	Bacteria	1025
1187	Ga0207702_10959967	3300026078	Bacteria	848
1188	Ga0207641_10000374	3300026088	Bacteria	53088
1189	Ga0207641_10060660	3300026088	Bacteria	3224
1190	Ga0207641_10146203	3300026088	Bacteria	2137
1191	Ga0207641_10181002	3300026088	Bacteria	1930
1192	Ga0207641_10248429	3300026088	Bacteria	1660
1193	Ga0207641_10484126	3300026088	Bacteria	1199
1194	Ga0207641_10636429	3300026088	Bacteria	1047
1195	Ga0207641_10701441	3300026088	Bacteria	997
1196	Ga0207641_11567516	3300026088	Bacteria	660
1197	Ga0207641_11644708	3300026088	Bacteria	644
1198	Ga0207641_11903517	3300026088	Bacteria	596
1199	Ga0207648_10000523	3300026089	Bacteria	42961
1200	Ga0207648_10028050	3300026089	Bacteria	4993
1201	Ga0207648_10046612	3300026089	Bacteria	3801
1202	Ga0207648_10058572	3300026089	Bacteria	3359
1203	Ga0207648_10079468	3300026089	Bacteria	2861
1204	Ga0207648_10151293	3300026089	Bacteria	2048
1205	Ga0207648_10205160	3300026089	Bacteria	1749
1206	Ga0207648_11096860	3300026089	Bacteria	746
1207	Ga0207648_11135083	3300026089	Bacteria	733
1208	Ga0207648_11382900	3300026089	Bacteria	662
1209	Ga0207676_10008789	3300026095	Bacteria	7187
1210	Ga0207676_10022296	3300026095	Bacteria	4656
1211	Ga0207676_10056352	3300026095	Bacteria	3089
1212	Ga0207676_10099358	3300026095	Bacteria	2408
1213	Ga0207676_10256029	3300026095	Bacteria	1578
1214	Ga0207676_10608435	3300026095	Bacteria	1050
1215	Ga0207676_10699647	3300026095	Bacteria	982
1216	Ga0207676_11479002	3300026095	Bacteria	676
1217	Ga0207674_10000118	3300026116	Bacteria	92408
1218	Ga0207674_10001292	3300026116	Bacteria	32705
1219	Ga0207674_10004098	3300026116	Bacteria	17651
1220	Ga0207674_10071412	3300026116	Bacteria	3488
1221	Ga0207674_10116225	3300026116	Bacteria	2646
1222	Ga0207674_10206561	3300026116	Bacteria	1913
1223	Ga0207674_10320847	3300026116	Bacteria	1498
1224	Ga0207674_10387621	3300026116	Bacteria	1351
1225	Ga0207674_10565789	3300026116	Bacteria	1098
1226	Ga0207675_100000635	3300026118	Bacteria	34445
1227	Ga0207675_100024242	3300026118	Bacteria	5642
1228	Ga0207675_100050551	3300026118	Bacteria	3879
1229	Ga0207675_100118498	3300026118	Bacteria	2503
1230	Ga0207675_100250228	3300026118	Bacteria	1715
1231	Ga0207675_100400814	3300026118	Bacteria	1352
1232	Ga0207675_102085500	3300026118	Bacteria	584
1233	Ga0207683_10000476	3300026121	Bacteria	37318
1234	Ga0207683_10000672	3300026121	Bacteria	31425
1235	Ga0207683_10002112	3300026121	Bacteria	17478
1236	Ga0207683_10012224	3300026121	Bacteria	7328
1237	Ga0207683_10079337	3300026121	Bacteria	2910
1238	Ga0207683_10310932	3300026121	Bacteria	1442
1239	Ga0207683_10370294	3300026121	Bacteria	1316
1240	Ga0207683_10692827	3300026121	Bacteria	944
1241	Ga0207683_10736882	3300026121	Bacteria	914
1242	Ga0207683_11123953	3300026121	Bacteria	729
1243	Ga0207683_11196953	3300026121	Bacteria	704
1244	Ga0207683_11266057	3300026121	Bacteria	683
1245	Ga0207683_11419879	3300026121	Bacteria	642
1246	Ga0207683_12126574	3300026121	Bacteria	509
1247	Ga0207698_10004704	3300026142	Bacteria	8347
1248	Ga0207698_10008972	3300026142	Bacteria	6346
1249	Ga0207698_10024578	3300026142	Bacteria	4231
1250	Ga0207698_10077031	3300026142	Bacteria	2672
1251	Ga0207698_10245381	3300026142	Bacteria	1635
1252	Ga0207698_10318472	3300026142	Bacteria	1455
1253	Ga0207698_10408863	3300026142	Bacteria	1299
1254	Ga0207698_10463650	3300026142	Bacteria	1226
1255	Ga0207698_10476678	3300026142	Bacteria	1210
1256	Ga0207698_10853850	3300026142	Bacteria	915
1257	Ga0207698_11185978	3300026142	Bacteria	777
1258	Ga0209973_1023361	3300027252	Bacteria	835
1259	Ga0209371_1000325	3300027312	Bacteria	52216
1260	Ga0209371_1000766	3300027312	Bacteria	26728
1261	Ga0209371_1005929	3300027312	Bacteria	4693
1262	Ga0209981_1077108	3300027378	Bacteria	517
1263	Ga0209999_1044326	3300027543	Bacteria	836
1264	Ga0209970_1007440	3300027614	Bacteria	1796
1265	Ga0209970_1012711	3300027614	Bacteria	1392
1266	Ga0210002_1031140	3300027617	Bacteria	887
1267	Ga0210002_1039852	3300027617	Bacteria	796
1268	Ga0209983_1039796	3300027665	Bacteria	1016
1269	Ga0209983_1069814	3300027665	Bacteria	782
1270	Ga0209282_1104606	3300027666	Bacteria	1451
1271	Ga0209971_1000944	3300027682	Bacteria	7488
1272	Ga0209971_1009534	3300027682	Bacteria	2300
1273	Ga0209998_10016081	3300027717	Bacteria	1572
1274	Ga0209974_10000388	3300027876	Bacteria	14607
1275	Ga0209974_10002687	3300027876	Bacteria	6442
1276	Ga0209974_10012991	3300027876	Bacteria	2779
1277	Ga0207428_10211716	3300027907	Bacteria	1456
1278	Ga0268266_10004526	3300028379	Bacteria	13283
1279	Ga0268266_10006169	3300028379	Bacteria	11019
1280	Ga0268266_10027784	3300028379	Bacteria	4810
1281	Ga0268266_10302635	3300028379	Bacteria	1492
1282	Ga0268266_10451765	3300028379	Bacteria	1222
1283	Ga0268266_10556210	3300028379	Bacteria	1099
1284	Ga0268266_11283318	3300028379	Bacteria	707
1285	Ga0268266_11551761	3300028379	Bacteria	638
1286	Ga0268266_11675716	3300028379	Bacteria	611
1287	Ga0268265_10040781	3300028380	Bacteria	3430
1288	Ga0268265_10117676	3300028380	Bacteria	2183
1289	Ga0268265_10141008	3300028380	Bacteria	2018
1290	Ga0268265_10206479	3300028380	Bacteria	1708
1291	Ga0268265_10370916	3300028380	Bacteria	1313
1292	Ga0268265_10522943	3300028380	Bacteria	1122
1293	Ga0268265_10736208	3300028380	Bacteria	956
1294	Ga0268264_10007867	3300028381	Bacteria	8871
1295	Ga0268264_10008790	3300028381	Bacteria	8380
1296	Ga0268264_10013714	3300028381	Bacteria	6671
1297	Ga0268264_10088363	3300028381	Bacteria	2667
1298	Ga0268264_10176303	3300028381	Bacteria	1938
1299	Ga0268264_10510077	3300028381	Bacteria	1174
1300	Ga0268264_10794185	3300028381	Bacteria	945
1301	Ga0268264_11936236	3300028381	Bacteria	599
1302	Ga0307515_10000063	3300028794	Bacteria	245504
1303	Ga0307515_10006150	3300028794	Bacteria	24126
1304	Ga0307515_10085745	3300028794	Bacteria	4025
1305	Ga0307515_10823060	3300028794	Bacteria	553
1306	Ga0265338_10004608	3300028800	Bacteria	18530
1307	Ga0265338_10052656	3300028800	Bacteria	3649
1308	Ga0268256_1001275	3300030500	Bacteria	15647
1309	Ga0268256_1002981	3300030500	Bacteria	8011
1310	Ga0307512_10110791	3300030522	Bacteria	1810
1311	Ga0307512_10422138	3300030522	Bacteria	550
1312	Ga0316177_1174401	3300030731	Bacteria	880
1313	Ga0316176_1043110	3300030732	Bacteria	2551
1314	Ga0314311_1156198	3300030733	Bacteria	6393
1315	Ga0316179_1076722	3300030734	Bacteria	3221
1316	Ga0316178_1027803	3300030735	Bacteria	4966
1317	Ga0316181_1052902	3300030744	Bacteria	2258
1318	Ga0265332_10000006	3300031238	Bacteria	327963
1319	Ga0265332_10079651	3300031238	Bacteria	1390
1320	Ga0265340_10203320	3300031247	Bacteria	890
1321	Ga0265331_10273708	3300031250	Bacteria	757
1322	Ga0265327_10003591	3300031251	Bacteria	14634
1323	Ga0265327_10264874	3300031251	Bacteria	762
1324	Ga0265316_10487862	3300031344	Bacteria	881
1325	Ga0307513_10005218	3300031456	Bacteria	17209
1326	Ga0307513_10011808	3300031456	Bacteria	10825
1327	Ga0307513_10108998	3300031456	Bacteria	2768
1328	Ga0307513_10345104	3300031456	Bacteria	1238
1329	Ga0307513_10443868	3300031456	Bacteria	1023
1330	Ga0307408_100002231	3300031548	Bacteria	13824
1331	Ga0307408_100004683	3300031548	Bacteria	9240
1332	Ga0307408_100016647	3300031548	Bacteria	4912
1333	Ga0307408_100022047	3300031548	Bacteria	4321
1334	Ga0307408_100221085	3300031548	Bacteria	1545
1335	Ga0307408_100376429	3300031548	Bacteria	1212
1336	Ga0307408_100394230	3300031548	Bacteria	1187
1337	Ga0307408_100419494	3300031548	Bacteria	1153
1338	Ga0307408_100427540	3300031548	Bacteria	1143
1339	Ga0307514_10000530	3300031649	Bacteria	74660
1340	Ga0307514_10129952	3300031649	Bacteria	1736
1341	Ga0310111_140303	3300031667	Bacteria	523
1342	Ga0265314_10257738	3300031711	Bacteria	998
1343	Ga0307516_10206285	3300031730	Bacteria	1682
1344	Ga0307516_10388974	3300031730	Bacteria	1055
1345	Ga0307405_10022124	3300031731	Bacteria	3589
1346	Ga0307405_10023987	3300031731	Bacteria	3478
1347	Ga0307405_10031144	3300031731	Bacteria	3136
1348	Ga0307405_10146238	3300031731	Bacteria	1656
1349	Ga0307405_10266526	3300031731	Bacteria	1282
1350	Ga0307405_10430756	3300031731	Bacteria	1040
1351	Ga0307405_11117092	3300031731	Bacteria	678
1352	Ga0307405_11509476	3300031731	Bacteria	590
1353	Ga0307405_11602925	3300031731	Bacteria	574
1354	Ga0307413_10013759	3300031824	Bacteria	4082
1355	Ga0307413_10016152	3300031824	Bacteria	3846
1356	Ga0307413_10060458	3300031824	Bacteria	2333
1357	Ga0307413_10134205	3300031824	Bacteria	1699
1358	Ga0307413_10251491	3300031824	Bacteria	1311
1359	Ga0307413_10596095	3300031824	Bacteria	903
1360	Ga0307413_11019416	3300031824	Bacteria	710
1361	Ga0307410_10022829	3300031852	Bacteria	3876
1362	Ga0307410_10034223	3300031852	Bacteria	3288
1363	Ga0307410_10040407	3300031852	Bacteria	3069
1364	Ga0307410_10056367	3300031852	Bacteria	2672
1365	Ga0307410_10109844	3300031852	Bacteria	1993
1366	Ga0307410_10135366	3300031852	Bacteria	1815
1367	Ga0307406_10006158	3300031901	Bacteria	6599
1368	Ga0307406_10015929	3300031901	Bacteria	4359
1369	Ga0307406_10218961	3300031901	Bacteria	1413
1370	Ga0307406_10788529	3300031901	Bacteria	801
1371	Ga0307406_11045835	3300031901	Bacteria	702
1372	Ga0307406_11431777	3300031901	Bacteria	606
1373	Ga0307407_10004407	3300031903	Bacteria	5974
1374	Ga0307407_10028790	3300031903	Bacteria	2975
1375	Ga0307407_10094168	3300031903	Bacteria	1843
1376	Ga0307407_10139229	3300031903	Bacteria	1563
1377	Ga0307412_10000056	3300031911	Bacteria	145861
1378	Ga0307412_10010550	3300031911	Bacteria	5322
1379	Ga0307412_10066666	3300031911	Bacteria	2441
1380	Ga0307412_10089695	3300031911	Bacteria	2147
1381	Ga0307412_10241980	3300031911	Bacteria	1396
1382	Ga0307409_100003369	3300031995	Bacteria	8669
1383	Ga0307409_100023370	3300031995	Bacteria	4282
1384	Ga0307409_100726070	3300031995	Bacteria	995
1385	Ga0307409_100832663	3300031995	Bacteria	932
1386	Ga0307409_101039428	3300031995	Bacteria	838
1387	Ga0307416_100001793	3300032002	Bacteria	11924
1388	Ga0307416_100016198	3300032002	Bacteria	5172
1389	Ga0307416_100032023	3300032002	Bacteria	3967
1390	Ga0307416_100041410	3300032002	Bacteria	3587
1391	Ga0307416_100113533	3300032002	Bacteria	2394
1392	Ga0307416_100358622	3300032002	Bacteria	1479
1393	Ga0307416_100495911	3300032002	Bacteria	1284
1394	Ga0307416_100543873	3300032002	Bacteria	1233
1395	Ga0307416_100563378	3300032002	Bacteria	1214
1396	Ga0307416_100701763	3300032002	Bacteria	1101
1397	Ga0307416_101623026	3300032002	Bacteria	752
1398	Ga0307416_102273973	3300032002	Bacteria	643
1399	Ga0307414_10004461	3300032004	Bacteria	7600
1400	Ga0307414_10202265	3300032004	Bacteria	1616
1401	Ga0307414_10664404	3300032004	Bacteria	940
1402	Ga0307411_10000409	3300032005	Bacteria	14714
1403	Ga0307411_10031067	3300032005	Bacteria	3281
1404	Ga0307411_10032206	3300032005	Bacteria	3237
1405	Ga0307411_10034784	3300032005	Bacteria	3139
1406	Ga0307411_10637374	3300032005	Bacteria	921
1407	Ga0307411_12012287	3300032005	Bacteria	539
1408	Ga0307415_100380349	3300032126	Bacteria	1198
1409	Ga0316583_10002814	3300032133	Bacteria	6088
1410	Ga0307510_10115446	3300033180	Bacteria	2410
1411	Ga0373934_0367836	3300035086	Bacteria	599
1412	Ga0373940_0060841	3300035088	Bacteria	1080
1413	Ga0373952_0138952	3300035092	Bacteria	673
1414	Ga0373956_0358029	3300035119	Bacteria	696
1415	Ga0373946_0144803	3300035171	Bacteria	1104
1416	Ga0373955_0456684	3300035172	Bacteria	779
1417	Ga0373955_0886253	3300035172	Bacteria	549
1418	Ga0373961_0016263	3300035241	Bacteria	1915
1419	Ga0373935_0326616	3300035692	Bacteria	1090
1420	Ga0373927_0021991	3300035695	Bacteria	4179
1421	Ga0373927_0087426	3300035695	Bacteria	2023
1422	Ga0373947_0509834	3300035725	Bacteria	818
1423	Ga0373937_0030611	3300036401	Bacteria	4874
1424	Ga0373937_0206310	3300036401	Bacteria	1848
1425	Ga0373937_0583556	3300036401	Bacteria	1061
1426	Ga0373937_1385795	3300036401	Bacteria	651
1427	Ga0310109_023389	3300036534	Bacteria	830
1428	Ga0316582_0128859	3300036647	Bacteria	1698
1429	Ga0373925_0019802	3300037068	Bacteria	4897
1430	Ga0395898_0061916	3300037466	Bacteria	3635
1431	Ga0395898_1457160	3300037466	Bacteria	611
1432	Ga0395905_0026187	3300037471	Bacteria	5500
1433	Ga0395905_0322925	3300037471	Bacteria	1433
1434	Ga0395905_1516079	3300037471	Bacteria	575
1435	Ga0395901_1000191	3300038443	Bacteria	812
1436	Ga0436365_1259852	3300039437	Bacteria	2430
1437	Ga0439436_0000116	3300041404	Bacteria	18426
1438	Ga0439436_0022736	3300041404	Bacteria	1856
1439	Ga0439447_065835	3300041407	Bacteria	847
1440	Ga0439466_0001083	3300041411	Bacteria	10556
1441	Ga0439466_0016884	3300041411	Bacteria	2633
1442	Ga0439465_0001025	3300041413	Bacteria	8893
1443	Ga0451791_1640340	3300041451	Bacteria	950
1444	Ga0451795_0706091	3300041456	Bacteria	516
1445	Ga0451798_0747670	3300041458	Bacteria	679
1446	Ga0451800_0896620	3300041459	Bacteria	739
1447	Ga0451800_1306844	3300041459	Bacteria	602
1448	Ga0451807_1541707	3300041486	Bacteria	585
1449	Ga0451833_1273567	3300041491	Bacteria	610
1450	Ga0451839_1258874	3300041496	Bacteria	550
1451	Ga0451853_2975676	3300041512	Bacteria	1061
1452	Ga0439431_0006512	3300041997	Bacteria	2584
1453	Ga0439431_0065538	3300041997	Bacteria	961
1454	Ga0439442_023524	3300042002	Bacteria	1280
1455	Ga0439442_068571	3300042002	Bacteria	754
1456	Ga0439445_0024394	3300042004	Bacteria	1537
1457	Ga0439432_001484	3300042006	Bacteria	8802
1458	Ga0439449_0002576	3300042007	Bacteria	7069
1459	Ga0439449_0009458	3300042007	Bacteria	3695
1460	Ga0439452_003623	3300042010	Bacteria	5374
1461	Ga0450919_003335	3300042121	Bacteria	2027
1462	Ga0450888_031356	3300042126	Bacteria	712
1463	Ga0450899_014163	3300042135	Bacteria	905
1464	Ga0450899_019122	3300042135	Bacteria	795
1465	Ga0450889_040584	3300042144	Bacteria	561
1466	Ga0450906_002101	3300042145	Bacteria	4358
1467	Ga0439446_0263379	3300042156	Bacteria	597
1468	Ga0450909_013399	3300042185	Bacteria	1206
1469	Ga0439434_0001991	3300042435	Bacteria	5908
1470	Ga0439434_0016176	3300042435	Bacteria	2228
1471	Ga0450918_000550	3300042531	Bacteria	8018
1472	Ga0451577_0310111	3300042876	Bacteria	1430
1473	Ga0466972_0174584	3300044658	Bacteria	1008
1474	Ga0453683_0391066	3300044673	Bacteria	896
1475	Ga0466965_0021418	3300044683	Bacteria	3111
1476	Ga0466966_0022548	3300044684	Bacteria	4130
1477	Ga0466971_0249056	3300044719	Bacteria	846
1478	Ga0466960_0052178	3300044901	Bacteria	1978
1479	Ga0466967_0628753	3300045976	Bacteria	1061
1480	Ga0495627_047086	3300046453	Bacteria	1308
1481	Ga0495603_0007633	3300046455	Bacteria	6513
1482	Ga0495590_0000842	3300046457	Bacteria	13854
1483	Ga0495591_011808	3300046458	Bacteria	3285
1484	Ga0495629_0000465	3300046459	Bacteria	33935
1485	Ga0495629_0204460	3300046459	Bacteria	1365
1486	Ga0495651_0176037	3300046462	Bacteria	1519
1487	Ga0495651_0363896	3300046462	Bacteria	952
1488	Ga0495651_0382804	3300046462	Bacteria	922
1489	Ga0495650_0009993	3300046471	Bacteria	5341
1490	Ga0495580_0020774	3300046472	Bacteria	4853
1491	Ga0495580_0040792	3300046472	Bacteria	3314
1492	Ga0495580_0433985	3300046472	Bacteria	883
1493	Ga0495580_0461229	3300046472	Bacteria	852
1494	Ga0495582_0675704	3300046473	Bacteria	598
1495	Ga0495639_0014931	3300046475	Bacteria	3365
1496	Ga0495662_0285262	3300046476	Bacteria	813
1497	Ga0495662_0493617	3300046476	Bacteria	600
1498	Ga0495664_0260419	3300046477	Bacteria	1048
1499	Ga0495606_0011997	3300046507	Bacteria	6998
1500	Ga0495606_0182488	3300046507	Bacteria	1209
1501	Ga0495608_0015869	3300046511	Bacteria	5212
1502	Ga0495610_0006839	3300046512	Bacteria	7732
1503	Ga0495620_0141759	3300046515	Bacteria	939
1504	Ga0495628_0075733	3300046516	Bacteria	2620
1505	Ga0495630_0200448	3300046517	Bacteria	1523
1506	Ga0495630_0825183	3300046517	Bacteria	707
1507	Ga0495631_0000456	3300046518	Bacteria	27772
1508	Ga0495637_0001023	3300046520	Bacteria	17604
1509	Ga0495637_0258659	3300046520	Bacteria	625
1510	Ga0495643_0145016	3300046522	Bacteria	1180
1511	Ga0495642_0011654	3300046528	Bacteria	3383
1512	Ga0495642_0026853	3300046528	Bacteria	2289
1513	Ga0495652_0046140	3300046529	Bacteria	3742
1514	Ga0495652_0232624	3300046529	Bacteria	1377
1515	Ga0495654_0005873	3300046530	Bacteria	7061
1516	Ga0495665_0020113	3300046531	Bacteria	3586
1517	Ga0495665_0049608	3300046531	Bacteria	2225
1518	Ga0495598_0256357	3300046537	Bacteria	649
1519	Ga0495609_0050169	3300046538	Bacteria	1861
1520	Ga0495609_0122618	3300046538	Bacteria	1117
1521	Ga0495621_0004363	3300046539	Bacteria	3973
1522	Ga0495621_0026254	3300046539	Bacteria	1963
1523	Ga0495621_0122345	3300046539	Bacteria	1007
1524	Ga0495597_0004639	3300046542	Bacteria	7486
1525	Ga0495597_0163898	3300046542	Bacteria	906
1526	Ga0495645_0000582	3300046543	Bacteria	25023
1527	Ga0495645_0194562	3300046543	Bacteria	1379
1528	Ga0495622_0306040	3300046557	Bacteria	692
1529	Ga0495633_0291493	3300046558	Bacteria	742
1530	Ga0495656_0002977	3300046615	Bacteria	5688
1531	Ga0495668_0141599	3300046616	Bacteria	1316
1532	Ga0495625_0000510	3300046660	Bacteria	57454
1533	Ga0495635_0156032	3300046663	Bacteria	1553
1534	Ga0495661_0124059	3300046665	Bacteria	1423
1535	Ga0495588_0046359	3300046674	Bacteria	2230
1536	Ga0495588_0124483	3300046674	Bacteria	1359
1537	Ga0495588_0523442	3300046674	Bacteria	621
1538	Ga0495588_0561216	3300046674	Bacteria	598
1539	Ga0495657_0321906	3300046675	Bacteria	919
1540	Ga0495599_0352104	3300046678	Bacteria	883
1541	Ga0495599_0483877	3300046678	Bacteria	730
1542	Ga0495646_0061124	3300046680	Bacteria	2244
1543	Ga0495647_0446776	3300046681	Bacteria	598
1544	Ga0495658_0005887	3300046683	Bacteria	6016
1545	Ga0495658_0729303	3300046683	Bacteria	635
1546	Ga0495669_0032205	3300046684	Bacteria	2304
1547	Ga0495669_0245921	3300046684	Bacteria	859
1548	Ga0495624_0042714	3300046690	Bacteria	2897
1549	Ga0495624_0686058	3300046690	Bacteria	608
1550	Ga0495671_0012484	3300046692	Bacteria	4638
1551	Ga0495649_0217847	3300046694	Bacteria	988
1552	Ga0495589_0334818	3300046794	Bacteria	698
1553	Ga0495581_0003203	3300047315	Bacteria	9371
1554	Ga0495581_0403276	3300047315	Bacteria	797
1555	Ga0495604_0150378	3300047317	Bacteria	1655
1556	Ga0495674_0015320	3300047319	Bacteria	7171
1557	Ga0495674_0032881	3300047319	Bacteria	4701
1558	Ga0495674_0418075	3300047319	Bacteria	1080
1559	Ga0495676_0006299	3300047321	Bacteria	10919
1560	Ga0495680_0125604	3300047322	Bacteria	1890
1561	Ga0495683_0002149	3300047323	Bacteria	12120
1562	Ga0495675_0611634	3300047444	Bacteria	617
1563	Ga0495681_0350509	3300047470	Bacteria	561
1564	Ga0495684_0296529	3300047471	Bacteria	1162
1565	Ga0495686_0010936	3300047472	Bacteria	6424
1566	Ga0495686_0352431	3300047472	Bacteria	800
1567	Ga0495593_0003632	3300047673	Bacteria	9213
1568	Ga0495593_0113776	3300047673	Bacteria	1380
1569	Ga0495593_0287935	3300047673	Bacteria	821
1570	Ga0495602_0207890	3300048088	Bacteria	1488
1571	Ga0495614_0001103	3300048089	Bacteria	11565
1572	Ga0496100_0052843	3300048903	Bacteria	2643
1573	Ga0496100_1413780	3300048903	Bacteria	549
1574	Ga0496101_0008817	3300048904	Bacteria	6598
1575	Ga0496101_0011340	3300048904	Bacteria	5911
1576	Ga0496101_0122689	3300048904	Bacteria	1965
1577	Ga0496102_0004270	3300048905	Bacteria	12082
1578	Ga0496102_0040966	3300048905	Bacteria	4192
1579	Ga0496102_0049771	3300048905	Bacteria	3813
1580	Ga0496102_1518338	3300048905	Bacteria	588
1581	Ga0496103_0001532	3300048906	Bacteria	15433
1582	Ga0496103_0119196	3300048906	Bacteria	1680
1583	Ga0496104_0111009	3300048907	Bacteria	2629
1584	Ga0496104_0118703	3300048907	Bacteria	2539
1585	Ga0496105_0176749	3300048908	Bacteria	1748
1586	Ga0496105_0245561	3300048908	Bacteria	1452
1587	Ga0496105_0301355	3300048908	Bacteria	1288
1588	Ga0496105_0591813	3300048908	Bacteria	862
1589	Ga0496106_0001808	3300048909	Bacteria	15988
1590	Ga0496106_0831882	3300048909	Bacteria	731
1591	Ga0496107_0031326	3300048910	Bacteria	3794
1592	Ga0496107_0816016	3300048910	Bacteria	682
1593	Ga0496109_0476737	3300048912	Bacteria	1178
1594	Ga0496110_0085410	3300048913	Bacteria	2817
1595	Ga0496110_0458129	3300048913	Bacteria	1162
1596	Ga0496110_0858621	3300048913	Bacteria	813
1597	Ga0496110_0894679	3300048913	Bacteria	794
1598	Ga0496110_1565773	3300048913	Bacteria	569
1599	Ga0496111_0003111	3300048914	Bacteria	10204
1600	Ga0496111_0362159	3300048914	Bacteria	1073
1601	Ga0496112_0004471	3300048915	Bacteria	11856
1602	Ga0496112_0051037	3300048915	Bacteria	4057
1603	Ga0496112_0452054	3300048915	Bacteria	1222
1604	Ga0496113_0303875	3300048916	Bacteria	1278
1605	Ga0496113_0698221	3300048916	Bacteria	810
1606	Ga0496114_0076106	3300048917	Bacteria	2828
1607	Ga0496114_0584113	3300048917	Bacteria	986
1608	Ga0496114_1763948	3300048917	Bacteria	507
1609	Ga0496115_0537792	3300048918	Bacteria	935
1610	Ga0496115_0698283	3300048918	Bacteria	798
1611	Ga0496116_0001318	3300048919	Bacteria	28314
1612	Ga0496116_0205652	3300048919	Bacteria	1025
1613	Ga0496117_0004062	3300048920	Bacteria	16439
1614	Ga0496117_0044649	3300048920	Bacteria	3208
1615	Ga0496117_0120925	3300048920	Bacteria	1608
1616	Ga0496117_0474924	3300048920	Bacteria	612
1617	Ga0496117_0505954	3300048920	Bacteria	584
1618	Ga0496118_0024875	3300048921	Bacteria	5154
1619	Ga0496119_0157137	3300048922	Bacteria	1213
1620	Ga0496119_0430845	3300048922	Bacteria	624
1621	Ga0496120_0184374	3300048923	Bacteria	1022
1622	Ga0496120_0371531	3300048923	Bacteria	638
1623	Ga0496121_0006168	3300048924	Bacteria	15036
1624	Ga0496121_0352003	3300048924	Bacteria	980
1625	Ga0496122_0000317	3300048925	Bacteria	105883
1626	Ga0496122_0012516	3300048925	Bacteria	8434
1627	Ga0496122_0361109	3300048925	Bacteria	754
1628	Ga0496123_0000264	3300048926	Bacteria	105015
1629	Ga0496123_0011806	3300048926	Bacteria	7523
1630	Ga0496123_0481976	3300048926	Bacteria	546
1631	Ga0496124_0017859	3300048927	Bacteria	6668
1632	Ga0496124_0189486	3300048927	Bacteria	1575
1633	Ga0496124_0260812	3300048927	Bacteria	1275
1634	Ga0496125_0244279	3300048928	Bacteria	1137
1635	Ga0496125_0461005	3300048928	Bacteria	725
1636	Ga0496126_0003244	3300048929	Bacteria	20790
1637	Ga0496126_0391503	3300048929	Bacteria	1129
1638	Ga0466983_0168030	3300048986	Bacteria	1779
1639	Ga0501306_028555	3300049127	Bacteria	818
1640	Ga0501306_043986	3300049127	Bacteria	700
1641	Ga0501309_049751	3300049129	Bacteria	656
1642	Ga0501310_013085	3300049130	Bacteria	959
1643	Ga0501310_024332	3300049130	Bacteria	774
1644	Ga0501310_036299	3300049130	Bacteria	672
1645	Ga0501310_085046	3300049130	Bacteria	501
1646	Ga0501341_09323	3300049131	Bacteria	635
1647	Ga0501304_003276	3300049160	Bacteria	1179
1648	Ga0501305_045395	3300049161	Bacteria	725
1649	Ga0501307_006932	3300049162	Bacteria	1237
1650	Ga0501307_020674	3300049162	Bacteria	853
1651	Ga0495678_046786	3300049459	Bacteria	1698
1652	Ga0501311_020644	3300049527	Bacteria	893
1653	Ga0501311_053701	3300049527	Bacteria	637
1654	Ga0501312_034107	3300049528	Bacteria	810
1655	Ga0501312_103539	3300049528	Bacteria	536
1656	Ga0501314_046423	3300049530	Bacteria	517
1657	Ga0501315_000611	3300049531	Bacteria	2585
1658	Ga0501316_033097	3300049532	Bacteria	699
1659	Ga0501317_007769	3300049533	Bacteria	1219
1660	Ga0501317_008485	3300049533	Bacteria	1184
1661	Ga0501317_095528	3300049533	Bacteria	531
1662	Ga0501318_060143	3300049534	Bacteria	581
1663	Ga0501319_033823	3300049535	Bacteria	500
1664	Ga0501320_002470	3300049536	Bacteria	1481
1665	Ga0501320_002513	3300049536	Bacteria	1473
1666	Ga0501320_007009	3300049536	Bacteria	1073
1667	Ga0501320_010244	3300049536	Bacteria	952
1668	Ga0501320_045308	3300049536	Bacteria	587
1669	Ga0501321_009551	3300049537	Bacteria	1049
1670	Ga0501321_036213	3300049537	Bacteria	679
1671	Ga0501321_064242	3300049537	Bacteria	560
1672	Ga0501323_015268	3300049539	Bacteria	968
1673	Ga0501323_021391	3300049539	Bacteria	855
1674	Ga0501323_026005	3300049539	Bacteria	799
1675	Ga0501323_029080	3300049539	Bacteria	768
1676	Ga0501323_039785	3300049539	Bacteria	686
1677	Ga0501323_059772	3300049539	Bacteria	593
1678	Ga0501324_021607	3300049540	Bacteria	661
1679	Ga0501325_003357	3300049541	Bacteria	1162
1680	Ga0501325_016375	3300049541	Bacteria	740
1681	Ga0501331_06509	3300049547	Bacteria	683
1682	Ga0501333_017156	3300049549	Bacteria	558
1683	Ga0501335_019779	3300049551	Bacteria	713
1684	Ga0501335_045309	3300049551	Bacteria	526
1685	Ga0501336_013620	3300049552	Bacteria	682
1686	Ga0501337_000274	3300049553	Bacteria	2347
1687	Ga0501031_0573958	3300049568	Bacteria	726
1688	Ga0501033_0123561	3300049570	Bacteria	1877
1689	Ga0501037_0297284	3300049573	Bacteria	1122
1690	Ga0501039_0668887	3300049575	Bacteria	813
1691	Ga0501039_0734146	3300049575	Bacteria	772
1692	Ga0501041_1066449	3300049577	Bacteria	520
1693	Ga0501042_0370615	3300049578	Bacteria	1036
1694	Ga0501048_0611089	3300049582	Bacteria	783
1695	Ga0501067_0069853	3300049583	Bacteria	1945
1696	Ga0501071_1604547	3300049587	Bacteria	502
1697	Ga0501076_0256872	3300049592	Bacteria	1430
1698	Ga0501206_076022	3300049653	Bacteria	576
1699	Ga0501216_161072	3300049660	Bacteria	538
1700	Ga0501223_072536	3300049663	Bacteria	682
1701	Ga0501249_004353	3300049679	Bacteria	2876
1702	Ga0501257_140665	3300049686	Bacteria	659
1703	Ga0501225_0151426	3300049705	Bacteria	707
1704	Ga0501241_042909	3300049758	Bacteria	880
1705	Ga0501262_023857	3300049759	Bacteria	852
1706	Ga0501266_000448	3300049763	Bacteria	5436
1707	Ga0501035_0820931	3300049822	Bacteria	741
1708	nmdc:mga03683_25632_c1	3300050489	Bacteria	2319
1709	nmdc:mga03683_412001_c1	3300050489	Bacteria	646
1710	nmdc:mga03683_80608_c1	3300050489	Bacteria	1405
1711	nmdc:mga03683_87633_c1	3300050489	Bacteria	1353
1712	nmdc:mga03n38_272416_c1	3300050490	Bacteria	901
1713	nmdc:mga03n38_56084_c1	3300050490	Bacteria	1777
1714	nmdc:mga00v17_122010_c1	3300050491	Bacteria	937
1715	nmdc:mga00v17_36447_c1	3300050491	Bacteria	2931
1716	nmdc:mga0yw44_10396_c1	3300050492	Bacteria	4753
1717	nmdc:mga0yw44_714710_c1	3300050492	Bacteria	680
1718	nmdc:mga0k408_17980_c1	3300050493	Bacteria	3941
1719	nmdc:mga0k408_223643_c1	3300050493	Bacteria	1124
1720	nmdc:mga0k408_29075_c1	3300050493	Bacteria	3144
1721	nmdc:mga0k408_330443_c1	3300050493	Bacteria	909
1722	nmdc:mga0k408_4374_c1	3300050493	Bacteria	7499
1723	nmdc:mga0k408_49325_c1	3300050493	Bacteria	2437
1724	nmdc:mga0k408_51956_c1	3300050493	Bacteria	752
1725	nmdc:mga0k408_528578_c1	3300050493	Bacteria	698
1726	nmdc:mga0k408_615713_c1	3300050493	Bacteria	640
1727	nmdc:mga06z11_138011_c1	3300050494	Bacteria	1375
1728	nmdc:mga06z11_277099_c1	3300050494	Bacteria	993
1729	nmdc:mga06z11_563570_c1	3300050494	Bacteria	692
1730	nmdc:mga07m45_261402_c1	3300050496	Bacteria	1007
1731	nmdc:mga07m45_32522_c1	3300050496	Bacteria	2893
1732	nmdc:mga07m45_9710_c1	3300050496	Bacteria	5003
1733	nmdc:mga05p37_22798_c1	3300050507	Bacteria	7593
1734	nmdc:mga05p37_880204_c1	3300050507	Bacteria	968
1735	nmdc:mga08y16_1909908_c1	3300050511	Bacteria	544
1736	nmdc:mga08y16_1989677_c1	3300050511	Bacteria	530
1737	nmdc:mga08y16_414182_c1	3300050511	Bacteria	1378
1738	nmdc:mga08y16_9048_c1	3300050511	Bacteria	10454
1739	nmdc:mga0n895_1196550_c1	3300050512	Bacteria	734
1740	nmdc:mga0n895_2176964_c1	3300050512	Bacteria	510
1741	nmdc:mga0rr50_1185921_c1	3300050513	Bacteria	649
1742	nmdc:mga0rr50_1328512_c1	3300050513	Bacteria	609
1743	nmdc:mga0rr50_501091_c1	3300050513	Bacteria	1032
1744	nmdc:mga0a205_347780_c1	3300050515	Bacteria	1350
1745	nmdc:mga0a205_634028_c2	3300050515	Bacteria	598
1746	nmdc:mga0a205_668503_c1	3300050515	Bacteria	889
1747	Ga0495612_0357416	3300053078	Bacteria	660
1748	Ga0495595_0109093	3300053084	Bacteria	1341
1749	Ga0495595_0611226	3300053084	Bacteria	558
1750	Ga0495619_0066878	3300053085	Bacteria	2399
1751	Ga0495619_0943497	3300053085	Bacteria	579
1752	Ga0500643_006811	3300053087	Bacteria	4709
1753	Ga0500643_145470	3300053087	Bacteria	637
1754	Ga0500644_0035516	3300053088	Bacteria	1616
1755	Ga0500644_0095793	3300053088	Bacteria	1119
1756	Ga0500651_0000298	3300053093	Bacteria	28626
1757	Ga0500566_0034696	3300053094	Bacteria	2934
1758	Ga0500650_0111121	3300053098	Bacteria	1279
1759	Ga0500555_075386	3300053103	Bacteria	884
1760	Ga0500562_073479	3300053108	Bacteria	923
1761	Ga0500571_000095	3300053110	Bacteria	28943
1762	Ga0500592_016919	3300053116	Bacteria	1171
1763	Ga0500593_000205	3300053117	Bacteria	24092
1764	Ga0500593_027132	3300053117	Bacteria	2553
1765	Ga0500594_0000172	3300053118	Bacteria	16562
1766	Ga0500597_198047	3300053120	Bacteria	845
1767	Ga0500607_001138	3300053121	Bacteria	24753
1768	Ga0500608_268144	3300053122	Bacteria	654
1769	Ga0500618_047100	3300053125	Bacteria	981
1770	Ga0500642_0275016	3300053130	Bacteria	767
1771	Ga0500655_002489	3300053133	Bacteria	3356
1772	Ga0500658_0060625	3300053134	Bacteria	1571
1773	Ga0500559_0148246	3300053136	Bacteria	1100
1774	Ga0500564_168438	3300053138	Bacteria	922
1775	Ga0500568_0002630	3300053139	Bacteria	10437
1776	Ga0500573_0011672	3300053140	Bacteria	4923
1777	Ga0500574_000607	3300053141	Bacteria	4638
1778	Ga0500577_0085473	3300053142	Bacteria	1266
1779	Ga0500577_0547652	3300053142	Bacteria	505
1780	Ga0500616_0026791	3300053153	Bacteria	3187
1781	Ga0500616_0082171	3300053153	Bacteria	1616
1782	Ga0500627_0002287	3300053158	Bacteria	5631
1783	Ga0500627_0265783	3300053158	Bacteria	756
1784	Ga0500638_002179	3300053162	Bacteria	6674
1785	Ga0500636_0025507	3300053177	Bacteria	3494
1786	Ga0500625_111272	3300053729	Bacteria	1123
1787	Ga0500645_000992	3300053730	Bacteria	16005
1788	Ga0500645_001319	3300053730	Bacteria	12868
1789	Ga0500645_021644	3300053730	Bacteria	1983
1790	Ga0500565_038311	3300053734	Bacteria	660
1791	Ga0500661_003302	3300055283	Bacteria	3033
1792	Ga0587084_044995	3300059477	Bacteria	763
1793	Ga0587070_019837	3300059491	Bacteria	1118
1794	Ga0587080_010303	3300059503	Bacteria	1375
1795	Ga0587080_030949	3300059503	Bacteria	932
1796	Ga0587080_050368	3300059503	Bacteria	785
1797	Ga0587082_011683	3300059504	Bacteria	1289
1798	Ga0587083_0185740	3300059505	Bacteria	585
1799	Ga0587085_079601	3300059506	Bacteria	657
1800	Ga0587091_053543	3300059511	Bacteria	836
1801	Ga0587092_148320	3300059512	Bacteria	522
1802	Ga0587098_029155	3300059604	Bacteria	750
1803	Ga0587117_042809	3300059627	Bacteria	727
1804	Ga0587128_062540	3300059630	Bacteria	707
1805	Ga0587072_008270	3300059643	Bacteria	1644
1806	Ga0587072_013950	3300059643	Bacteria	1349
1807	Ga0587072_115001	3300059643	Bacteria	618
1808	Ga0587076_012417	3300059645	Bacteria	1273
1809	Ga0587079_198783	3300059647	Bacteria	546
1810	Ga0587107_007741	3300059652	Bacteria	1219
1811	Ga0587071_043924	3300060344	Bacteria	904
1812	Ga0587071_072798	3300060344	Bacteria	752
1813	Ga0587111_0049197	3300060346	Bacteria	925
1814	Ga0501082_0766730	3300060353	Bacteria	844
1815	Ga0466962_0090599	3300061719	Bacteria	1465

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300036647	Ga0316582_0128859	Ga0316582_0128859_1107_1667	125
2	3300005616	Ga0068852_101318101	Ga0068852_1013181012	126
3	3300026142	Ga0207698_11185978	Ga0207698_111859782	126
4	3300005339	Ga0070660_100006994	Ga0070660_1000069943	127
5	3300005344	Ga0070661_100302329	Ga0070661_1003023292	127
6	3300005366	Ga0070659_100027593	Ga0070659_1000275932	127
7	3300005455	Ga0070663_100732787	Ga0070663_1007327872	127
8	3300005530	Ga0070679_100362091	Ga0070679_1003620911	127
9	3300005614	Ga0068856_101137585	Ga0068856_1011375852	127
10	3300005616	Ga0068852_100014733	Ga0068852_1000147333	127
11	3300009551	Ga0105238_11194808	Ga0105238_111948082	127
12	3300013105	Ga0157369_10024139	Ga0157369_100241397	127
13	3300013307	Ga0157372_12043148	Ga0157372_120431481	127
14	3300026067	Ga0207678_10157526	Ga0207678_101575261	127
15	3300005327	Ga0070658_10600718	Ga0070658_106007181	128
16	3300005327	Ga0070658_11223859	Ga0070658_112238592	128
17	3300005328	Ga0070676_10445171	Ga0070676_104451711	128
18	3300005329	Ga0070683_100636061	Ga0070683_1006360611	128
19	3300005331	Ga0070670_100344849	Ga0070670_1003448492	128
20	3300005331	Ga0070670_100611574	Ga0070670_1006115741	128
21	3300005334	Ga0068869_100922795	Ga0068869_1009227952	128
22	3300005334	Ga0068869_101504713	Ga0068869_1015047132	128
23	3300005335	Ga0070666_11037380	Ga0070666_110373801	128
24	3300005336	Ga0070680_100315946	Ga0070680_1003159462	128
25	3300005336	Ga0070680_100333100	Ga0070680_1003331002	128
26	3300005336	Ga0070680_100500637	Ga0070680_1005006372	128
27	3300005337	Ga0070682_100720997	Ga0070682_1007209971	128
28	3300005338	Ga0068868_100935386	Ga0068868_1009353861	128
29	3300005339	Ga0070660_100028918	Ga0070660_1000289186	128
30	3300005339	Ga0070660_100033307	Ga0070660_1000333074	128
31	3300005339	Ga0070660_100104773	Ga0070660_1001047732	128
32	3300005339	Ga0070660_101188259	Ga0070660_1011882591	128
33	3300005344	Ga0070661_100022855	Ga0070661_1000228554	128
34	3300005344	Ga0070661_100028880	Ga0070661_1000288804	128
35	3300005344	Ga0070661_100058231	Ga0070661_1000582313	128
36	3300005344	Ga0070661_100103115	Ga0070661_1001031151	128
37	3300005344	Ga0070661_100103571	Ga0070661_1001035712	128
38	3300005344	Ga0070661_100302939	Ga0070661_1003029392	128
39	3300005345	Ga0070692_10041318	Ga0070692_100413182	128
40	3300005347	Ga0070668_100002853	Ga0070668_10000285311	128
41	3300005347	Ga0070668_100642392	Ga0070668_1006423921	128
42	3300005353	Ga0070669_100886421	Ga0070669_1008864211	128
43	3300005354	Ga0070675_101697624	Ga0070675_1016976241	128
44	3300005355	Ga0070671_100004906	Ga0070671_1000049062	128
45	3300005356	Ga0070674_100136747	Ga0070674_1001367472	128
46	3300005356	Ga0070674_101402484	Ga0070674_1014024841	128
47	3300005364	Ga0070673_100654868	Ga0070673_1006548681	128
48	3300005364	Ga0070673_101866686	Ga0070673_1018666861	128
49	3300005366	Ga0070659_100020070	Ga0070659_1000200701	128
50	3300005366	Ga0070659_100091948	Ga0070659_1000919482	128
51	3300005366	Ga0070659_100661077	Ga0070659_1006610771	128
52	3300005366	Ga0070659_100773428	Ga0070659_1007734282	128
53	3300005366	Ga0070659_101545748	Ga0070659_1015457481	128
54	3300005367	Ga0070667_102158284	Ga0070667_1021582841	128
55	3300005434	Ga0070709_10067143	Ga0070709_100671433	128
56	3300005434	Ga0070709_10204907	Ga0070709_102049071	128
57	3300005435	Ga0070714_100009061	Ga0070714_1000090619	128
58	3300005435	Ga0070714_100183866	Ga0070714_1001838662	128
59	3300005435	Ga0070714_100208931	Ga0070714_1002089312	128
60	3300005435	Ga0070714_100554553	Ga0070714_1005545532	128
61	3300005436	Ga0070713_100120010	Ga0070713_1001200103	128
62	3300005436	Ga0070713_101524478	Ga0070713_1015244781	128
63	3300005437	Ga0070710_10862464	Ga0070710_108624641	128
64	3300005439	Ga0070711_100030431	Ga0070711_1000304312	128
65	3300005439	Ga0070711_100910655	Ga0070711_1009106552	128
66	3300005439	Ga0070711_101114990	Ga0070711_1011149902	128
67	3300005455	Ga0070663_100142929	Ga0070663_1001429293	128
68	3300005457	Ga0070662_100008353	Ga0070662_1000083538	128
69	3300005457	Ga0070662_100418381	Ga0070662_1004183812	128
70	3300005457	Ga0070662_100793765	Ga0070662_1007937652	128
71	3300005458	Ga0070681_10016094	Ga0070681_100160948	128
72	3300005458	Ga0070681_10038903	Ga0070681_100389034	128
73	3300005458	Ga0070681_10545894	Ga0070681_105458942	128
74	3300005518	Ga0070699_100008010	Ga0070699_1000080105	128
75	3300005518	Ga0070699_100164052	Ga0070699_1001640523	128
76	3300005530	Ga0070679_100014871	Ga0070679_1000148718	128
77	3300005530	Ga0070679_100070200	Ga0070679_1000702003	128
78	3300005530	Ga0070679_100091345	Ga0070679_1000913451	128
79	3300005530	Ga0070679_100713692	Ga0070679_1007136922	128
80	3300005530	Ga0070679_100882671	Ga0070679_1008826712	128
81	3300005530	Ga0070679_101303203	Ga0070679_1013032031	128
82	3300005535	Ga0070684_100012246	Ga0070684_1000122468	128
83	3300005535	Ga0070684_100035140	Ga0070684_1000351405	128
84	3300005539	Ga0068853_100038086	Ga0068853_1000380862	128
85	3300005539	Ga0068853_100070402	Ga0068853_1000704024	128
86	3300005539	Ga0068853_101135968	Ga0068853_1011359681	128
87	3300005543	Ga0070672_100603466	Ga0070672_1006034662	128
88	3300005543	Ga0070672_100959866	Ga0070672_1009598661	128
89	3300005547	Ga0070693_100018179	Ga0070693_1000181793	128
90	3300005548	Ga0070665_102248317	Ga0070665_1022483171	128
91	3300005563	Ga0068855_100004098	Ga0068855_10000409830	128
92	3300005563	Ga0068855_100039037	Ga0068855_1000390378	128
93	3300005563	Ga0068855_100073653	Ga0068855_1000736531	128
94	3300005563	Ga0068855_100626532	Ga0068855_1006265321	128
95	3300005564	Ga0070664_100003932	Ga0070664_1000039328	128
96	3300005564	Ga0070664_100004905	Ga0070664_1000049052	128
97	3300005564	Ga0070664_100051820	Ga0070664_1000518202	128
98	3300005577	Ga0068857_100007509	Ga0068857_1000075094	128
99	3300005577	Ga0068857_100056433	Ga0068857_1000564332	128
100	3300005577	Ga0068857_100101427	Ga0068857_1001014273	128
101	3300005577	Ga0068857_102091267	Ga0068857_1020912671	128
102	3300005578	Ga0068854_100002741	Ga0068854_10000274122	128
103	3300005578	Ga0068854_100188090	Ga0068854_1001880902	128
104	3300005578	Ga0068854_100798173	Ga0068854_1007981732	128
105	3300005578	Ga0068854_100976328	Ga0068854_1009763281	128
106	3300005614	Ga0068856_100002683	Ga0068856_1000026834	128
107	3300005614	Ga0068856_100017956	Ga0068856_1000179568	128
108	3300005614	Ga0068856_100083208	Ga0068856_1000832082	128
109	3300005614	Ga0068856_100626601	Ga0068856_1006266012	128
110	3300005615	Ga0070702_101594100	Ga0070702_1015941001	128
111	3300005616	Ga0068852_100017738	Ga0068852_1000177385	128
112	3300005616	Ga0068852_100396534	Ga0068852_1003965341	128
113	3300005616	Ga0068852_100472585	Ga0068852_1004725852	128
114	3300005616	Ga0068852_100531442	Ga0068852_1005314421	128
115	3300005617	Ga0068859_100497274	Ga0068859_1004972742	128
116	3300005719	Ga0068861_100220211	Ga0068861_1002202111	128
117	3300005834	Ga0068851_10010332	Ga0068851_100103325	128
118	3300005841	Ga0068863_102635447	Ga0068863_1026354471	128
119	3300005843	Ga0068860_100046459	Ga0068860_1000464598	128
120	3300005844	Ga0068862_100444729	Ga0068862_1004447292	128
121	3300006914	Ga0075436_100232751	Ga0075436_1002327512	128
122	3300006931	Ga0097620_100497249	Ga0097620_1004972492	128
123	3300009093	Ga0105240_10002428	Ga0105240_1000242824	128
124	3300009094	Ga0111539_10537749	Ga0111539_105377491	128
125	3300009094	Ga0111539_10947844	Ga0111539_109478442	128
126	3300009174	Ga0105241_10045213	Ga0105241_100452134	128
127	3300009545	Ga0105237_11798968	Ga0105237_117989681	128
128	3300009551	Ga0105238_10001044	Ga0105238_1000104423	128
129	3300009553	Ga0105249_10165292	Ga0105249_101652923	128
130	3300010375	Ga0105239_12844731	Ga0105239_128447311	128
131	3300012513	Ga0157326_1020498	Ga0157326_10204982	128
132	3300013100	Ga0157373_10154216	Ga0157373_101542163	128
133	3300013102	Ga0157371_10025310	Ga0157371_100253103	128
134	3300013104	Ga0157370_10036594	Ga0157370_100365942	128
135	3300013104	Ga0157370_10102144	Ga0157370_101021442	128
136	3300013105	Ga0157369_10048697	Ga0157369_100486975	128
137	3300013105	Ga0157369_10331601	Ga0157369_103316012	128
138	3300013296	Ga0157374_10242224	Ga0157374_102422242	128
139	3300013296	Ga0157374_11051065	Ga0157374_110510651	128
140	3300013307	Ga0157372_10087974	Ga0157372_100879744	128
141	3300013307	Ga0157372_11028179	Ga0157372_110281792	128
142	3300013308	Ga0157375_10347293	Ga0157375_103472932	128
143	3300014325	Ga0163163_10043512	Ga0163163_100435122	128
144	3300014326	Ga0157380_10033021	Ga0157380_100330216	128
145	3300014968	Ga0157379_10419202	Ga0157379_104192022	128
146	3300020070	Ga0206356_10165197	Ga0206356_101651974	128
147	3300020082	Ga0206353_10824682	Ga0206353_108246823	128
148	3300021441	Ga0213871_10179786	Ga0213871_101797861	128
149	3300025321	Ga0207656_10017249	Ga0207656_100172494	128
150	3300025321	Ga0207656_10034423	Ga0207656_100344232	128
151	3300025321	Ga0207656_10144556	Ga0207656_101445562	128
152	3300025898	Ga0207692_10292263	Ga0207692_102922632	128
153	3300025898	Ga0207692_10682076	Ga0207692_106820761	128
154	3300025903	Ga0207680_10305879	Ga0207680_103058792	128
155	3300025906	Ga0207699_10018722	Ga0207699_100187222	128
156	3300025906	Ga0207699_10617686	Ga0207699_106176861	128
157	3300025907	Ga0207645_10469755	Ga0207645_104697551	128
158	3300025909	Ga0207705_10298065	Ga0207705_102980652	128
159	3300025909	Ga0207705_10422818	Ga0207705_104228181	128
160	3300025909	Ga0207705_10479847	Ga0207705_104798472	128
161	3300025911	Ga0207654_10087072	Ga0207654_100870722	128
162	3300025912	Ga0207707_10003975	Ga0207707_1000397520	128
163	3300025912	Ga0207707_10015618	Ga0207707_100156182	128
164	3300025913	Ga0207695_10030782	Ga0207695_100307822	128
165	3300025913	Ga0207695_10061639	Ga0207695_100616393	128
166	3300025913	Ga0207695_10157033	Ga0207695_101570332	128
167	3300025914	Ga0207671_10721712	Ga0207671_107217121	128
168	3300025915	Ga0207693_10519475	Ga0207693_105194751	128
169	3300025916	Ga0207663_10042488	Ga0207663_100424882	128
170	3300025916	Ga0207663_10510347	Ga0207663_105103472	128
171	3300025917	Ga0207660_10017282	Ga0207660_100172826	128
172	3300025917	Ga0207660_10285619	Ga0207660_102856191	128
173	3300025917	Ga0207660_10369754	Ga0207660_103697542	128
174	3300025919	Ga0207657_10003501	Ga0207657_100035018	128
175	3300025919	Ga0207657_10005149	Ga0207657_1000514916	128
176	3300025919	Ga0207657_10005254	Ga0207657_100052542	128
177	3300025919	Ga0207657_10044265	Ga0207657_100442654	128
178	3300025919	Ga0207657_10169683	Ga0207657_101696832	128
179	3300025919	Ga0207657_11206176	Ga0207657_112061761	128
180	3300025920	Ga0207649_10011009	Ga0207649_100110095	128
181	3300025920	Ga0207649_10060103	Ga0207649_100601032	128
182	3300025920	Ga0207649_10098085	Ga0207649_100980851	128
183	3300025920	Ga0207649_10552483	Ga0207649_105524831	128
184	3300025920	Ga0207649_10609593	Ga0207649_106095931	128
185	3300025921	Ga0207652_10092423	Ga0207652_100924233	128
186	3300025921	Ga0207652_10113951	Ga0207652_101139512	128
187	3300025921	Ga0207652_10509343	Ga0207652_105093432	128
188	3300025921	Ga0207652_10654407	Ga0207652_106544072	128
189	3300025921	Ga0207652_11908279	Ga0207652_119082791	128
190	3300025922	Ga0207646_11143746	Ga0207646_111437462	128
191	3300025923	Ga0207681_10251816	Ga0207681_102518161	128
192	3300025924	Ga0207694_10002385	Ga0207694_100023854	128
193	3300025924	Ga0207694_10012472	Ga0207694_100124722	128
194	3300025925	Ga0207650_10360634	Ga0207650_103606342	128
195	3300025926	Ga0207659_11771916	Ga0207659_117719161	128
196	3300025926	Ga0207659_11849984	Ga0207659_118499841	128
197	3300025928	Ga0207700_10013466	Ga0207700_100134666	128
198	3300025928	Ga0207700_10467031	Ga0207700_104670312	128
199	3300025928	Ga0207700_10973459	Ga0207700_109734591	128
200	3300025929	Ga0207664_10003371	Ga0207664_100033712	128
201	3300025929	Ga0207664_10044722	Ga0207664_100447222	128
202	3300025929	Ga0207664_10052351	Ga0207664_100523514	128
203	3300025929	Ga0207664_10447842	Ga0207664_104478421	128
204	3300025931	Ga0207644_10015225	Ga0207644_100152253	128
205	3300025932	Ga0207690_10003167	Ga0207690_100031672	128
206	3300025932	Ga0207690_10073662	Ga0207690_100736622	128
207	3300025932	Ga0207690_10193560	Ga0207690_101935602	128
208	3300025932	Ga0207690_11393680	Ga0207690_113936801	128
209	3300025933	Ga0207706_10002095	Ga0207706_100020952	128
210	3300025933	Ga0207706_10577320	Ga0207706_105773202	128
211	3300025937	Ga0207669_10441486	Ga0207669_104414861	128
212	3300025939	Ga0207665_11180141	Ga0207665_111801411	128
213	3300025940	Ga0207691_10424260	Ga0207691_104242601	128
214	3300025940	Ga0207691_11691239	Ga0207691_116912391	128
215	3300025944	Ga0207661_10081152	Ga0207661_100811522	128
216	3300025944	Ga0207661_11044148	Ga0207661_110441482	128
217	3300025945	Ga0207679_10004856	Ga0207679_100048569	128
218	3300025945	Ga0207679_10062339	Ga0207679_100623392	128
219	3300025945	Ga0207679_11299984	Ga0207679_112999841	128
220	3300025949	Ga0207667_10003792	Ga0207667_100037925	128
221	3300025949	Ga0207667_10012405	Ga0207667_100124052	128
222	3300025949	Ga0207667_10012581	Ga0207667_1001258113	128
223	3300025949	Ga0207667_10058785	Ga0207667_100587855	128
224	3300025949	Ga0207667_10532525	Ga0207667_105325252	128
225	3300025960	Ga0207651_11278811	Ga0207651_112788111	128
226	3300025961	Ga0207712_11788189	Ga0207712_117881891	128
227	3300025972	Ga0207668_10005330	Ga0207668_100053302	128
228	3300025972	Ga0207668_10042346	Ga0207668_100423463	128
229	3300025972	Ga0207668_10629417	Ga0207668_106294171	128
230	3300025981	Ga0207640_10470448	Ga0207640_104704481	128
231	3300025981	Ga0207640_12177168	Ga0207640_121771681	128
232	3300026023	Ga0207677_10552693	Ga0207677_105526932	128
233	3300026023	Ga0207677_12120612	Ga0207677_121206121	128
234	3300026035	Ga0207703_10010384	Ga0207703_100103844	128
235	3300026041	Ga0207639_10573309	Ga0207639_105733092	128
236	3300026041	Ga0207639_10845958	Ga0207639_108459581	128
237	3300026067	Ga0207678_10012240	Ga0207678_100122408	128
238	3300026067	Ga0207678_10044092	Ga0207678_100440924	128
239	3300026067	Ga0207678_10352674	Ga0207678_103526742	128
240	3300026078	Ga0207702_10007599	Ga0207702_1000759918	128
241	3300026078	Ga0207702_10014083	Ga0207702_100140834	128
242	3300026078	Ga0207702_10029015	Ga0207702_100290152	128
243	3300026095	Ga0207676_10256029	Ga0207676_102560292	128
244	3300026116	Ga0207674_10000118	Ga0207674_1000011883	128
245	3300026116	Ga0207674_10001292	Ga0207674_1000129219	128
246	3300026116	Ga0207674_10116225	Ga0207674_101162253	128
247	3300026116	Ga0207674_10206561	Ga0207674_102065612	128
248	3300026118	Ga0207675_100250228	Ga0207675_1002502281	128
249	3300026121	Ga0207683_10370294	Ga0207683_103702942	128
250	3300026142	Ga0207698_10008972	Ga0207698_1000897211	128
251	3300026142	Ga0207698_10024578	Ga0207698_100245782	128
252	3300026142	Ga0207698_10077031	Ga0207698_100770313	128
253	3300027378	Ga0209981_1077108	Ga0209981_10771081	128
254	3300027543	Ga0209999_1044326	Ga0209999_10443261	128
255	3300027614	Ga0209970_1007440	Ga0209970_10074402	128
256	3300027614	Ga0209970_1012711	Ga0209970_10127112	128
257	3300027617	Ga0210002_1031140	Ga0210002_10311402	128
258	3300027617	Ga0210002_1039852	Ga0210002_10398522	128
259	3300027665	Ga0209983_1039796	Ga0209983_10397962	128
260	3300027682	Ga0209971_1000944	Ga0209971_10009447	128
261	3300027682	Ga0209971_1009534	Ga0209971_10095342	128
262	3300027717	Ga0209998_10016081	Ga0209998_100160812	128
263	3300027876	Ga0209974_10000388	Ga0209974_100003882	128
264	3300027876	Ga0209974_10002687	Ga0209974_1000268710	128
265	3300028380	Ga0268265_10206479	Ga0268265_102064791	128
266	3300028380	Ga0268265_10370916	Ga0268265_103709162	128
267	3300028800	Ga0265338_10004608	Ga0265338_100046084	128
268	3300031238	Ga0265332_10079651	Ga0265332_100796513	128
269	3300031247	Ga0265340_10203320	Ga0265340_102033202	128
270	3300031548	Ga0307408_100022047	Ga0307408_1000220473	128
271	3300031731	Ga0307405_10022124	Ga0307405_100221243	128
272	3300031824	Ga0307413_10016152	Ga0307413_100161522	128
273	3300031852	Ga0307410_10034223	Ga0307410_100342232	128
274	3300031901	Ga0307406_10015929	Ga0307406_100159293	128
275	3300031903	Ga0307407_10004407	Ga0307407_100044072	128
276	3300031911	Ga0307412_10010550	Ga0307412_100105503	128
277	3300031995	Ga0307409_100003369	Ga0307409_1000033693	128
278	3300032002	Ga0307416_100016198	Ga0307416_1000161983	128
279	3300032004	Ga0307414_10004461	Ga0307414_100044613	128
280	3300032005	Ga0307411_10000409	Ga0307411_100004093	128
281	3300041496	Ga0451839_1258874	Ga0451839_1258874_127_516	128
282	3300048903	Ga0496100_1413780	Ga0496100_1413780_16_405	128
283	3300050515	nmdc:mga0a205_634028_c2	nmdc:mga0a205_634028_c2_70_459	128
284	iso_pu_bacteria	2511231002	2511245090	128
285	iso_pu_bacteria	2842747753	2842752774	128
286	iso_pu_bacteria	2885192300	2885197783	128
287	iso_pu_bacteria	2904541872	2904546660	128
288	iso_pu_bacteria	2929160207	2929166111	128
289	3300001979	JGI24740J21852_10005834	JGI24740J21852_100058343	129
290	3300001979	JGI24740J21852_10011491	JGI24740J21852_100114915	129
291	3300001979	JGI24740J21852_10011547	JGI24740J21852_100115471	129
292	3300001979	JGI24740J21852_10011575	JGI24740J21852_100115755	129
293	3300001979	JGI24740J21852_10064486	JGI24740J21852_100644862	129
294	3300001979	JGI24740J21852_10148927	JGI24740J21852_101489271	129
295	3300001989	JGI24739J22299_10007854	JGI24739J22299_100078542	129
296	3300001989	JGI24739J22299_10009692	JGI24739J22299_100096922	129
297	3300001989	JGI24739J22299_10027431	JGI24739J22299_100274312	129
298	3300001990	JGI24737J22298_10008217	JGI24737J22298_100082171	129
299	3300001990	JGI24737J22298_10008286	JGI24737J22298_100082862	129
300	3300001990	JGI24737J22298_10029964	JGI24737J22298_100299642	129
301	3300002067	JGI24735J21928_10002193	JGI24735J21928_100021933	129
302	3300002067	JGI24735J21928_10005321	JGI24735J21928_100053212	129
303	3300002067	JGI24735J21928_10011200	JGI24735J21928_100112004	129
304	3300002070	JGI24750J21931_1080679	JGI24750J21931_10806791	129
305	3300002075	JGI24738J21930_10002092	JGI24738J21930_100020926	129
306	3300002075	JGI24738J21930_10077393	JGI24738J21930_100773931	129
307	3300002076	JGI24749J21850_1071379	JGI24749J21850_10713791	129
308	3300002077	JGI24744J21845_10033802	JGI24744J21845_100338022	129
309	3300002155	JGI24033J26618_1001626	JGI24033J26618_10016263	129
310	3300002239	JGI24034J26672_10024192	JGI24034J26672_100241921	129
311	3300002244	JGI24742J22300_10101625	JGI24742J22300_101016251	129
312	3300002705	JGI25156J39149_1003704	JGI25156J39149_10037045	129
313	3300002705	JGI25156J39149_1056363	JGI25156J39149_10563631	129
314	3300002772	JGI25164J39214_1012390	JGI25164J39214_10123901	129
315	3300003214	JGI25165J46597_1002750	JGI25165J46597_10027503	129
316	3300003354	JGI25160J50197_1024894	JGI25160J50197_10248941	129
317	3300003479	Ga0006556J51387_1013500	Ga0006556J51387_101350030	129
318	3300003565	Ga0006560J51390_1020307	Ga0006560J51390_102030729	129
319	3300003567	Ga0006554J51385_1017299	Ga0006554J51385_101729929	129
320	3300003579	Ga0007429J51699_1068999	Ga0007429J51699_10689992	129
321	3300003693	Ga0032354_1013175	Ga0032354_10131758	129
322	3300003756	Ga0055533_1000655	Ga0055533_10006551	129
323	3300003758	Ga0055532_1000261	Ga0055532_100026126	129
324	3300003758	Ga0055532_1001878	Ga0055532_10018781	129
325	3300003760	Ga0055527_1000035	Ga0055527_100003514	129
326	3300003760	Ga0055527_1004604	Ga0055527_10046042	129
327	3300003761	Ga0055535_1000050	Ga0055535_100005014	129
328	3300003762	Ga0055542_1000512	Ga0055542_100051226	129
329	3300003763	Ga0055529_1000089	Ga0055529_100008914	129
330	3300003771	Ga0055526_1046455	Ga0055526_10464552	129
331	3300003790	Ga0055528_1000489	Ga0055528_100048917	129
332	3300003841	Ga0055541_1010086	Ga0055541_10100862	129
333	3300003856	Ga0058692_1003682	Ga0058692_10036825	129
334	3300005262	Ga0065165_1000885	Ga0065165_100088526	129
335	3300005293	Ga0065715_10098485	Ga0065715_100984852	129
336	3300005327	Ga0070658_10019083	Ga0070658_100190833	129
337	3300005327	Ga0070658_10031440	Ga0070658_100314404	129
338	3300005327	Ga0070658_10067485	Ga0070658_100674854	129
339	3300005327	Ga0070658_10187030	Ga0070658_101870302	129
340	3300005327	Ga0070658_10231738	Ga0070658_102317381	129
341	3300005327	Ga0070658_10330455	Ga0070658_103304552	129
342	3300005327	Ga0070658_11333962	Ga0070658_113339621	129
343	3300005328	Ga0070676_10011859	Ga0070676_100118593	129
344	3300005328	Ga0070676_10042665	Ga0070676_100426652	129
345	3300005329	Ga0070683_100021958	Ga0070683_1000219582	129
346	3300005329	Ga0070683_100203983	Ga0070683_1002039833	129
347	3300005330	Ga0070690_100032680	Ga0070690_1000326803	129
348	3300005330	Ga0070690_100078894	Ga0070690_1000788943	129
349	3300005331	Ga0070670_100000715	Ga0070670_10000071524	129
350	3300005331	Ga0070670_100117500	Ga0070670_1001175001	129
351	3300005331	Ga0070670_100131564	Ga0070670_1001315642	129
352	3300005331	Ga0070670_100163686	Ga0070670_1001636863	129
353	3300005333	Ga0070677_10017840	Ga0070677_100178402	129
354	3300005334	Ga0068869_100001730	Ga0068869_1000017303	129
355	3300005334	Ga0068869_100011497	Ga0068869_1000114977	129
356	3300005335	Ga0070666_10094322	Ga0070666_100943222	129
357	3300005337	Ga0070682_101259012	Ga0070682_1012590121	129
358	3300005338	Ga0068868_100020504	Ga0068868_1000205046	129
359	3300005338	Ga0068868_100166070	Ga0068868_1001660702	129
360	3300005338	Ga0068868_100824019	Ga0068868_1008240192	129
361	3300005338	Ga0068868_100869026	Ga0068868_1008690262	129
362	3300005338	Ga0068868_101060186	Ga0068868_1010601861	129
363	3300005339	Ga0070660_100000025	Ga0070660_10000002580	129
364	3300005339	Ga0070660_100017595	Ga0070660_1000175952	129
365	3300005339	Ga0070660_100115365	Ga0070660_1001153652	129
366	3300005339	Ga0070660_100772145	Ga0070660_1007721452	129
367	3300005340	Ga0070689_101474670	Ga0070689_1014746701	129
368	3300005343	Ga0070687_100021912	Ga0070687_1000219122	129
369	3300005344	Ga0070661_100009066	Ga0070661_1000090666	129
370	3300005344	Ga0070661_100118870	Ga0070661_1001188702	129
371	3300005344	Ga0070661_100203119	Ga0070661_1002031191	129
372	3300005344	Ga0070661_100513142	Ga0070661_1005131422	129
373	3300005345	Ga0070692_10329338	Ga0070692_103293381	129
374	3300005347	Ga0070668_100100555	Ga0070668_1001005552	129
375	3300005353	Ga0070669_100044244	Ga0070669_1000442443	129
376	3300005353	Ga0070669_100049498	Ga0070669_1000494984	129
377	3300005354	Ga0070675_100714742	Ga0070675_1007147421	129
378	3300005355	Ga0070671_100010289	Ga0070671_1000102896	129
379	3300005355	Ga0070671_100182356	Ga0070671_1001823562	129
380	3300005355	Ga0070671_100202028	Ga0070671_1002020283	129
381	3300005355	Ga0070671_100579364	Ga0070671_1005793642	129
382	3300005355	Ga0070671_100768612	Ga0070671_1007686122	129
383	3300005355	Ga0070671_100833901	Ga0070671_1008339011	129
384	3300005356	Ga0070674_100027353	Ga0070674_1000273532	129
385	3300005364	Ga0070673_100175971	Ga0070673_1001759712	129
386	3300005364	Ga0070673_100899439	Ga0070673_1008994391	129
387	3300005365	Ga0070688_100078708	Ga0070688_1000787082	129
388	3300005365	Ga0070688_100182762	Ga0070688_1001827621	129
389	3300005365	Ga0070688_100486270	Ga0070688_1004862702	129
390	3300005366	Ga0070659_100000426	Ga0070659_10000042621	129
391	3300005366	Ga0070659_100019728	Ga0070659_1000197287	129
392	3300005366	Ga0070659_100185032	Ga0070659_1001850321	129
393	3300005366	Ga0070659_100560429	Ga0070659_1005604292	129
394	3300005367	Ga0070667_100004919	Ga0070667_1000049194	129
395	3300005367	Ga0070667_100037796	Ga0070667_1000377964	129
396	3300005367	Ga0070667_100089806	Ga0070667_1000898062	129
397	3300005367	Ga0070667_100512002	Ga0070667_1005120021	129
398	3300005440	Ga0070705_100529230	Ga0070705_1005292302	129
399	3300005441	Ga0070700_100041749	Ga0070700_1000417493	129
400	3300005441	Ga0070700_100466931	Ga0070700_1004669312	129
401	3300005441	Ga0070700_100938288	Ga0070700_1009382881	129
402	3300005445	Ga0070708_100291271	Ga0070708_1002912712	129
403	3300005455	Ga0070663_100001396	Ga0070663_1000013969	129
404	3300005455	Ga0070663_100022370	Ga0070663_1000223701	129
405	3300005455	Ga0070663_100026432	Ga0070663_1000264322	129
406	3300005455	Ga0070663_100060645	Ga0070663_1000606453	129
407	3300005455	Ga0070663_100195837	Ga0070663_1001958372	129
408	3300005455	Ga0070663_100394663	Ga0070663_1003946632	129
409	3300005455	Ga0070663_101198865	Ga0070663_1011988651	129
410	3300005455	Ga0070663_101461669	Ga0070663_1014616691	129
411	3300005456	Ga0070678_100546173	Ga0070678_1005461731	129
412	3300005457	Ga0070662_100691223	Ga0070662_1006912232	129
413	3300005459	Ga0068867_100055511	Ga0068867_1000555113	129
414	3300005459	Ga0068867_100145055	Ga0068867_1001450552	129
415	3300005459	Ga0068867_100324715	Ga0068867_1003247152	129
416	3300005468	Ga0070707_101618021	Ga0070707_1016180211	129
417	3300005471	Ga0070698_100290312	Ga0070698_1002903122	129
418	3300005518	Ga0070699_100317831	Ga0070699_1003178313	129
419	3300005535	Ga0070684_100039795	Ga0070684_1000397952	129
420	3300005539	Ga0068853_100066150	Ga0068853_1000661502	129
421	3300005539	Ga0068853_100144788	Ga0068853_1001447882	129
422	3300005539	Ga0068853_100237452	Ga0068853_1002374522	129
423	3300005539	Ga0068853_100239411	Ga0068853_1002394112	129
424	3300005539	Ga0068853_100535941	Ga0068853_1005359411	129
425	3300005543	Ga0070672_100013687	Ga0070672_1000136878	129
426	3300005543	Ga0070672_100014087	Ga0070672_1000140875	129
427	3300005543	Ga0070672_100139452	Ga0070672_1001394521	129
428	3300005544	Ga0070686_100540978	Ga0070686_1005409781	129
429	3300005545	Ga0070695_101009461	Ga0070695_1010094611	129
430	3300005546	Ga0070696_101205323	Ga0070696_1012053231	129
431	3300005547	Ga0070693_100468266	Ga0070693_1004682662	129
432	3300005547	Ga0070693_100636295	Ga0070693_1006362951	129
433	3300005548	Ga0070665_100023377	Ga0070665_1000233774	129
434	3300005548	Ga0070665_100088437	Ga0070665_1000884373	129
435	3300005548	Ga0070665_102048719	Ga0070665_1020487191	129
436	3300005549	Ga0070704_100518537	Ga0070704_1005185372	129
437	3300005549	Ga0070704_101221087	Ga0070704_1012210871	129
438	3300005563	Ga0068855_100008244	Ga0068855_10000824410	129
439	3300005563	Ga0068855_100012991	Ga0068855_1000129914	129
440	3300005563	Ga0068855_100414341	Ga0068855_1004143412	129
441	3300005563	Ga0068855_100770386	Ga0068855_1007703862	129
442	3300005563	Ga0068855_101620985	Ga0068855_1016209852	129
443	3300005563	Ga0068855_101905996	Ga0068855_1019059961	129
444	3300005564	Ga0070664_100024940	Ga0070664_1000249403	129
445	3300005564	Ga0070664_100083520	Ga0070664_1000835201	129
446	3300005564	Ga0070664_100088917	Ga0070664_1000889174	129
447	3300005564	Ga0070664_100259708	Ga0070664_1002597082	129
448	3300005577	Ga0068857_100015199	Ga0068857_1000151995	129
449	3300005577	Ga0068857_100055544	Ga0068857_1000555444	129
450	3300005577	Ga0068857_100069137	Ga0068857_1000691373	129
451	3300005577	Ga0068857_100417307	Ga0068857_1004173072	129
452	3300005578	Ga0068854_100081572	Ga0068854_1000815723	129
453	3300005578	Ga0068854_100115116	Ga0068854_1001151162	129
454	3300005614	Ga0068856_100019473	Ga0068856_1000194739	129
455	3300005614	Ga0068856_100057802	Ga0068856_1000578025	129
456	3300005614	Ga0068856_100064452	Ga0068856_1000644521	129
457	3300005614	Ga0068856_100889365	Ga0068856_1008893651	129
458	3300005614	Ga0068856_101004254	Ga0068856_1010042542	129
459	3300005614	Ga0068856_102255771	Ga0068856_1022557712	129
460	3300005615	Ga0070702_100088741	Ga0070702_1000887412	129
461	3300005615	Ga0070702_100098753	Ga0070702_1000987531	129
462	3300005616	Ga0068852_100007549	Ga0068852_1000075495	129
463	3300005616	Ga0068852_100021453	Ga0068852_1000214531	129
464	3300005616	Ga0068852_100219697	Ga0068852_1002196972	129
465	3300005616	Ga0068852_100308501	Ga0068852_1003085012	129
466	3300005616	Ga0068852_100384772	Ga0068852_1003847723	129
467	3300005617	Ga0068859_100160882	Ga0068859_1001608823	129
468	3300005618	Ga0068864_100006639	Ga0068864_1000066393	129
469	3300005618	Ga0068864_100018523	Ga0068864_1000185239	129
470	3300005618	Ga0068864_101041033	Ga0068864_1010410332	129
471	3300005718	Ga0068866_10070397	Ga0068866_100703972	129
472	3300005719	Ga0068861_100021611	Ga0068861_1000216116	129
473	3300005719	Ga0068861_100071706	Ga0068861_1000717062	129
474	3300005834	Ga0068851_10007131	Ga0068851_100071317	129
475	3300005834	Ga0068851_10084675	Ga0068851_100846752	129
476	3300005840	Ga0068870_10001701	Ga0068870_1000170111	129
477	3300005840	Ga0068870_10039615	Ga0068870_100396154	129
478	3300005841	Ga0068863_100066660	Ga0068863_1000666604	129
479	3300005841	Ga0068863_100144528	Ga0068863_1001445282	129
480	3300005841	Ga0068863_101634474	Ga0068863_1016344741	129
481	3300005842	Ga0068858_100054558	Ga0068858_1000545583	129
482	3300005842	Ga0068858_100058258	Ga0068858_1000582585	129
483	3300005842	Ga0068858_100114974	Ga0068858_1001149742	129
484	3300005842	Ga0068858_100176226	Ga0068858_1001762262	129
485	3300005843	Ga0068860_100270456	Ga0068860_1002704562	129
486	3300005844	Ga0068862_100053525	Ga0068862_1000535253	129
487	3300005844	Ga0068862_100175010	Ga0068862_1001750102	129
488	3300006173	Ga0070716_100284348	Ga0070716_1002843482	129
489	3300006173	Ga0070716_101192622	Ga0070716_1011926221	129
490	3300006175	Ga0070712_100536218	Ga0070712_1005362182	129
491	3300006237	Ga0097621_100076468	Ga0097621_1000764683	129
492	3300006358	Ga0068871_100172216	Ga0068871_1001722163	129
493	3300006358	Ga0068871_100401412	Ga0068871_1004014122	129
494	3300006871	Ga0075434_100497693	Ga0075434_1004976931	129
495	3300006881	Ga0068865_100007501	Ga0068865_1000075015	129
496	3300006881	Ga0068865_100088857	Ga0068865_1000888571	129
497	3300006931	Ga0097620_100160876	Ga0097620_1001608762	129
498	3300009011	Ga0105251_10001215	Ga0105251_1000121519	129
499	3300009036	Ga0105244_10309767	Ga0105244_103097671	129
500	3300009093	Ga0105240_10694035	Ga0105240_106940352	129
501	3300009093	Ga0105240_11684434	Ga0105240_116844342	129
502	3300009101	Ga0105247_10292303	Ga0105247_102923031	129
503	3300009174	Ga0105241_10086666	Ga0105241_100866662	129
504	3300009174	Ga0105241_10616345	Ga0105241_106163452	129
505	3300009177	Ga0105248_10034376	Ga0105248_100343768	129
506	3300009177	Ga0105248_10081139	Ga0105248_100811394	129
507	3300009545	Ga0105237_10238550	Ga0105237_102385502	129
508	3300009551	Ga0105238_10114298	Ga0105238_101142981	129
509	3300009551	Ga0105238_10147898	Ga0105238_101478982	129
510	3300009553	Ga0105249_10039985	Ga0105249_100399853	129
511	3300009553	Ga0105249_10880916	Ga0105249_108809162	129
512	3300010375	Ga0105239_10702366	Ga0105239_107023662	129
513	3300011119	Ga0105246_10069162	Ga0105246_100691623	129
514	3300011119	Ga0105246_10110856	Ga0105246_101108562	129
515	3300011119	Ga0105246_11627674	Ga0105246_116276741	129
516	3300013100	Ga0157373_10311465	Ga0157373_103114651	129
517	3300013105	Ga0157369_10142232	Ga0157369_101422324	129
518	3300013297	Ga0157378_10388715	Ga0157378_103887152	129
519	3300013297	Ga0157378_12612805	Ga0157378_126128051	129
520	3300013306	Ga0163162_10370240	Ga0163162_103702402	129
521	3300013307	Ga0157372_10079216	Ga0157372_100792163	129
522	3300013307	Ga0157372_10080771	Ga0157372_100807713	129
523	3300013307	Ga0157372_10141862	Ga0157372_101418622	129
524	3300013307	Ga0157372_10608610	Ga0157372_106086102	129
525	3300013307	Ga0157372_11205527	Ga0157372_112055272	129
526	3300013308	Ga0157375_10443331	Ga0157375_104433312	129
527	3300013308	Ga0157375_10558302	Ga0157375_105583023	129
528	3300013308	Ga0157375_11450503	Ga0157375_114505032	129
529	3300013308	Ga0157375_12352234	Ga0157375_123522341	129
530	3300014325	Ga0163163_10014074	Ga0163163_100140746	129
531	3300014326	Ga0157380_10119555	Ga0157380_101195552	129
532	3300014497	Ga0182008_10114128	Ga0182008_101141283	129
533	3300014497	Ga0182008_10380839	Ga0182008_103808391	129
534	3300014745	Ga0157377_10139187	Ga0157377_101391872	129
535	3300014968	Ga0157379_10018178	Ga0157379_100181782	129
536	3300014969	Ga0157376_10498082	Ga0157376_104980822	129
537	3300014969	Ga0157376_10917361	Ga0157376_109173611	129
538	3300016635	Ga0183361_10015	Ga0183361_1001548	129
539	3300017792	Ga0163161_10027860	Ga0163161_100278603	129
540	3300017792	Ga0163161_10312290	Ga0163161_103122902	129
541	3300017792	Ga0163161_10682230	Ga0163161_106822302	129
542	3300020069	Ga0197907_11172527	Ga0197907_111725273	129
543	3300020070	Ga0206356_10656905	Ga0206356_106569054	129
544	3300020070	Ga0206356_11626061	Ga0206356_116260612	129
545	3300020070	Ga0206356_11693459	Ga0206356_116934592	129
546	3300020076	Ga0206355_1659039	Ga0206355_16590394	129
547	3300020077	Ga0206351_10247005	Ga0206351_102470051	129
548	3300020080	Ga0206350_10085980	Ga0206350_100859802	129
549	3300020080	Ga0206350_10225711	Ga0206350_102257111	129
550	3300020081	Ga0206354_10521870	Ga0206354_105218701	129
551	3300020081	Ga0206354_10894414	Ga0206354_108944143	129
552	3300020082	Ga0206353_11198635	Ga0206353_111986352	129
553	3300020082	Ga0206353_11257227	Ga0206353_112572271	129
554	3300020082	Ga0206353_11342394	Ga0206353_113423941	129
555	3300020610	Ga0154015_1142689	Ga0154015_11426891	129
556	3300021384	Ga0213876_10076913	Ga0213876_100769132	129
557	3300022467	Ga0224712_10000642	Ga0224712_100006425	129
558	3300022467	Ga0224712_10603196	Ga0224712_106031961	129
559	3300023564	Ga0247515_121331	Ga0247515_1213311	129
560	3300025206	Ga0209435_105249	Ga0209435_1052493	129
561	3300025206	Ga0209435_111149	Ga0209435_1111492	129
562	3300025225	Ga0209566_100801	Ga0209566_10080130	129
563	3300025226	Ga0209674_100153	Ga0209674_10015392	129
564	3300025226	Ga0209674_101740	Ga0209674_1017408	129
565	3300025228	Ga0209672_100054	Ga0209672_100054216	129
566	3300025228	Ga0209672_100072	Ga0209672_1000729	129
567	3300025228	Ga0209672_100073	Ga0209672_100073133	129
568	3300025228	Ga0209672_101899	Ga0209672_1018994	129
569	3300025229	Ga0209147_100093	Ga0209147_100093133	129
570	3300025229	Ga0209147_100328	Ga0209147_10032828	129
571	3300025230	Ga0209563_100373	Ga0209563_1003738	129
572	3300025231	Ga0207427_101666	Ga0207427_1016667	129
573	3300025242	Ga0209258_100140	Ga0209258_100140133	129
574	3300025242	Ga0209258_100579	Ga0209258_1005792	129
575	3300025242	Ga0209258_100581	Ga0209258_1005812	129
576	3300025254	Ga0209148_1000119	Ga0209148_100011930	129
577	3300025254	Ga0209148_1000140	Ga0209148_1000140134	129
578	3300025256	Ga0209759_1000281	Ga0209759_100028173	129
579	3300025256	Ga0209759_1001723	Ga0209759_10017234	129
580	3300025256	Ga0209759_1001789	Ga0209759_10017897	129
581	3300025256	Ga0209759_1003170	Ga0209759_10031705	129
582	3300025256	Ga0209759_1003216	Ga0209759_10032164	129
583	3300025256	Ga0209759_1037913	Ga0209759_10379131	129
584	3300025256	Ga0209759_1052699	Ga0209759_10526991	129
585	3300025261	Ga0209233_1000173	Ga0209233_1000173133	129
586	3300025263	Ga0209565_1011763	Ga0209565_10117633	129
587	3300025271	Ga0207666_1000954	Ga0207666_10009544	129
588	3300025272	Ga0209455_1000125	Ga0209455_1000125134	129
589	3300025272	Ga0209455_1000244	Ga0209455_100024430	129
590	3300025273	Ga0209673_1000098	Ga0209673_1000098172	129
591	3300025284	Ga0209130_1004489	Ga0209130_10044898	129
592	3300025290	Ga0207673_1001230	Ga0207673_10012304	129
593	3300025295	Ga0209564_1006738	Ga0209564_10067382	129
594	3300025295	Ga0209564_1011244	Ga0209564_10112443	129
595	3300025302	Ga0207426_1000199	Ga0207426_100019922	129
596	3300025302	Ga0207426_1007030	Ga0207426_10070304	129
597	3300025315	Ga0207697_10000810	Ga0207697_100008104	129
598	3300025315	Ga0207697_10145017	Ga0207697_101450171	129
599	3300025321	Ga0207656_10015220	Ga0207656_100152202	129
600	3300025321	Ga0207656_10048559	Ga0207656_100485592	129
601	3300025711	Ga0207696_1003988	Ga0207696_10039883	129
602	3300025728	Ga0207655_1152763	Ga0207655_11527632	129
603	3300025735	Ga0207713_1085146	Ga0207713_10851461	129
604	3300025893	Ga0207682_10000501	Ga0207682_100005017	129
605	3300025899	Ga0207642_10632062	Ga0207642_106320621	129
606	3300025901	Ga0207688_10013022	Ga0207688_100130225	129
607	3300025901	Ga0207688_10662708	Ga0207688_106627082	129
608	3300025903	Ga0207680_10041023	Ga0207680_100410232	129
609	3300025903	Ga0207680_10076097	Ga0207680_100760972	129
610	3300025904	Ga0207647_10000362	Ga0207647_1000036230	129
611	3300025904	Ga0207647_10004870	Ga0207647_1000487014	129
612	3300025904	Ga0207647_10109706	Ga0207647_101097062	129
613	3300025907	Ga0207645_10000661	Ga0207645_1000066126	129
614	3300025907	Ga0207645_10050166	Ga0207645_100501662	129
615	3300025907	Ga0207645_10379337	Ga0207645_103793371	129
616	3300025908	Ga0207643_10000515	Ga0207643_1000051524	129
617	3300025908	Ga0207643_10061388	Ga0207643_100613883	129
618	3300025909	Ga0207705_10008686	Ga0207705_100086868	129
619	3300025909	Ga0207705_10015106	Ga0207705_100151062	129
620	3300025909	Ga0207705_10128454	Ga0207705_101284542	129
621	3300025909	Ga0207705_10139451	Ga0207705_101394512	129
622	3300025909	Ga0207705_10166750	Ga0207705_101667501	129
623	3300025909	Ga0207705_11453324	Ga0207705_114533241	129
624	3300025911	Ga0207654_10364651	Ga0207654_103646512	129
625	3300025911	Ga0207654_10683427	Ga0207654_106834271	129
626	3300025913	Ga0207695_10058845	Ga0207695_100588452	129
627	3300025913	Ga0207695_10128713	Ga0207695_101287132	129
628	3300025913	Ga0207695_10155617	Ga0207695_101556173	129
629	3300025914	Ga0207671_10004456	Ga0207671_1000445624	129
630	3300025914	Ga0207671_10018111	Ga0207671_100181113	129
631	3300025914	Ga0207671_10045547	Ga0207671_100455474	129
632	3300025915	Ga0207693_10100972	Ga0207693_101009723	129
633	3300025918	Ga0207662_10031485	Ga0207662_100314855	129
634	3300025919	Ga0207657_10000065	Ga0207657_1000006584	129
635	3300025919	Ga0207657_10003529	Ga0207657_1000352914	129
636	3300025920	Ga0207649_10115561	Ga0207649_101155612	129
637	3300025920	Ga0207649_10177341	Ga0207649_101773412	129
638	3300025920	Ga0207649_10473906	Ga0207649_104739062	129
639	3300025920	Ga0207649_10670191	Ga0207649_106701912	129
640	3300025923	Ga0207681_10019167	Ga0207681_100191672	129
641	3300025923	Ga0207681_10040135	Ga0207681_100401355	129
642	3300025923	Ga0207681_10042336	Ga0207681_100423362	129
643	3300025924	Ga0207694_10025661	Ga0207694_100256613	129
644	3300025924	Ga0207694_10050454	Ga0207694_100504543	129
645	3300025924	Ga0207694_10108476	Ga0207694_101084762	129
646	3300025924	Ga0207694_10355755	Ga0207694_103557551	129
647	3300025924	Ga0207694_10621801	Ga0207694_106218012	129
648	3300025924	Ga0207694_11258530	Ga0207694_112585301	129
649	3300025924	Ga0207694_11705808	Ga0207694_117058081	129
650	3300025925	Ga0207650_10008016	Ga0207650_1000801613	129
651	3300025925	Ga0207650_10078784	Ga0207650_100787842	129
652	3300025925	Ga0207650_10099957	Ga0207650_100999572	129
653	3300025925	Ga0207650_10281464	Ga0207650_102814642	129
654	3300025926	Ga0207659_10014188	Ga0207659_100141884	129
655	3300025926	Ga0207659_11029115	Ga0207659_110291152	129
656	3300025926	Ga0207659_11447406	Ga0207659_114474061	129
657	3300025927	Ga0207687_11706414	Ga0207687_117064141	129
658	3300025931	Ga0207644_10030257	Ga0207644_100302572	129
659	3300025931	Ga0207644_10111134	Ga0207644_101111342	129
660	3300025931	Ga0207644_10190892	Ga0207644_101908922	129
661	3300025931	Ga0207644_10211435	Ga0207644_102114352	129
662	3300025931	Ga0207644_10694537	Ga0207644_106945371	129
663	3300025931	Ga0207644_11275970	Ga0207644_112759701	129
664	3300025931	Ga0207644_11386845	Ga0207644_113868451	129
665	3300025932	Ga0207690_10000040	Ga0207690_1000004084	129
666	3300025932	Ga0207690_10070880	Ga0207690_100708802	129
667	3300025934	Ga0207686_10125313	Ga0207686_101253132	129
668	3300025935	Ga0207709_10599886	Ga0207709_105998862	129
669	3300025936	Ga0207670_10054191	Ga0207670_100541912	129
670	3300025936	Ga0207670_10867444	Ga0207670_108674442	129
671	3300025937	Ga0207669_10097079	Ga0207669_100970791	129
672	3300025937	Ga0207669_10266758	Ga0207669_102667582	129
673	3300025938	Ga0207704_10060135	Ga0207704_100601353	129
674	3300025938	Ga0207704_10185921	Ga0207704_101859212	129
675	3300025938	Ga0207704_11560520	Ga0207704_115605201	129
676	3300025939	Ga0207665_10649121	Ga0207665_106491211	129
677	3300025940	Ga0207691_10009525	Ga0207691_100095253	129
678	3300025940	Ga0207691_10023580	Ga0207691_100235805	129
679	3300025940	Ga0207691_10062471	Ga0207691_100624712	129
680	3300025941	Ga0207711_10043413	Ga0207711_100434134	129
681	3300025941	Ga0207711_10048001	Ga0207711_100480012	129
682	3300025941	Ga0207711_10082942	Ga0207711_100829423	129
683	3300025941	Ga0207711_10125417	Ga0207711_101254173	129
684	3300025941	Ga0207711_10397370	Ga0207711_103973702	129
685	3300025941	Ga0207711_11935165	Ga0207711_119351651	129
686	3300025942	Ga0207689_10002125	Ga0207689_100021254	129
687	3300025942	Ga0207689_10002775	Ga0207689_1000277529	129
688	3300025942	Ga0207689_10345699	Ga0207689_103456991	129
689	3300025944	Ga0207661_10028665	Ga0207661_100286653	129
690	3300025944	Ga0207661_10178986	Ga0207661_101789862	129
691	3300025944	Ga0207661_10489047	Ga0207661_104890472	129
692	3300025944	Ga0207661_11349596	Ga0207661_113495961	129
693	3300025945	Ga0207679_10033217	Ga0207679_100332174	129
694	3300025945	Ga0207679_10034919	Ga0207679_100349193	129
695	3300025945	Ga0207679_10057913	Ga0207679_100579132	129
696	3300025945	Ga0207679_10272773	Ga0207679_102727731	129
697	3300025945	Ga0207679_10510534	Ga0207679_105105342	129
698	3300025949	Ga0207667_10006131	Ga0207667_1000613128	129
699	3300025949	Ga0207667_10007228	Ga0207667_1000722810	129
700	3300025949	Ga0207667_10009212	Ga0207667_1000921223	129
701	3300025949	Ga0207667_10166593	Ga0207667_101665932	129
702	3300025949	Ga0207667_10293133	Ga0207667_102931332	129
703	3300025949	Ga0207667_10352811	Ga0207667_103528112	129
704	3300025949	Ga0207667_10502740	Ga0207667_105027403	129
705	3300025949	Ga0207667_11240350	Ga0207667_112403501	129
706	3300025960	Ga0207651_10005983	Ga0207651_1000598312	129
707	3300025960	Ga0207651_10070216	Ga0207651_100702162	129
708	3300025960	Ga0207651_10321829	Ga0207651_103218292	129
709	3300025960	Ga0207651_10821674	Ga0207651_108216741	129
710	3300025961	Ga0207712_10337304	Ga0207712_103373042	129
711	3300025961	Ga0207712_10474714	Ga0207712_104747142	129
712	3300025972	Ga0207668_10050091	Ga0207668_100500912	129
713	3300025972	Ga0207668_10086296	Ga0207668_100862962	129
714	3300025972	Ga0207668_10414184	Ga0207668_104141842	129
715	3300025981	Ga0207640_10104659	Ga0207640_101046591	129
716	3300025981	Ga0207640_10117293	Ga0207640_101172932	129
717	3300025986	Ga0207658_10057416	Ga0207658_100574163	129
718	3300025986	Ga0207658_10069682	Ga0207658_100696822	129
719	3300025986	Ga0207658_10458707	Ga0207658_104587072	129
720	3300026023	Ga0207677_10371911	Ga0207677_103719112	129
721	3300026023	Ga0207677_10645633	Ga0207677_106456331	129
722	3300026023	Ga0207677_10647596	Ga0207677_106475962	129
723	3300026023	Ga0207677_10828996	Ga0207677_108289961	129
724	3300026035	Ga0207703_10012560	Ga0207703_100125608	129
725	3300026035	Ga0207703_10067166	Ga0207703_100671663	129
726	3300026035	Ga0207703_10138301	Ga0207703_101383012	129
727	3300026035	Ga0207703_10145277	Ga0207703_101452772	129
728	3300026035	Ga0207703_11429687	Ga0207703_114296872	129
729	3300026041	Ga0207639_10113819	Ga0207639_101138192	129
730	3300026041	Ga0207639_10201273	Ga0207639_102012732	129
731	3300026041	Ga0207639_10250568	Ga0207639_102505682	129
732	3300026041	Ga0207639_10566265	Ga0207639_105662652	129
733	3300026067	Ga0207678_10002359	Ga0207678_100023598	129
734	3300026067	Ga0207678_10012406	Ga0207678_100124067	129
735	3300026067	Ga0207678_10065923	Ga0207678_100659231	129
736	3300026067	Ga0207678_10076999	Ga0207678_100769993	129
737	3300026067	Ga0207678_10094242	Ga0207678_100942423	129
738	3300026067	Ga0207678_10101714	Ga0207678_101017143	129
739	3300026067	Ga0207678_10212887	Ga0207678_102128873	129
740	3300026067	Ga0207678_10878342	Ga0207678_108783422	129
741	3300026075	Ga0207708_10007131	Ga0207708_100071318	129
742	3300026075	Ga0207708_10389682	Ga0207708_103896822	129
743	3300026078	Ga0207702_10026484	Ga0207702_100264843	129
744	3300026078	Ga0207702_10488284	Ga0207702_104882842	129
745	3300026078	Ga0207702_10959967	Ga0207702_109599671	129
746	3300026088	Ga0207641_10248429	Ga0207641_102484292	129
747	3300026088	Ga0207641_10484126	Ga0207641_104841261	129
748	3300026088	Ga0207641_11567516	Ga0207641_115675162	129
749	3300026089	Ga0207648_10046612	Ga0207648_100466123	129
750	3300026089	Ga0207648_10151293	Ga0207648_101512932	129
751	3300026095	Ga0207676_10022296	Ga0207676_100222965	129
752	3300026095	Ga0207676_10099358	Ga0207676_100993582	129
753	3300026095	Ga0207676_11479002	Ga0207676_114790022	129
754	3300026116	Ga0207674_10004098	Ga0207674_1000409820	129
755	3300026116	Ga0207674_10071412	Ga0207674_100714122	129
756	3300026116	Ga0207674_10320847	Ga0207674_103208472	129
757	3300026118	Ga0207675_100000635	Ga0207675_10000063531	129
758	3300026118	Ga0207675_100050551	Ga0207675_1000505513	129
759	3300026121	Ga0207683_10002112	Ga0207683_100021123	129
760	3300026121	Ga0207683_10012224	Ga0207683_1001222413	129
761	3300026121	Ga0207683_10310932	Ga0207683_103109321	129
762	3300026121	Ga0207683_11266057	Ga0207683_112660572	129
763	3300026142	Ga0207698_10004704	Ga0207698_100047042	129
764	3300026142	Ga0207698_10245381	Ga0207698_102453812	129
765	3300026142	Ga0207698_10318472	Ga0207698_103184723	129
766	3300026142	Ga0207698_10476678	Ga0207698_104766782	129
767	3300027312	Ga0209371_1000325	Ga0209371_100032536	129
768	3300027312	Ga0209371_1000766	Ga0209371_100076613	129
769	3300027312	Ga0209371_1005929	Ga0209371_10059294	129
770	3300027907	Ga0207428_10211716	Ga0207428_102117162	129
771	3300028379	Ga0268266_10006169	Ga0268266_1000616918	129
772	3300028379	Ga0268266_10027784	Ga0268266_100277844	129
773	3300028379	Ga0268266_11551761	Ga0268266_115517612	129
774	3300028380	Ga0268265_10040781	Ga0268265_100407812	129
775	3300028381	Ga0268264_10008790	Ga0268264_1000879013	129
776	3300028381	Ga0268264_10088363	Ga0268264_100883632	129
777	3300028800	Ga0265338_10052656	Ga0265338_100526563	129
778	3300030500	Ga0268256_1001275	Ga0268256_10012757	129
779	3300030500	Ga0268256_1002981	Ga0268256_10029811	129
780	3300031250	Ga0265331_10273708	Ga0265331_102737081	129
781	3300031251	Ga0265327_10003591	Ga0265327_100035912	129
782	3300031344	Ga0265316_10487862	Ga0265316_104878622	129
783	3300031548	Ga0307408_100004683	Ga0307408_1000046833	129
784	3300031548	Ga0307408_100394230	Ga0307408_1003942302	129
785	3300031667	Ga0310111_140303	Ga0310111_1403031	129
786	3300031731	Ga0307405_10023987	Ga0307405_100239872	129
787	3300031731	Ga0307405_10146238	Ga0307405_101462382	129
788	3300031824	Ga0307413_10134205	Ga0307413_101342051	129
789	3300031824	Ga0307413_10251491	Ga0307413_102514911	129
790	3300031824	Ga0307413_11019416	Ga0307413_110194161	129
791	3300031852	Ga0307410_10022829	Ga0307410_100228292	129
792	3300031852	Ga0307410_10056367	Ga0307410_100563674	129
793	3300031852	Ga0307410_10109844	Ga0307410_101098442	129
794	3300031901	Ga0307406_11431777	Ga0307406_114317771	129
795	3300031903	Ga0307407_10028790	Ga0307407_100287902	129
796	3300031911	Ga0307412_10000056	Ga0307412_1000005630	129
797	3300031911	Ga0307412_10066666	Ga0307412_100666662	129
798	3300031995	Ga0307409_100832663	Ga0307409_1008326631	129
799	3300032002	Ga0307416_100041410	Ga0307416_1000414102	129
800	3300032002	Ga0307416_100563378	Ga0307416_1005633782	129
801	3300032002	Ga0307416_100701763	Ga0307416_1007017631	129
802	3300032002	Ga0307416_102273973	Ga0307416_1022739732	129
803	3300032005	Ga0307411_10032206	Ga0307411_100322062	129
804	3300032005	Ga0307411_10034784	Ga0307411_100347842	129
805	3300032133	Ga0316583_10002814	Ga0316583_100028142	129
806	3300035171	Ga0373946_0144803	Ga0373946_0144803_571_963	129
807	3300036534	Ga0310109_023389	Ga0310109_023389_356_751	129
808	3300037466	Ga0395898_0061916	Ga0395898_0061916_3196_3591	129
809	3300037471	Ga0395905_0026187	Ga0395905_0026187_2314_2709	129
810	3300039437	Ga0436365_1259852	Ga0436365_1259852_1213_1611	129
811	3300042126	Ga0450888_031356	Ga0450888_031356_168_563	129
812	3300042135	Ga0450899_014163	Ga0450899_014163_248_643	129
813	3300044658	Ga0466972_0174584	Ga0466972_0174584_477_872	129
814	3300044684	Ga0466966_0022548	Ga0466966_0022548_1186_1581	129
815	3300044719	Ga0466971_0249056	Ga0466971_0249056_131_526	129
816	3300045976	Ga0466967_0628753	Ga0466967_0628753_205_600	129
817	3300046455	Ga0495603_0007633	Ga0495603_0007633_3731_4126	129
818	3300046457	Ga0495590_0000842	Ga0495590_0000842_12804_13199	129
819	3300046458	Ga0495591_011808	Ga0495591_011808_511_906	129
820	3300046459	Ga0495629_0000465	Ga0495629_0000465_2380_2775	129
821	3300046462	Ga0495651_0176037	Ga0495651_0176037_1090_1485	129
822	3300046471	Ga0495650_0009993	Ga0495650_0009993_2568_2963	129
823	3300046472	Ga0495580_0020774	Ga0495580_0020774_4396_4788	129
824	3300046472	Ga0495580_0433985	Ga0495580_0433985_425_817	129
825	3300046476	Ga0495662_0285262	Ga0495662_0285262_348_743	129
826	3300046476	Ga0495662_0493617	Ga0495662_0493617_16_411	129
827	3300046477	Ga0495664_0260419	Ga0495664_0260419_637_1032	129
828	3300046507	Ga0495606_0011997	Ga0495606_0011997_5176_5571	129
829	3300046511	Ga0495608_0015869	Ga0495608_0015869_4626_5021	129
830	3300046516	Ga0495628_0075733	Ga0495628_0075733_2001_2396	129
831	3300046517	Ga0495630_0200448	Ga0495630_0200448_191_586	129
832	3300046517	Ga0495630_0825183	Ga0495630_0825183_225_620	129
833	3300046528	Ga0495642_0011654	Ga0495642_0011654_554_949	129
834	3300046529	Ga0495652_0046140	Ga0495652_0046140_64_459	129
835	3300046529	Ga0495652_0232624	Ga0495652_0232624_863_1255	129
836	3300046530	Ga0495654_0005873	Ga0495654_0005873_4825_5220	129
837	3300046531	Ga0495665_0020113	Ga0495665_0020113_2451_2846	129
838	3300046531	Ga0495665_0049608	Ga0495665_0049608_1278_1670	129
839	3300046538	Ga0495609_0122618	Ga0495609_0122618_550_942	129
840	3300046542	Ga0495597_0004639	Ga0495597_0004639_359_754	129
841	3300046543	Ga0495645_0000582	Ga0495645_0000582_22696_23091	129
842	3300046543	Ga0495645_0194562	Ga0495645_0194562_31_426	129
843	3300046663	Ga0495635_0156032	Ga0495635_0156032_179_574	129
844	3300046674	Ga0495588_0046359	Ga0495588_0046359_271_663	129
845	3300046674	Ga0495588_0523442	Ga0495588_0523442_78_473	129
846	3300046678	Ga0495599_0483877	Ga0495599_0483877_298_693	129
847	3300046680	Ga0495646_0061124	Ga0495646_0061124_294_689	129
848	3300046681	Ga0495647_0446776	Ga0495647_0446776_178_570	129
849	3300046684	Ga0495669_0032205	Ga0495669_0032205_1124_1519	129
850	3300046690	Ga0495624_0042714	Ga0495624_0042714_2406_2801	129
851	3300046694	Ga0495649_0217847	Ga0495649_0217847_101_496	129
852	3300046794	Ga0495589_0334818	Ga0495589_0334818_115_510	129
853	3300047315	Ga0495581_0003203	Ga0495581_0003203_8963_9358	129
854	3300047317	Ga0495604_0150378	Ga0495604_0150378_963_1358	129
855	3300047319	Ga0495674_0015320	Ga0495674_0015320_2450_2845	129
856	3300047319	Ga0495674_0032881	Ga0495674_0032881_3277_3669	129
857	3300047319	Ga0495674_0418075	Ga0495674_0418075_40_435	129
858	3300047322	Ga0495680_0125604	Ga0495680_0125604_743_1138	129
859	3300047323	Ga0495683_0002149	Ga0495683_0002149_2094_2489	129
860	3300047444	Ga0495675_0611634	Ga0495675_0611634_82_477	129
861	3300047470	Ga0495681_0350509	Ga0495681_0350509_77_472	129
862	3300047472	Ga0495686_0010936	Ga0495686_0010936_3571_3963	129
863	3300047673	Ga0495593_0113776	Ga0495593_0113776_83_478	129
864	3300047673	Ga0495593_0287935	Ga0495593_0287935_409_804	129
865	3300048088	Ga0495602_0207890	Ga0495602_0207890_340_735	129
866	3300048903	Ga0496100_0052843	Ga0496100_0052843_176_571	129
867	3300048904	Ga0496101_0008817	Ga0496101_0008817_5434_5829	129
868	3300048904	Ga0496101_0011340	Ga0496101_0011340_4922_5317	129
869	3300048905	Ga0496102_0004270	Ga0496102_0004270_2961_3356	129
870	3300048905	Ga0496102_0049771	Ga0496102_0049771_2932_3324	129
871	3300048906	Ga0496103_0001532	Ga0496103_0001532_14271_14666	129
872	3300048906	Ga0496103_0119196	Ga0496103_0119196_166_558	129
873	3300048907	Ga0496104_0111009	Ga0496104_0111009_1466_1861	129
874	3300048907	Ga0496104_0118703	Ga0496104_0118703_738_1133	129
875	3300048908	Ga0496105_0176749	Ga0496105_0176749_121_516	129
876	3300048908	Ga0496105_0301355	Ga0496105_0301355_845_1240	129
877	3300048909	Ga0496106_0001808	Ga0496106_0001808_487_882	129
878	3300048910	Ga0496107_0031326	Ga0496107_0031326_2681_3076	129
879	3300048910	Ga0496107_0816016	Ga0496107_0816016_154_549	129
880	3300048912	Ga0496109_0476737	Ga0496109_0476737_241_633	129
881	3300048913	Ga0496110_0085410	Ga0496110_0085410_71_466	129
882	3300048913	Ga0496110_0458129	Ga0496110_0458129_199_594	129
883	3300048913	Ga0496110_1565773	Ga0496110_1565773_158_553	129
884	3300048914	Ga0496111_0003111	Ga0496111_0003111_377_772	129
885	3300048915	Ga0496112_0004471	Ga0496112_0004471_2619_3014	129
886	3300048915	Ga0496112_0452054	Ga0496112_0452054_167_562	129
887	3300048917	Ga0496114_0584113	Ga0496114_0584113_493_885	129
888	3300048917	Ga0496114_1763948	Ga0496114_1763948_53_448	129
889	3300048918	Ga0496115_0537792	Ga0496115_0537792_393_788	129
890	3300048919	Ga0496116_0001318	Ga0496116_0001318_2453_2848	129
891	3300048920	Ga0496117_0004062	Ga0496117_0004062_13612_14007	129
892	3300048920	Ga0496117_0120925	Ga0496117_0120925_16_411	129
893	3300048921	Ga0496118_0024875	Ga0496118_0024875_2334_2729	129
894	3300048922	Ga0496119_0430845	Ga0496119_0430845_81_476	129
895	3300048923	Ga0496120_0371531	Ga0496120_0371531_219_614	129
896	3300048924	Ga0496121_0006168	Ga0496121_0006168_12189_12584	129
897	3300048925	Ga0496122_0012516	Ga0496122_0012516_795_1190	129
898	3300048926	Ga0496123_0011806	Ga0496123_0011806_392_787	129
899	3300048929	Ga0496126_0003244	Ga0496126_0003244_17386_17781	129
900	3300048986	Ga0466983_0168030	Ga0466983_0168030_890_1285	129
901	3300049459	Ga0495678_046786	Ga0495678_046786_879_1274	129
902	3300049532	Ga0501316_033097	Ga0501316_033097_184_576	129
903	3300049536	Ga0501320_010244	Ga0501320_010244_405_797	129
904	3300049575	Ga0501039_0668887	Ga0501039_0668887_321_713	129
905	3300049577	Ga0501041_1066449	Ga0501041_1066449_15_407	129
906	3300049578	Ga0501042_0370615	Ga0501042_0370615_352_744	129
907	3300049582	Ga0501048_0611089	Ga0501048_0611089_283_675	129
908	3300049587	Ga0501071_1604547	Ga0501071_1604547_57_449	129
909	3300049592	Ga0501076_0256872	Ga0501076_0256872_932_1324	129
910	3300050493	nmdc:mga0k408_29075_c1	nmdc:mga0k408_29075_c1_2022_2411	129
911	3300050511	nmdc:mga08y16_9048_c1	nmdc:mga08y16_9048_c1_4474_4866	129
912	3300050513	nmdc:mga0rr50_1328512_c1	nmdc:mga0rr50_1328512_c1_199_591	129
913	3300059477	Ga0587084_044995	Ga0587084_044995_235_630	129
914	3300059491	Ga0587070_019837	Ga0587070_019837_25_420	129
915	3300059503	Ga0587080_010303	Ga0587080_010303_930_1325	129
916	3300059503	Ga0587080_030949	Ga0587080_030949_504_896	129
917	3300059503	Ga0587080_050368	Ga0587080_050368_17_412	129
918	3300059504	Ga0587082_011683	Ga0587082_011683_30_425	129
919	3300059505	Ga0587083_0185740	Ga0587083_0185740_17_412	129
920	3300059506	Ga0587085_079601	Ga0587085_079601_45_440	129
921	3300059511	Ga0587091_053543	Ga0587091_053543_30_425	129
922	3300059512	Ga0587092_148320	Ga0587092_148320_63_458	129
923	3300059604	Ga0587098_029155	Ga0587098_029155_305_700	129
924	3300059627	Ga0587117_042809	Ga0587117_042809_298_693	129
925	3300059630	Ga0587128_062540	Ga0587128_062540_294_689	129
926	3300059643	Ga0587072_013950	Ga0587072_013950_65_460	129
927	3300059643	Ga0587072_115001	Ga0587072_115001_24_419	129
928	3300059645	Ga0587076_012417	Ga0587076_012417_25_420	129
929	3300059647	Ga0587079_198783	Ga0587079_198783_14_409	129
930	3300059652	Ga0587107_007741	Ga0587107_007741_11_406	129
931	3300060344	Ga0587071_043924	Ga0587071_043924_27_422	129
932	3300060344	Ga0587071_072798	Ga0587071_072798_301_699	129
933	3300060353	Ga0501082_0766730	Ga0501082_0766730_265_657	129
934	3300061719	Ga0466962_0090599	Ga0466962_0090599_958_1353	129
935	3300003577	Ga0007416J51690_1051518	Ga0007416J51690_10515182	130
936	3300005328	Ga0070676_10000304	Ga0070676_100003049	130
937	3300005328	Ga0070676_10976607	Ga0070676_109766071	130
938	3300005331	Ga0070670_100025395	Ga0070670_1000253955	130
939	3300005331	Ga0070670_100111565	Ga0070670_1001115652	130
940	3300005333	Ga0070677_10000489	Ga0070677_100004898	130
941	3300005333	Ga0070677_10253535	Ga0070677_102535352	130
942	3300005335	Ga0070666_10019754	Ga0070666_100197543	130
943	3300005335	Ga0070666_10059174	Ga0070666_100591743	130
944	3300005335	Ga0070666_10201346	Ga0070666_102013462	130
945	3300005338	Ga0068868_100011298	Ga0068868_1000112983	130
946	3300005338	Ga0068868_100052562	Ga0068868_1000525622	130
947	3300005338	Ga0068868_100074415	Ga0068868_1000744152	130
948	3300005340	Ga0070689_100160532	Ga0070689_1001605322	130
949	3300005347	Ga0070668_100000779	Ga0070668_1000007792	130
950	3300005347	Ga0070668_100001341	Ga0070668_1000013418	130
951	3300005347	Ga0070668_100045758	Ga0070668_1000457584	130
952	3300005347	Ga0070668_100142075	Ga0070668_1001420753	130
953	3300005347	Ga0070668_101281690	Ga0070668_1012816901	130
954	3300005353	Ga0070669_100000668	Ga0070669_1000006682	130
955	3300005353	Ga0070669_100081657	Ga0070669_1000816574	130
956	3300005353	Ga0070669_100876952	Ga0070669_1008769521	130
957	3300005354	Ga0070675_100001258	Ga0070675_10000125817	130
958	3300005354	Ga0070675_100007692	Ga0070675_10000769210	130
959	3300005354	Ga0070675_100118924	Ga0070675_1001189242	130
960	3300005355	Ga0070671_100003196	Ga0070671_10000319610	130
961	3300005355	Ga0070671_100063047	Ga0070671_1000630473	130
962	3300005355	Ga0070671_100083572	Ga0070671_1000835722	130
963	3300005355	Ga0070671_100406083	Ga0070671_1004060832	130
964	3300005356	Ga0070674_100000737	Ga0070674_1000007377	130
965	3300005364	Ga0070673_100000729	Ga0070673_10000072916	130
966	3300005364	Ga0070673_100154263	Ga0070673_1001542633	130
967	3300005367	Ga0070667_100005264	Ga0070667_1000052648	130
968	3300005367	Ga0070667_100232076	Ga0070667_1002320762	130
969	3300005367	Ga0070667_100253290	Ga0070667_1002532902	130
970	3300005367	Ga0070667_101397522	Ga0070667_1013975221	130
971	3300005441	Ga0070700_100505199	Ga0070700_1005051992	130
972	3300005455	Ga0070663_100035325	Ga0070663_1000353255	130
973	3300005456	Ga0070678_100003201	Ga0070678_1000032013	130
974	3300005456	Ga0070678_100081176	Ga0070678_1000811762	130
975	3300005456	Ga0070678_100896397	Ga0070678_1008963971	130
976	3300005457	Ga0070662_100772581	Ga0070662_1007725811	130
977	3300005457	Ga0070662_101532189	Ga0070662_1015321891	130
978	3300005457	Ga0070662_101637478	Ga0070662_1016374781	130
979	3300005459	Ga0068867_100000975	Ga0068867_1000009754	130
980	3300005459	Ga0068867_100041796	Ga0068867_1000417962	130
981	3300005459	Ga0068867_100617122	Ga0068867_1006171221	130
982	3300005466	Ga0070685_10238839	Ga0070685_102388392	130
983	3300005466	Ga0070685_10457887	Ga0070685_104578872	130
984	3300005539	Ga0068853_100091266	Ga0068853_1000912661	130
985	3300005539	Ga0068853_100612465	Ga0068853_1006124651	130
986	3300005543	Ga0070672_100000287	Ga0070672_1000002879	130
987	3300005543	Ga0070672_100001456	Ga0070672_1000014569	130
988	3300005543	Ga0070672_101298809	Ga0070672_1012988092	130
989	3300005547	Ga0070693_101251835	Ga0070693_1012518351	130
990	3300005548	Ga0070665_100008986	Ga0070665_1000089869	130
991	3300005548	Ga0070665_100031122	Ga0070665_1000311223	130
992	3300005548	Ga0070665_100464622	Ga0070665_1004646221	130
993	3300005548	Ga0070665_100472350	Ga0070665_1004723502	130
994	3300005578	Ga0068854_100204620	Ga0068854_1002046202	130
995	3300005578	Ga0068854_100775733	Ga0068854_1007757331	130
996	3300005616	Ga0068852_100001757	Ga0068852_10000175714	130
997	3300005616	Ga0068852_100689698	Ga0068852_1006896982	130
998	3300005616	Ga0068852_100750969	Ga0068852_1007509692	130
999	3300005616	Ga0068852_100971597	Ga0068852_1009715972	130
1000	3300005617	Ga0068859_100050936	Ga0068859_1000509363	130
1001	3300005617	Ga0068859_100197722	Ga0068859_1001977221	130
1002	3300005617	Ga0068859_100281196	Ga0068859_1002811962	130
1003	3300005618	Ga0068864_100005258	Ga0068864_10000525810	130
1004	3300005618	Ga0068864_100009015	Ga0068864_1000090156	130
1005	3300005618	Ga0068864_100247859	Ga0068864_1002478592	130
1006	3300005719	Ga0068861_100037620	Ga0068861_1000376203	130
1007	3300005719	Ga0068861_101155139	Ga0068861_1011551391	130
1008	3300005834	Ga0068851_10003210	Ga0068851_100032102	130
1009	3300005840	Ga0068870_10229005	Ga0068870_102290052	130
1010	3300005841	Ga0068863_100001368	Ga0068863_10000136818	130
1011	3300005841	Ga0068863_100007567	Ga0068863_1000075673	130
1012	3300005841	Ga0068863_100158088	Ga0068863_1001580882	130
1013	3300005841	Ga0068863_102300674	Ga0068863_1023006741	130
1014	3300005842	Ga0068858_100006176	Ga0068858_1000061768	130
1015	3300005842	Ga0068858_100016320	Ga0068858_1000163203	130
1016	3300005842	Ga0068858_100216406	Ga0068858_1002164062	130
1017	3300005842	Ga0068858_100232085	Ga0068858_1002320852	130
1018	3300005843	Ga0068860_100004808	Ga0068860_1000048082	130
1019	3300005843	Ga0068860_100106931	Ga0068860_1001069312	130
1020	3300005843	Ga0068860_100198684	Ga0068860_1001986843	130
1021	3300005843	Ga0068860_100220259	Ga0068860_1002202592	130
1022	3300005843	Ga0068860_100808836	Ga0068860_1008088361	130
1023	3300005843	Ga0068860_101505309	Ga0068860_1015053091	130
1024	3300005844	Ga0068862_100044946	Ga0068862_1000449461	130
1025	3300005844	Ga0068862_100092760	Ga0068862_1000927604	130
1026	3300005844	Ga0068862_100295944	Ga0068862_1002959441	130
1027	3300005844	Ga0068862_100474970	Ga0068862_1004749702	130
1028	3300005937	Ga0081455_10308360	Ga0081455_103083602	130
1029	3300005985	Ga0081539_10037624	Ga0081539_100376243	130
1030	3300006195	Ga0075366_10269707	Ga0075366_102697073	130
1031	3300006237	Ga0097621_100175104	Ga0097621_1001751043	130
1032	3300006237	Ga0097621_100367022	Ga0097621_1003670222	130
1033	3300006358	Ga0068871_100000834	Ga0068871_1000008348	130
1034	3300006358	Ga0068871_100289609	Ga0068871_1002896092	130
1035	3300006358	Ga0068871_101317402	Ga0068871_1013174021	130
1036	3300006844	Ga0075428_100879861	Ga0075428_1008798612	130
1037	3300006844	Ga0075428_102279329	Ga0075428_1022793291	130
1038	3300006846	Ga0075430_100966888	Ga0075430_1009668881	130
1039	3300006852	Ga0075433_11202607	Ga0075433_112026071	130
1040	3300006871	Ga0075434_100585678	Ga0075434_1005856782	130
1041	3300006871	Ga0075434_102525765	Ga0075434_1025257651	130
1042	3300006881	Ga0068865_100038461	Ga0068865_1000384613	130
1043	3300006881	Ga0068865_100113385	Ga0068865_1001133853	130
1044	3300006881	Ga0068865_101365905	Ga0068865_1013659052	130
1045	3300006931	Ga0097620_100050936	Ga0097620_1000509363	130
1046	3300006931	Ga0097620_100197724	Ga0097620_1001977241	130
1047	3300006931	Ga0097620_100281184	Ga0097620_1002811842	130
1048	3300007076	Ga0075435_100550916	Ga0075435_1005509162	130
1049	3300007076	Ga0075435_100781998	Ga0075435_1007819981	130
1050	3300009101	Ga0105247_10094065	Ga0105247_100940653	130
1051	3300009176	Ga0105242_12046814	Ga0105242_120468141	130
1052	3300009177	Ga0105248_10017795	Ga0105248_100177952	130
1053	3300009177	Ga0105248_10731674	Ga0105248_107316742	130
1054	3300009551	Ga0105238_10381411	Ga0105238_103814112	130
1055	3300009553	Ga0105249_10403331	Ga0105249_104033312	130
1056	3300012508	Ga0157315_1024230	Ga0157315_10242302	130
1057	3300013296	Ga0157374_10003813	Ga0157374_1000381313	130
1058	3300013296	Ga0157374_10205688	Ga0157374_102056882	130
1059	3300013297	Ga0157378_10007092	Ga0157378_100070928	130
1060	3300013297	Ga0157378_10060018	Ga0157378_100600186	130
1061	3300013297	Ga0157378_10148795	Ga0157378_101487953	130
1062	3300013297	Ga0157378_10529615	Ga0157378_105296152	130
1063	3300013306	Ga0163162_10003831	Ga0163162_100038312	130
1064	3300013306	Ga0163162_11184190	Ga0163162_111841902	130
1065	3300013306	Ga0163162_11321900	Ga0163162_113219002	130
1066	3300013306	Ga0163162_12877302	Ga0163162_128773022	130
1067	3300013308	Ga0157375_10003753	Ga0157375_100037537	130
1068	3300013308	Ga0157375_10049224	Ga0157375_100492246	130
1069	3300013308	Ga0157375_10373302	Ga0157375_103733022	130
1070	3300013308	Ga0157375_12665339	Ga0157375_126653391	130
1071	3300014325	Ga0163163_10197576	Ga0163163_101975762	130
1072	3300014326	Ga0157380_12617527	Ga0157380_126175271	130
1073	3300014745	Ga0157377_10189836	Ga0157377_101898362	130
1074	3300014968	Ga0157379_10040933	Ga0157379_100409331	130
1075	3300014969	Ga0157376_10000986	Ga0157376_1000098614	130
1076	3300014969	Ga0157376_10533647	Ga0157376_105336471	130
1077	3300014969	Ga0157376_12089299	Ga0157376_120892991	130
1078	3300025315	Ga0207697_10050439	Ga0207697_100504392	130
1079	3300025315	Ga0207697_10057007	Ga0207697_100570072	130
1080	3300025315	Ga0207697_10477191	Ga0207697_104771911	130
1081	3300025321	Ga0207656_10001788	Ga0207656_100017882	130
1082	3300025321	Ga0207656_10128399	Ga0207656_101283992	130
1083	3300025893	Ga0207682_10001872	Ga0207682_100018728	130
1084	3300025901	Ga0207688_10172850	Ga0207688_101728502	130
1085	3300025903	Ga0207680_10005324	Ga0207680_100053248	130
1086	3300025903	Ga0207680_10025437	Ga0207680_100254373	130
1087	3300025907	Ga0207645_10000157	Ga0207645_1000015718	130
1088	3300025907	Ga0207645_10033194	Ga0207645_100331945	130
1089	3300025908	Ga0207643_10061318	Ga0207643_100613183	130
1090	3300025908	Ga0207643_10189601	Ga0207643_101896011	130
1091	3300025923	Ga0207681_10034153	Ga0207681_100341532	130
1092	3300025923	Ga0207681_10062817	Ga0207681_100628172	130
1093	3300025925	Ga0207650_10035463	Ga0207650_100354631	130
1094	3300025925	Ga0207650_10060973	Ga0207650_100609733	130
1095	3300025925	Ga0207650_10158791	Ga0207650_101587913	130
1096	3300025925	Ga0207650_11213438	Ga0207650_112134381	130
1097	3300025925	Ga0207650_11656607	Ga0207650_116566071	130
1098	3300025926	Ga0207659_10006435	Ga0207659_100064358	130
1099	3300025926	Ga0207659_10177981	Ga0207659_101779812	130
1100	3300025931	Ga0207644_10004394	Ga0207644_100043944	130
1101	3300025931	Ga0207644_10012783	Ga0207644_100127835	130
1102	3300025931	Ga0207644_10075404	Ga0207644_100754042	130
1103	3300025931	Ga0207644_10168834	Ga0207644_101688341	130
1104	3300025931	Ga0207644_11212233	Ga0207644_112122331	130
1105	3300025933	Ga0207706_10119077	Ga0207706_101190772	130
1106	3300025933	Ga0207706_11061523	Ga0207706_110615231	130
1107	3300025937	Ga0207669_10002272	Ga0207669_1000227214	130
1108	3300025937	Ga0207669_10540696	Ga0207669_105406962	130
1109	3300025938	Ga0207704_10083542	Ga0207704_100835423	130
1110	3300025938	Ga0207704_10863206	Ga0207704_108632062	130
1111	3300025940	Ga0207691_10000249	Ga0207691_1000024941	130
1112	3300025940	Ga0207691_10001733	Ga0207691_1000173318	130
1113	3300025941	Ga0207711_10026251	Ga0207711_100262515	130
1114	3300025941	Ga0207711_10412528	Ga0207711_104125282	130
1115	3300025941	Ga0207711_10562973	Ga0207711_105629732	130
1116	3300025942	Ga0207689_10019553	Ga0207689_100195536	130
1117	3300025942	Ga0207689_10033026	Ga0207689_100330262	130
1118	3300025945	Ga0207679_10195676	Ga0207679_101956762	130
1119	3300025960	Ga0207651_10002900	Ga0207651_1000290014	130
1120	3300025960	Ga0207651_10044919	Ga0207651_100449192	130
1121	3300025961	Ga0207712_12138560	Ga0207712_121385601	130
1122	3300025972	Ga0207668_10005279	Ga0207668_100052792	130
1123	3300025972	Ga0207668_10046004	Ga0207668_100460044	130
1124	3300025972	Ga0207668_10341499	Ga0207668_103414992	130
1125	3300025981	Ga0207640_10442732	Ga0207640_104427322	130
1126	3300025981	Ga0207640_10775846	Ga0207640_107758462	130
1127	3300025986	Ga0207658_10002265	Ga0207658_100022653	130
1128	3300025986	Ga0207658_10083183	Ga0207658_100831832	130
1129	3300025986	Ga0207658_10209742	Ga0207658_102097422	130
1130	3300026023	Ga0207677_10110258	Ga0207677_101102583	130
1131	3300026023	Ga0207677_11093676	Ga0207677_110936762	130
1132	3300026035	Ga0207703_10002253	Ga0207703_1000225314	130
1133	3300026035	Ga0207703_10185945	Ga0207703_101859452	130
1134	3300026035	Ga0207703_10204574	Ga0207703_102045743	130
1135	3300026035	Ga0207703_11305358	Ga0207703_113053581	130
1136	3300026035	Ga0207703_11727567	Ga0207703_117275672	130
1137	3300026041	Ga0207639_10061908	Ga0207639_100619081	130
1138	3300026041	Ga0207639_10395458	Ga0207639_103954582	130
1139	3300026067	Ga0207678_10042665	Ga0207678_100426653	130
1140	3300026067	Ga0207678_10503316	Ga0207678_105033162	130
1141	3300026075	Ga0207708_10342124	Ga0207708_103421242	130
1142	3300026088	Ga0207641_10000374	Ga0207641_1000037434	130
1143	3300026088	Ga0207641_10060660	Ga0207641_100606602	130
1144	3300026088	Ga0207641_10146203	Ga0207641_101462032	130
1145	3300026088	Ga0207641_10181002	Ga0207641_101810022	130
1146	3300026088	Ga0207641_10636429	Ga0207641_106364292	130
1147	3300026088	Ga0207641_10701441	Ga0207641_107014412	130
1148	3300026088	Ga0207641_11903517	Ga0207641_119035171	130
1149	3300026089	Ga0207648_10000523	Ga0207648_100005234	130
1150	3300026089	Ga0207648_10028050	Ga0207648_100280502	130
1151	3300026089	Ga0207648_10058572	Ga0207648_100585722	130
1152	3300026089	Ga0207648_11382900	Ga0207648_113829002	130
1153	3300026095	Ga0207676_10008789	Ga0207676_100087897	130
1154	3300026095	Ga0207676_10056352	Ga0207676_100563522	130
1155	3300026095	Ga0207676_10608435	Ga0207676_106084352	130
1156	3300026095	Ga0207676_10699647	Ga0207676_106996472	130
1157	3300026118	Ga0207675_100024242	Ga0207675_1000242423	130
1158	3300026118	Ga0207675_100118498	Ga0207675_1001184982	130
1159	3300026118	Ga0207675_100400814	Ga0207675_1004008141	130
1160	3300026118	Ga0207675_102085500	Ga0207675_1020855001	130
1161	3300026121	Ga0207683_10000476	Ga0207683_100004768	130
1162	3300026121	Ga0207683_10000672	Ga0207683_1000067224	130
1163	3300026121	Ga0207683_10692827	Ga0207683_106928272	130
1164	3300026142	Ga0207698_10408863	Ga0207698_104088632	130
1165	3300026142	Ga0207698_10463650	Ga0207698_104636502	130
1166	3300026142	Ga0207698_10853850	Ga0207698_108538501	130
1167	3300027252	Ga0209973_1023361	Ga0209973_10233612	130
1168	3300027665	Ga0209983_1069814	Ga0209983_10698141	130
1169	3300027876	Ga0209974_10012991	Ga0209974_100129912	130
1170	3300028379	Ga0268266_10004526	Ga0268266_1000452614	130
1171	3300028379	Ga0268266_10302635	Ga0268266_103026352	130
1172	3300028379	Ga0268266_10451765	Ga0268266_104517652	130
1173	3300028379	Ga0268266_10556210	Ga0268266_105562101	130
1174	3300028380	Ga0268265_10117676	Ga0268265_101176762	130
1175	3300028380	Ga0268265_10141008	Ga0268265_101410083	130
1176	3300028380	Ga0268265_10736208	Ga0268265_107362081	130
1177	3300028381	Ga0268264_10007867	Ga0268264_100078674	130
1178	3300028381	Ga0268264_10013714	Ga0268264_100137141	130
1179	3300028381	Ga0268264_10176303	Ga0268264_101763031	130
1180	3300028381	Ga0268264_10510077	Ga0268264_105100772	130
1181	3300028381	Ga0268264_11936236	Ga0268264_119362361	130
1182	3300028794	Ga0307515_10085745	Ga0307515_100857452	130
1183	3300031456	Ga0307513_10345104	Ga0307513_103451042	130
1184	3300031548	Ga0307408_100221085	Ga0307408_1002210853	130
1185	3300031548	Ga0307408_100376429	Ga0307408_1003764292	130
1186	3300031731	Ga0307405_11117092	Ga0307405_111170922	130
1187	3300031824	Ga0307413_10013759	Ga0307413_100137594	130
1188	3300031852	Ga0307410_10040407	Ga0307410_100404072	130
1189	3300031901	Ga0307406_10218961	Ga0307406_102189612	130
1190	3300031901	Ga0307406_10788529	Ga0307406_107885292	130
1191	3300031903	Ga0307407_10094168	Ga0307407_100941682	130
1192	3300031995	Ga0307409_100023370	Ga0307409_1000233701	130
1193	3300032002	Ga0307416_100001793	Ga0307416_1000017932	130
1194	3300032002	Ga0307416_100113533	Ga0307416_1001135333	130
1195	3300032004	Ga0307414_10664404	Ga0307414_106644042	130
1196	3300032005	Ga0307411_10031067	Ga0307411_100310673	130
1197	3300032005	Ga0307411_12012287	Ga0307411_120122871	130
1198	3300032126	Ga0307415_100380349	Ga0307415_1003803491	130
1199	3300035086	Ga0373934_0367836	Ga0373934_0367836_59_457	130
1200	3300035119	Ga0373956_0358029	Ga0373956_0358029_229_627	130
1201	3300035172	Ga0373955_0456684	Ga0373955_0456684_238_636	130
1202	3300035172	Ga0373955_0886253	Ga0373955_0886253_46_441	130
1203	3300035241	Ga0373961_0016263	Ga0373961_0016263_1301_1795	130
1204	3300036401	Ga0373937_0030611	Ga0373937_0030611_801_1199	130
1205	3300036401	Ga0373937_0206310	Ga0373937_0206310_561_959	130
1206	3300036401	Ga0373937_1385795	Ga0373937_1385795_154_552	130
1207	3300037471	Ga0395905_1516079	Ga0395905_1516079_92_487	130
1208	3300041459	Ga0451800_0896620	Ga0451800_0896620_270_665	130
1209	3300041459	Ga0451800_1306844	Ga0451800_1306844_139_537	130
1210	3300041486	Ga0451807_1541707	Ga0451807_1541707_97_492	130
1211	3300041491	Ga0451833_1273567	Ga0451833_1273567_130_525	130
1212	3300042876	Ga0451577_0310111	Ga0451577_0310111_205_600	130
1213	3300046459	Ga0495629_0204460	Ga0495629_0204460_280_678	130
1214	3300046462	Ga0495651_0382804	Ga0495651_0382804_176_574	130
1215	3300046674	Ga0495588_0561216	Ga0495588_0561216_168_566	130
1216	3300046683	Ga0495658_0729303	Ga0495658_0729303_79_477	130
1217	3300047471	Ga0495684_0296529	Ga0495684_0296529_298_696	130
1218	3300048908	Ga0496105_0245561	Ga0496105_0245561_871_1269	130
1219	3300048908	Ga0496105_0591813	Ga0496105_0591813_296_691	130
1220	3300048909	Ga0496106_0831882	Ga0496106_0831882_313_711	130
1221	3300048913	Ga0496110_0858621	Ga0496110_0858621_176_571	130
1222	3300048913	Ga0496110_0894679	Ga0496110_0894679_363_761	130
1223	3300048915	Ga0496112_0051037	Ga0496112_0051037_146_541	130
1224	3300048916	Ga0496113_0698221	Ga0496113_0698221_222_617	130
1225	3300048917	Ga0496114_0076106	Ga0496114_0076106_982_1380	130
1226	3300049127	Ga0501306_028555	Ga0501306_028555_18_413	130
1227	3300049161	Ga0501305_045395	Ga0501305_045395_109_504	130
1228	3300049162	Ga0501307_020674	Ga0501307_020674_358_753	130
1229	3300049528	Ga0501312_034107	Ga0501312_034107_274_669	130
1230	3300049531	Ga0501315_000611	Ga0501315_000611_2049_2444	130
1231	3300049536	Ga0501320_045308	Ga0501320_045308_169_564	130
1232	3300049537	Ga0501321_036213	Ga0501321_036213_15_410	130
1233	3300049537	Ga0501321_064242	Ga0501321_064242_25_420	130
1234	3300049539	Ga0501323_026005	Ga0501323_026005_245_640	130
1235	3300049541	Ga0501325_003357	Ga0501325_003357_606_1001	130
1236	3300049583	Ga0501067_0069853	Ga0501067_0069853_649_1044	130
1237	3300050493	nmdc:mga0k408_615713_c1	nmdc:mga0k408_615713_c1_106_504	130
1238	3300050507	nmdc:mga05p37_880204_c1	nmdc:mga05p37_880204_c1_250_645	130
1239	3300050511	nmdc:mga08y16_1989677_c1	nmdc:mga08y16_1989677_c1_57_452	130
1240	3300050512	nmdc:mga0n895_2176964_c1	nmdc:mga0n895_2176964_c1_55_450	130
1241	3300050513	nmdc:mga0rr50_1185921_c1	nmdc:mga0rr50_1185921_c1_34_429	130
1242	3300050513	nmdc:mga0rr50_501091_c1	nmdc:mga0rr50_501091_c1_178_573	130
1243	3300050515	nmdc:mga0a205_347780_c1	nmdc:mga0a205_347780_c1_887_1285	130
1244	3300053084	Ga0495595_0109093	Ga0495595_0109093_582_980	130
1245	3300053084	Ga0495595_0611226	Ga0495595_0611226_36_434	130
1246	3300053085	Ga0495619_0066878	Ga0495619_0066878_1675_2073	130
1247	3300053085	Ga0495619_0943497	Ga0495619_0943497_85_483	130
1248	3300053088	Ga0500644_0095793	Ga0500644_0095793_212_610	130
1249	3300053142	Ga0500577_0085473	Ga0500577_0085473_500_898	130
1250	3300053153	Ga0500616_0026791	Ga0500616_0026791_302_700	130
1251	3300003300	Ga0006758J48902_1022226	Ga0006758J48902_10222262	131
1252	3300003693	Ga0032354_1094894	Ga0032354_10948941	131
1253	3300003781	Ga0055536_1075132	Ga0055536_10751322	131
1254	3300003784	Ga0055534_1020269	Ga0055534_10202693	131
1255	3300003794	Ga0055531_10037274	Ga0055531_100372742	131
1256	3300005262	Ga0065165_1110876	Ga0065165_11108762	131
1257	3300005331	Ga0070670_100289373	Ga0070670_1002893732	131
1258	3300005354	Ga0070675_100137932	Ga0070675_1001379322	131
1259	3300005356	Ga0070674_100905593	Ga0070674_1009055932	131
1260	3300005436	Ga0070713_100000028	Ga0070713_10000002839	131
1261	3300005438	Ga0070701_10182430	Ga0070701_101824301	131
1262	3300005440	Ga0070705_101020331	Ga0070705_1010203311	131
1263	3300005456	Ga0070678_101172064	Ga0070678_1011720642	131
1264	3300005459	Ga0068867_101601436	Ga0068867_1016014361	131
1265	3300005544	Ga0070686_100155249	Ga0070686_1001552493	131
1266	3300005548	Ga0070665_100463687	Ga0070665_1004636872	131
1267	3300005618	Ga0068864_102055295	Ga0068864_1020552951	131
1268	3300005719	Ga0068861_100972192	Ga0068861_1009721922	131
1269	3300005841	Ga0068863_101370525	Ga0068863_1013705252	131
1270	3300006038	Ga0075365_10171372	Ga0075365_101713722	131
1271	3300006195	Ga0075366_10003125	Ga0075366_100031255	131
1272	3300006195	Ga0075366_10102974	Ga0075366_101029742	131
1273	3300006195	Ga0075366_10576949	Ga0075366_105769491	131
1274	3300006871	Ga0075434_101337986	Ga0075434_1013379861	131
1275	3300009094	Ga0111539_10445508	Ga0111539_104455082	131
1276	3300013306	Ga0163162_11514200	Ga0163162_115142001	131
1277	3300014326	Ga0157380_11940916	Ga0157380_119409162	131
1278	3300017792	Ga0163161_10070374	Ga0163161_100703742	131
1279	3300025273	Ga0209673_1051516	Ga0209673_10515162	131
1280	3300025284	Ga0209130_1013476	Ga0209130_10134763	131
1281	3300025291	Ga0209675_1000683	Ga0209675_100068321	131
1282	3300025294	Ga0209025_1131532	Ga0209025_11315322	131
1283	3300025893	Ga0207682_10045019	Ga0207682_100450193	131
1284	3300025903	Ga0207680_10602556	Ga0207680_106025561	131
1285	3300025915	Ga0207693_10704308	Ga0207693_107043081	131
1286	3300025923	Ga0207681_10386805	Ga0207681_103868052	131
1287	3300025925	Ga0207650_10051611	Ga0207650_100516114	131
1288	3300025926	Ga0207659_10111696	Ga0207659_101116963	131
1289	3300025928	Ga0207700_10000077	Ga0207700_1000007766	131
1290	3300025972	Ga0207668_10021602	Ga0207668_100216027	131
1291	3300025981	Ga0207640_10312883	Ga0207640_103128832	131
1292	3300025986	Ga0207658_10130377	Ga0207658_101303773	131
1293	3300026089	Ga0207648_10205160	Ga0207648_102051602	131
1294	3300028380	Ga0268265_10522943	Ga0268265_105229431	131
1295	3300031456	Ga0307513_10108998	Ga0307513_101089983	131
1296	3300031730	Ga0307516_10388974	Ga0307516_103889741	131
1297	3300031731	Ga0307405_10266526	Ga0307405_102665262	131
1298	3300031995	Ga0307409_100726070	Ga0307409_1007260701	131
1299	3300032002	Ga0307416_100032023	Ga0307416_1000320234	131
1300	3300032002	Ga0307416_101623026	Ga0307416_1016230261	131
1301	3300035092	Ga0373952_0138952	Ga0373952_0138952_148_546	131
1302	3300037068	Ga0373925_0019802	Ga0373925_0019802_4180_4578	131
1303	3300037466	Ga0395898_1457160	Ga0395898_1457160_110_508	131
1304	3300037471	Ga0395905_0322925	Ga0395905_0322925_322_720	131
1305	3300038443	Ga0395901_1000191	Ga0395901_1000191_130_528	131
1306	3300044673	Ga0453683_0391066	Ga0453683_0391066_352_750	131
1307	3300046472	Ga0495580_0461229	Ga0495580_0461229_191_589	131
1308	3300048925	Ga0496122_0361109	Ga0496122_0361109_160_558	131
1309	3300049129	Ga0501309_049751	Ga0501309_049751_16_414	131
1310	3300049130	Ga0501310_013085	Ga0501310_013085_542_940	131
1311	3300049130	Ga0501310_024332	Ga0501310_024332_95_493	131
1312	3300049131	Ga0501341_09323	Ga0501341_09323_219_617	131
1313	3300049528	Ga0501312_103539	Ga0501312_103539_117_515	131
1314	3300049533	Ga0501317_008485	Ga0501317_008485_68_466	131
1315	3300049535	Ga0501319_033823	Ga0501319_033823_29_430	131
1316	3300049536	Ga0501320_002513	Ga0501320_002513_27_428	131
1317	3300049537	Ga0501321_009551	Ga0501321_009551_632_1036	131
1318	3300049539	Ga0501323_015268	Ga0501323_015268_138_536	131
1319	3300049539	Ga0501323_021391	Ga0501323_021391_354_749	131
1320	3300049540	Ga0501324_021607	Ga0501324_021607_242_643	131
1321	3300049547	Ga0501331_06509	Ga0501331_06509_58_456	131
1322	3300049551	Ga0501335_019779	Ga0501335_019779_105_503	131
1323	3300049568	Ga0501031_0573958	Ga0501031_0573958_289_687	131
1324	3300049570	Ga0501033_0123561	Ga0501033_0123561_633_1031	131
1325	3300049573	Ga0501037_0297284	Ga0501037_0297284_537_935	131
1326	3300049575	Ga0501039_0734146	Ga0501039_0734146_148_546	131
1327	3300049822	Ga0501035_0820931	Ga0501035_0820931_260_658	131
1328	3300050491	nmdc:mga00v17_122010_c1	nmdc:mga00v17_122010_c1_284_682	131
1329	3300050493	nmdc:mga0k408_4374_c1	nmdc:mga0k408_4374_c1_1857_2255	131
1330	3300050493	nmdc:mga0k408_51956_c1	nmdc:mga0k408_51956_c1_94_492	131
1331	3300050511	nmdc:mga08y16_1909908_c1	nmdc:mga08y16_1909908_c1_26_424	131
1332	3300050511	nmdc:mga08y16_414182_c1	nmdc:mga08y16_414182_c1_264_662	131
1333	3300050512	nmdc:mga0n895_1196550_c1	nmdc:mga0n895_1196550_c1_74_472	131
1334	3300053729	Ga0500625_111272	Ga0500625_111272_45_440	131
1335	3300060346	Ga0587111_0049197	Ga0587111_0049197_212_610	131
1336	3300001979	JGI24740J21852_10000716	JGI24740J21852_1000071619	132
1337	3300001989	JGI24739J22299_10007473	JGI24739J22299_100074732	132
1338	3300002067	JGI24735J21928_10053916	JGI24735J21928_100539162	132
1339	3300002705	JGI25156J39149_1000085	JGI25156J39149_100008523	132
1340	3300002738	JGI25154J39366_1000112	JGI25154J39366_100011223	132
1341	3300002739	JGI25158J39367_1029465	JGI25158J39367_10294652	132
1342	3300002741	JGI25157J39369_1000109	JGI25157J39369_100010947	132
1343	3300002773	JGI25152J39213_1010337	JGI25152J39213_10103372	132
1344	3300002774	JGI25150J39212_1007029	JGI25150J39212_10070293	132
1345	3300002774	JGI25150J39212_1015771	JGI25150J39212_10157712	132
1346	3300002987	JGI25159J45721_1000105	JGI25159J45721_10001052	132
1347	3300003187	JGI25151J46595_10003596	JGI25151J46595_100035968	132
1348	3300003187	JGI25151J46595_10043484	JGI25151J46595_100434841	132
1349	3300003187	JGI25151J46595_10108902	JGI25151J46595_101089022	132
1350	3300003354	JGI25160J50197_1000204	JGI25160J50197_10002042	132
1351	3300003354	JGI25160J50197_1014365	JGI25160J50197_10143652	132
1352	3300003374	JGI25161J50226_1000036	JGI25161J50226_100003690	132
1353	3300003374	JGI25161J50226_1007514	JGI25161J50226_10075142	132
1354	3300003374	JGI25161J50226_1015965	JGI25161J50226_10159652	132
1355	3300003578	Ga0006562J51391_1076814	Ga0006562J51391_10768141	132
1356	3300003693	Ga0032354_1110879	Ga0032354_11108791	132
1357	3300003761	Ga0055535_1000874	Ga0055535_100087417	132
1358	3300003762	Ga0055542_1000003	Ga0055542_100000353	132
1359	3300003771	Ga0055526_1042006	Ga0055526_10420062	132
1360	3300003771	Ga0055526_1066652	Ga0055526_10666522	132
1361	3300003771	Ga0055526_1066856	Ga0055526_10668562	132
1362	3300003773	Ga0055537_1000615	Ga0055537_10006152	132
1363	3300003773	Ga0055537_1000800	Ga0055537_100080018	132
1364	3300003773	Ga0055537_1005335	Ga0055537_10053352	132
1365	3300003775	Ga0055524_1000145	Ga0055524_10001454	132
1366	3300003775	Ga0055524_1050814	Ga0055524_10508142	132
1367	3300003781	Ga0055536_1016731	Ga0055536_10167312	132
1368	3300003781	Ga0055536_1042517	Ga0055536_10425172	132
1369	3300003784	Ga0055534_1000565	Ga0055534_10005652	132
1370	3300003784	Ga0055534_1001443	Ga0055534_10014439	132
1371	3300003784	Ga0055534_1006286	Ga0055534_10062865	132
1372	3300003790	Ga0055528_1000762	Ga0055528_100076218	132
1373	3300003790	Ga0055528_1012584	Ga0055528_10125842	132
1374	3300003790	Ga0055528_1028583	Ga0055528_10285832	132
1375	3300003791	Ga0055530_10002021	Ga0055530_100020212	132
1376	3300003791	Ga0055530_10025615	Ga0055530_100256152	132
1377	3300003791	Ga0055530_10061355	Ga0055530_100613552	132
1378	3300003792	Ga0055540_1000137	Ga0055540_100013740	132
1379	3300003792	Ga0055540_1013421	Ga0055540_10134212	132
1380	3300003794	Ga0055531_10002851	Ga0055531_100028512	132
1381	3300003794	Ga0055531_10004613	Ga0055531_100046132	132
1382	3300003794	Ga0055531_10079012	Ga0055531_100790122	132
1383	3300004625	Ga0055543_1000157	Ga0055543_100015738	132
1384	3300005262	Ga0065165_1015803	Ga0065165_10158032	132
1385	3300005262	Ga0065165_1020181	Ga0065165_10201813	132
1386	3300005262	Ga0065165_1028476	Ga0065165_10284763	132
1387	3300005288	Ga0065714_10297130	Ga0065714_102971301	132
1388	3300005288	Ga0065714_10441357	Ga0065714_104413572	132
1389	3300005289	Ga0065704_10018258	Ga0065704_100182582	132
1390	3300005328	Ga0070676_11522016	Ga0070676_115220162	132
1391	3300005331	Ga0070670_101459431	Ga0070670_1014594311	132
1392	3300005334	Ga0068869_100085286	Ga0068869_1000852862	132
1393	3300005335	Ga0070666_10556378	Ga0070666_105563783	132
1394	3300005344	Ga0070661_100280408	Ga0070661_1002804082	132
1395	3300005353	Ga0070669_100127117	Ga0070669_1001271172	132
1396	3300005354	Ga0070675_100981130	Ga0070675_1009811303	132
1397	3300005355	Ga0070671_100857179	Ga0070671_1008571792	132
1398	3300005356	Ga0070674_100387427	Ga0070674_1003874273	132
1399	3300005364	Ga0070673_100637192	Ga0070673_1006371921	132
1400	3300005364	Ga0070673_101005268	Ga0070673_1010052682	132
1401	3300005364	Ga0070673_102407646	Ga0070673_1024076461	132
1402	3300005367	Ga0070667_100119215	Ga0070667_1001192153	132
1403	3300005367	Ga0070667_100327852	Ga0070667_1003278521	132
1404	3300005437	Ga0070710_10052959	Ga0070710_100529591	132
1405	3300005456	Ga0070678_100120070	Ga0070678_1001200702	132
1406	3300005456	Ga0070678_101027408	Ga0070678_1010274082	132
1407	3300005457	Ga0070662_100079370	Ga0070662_1000793704	132
1408	3300005459	Ga0068867_100283415	Ga0068867_1002834153	132
1409	3300005459	Ga0068867_101182597	Ga0068867_1011825971	132
1410	3300005459	Ga0068867_101731653	Ga0068867_1017316532	132
1411	3300005459	Ga0068867_101919921	Ga0068867_1019199211	132
1412	3300005466	Ga0070685_10788049	Ga0070685_107880492	132
1413	3300005467	Ga0070706_100369668	Ga0070706_1003696682	132
1414	3300005539	Ga0068853_100063561	Ga0068853_1000635614	132
1415	3300005543	Ga0070672_100041046	Ga0070672_1000410462	132
1416	3300005543	Ga0070672_100606598	Ga0070672_1006065982	132
1417	3300005543	Ga0070672_101762477	Ga0070672_1017624772	132
1418	3300005548	Ga0070665_100289454	Ga0070665_1002894542	132
1419	3300005548	Ga0070665_102521810	Ga0070665_1025218102	132
1420	3300005563	Ga0068855_100115082	Ga0068855_1001150824	132
1421	3300005564	Ga0070664_100004481	Ga0070664_10000448112	132
1422	3300005577	Ga0068857_100104299	Ga0068857_1001042994	132
1423	3300005577	Ga0068857_100171287	Ga0068857_1001712872	132
1424	3300005616	Ga0068852_100259054	Ga0068852_1002590543	132
1425	3300005834	Ga0068851_10020569	Ga0068851_100205694	132
1426	3300005843	Ga0068860_100519424	Ga0068860_1005194242	132
1427	3300005844	Ga0068862_100250316	Ga0068862_1002503162	132
1428	3300006038	Ga0075365_10035693	Ga0075365_100356932	132
1429	3300006038	Ga0075365_10048049	Ga0075365_100480494	132
1430	3300006048	Ga0075363_100083709	Ga0075363_1000837092	132
1431	3300006048	Ga0075363_100223054	Ga0075363_1002230542	132
1432	3300006051	Ga0075364_10253781	Ga0075364_102537812	132
1433	3300006051	Ga0075364_11053543	Ga0075364_110535431	132
1434	3300006058	Ga0075432_10036299	Ga0075432_100362994	132
1435	3300006178	Ga0075367_10169768	Ga0075367_101697682	132
1436	3300006178	Ga0075367_10494831	Ga0075367_104948312	132
1437	3300006186	Ga0075369_10369275	Ga0075369_103692751	132
1438	3300006195	Ga0075366_10005640	Ga0075366_100056403	132
1439	3300006195	Ga0075366_10005712	Ga0075366_100057128	132
1440	3300006195	Ga0075366_10148842	Ga0075366_101488422	132
1441	3300006237	Ga0097621_100142028	Ga0097621_1001420284	132
1442	3300006353	Ga0075370_10190644	Ga0075370_101906442	132
1443	3300006353	Ga0075370_10470926	Ga0075370_104709261	132
1444	3300006358	Ga0068871_100977504	Ga0068871_1009775042	132
1445	3300006852	Ga0075433_10697968	Ga0075433_106979682	132
1446	3300006881	Ga0068865_100696766	Ga0068865_1006967662	132
1447	3300006948	Ga0099826_10398077	Ga0099826_103980772	132
1448	3300007076	Ga0075435_100696909	Ga0075435_1006969092	132
1449	3300009036	Ga0105244_10001068	Ga0105244_100010682	132
1450	3300009148	Ga0105243_11409194	Ga0105243_114091942	132
1451	3300009176	Ga0105242_10382134	Ga0105242_103821342	132
1452	3300009545	Ga0105237_10054506	Ga0105237_100545064	132
1453	3300009551	Ga0105238_10179482	Ga0105238_101794824	132
1454	3300009553	Ga0105249_11271925	Ga0105249_112719252	132
1455	3300010375	Ga0105239_10217199	Ga0105239_102171992	132
1456	3300012502	Ga0157347_1004314	Ga0157347_10043143	132
1457	3300012505	Ga0157339_1021150	Ga0157339_10211501	132
1458	3300012513	Ga0157326_1000234	Ga0157326_100023412	132
1459	3300013102	Ga0157371_11353340	Ga0157371_113533401	132
1460	3300013104	Ga0157370_10266529	Ga0157370_102665292	132
1461	3300013105	Ga0157369_10018025	Ga0157369_100180259	132
1462	3300013297	Ga0157378_11758428	Ga0157378_117584282	132
1463	3300013306	Ga0163162_12029834	Ga0163162_120298341	132
1464	3300013307	Ga0157372_10201235	Ga0157372_102012354	132
1465	3300013308	Ga0157375_10246005	Ga0157375_102460052	132
1466	3300013308	Ga0157375_13745679	Ga0157375_137456791	132
1467	3300014497	Ga0182008_10007518	Ga0182008_100075186	132
1468	3300014497	Ga0182008_10032875	Ga0182008_100328752	132
1469	3300014497	Ga0182008_10249713	Ga0182008_102497132	132
1470	3300014969	Ga0157376_10525417	Ga0157376_105254172	132
1471	3300014969	Ga0157376_11272382	Ga0157376_112723822	132
1472	3300014969	Ga0157376_12685256	Ga0157376_126852561	132
1473	3300015261	Ga0182006_1110076	Ga0182006_11100762	132
1474	3300015262	Ga0182007_10001322	Ga0182007_1000132210	132
1475	3300015262	Ga0182007_10001550	Ga0182007_100015508	132
1476	3300015265	Ga0182005_1026496	Ga0182005_10264962	132
1477	3300015265	Ga0182005_1238534	Ga0182005_12385342	132
1478	3300015683	Ga0183362_10007	Ga0183362_1000766	132
1479	3300017792	Ga0163161_10582032	Ga0163161_105820322	132
1480	3300017792	Ga0163161_10659699	Ga0163161_106596992	132
1481	3300017792	Ga0163161_11735990	Ga0163161_117359902	132
1482	3300025206	Ga0209435_100002	Ga0209435_100002679	132
1483	3300025208	Ga0209436_111154	Ga0209436_1111542	132
1484	3300025208	Ga0209436_111782	Ga0209436_1117822	132
1485	3300025228	Ga0209672_100460	Ga0209672_1004609	132
1486	3300025229	Ga0209147_100840	Ga0209147_10084016	132
1487	3300025242	Ga0209258_100015	Ga0209258_100015171	132
1488	3300025245	Ga0207425_1001631	Ga0207425_10016313	132
1489	3300025245	Ga0207425_1006991	Ga0207425_10069915	132
1490	3300025245	Ga0207425_1013709	Ga0207425_10137092	132
1491	3300025246	Ga0209646_1000001	Ga0209646_10000012822	132
1492	3300025250	Ga0209026_1000121	Ga0209026_100012148	132
1493	3300025254	Ga0209148_1000028	Ga0209148_1000028497	132
1494	3300025256	Ga0209759_1000001	Ga0209759_10000012453	132
1495	3300025258	Ga0209129_1000049	Ga0209129_1000049176	132
1496	3300025258	Ga0209129_1000908	Ga0209129_100090817	132
1497	3300025258	Ga0209129_1001763	Ga0209129_100176311	132
1498	3300025263	Ga0209565_1000026	Ga0209565_1000026126	132
1499	3300025263	Ga0209565_1000259	Ga0209565_100025918	132
1500	3300025263	Ga0209565_1001138	Ga0209565_10011388	132
1501	3300025263	Ga0209565_1006925	Ga0209565_10069253	132
1502	3300025263	Ga0209565_1044316	Ga0209565_10443162	132
1503	3300025273	Ga0209673_1000009	Ga0209673_1000009134	132
1504	3300025273	Ga0209673_1000193	Ga0209673_100019370	132
1505	3300025273	Ga0209673_1000477	Ga0209673_100047762	132
1506	3300025273	Ga0209673_1027930	Ga0209673_10279302	132
1507	3300025284	Ga0209130_1000109	Ga0209130_100010937	132
1508	3300025284	Ga0209130_1000307	Ga0209130_100030748	132
1509	3300025291	Ga0209675_1000796	Ga0209675_10007964	132
1510	3300025291	Ga0209675_1002624	Ga0209675_100262418	132
1511	3300025291	Ga0209675_1007284	Ga0209675_10072845	132
1512	3300025291	Ga0209675_1012711	Ga0209675_10127113	132
1513	3300025291	Ga0209675_1017433	Ga0209675_10174333	132
1514	3300025292	Ga0209676_1000013	Ga0209676_1000013113	132
1515	3300025292	Ga0209676_1000137	Ga0209676_10001377	132
1516	3300025292	Ga0209676_1000903	Ga0209676_10009032	132
1517	3300025292	Ga0209676_1007174	Ga0209676_10071745	132
1518	3300025292	Ga0209676_1086093	Ga0209676_10860931	132
1519	3300025294	Ga0209025_1000707	Ga0209025_10007079	132
1520	3300025294	Ga0209025_1003616	Ga0209025_10036162	132
1521	3300025294	Ga0209025_1006489	Ga0209025_10064899	132
1522	3300025294	Ga0209025_1027283	Ga0209025_10272834	132
1523	3300025294	Ga0209025_1190070	Ga0209025_11900701	132
1524	3300025295	Ga0209564_1000243	Ga0209564_100024366	132
1525	3300025295	Ga0209564_1000387	Ga0209564_10003875	132
1526	3300025295	Ga0209564_1001368	Ga0209564_10013683	132
1527	3300025295	Ga0209564_1006136	Ga0209564_10061361	132
1528	3300025297	Ga0209758_1040184	Ga0209758_10401842	132
1529	3300025298	Ga0209050_1000008	Ga0209050_1000008113	132
1530	3300025298	Ga0209050_1000015	Ga0209050_1000015173	132
1531	3300025298	Ga0209050_1000936	Ga0209050_10009362	132
1532	3300025298	Ga0209050_1003163	Ga0209050_10031637	132
1533	3300025298	Ga0209050_1006345	Ga0209050_10063458	132
1534	3300025299	Ga0209256_1000003	Ga0209256_1000003289	132
1535	3300025302	Ga0207426_1000062	Ga0207426_100006216	132
1536	3300025302	Ga0207426_1009336	Ga0207426_10093362	132
1537	3300025303	Ga0209051_1000005	Ga0209051_1000005113	132
1538	3300025303	Ga0209051_1000010	Ga0209051_1000010173	132
1539	3300025303	Ga0209051_1000137	Ga0209051_1000137135	132
1540	3300025304	Ga0209257_1000026	Ga0209257_1000026505	132
1541	3300025304	Ga0209257_1000048	Ga0209257_1000048113	132
1542	3300025304	Ga0209257_1000205	Ga0209257_1000205138	132
1543	3300025304	Ga0209257_1006892	Ga0209257_10068929	132
1544	3300025321	Ga0207656_10019570	Ga0207656_100195703	132
1545	3300025728	Ga0207655_1000800	Ga0207655_100080010	132
1546	3300025898	Ga0207692_10025346	Ga0207692_100253462	132
1547	3300025903	Ga0207680_10430207	Ga0207680_104302072	132
1548	3300025904	Ga0207647_10076243	Ga0207647_100762432	132
1549	3300025909	Ga0207705_10593463	Ga0207705_105934631	132
1550	3300025910	Ga0207684_10231133	Ga0207684_102311332	132
1551	3300025913	Ga0207695_10278781	Ga0207695_102787813	132
1552	3300025914	Ga0207671_11051160	Ga0207671_110511601	132
1553	3300025919	Ga0207657_10130195	Ga0207657_101301954	132
1554	3300025920	Ga0207649_10111001	Ga0207649_101110014	132
1555	3300025923	Ga0207681_10027377	Ga0207681_100273775	132
1556	3300025924	Ga0207694_10064854	Ga0207694_100648541	132
1557	3300025925	Ga0207650_10730874	Ga0207650_107308741	132
1558	3300025926	Ga0207659_11116138	Ga0207659_111161381	132
1559	3300025927	Ga0207687_10375638	Ga0207687_103756382	132
1560	3300025933	Ga0207706_10018751	Ga0207706_1001875111	132
1561	3300025935	Ga0207709_10000947	Ga0207709_100009471	132
1562	3300025935	Ga0207709_10002316	Ga0207709_1000231618	132
1563	3300025937	Ga0207669_10755844	Ga0207669_107558441	132
1564	3300025940	Ga0207691_10635017	Ga0207691_106350172	132
1565	3300025941	Ga0207711_11791332	Ga0207711_117913321	132
1566	3300025942	Ga0207689_10172504	Ga0207689_101725043	132
1567	3300025945	Ga0207679_10005962	Ga0207679_100059627	132
1568	3300025961	Ga0207712_11046751	Ga0207712_110467512	132
1569	3300025972	Ga0207668_10744430	Ga0207668_107444302	132
1570	3300025981	Ga0207640_10154206	Ga0207640_101542062	132
1571	3300025986	Ga0207658_10028692	Ga0207658_100286924	132
1572	3300025986	Ga0207658_11542229	Ga0207658_115422291	132
1573	3300026023	Ga0207677_12153069	Ga0207677_121530691	132
1574	3300026035	Ga0207703_11126363	Ga0207703_111263631	132
1575	3300026041	Ga0207639_10049081	Ga0207639_100490811	132
1576	3300026078	Ga0207702_10665287	Ga0207702_106652872	132
1577	3300026088	Ga0207641_11644708	Ga0207641_116447082	132
1578	3300026089	Ga0207648_10079468	Ga0207648_100794683	132
1579	3300026089	Ga0207648_11096860	Ga0207648_110968602	132
1580	3300026089	Ga0207648_11135083	Ga0207648_111350832	132
1581	3300026116	Ga0207674_10387621	Ga0207674_103876212	132
1582	3300026116	Ga0207674_10565789	Ga0207674_105657892	132
1583	3300026121	Ga0207683_10079337	Ga0207683_100793374	132
1584	3300026121	Ga0207683_10736882	Ga0207683_107368822	132
1585	3300026121	Ga0207683_11123953	Ga0207683_111239532	132
1586	3300026121	Ga0207683_11196953	Ga0207683_111969532	132
1587	3300026121	Ga0207683_11419879	Ga0207683_114198792	132
1588	3300026121	Ga0207683_12126574	Ga0207683_121265741	132
1589	3300027666	Ga0209282_1104606	Ga0209282_11046064	132
1590	3300028379	Ga0268266_11283318	Ga0268266_112833181	132
1591	3300028379	Ga0268266_11675716	Ga0268266_116757161	132
1592	3300028381	Ga0268264_10794185	Ga0268264_107941852	132
1593	3300028794	Ga0307515_10000063	Ga0307515_1000006392	132
1594	3300028794	Ga0307515_10006150	Ga0307515_1000615032	132
1595	3300028794	Ga0307515_10823060	Ga0307515_108230602	132
1596	3300030522	Ga0307512_10110791	Ga0307512_101107913	132
1597	3300030522	Ga0307512_10422138	Ga0307512_104221382	132
1598	3300030731	Ga0316177_1174401	Ga0316177_11744012	132
1599	3300030732	Ga0316176_1043110	Ga0316176_10431104	132
1600	3300030733	Ga0314311_1156198	Ga0314311_11561984	132
1601	3300030734	Ga0316179_1076722	Ga0316179_10767224	132
1602	3300030735	Ga0316178_1027803	Ga0316178_10278037	132
1603	3300030744	Ga0316181_1052902	Ga0316181_10529022	132
1604	3300031238	Ga0265332_10000006	Ga0265332_10000006286	132
1605	3300031251	Ga0265327_10264874	Ga0265327_102648742	132
1606	3300031456	Ga0307513_10005218	Ga0307513_1000521811	132
1607	3300031456	Ga0307513_10011808	Ga0307513_100118084	132
1608	3300031456	Ga0307513_10443868	Ga0307513_104438683	132
1609	3300031548	Ga0307408_100002231	Ga0307408_1000022318	132
1610	3300031548	Ga0307408_100016647	Ga0307408_1000166475	132
1611	3300031548	Ga0307408_100419494	Ga0307408_1004194942	132
1612	3300031548	Ga0307408_100427540	Ga0307408_1004275402	132
1613	3300031649	Ga0307514_10000530	Ga0307514_1000053031	132
1614	3300031649	Ga0307514_10129952	Ga0307514_101299523	132
1615	3300031711	Ga0265314_10257738	Ga0265314_102577382	132
1616	3300031730	Ga0307516_10206285	Ga0307516_102062853	132
1617	3300031731	Ga0307405_10031144	Ga0307405_100311443	132
1618	3300031731	Ga0307405_10430756	Ga0307405_104307562	132
1619	3300031731	Ga0307405_11509476	Ga0307405_115094761	132
1620	3300031731	Ga0307405_11602925	Ga0307405_116029251	132
1621	3300031824	Ga0307413_10060458	Ga0307413_100604583	132
1622	3300031824	Ga0307413_10596095	Ga0307413_105960952	132
1623	3300031852	Ga0307410_10135366	Ga0307410_101353665	132
1624	3300031901	Ga0307406_10006158	Ga0307406_100061587	132
1625	3300031901	Ga0307406_11045835	Ga0307406_110458352	132
1626	3300031903	Ga0307407_10139229	Ga0307407_101392292	132
1627	3300031911	Ga0307412_10089695	Ga0307412_100896952	132
1628	3300031911	Ga0307412_10241980	Ga0307412_102419802	132
1629	3300031995	Ga0307409_101039428	Ga0307409_1010394282	132
1630	3300032002	Ga0307416_100358622	Ga0307416_1003586222	132
1631	3300032002	Ga0307416_100495911	Ga0307416_1004959112	132
1632	3300032002	Ga0307416_100543873	Ga0307416_1005438732	132
1633	3300032004	Ga0307414_10202265	Ga0307414_102022653	132
1634	3300032005	Ga0307411_10637374	Ga0307411_106373742	132
1635	3300033180	Ga0307510_10115446	Ga0307510_101154463	132
1636	3300035088	Ga0373940_0060841	Ga0373940_0060841_352_750	132
1637	3300035692	Ga0373935_0326616	Ga0373935_0326616_367_957	132
1638	3300035695	Ga0373927_0021991	Ga0373927_0021991_274_864	132
1639	3300035695	Ga0373927_0087426	Ga0373927_0087426_691_1209	132
1640	3300035725	Ga0373947_0509834	Ga0373947_0509834_249_758	132
1641	3300036401	Ga0373937_0583556	Ga0373937_0583556_471_1016	132
1642	3300041404	Ga0439436_0000116	Ga0439436_0000116_17211_17612	132
1643	3300041404	Ga0439436_0022736	Ga0439436_0022736_1181_1579	132
1644	3300041407	Ga0439447_065835	Ga0439447_065835_272_670	132
1645	3300041411	Ga0439466_0001083	Ga0439466_0001083_9956_10357	132
1646	3300041411	Ga0439466_0016884	Ga0439466_0016884_1639_2037	132
1647	3300041413	Ga0439465_0001025	Ga0439465_0001025_3031_3432	132
1648	3300041451	Ga0451791_1640340	Ga0451791_1640340_423_821	132
1649	3300041456	Ga0451795_0706091	Ga0451795_0706091_62_463	132
1650	3300041458	Ga0451798_0747670	Ga0451798_0747670_67_468	132
1651	3300041512	Ga0451853_2975676	Ga0451853_2975676_154_552	132
1652	3300041997	Ga0439431_0006512	Ga0439431_0006512_1853_2254	132
1653	3300041997	Ga0439431_0065538	Ga0439431_0065538_129_527	132
1654	3300042002	Ga0439442_023524	Ga0439442_023524_217_618	132
1655	3300042002	Ga0439442_068571	Ga0439442_068571_52_453	132
1656	3300042004	Ga0439445_0024394	Ga0439445_0024394_660_1061	132
1657	3300042006	Ga0439432_001484	Ga0439432_001484_7466_7867	132
1658	3300042007	Ga0439449_0002576	Ga0439449_0002576_647_1048	132
1659	3300042007	Ga0439449_0009458	Ga0439449_0009458_670_1071	132
1660	3300042010	Ga0439452_003623	Ga0439452_003623_797_1198	132
1661	3300042121	Ga0450919_003335	Ga0450919_003335_674_1072	132
1662	3300042135	Ga0450899_019122	Ga0450899_019122_224_622	132
1663	3300042144	Ga0450889_040584	Ga0450889_040584_54_452	132
1664	3300042145	Ga0450906_002101	Ga0450906_002101_1301_1699	132
1665	3300042156	Ga0439446_0263379	Ga0439446_0263379_180_578	132
1666	3300042185	Ga0450909_013399	Ga0450909_013399_718_1116	132
1667	3300042435	Ga0439434_0001991	Ga0439434_0001991_3969_4370	132
1668	3300042435	Ga0439434_0016176	Ga0439434_0016176_123_521	132
1669	3300042531	Ga0450918_000550	Ga0450918_000550_7189_7587	132
1670	3300044683	Ga0466965_0021418	Ga0466965_0021418_1600_2001	132
1671	3300044901	Ga0466960_0052178	Ga0466960_0052178_909_1310	132
1672	3300046453	Ga0495627_047086	Ga0495627_047086_138_536	132
1673	3300046462	Ga0495651_0363896	Ga0495651_0363896_493_894	132
1674	3300046472	Ga0495580_0040792	Ga0495580_0040792_1078_1587	132
1675	3300046473	Ga0495582_0675704	Ga0495582_0675704_133_534	132
1676	3300046475	Ga0495639_0014931	Ga0495639_0014931_1494_1895	132
1677	3300046507	Ga0495606_0182488	Ga0495606_0182488_688_1086	132
1678	3300046512	Ga0495610_0006839	Ga0495610_0006839_6860_7258	132
1679	3300046515	Ga0495620_0141759	Ga0495620_0141759_161_559	132
1680	3300046518	Ga0495631_0000456	Ga0495631_0000456_20483_20881	132
1681	3300046520	Ga0495637_0001023	Ga0495637_0001023_2743_3141	132
1682	3300046520	Ga0495637_0258659	Ga0495637_0258659_104_502	132
1683	3300046522	Ga0495643_0145016	Ga0495643_0145016_81_482	132
1684	3300046528	Ga0495642_0026853	Ga0495642_0026853_179_580	132
1685	3300046537	Ga0495598_0256357	Ga0495598_0256357_26_442	132
1686	3300046538	Ga0495609_0050169	Ga0495609_0050169_1244_1642	132
1687	3300046539	Ga0495621_0004363	Ga0495621_0004363_2972_3388	132
1688	3300046539	Ga0495621_0026254	Ga0495621_0026254_549_950	132
1689	3300046539	Ga0495621_0122345	Ga0495621_0122345_156_557	132
1690	3300046542	Ga0495597_0163898	Ga0495597_0163898_328_726	132
1691	3300046557	Ga0495622_0306040	Ga0495622_0306040_126_524	132
1692	3300046558	Ga0495633_0291493	Ga0495633_0291493_129_530	132
1693	3300046615	Ga0495656_0002977	Ga0495656_0002977_897_1298	132
1694	3300046616	Ga0495668_0141599	Ga0495668_0141599_314_712	132
1695	3300046660	Ga0495625_0000510	Ga0495625_0000510_55347_55745	132
1696	3300046665	Ga0495661_0124059	Ga0495661_0124059_863_1261	132
1697	3300046674	Ga0495588_0124483	Ga0495588_0124483_748_1149	132
1698	3300046675	Ga0495657_0321906	Ga0495657_0321906_454_855	132
1699	3300046678	Ga0495599_0352104	Ga0495599_0352104_129_530	132
1700	3300046683	Ga0495658_0005887	Ga0495658_0005887_4248_4646	132
1701	3300046684	Ga0495669_0245921	Ga0495669_0245921_175_576	132
1702	3300046690	Ga0495624_0686058	Ga0495624_0686058_114_512	132
1703	3300046692	Ga0495671_0012484	Ga0495671_0012484_453_851	132
1704	3300047315	Ga0495581_0403276	Ga0495581_0403276_211_612	132
1705	3300047321	Ga0495676_0006299	Ga0495676_0006299_3331_3729	132
1706	3300047472	Ga0495686_0352431	Ga0495686_0352431_292_690	132
1707	3300047673	Ga0495593_0003632	Ga0495593_0003632_3828_4226	132
1708	3300048089	Ga0495614_0001103	Ga0495614_0001103_2220_2618	132
1709	3300048904	Ga0496101_0122689	Ga0496101_0122689_132_533	132
1710	3300048905	Ga0496102_0040966	Ga0496102_0040966_2042_2443	132
1711	3300048905	Ga0496102_1518338	Ga0496102_1518338_105_503	132
1712	3300048914	Ga0496111_0362159	Ga0496111_0362159_68_469	132
1713	3300048916	Ga0496113_0303875	Ga0496113_0303875_590_991	132
1714	3300048918	Ga0496115_0698283	Ga0496115_0698283_227_628	132
1715	3300048919	Ga0496116_0205652	Ga0496116_0205652_79_477	132
1716	3300048920	Ga0496117_0044649	Ga0496117_0044649_1621_2019	132
1717	3300048920	Ga0496117_0474924	Ga0496117_0474924_113_511	132
1718	3300048920	Ga0496117_0505954	Ga0496117_0505954_170_571	132
1719	3300048922	Ga0496119_0157137	Ga0496119_0157137_313_711	132
1720	3300048923	Ga0496120_0184374	Ga0496120_0184374_95_493	132
1721	3300048924	Ga0496121_0352003	Ga0496121_0352003_240_638	132
1722	3300048925	Ga0496122_0000317	Ga0496122_0000317_4952_5353	132
1723	3300048926	Ga0496123_0000264	Ga0496123_0000264_65784_66185	132
1724	3300048926	Ga0496123_0481976	Ga0496123_0481976_74_472	132
1725	3300048927	Ga0496124_0017859	Ga0496124_0017859_301_702	132
1726	3300048927	Ga0496124_0189486	Ga0496124_0189486_1111_1509	132
1727	3300048927	Ga0496124_0260812	Ga0496124_0260812_614_1012	132
1728	3300048928	Ga0496125_0244279	Ga0496125_0244279_64_462	132
1729	3300048928	Ga0496125_0461005	Ga0496125_0461005_129_527	132
1730	3300048929	Ga0496126_0391503	Ga0496126_0391503_365_763	132
1731	3300049127	Ga0501306_043986	Ga0501306_043986_21_422	132
1732	3300049130	Ga0501310_036299	Ga0501310_036299_98_496	132
1733	3300049130	Ga0501310_085046	Ga0501310_085046_36_437	132
1734	3300049160	Ga0501304_003276	Ga0501304_003276_533_931	132
1735	3300049162	Ga0501307_006932	Ga0501307_006932_14_415	132
1736	3300049527	Ga0501311_020644	Ga0501311_020644_474_875	132
1737	3300049527	Ga0501311_053701	Ga0501311_053701_21_422	132
1738	3300049530	Ga0501314_046423	Ga0501314_046423_98_499	132
1739	3300049533	Ga0501317_007769	Ga0501317_007769_801_1199	132
1740	3300049533	Ga0501317_095528	Ga0501317_095528_14_415	132
1741	3300049534	Ga0501318_060143	Ga0501318_060143_14_415	132
1742	3300049536	Ga0501320_002470	Ga0501320_002470_26_424	132
1743	3300049536	Ga0501320_007009	Ga0501320_007009_16_417	132
1744	3300049539	Ga0501323_029080	Ga0501323_029080_277_675	132
1745	3300049539	Ga0501323_039785	Ga0501323_039785_274_672	132
1746	3300049539	Ga0501323_059772	Ga0501323_059772_89_490	132
1747	3300049541	Ga0501325_016375	Ga0501325_016375_13_414	132
1748	3300049549	Ga0501333_017156	Ga0501333_017156_13_414	132
1749	3300049551	Ga0501335_045309	Ga0501335_045309_13_414	132
1750	3300049552	Ga0501336_013620	Ga0501336_013620_266_664	132
1751	3300049553	Ga0501337_000274	Ga0501337_000274_1901_2299	132
1752	3300049653	Ga0501206_076022	Ga0501206_076022_11_409	132
1753	3300049660	Ga0501216_161072	Ga0501216_161072_16_417	132
1754	3300049663	Ga0501223_072536	Ga0501223_072536_142_540	132
1755	3300049679	Ga0501249_004353	Ga0501249_004353_2415_2813	132
1756	3300049686	Ga0501257_140665	Ga0501257_140665_104_502	132
1757	3300049705	Ga0501225_0151426	Ga0501225_0151426_118_516	132
1758	3300049758	Ga0501241_042909	Ga0501241_042909_98_496	132
1759	3300049759	Ga0501262_023857	Ga0501262_023857_119_517	132
1760	3300049763	Ga0501266_000448	Ga0501266_000448_1150_1548	132
1761	3300050489	nmdc:mga03683_25632_c1	nmdc:mga03683_25632_c1_1866_2267	132
1762	3300050489	nmdc:mga03683_412001_c1	nmdc:mga03683_412001_c1_203_604	132
1763	3300050489	nmdc:mga03683_80608_c1	nmdc:mga03683_80608_c1_199_597	132
1764	3300050489	nmdc:mga03683_87633_c1	nmdc:mga03683_87633_c1_535_936	132
1765	3300050490	nmdc:mga03n38_272416_c1	nmdc:mga03n38_272416_c1_286_687	132
1766	3300050490	nmdc:mga03n38_56084_c1	nmdc:mga03n38_56084_c1_1091_1492	132
1767	3300050491	nmdc:mga00v17_36447_c1	nmdc:mga00v17_36447_c1_2303_2701	132
1768	3300050492	nmdc:mga0yw44_10396_c1	nmdc:mga0yw44_10396_c1_3820_4218	132
1769	3300050492	nmdc:mga0yw44_714710_c1	nmdc:mga0yw44_714710_c1_261_662	132
1770	3300050493	nmdc:mga0k408_17980_c1	nmdc:mga0k408_17980_c1_3306_3707	132
1771	3300050493	nmdc:mga0k408_223643_c1	nmdc:mga0k408_223643_c1_203_601	132
1772	3300050493	nmdc:mga0k408_330443_c1	nmdc:mga0k408_330443_c1_475_876	132
1773	3300050493	nmdc:mga0k408_49325_c1	nmdc:mga0k408_49325_c1_1565_1966	132
1774	3300050493	nmdc:mga0k408_528578_c1	nmdc:mga0k408_528578_c1_83_484	132
1775	3300050494	nmdc:mga06z11_138011_c1	nmdc:mga06z11_138011_c1_665_1066	132
1776	3300050494	nmdc:mga06z11_277099_c1	nmdc:mga06z11_277099_c1_231_629	132
1777	3300050494	nmdc:mga06z11_563570_c1	nmdc:mga06z11_563570_c1_101_502	132
1778	3300050496	nmdc:mga07m45_261402_c1	nmdc:mga07m45_261402_c1_334_735	132
1779	3300050496	nmdc:mga07m45_32522_c1	nmdc:mga07m45_32522_c1_2273_2674	132
1780	3300050496	nmdc:mga07m45_9710_c1	nmdc:mga07m45_9710_c1_253_651	132
1781	3300050507	nmdc:mga05p37_22798_c1	nmdc:mga05p37_22798_c1_3221_3796	132
1782	3300050515	nmdc:mga0a205_668503_c1	nmdc:mga0a205_668503_c1_290_859	132
1783	3300053078	Ga0495612_0357416	Ga0495612_0357416_159_560	132
1784	3300053087	Ga0500643_006811	Ga0500643_006811_491_889	132
1785	3300053087	Ga0500643_145470	Ga0500643_145470_138_539	132
1786	3300053088	Ga0500644_0035516	Ga0500644_0035516_246_647	132
1787	3300053093	Ga0500651_0000298	Ga0500651_0000298_14299_14697	132
1788	3300053094	Ga0500566_0034696	Ga0500566_0034696_2066_2464	132
1789	3300053098	Ga0500650_0111121	Ga0500650_0111121_654_1055	132
1790	3300053103	Ga0500555_075386	Ga0500555_075386_384_785	132
1791	3300053108	Ga0500562_073479	Ga0500562_073479_319_717	132
1792	3300053110	Ga0500571_000095	Ga0500571_000095_6943_7341	132
1793	3300053116	Ga0500592_016919	Ga0500592_016919_365_763	132
1794	3300053117	Ga0500593_000205	Ga0500593_000205_7246_7644	132
1795	3300053117	Ga0500593_027132	Ga0500593_027132_771_1172	132
1796	3300053118	Ga0500594_0000172	Ga0500594_0000172_16082_16480	132
1797	3300053120	Ga0500597_198047	Ga0500597_198047_224_622	132
1798	3300053121	Ga0500607_001138	Ga0500607_001138_22770_23168	132
1799	3300053122	Ga0500608_268144	Ga0500608_268144_42_440	132
1800	3300053125	Ga0500618_047100	Ga0500618_047100_189_587	132
1801	3300053130	Ga0500642_0275016	Ga0500642_0275016_225_623	132
1802	3300053133	Ga0500655_002489	Ga0500655_002489_680_1078	132
1803	3300053134	Ga0500658_0060625	Ga0500658_0060625_138_536	132
1804	3300053136	Ga0500559_0148246	Ga0500559_0148246_618_1016	132
1805	3300053138	Ga0500564_168438	Ga0500564_168438_374_772	132
1806	3300053139	Ga0500568_0002630	Ga0500568_0002630_9704_10102	132
1807	3300053140	Ga0500573_0011672	Ga0500573_0011672_3929_4330	132
1808	3300053141	Ga0500574_000607	Ga0500574_000607_101_499	132
1809	3300053142	Ga0500577_0547652	Ga0500577_0547652_28_426	132
1810	3300053153	Ga0500616_0082171	Ga0500616_0082171_1103_1501	132
1811	3300053158	Ga0500627_0002287	Ga0500627_0002287_129_527	132
1812	3300053158	Ga0500627_0265783	Ga0500627_0265783_212_613	132
1813	3300053162	Ga0500638_002179	Ga0500638_002179_5654_6052	132
1814	3300053177	Ga0500636_0025507	Ga0500636_0025507_1524_1922	132
1815	3300053730	Ga0500645_000992	Ga0500645_000992_12801_13202	132
1816	3300053730	Ga0500645_001319	Ga0500645_001319_9668_10069	132
1817	3300053730	Ga0500645_021644	Ga0500645_021644_146_547	132
1818	3300053734	Ga0500565_038311	Ga0500565_038311_149_547	132
1819	3300055283	Ga0500661_003302	Ga0500661_003302_1442_1843	132
1820	3300059643	Ga0587072_008270	Ga0587072_008270_24_422	132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01196

Ribosomal_L17

Ribosomal protein L17

20

116

0.99 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5xym-assembly1.cif.gz_N	large subunit of mycobacterium smegmatis	0.9695	10	116
7sfr-assembly1.cif.gz_N	unmethylated mtb ribosome 50s with seq-9	0.969	10	116
8cvm-assembly1.cif.gz_m	cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map	0.9593	10	116
4v4p-assembly1.cif.gz_A0	crystal structure of 70s ribosome with thrs operator and trnas.	0.9538	14	117
6yxy-assembly1.cif.gz_AR	state b of the trypanosoma brucei mitoribosomal large subunit assembly intermediate	0.9486	12	115

ID	Description	Score	Start	End	Superfamily
1vt2N01	Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17	0.9805	13	115	3.90.1030.10
1vt2N01	Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17	0.9712	13	115	3.90.1030.10
1vs8N01	Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17	0.9677	13	115	3.90.1030.10
5v7qN00	Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17	0.9671	10	116	3.90.1030.10
1vs8N01	Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17	0.9587	13	115	3.90.1030.10

ID	Description	Score	Start	End	GO Terms
AF-A0A2E2TK58-F1-model_v4	50S ribosomal protein L17	1.001	23	118	GO:0003735 GO:0006412 GO:0022625
AF-A0A3B8UXI4-F1-model_v4	deleted	0.9953	22	117
AF-A0A2E0WCX0-F1-model_v4	Large ribosomal subunit protein bL17	0.993	13	116	GO:0003735 GO:0006412 GO:0022625
AF-A0A381R7A7-F1-model_v4	50S ribosomal protein L17	0.9929	20	117	GO:0003735 GO:0006412 GO:0022625
AF-C6V4F3-F1-model_v4	50S ribosomal protein L17	0.9924	22	116	GO:0003735 GO:0006412 GO:0022625

Feature Viewer

pLDDT	pTM	Quality
86.23	0.74	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F495790

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01196

Ribosomal_L17

Ribosomal protein L17

20

116

0.99

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map