F495735

General Info

Members Datasets Scaffolds Average Seq Length
1799 837 1455 264

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10056060|Ga0105247_100560602
Length 290
Sequence LIVTPGRAPARPRNDLDKKFREIPMYETTYHRASSIDEAAALFAKGSEAKFLAGGHTLLPVMKQRLASPSDVIDIGKIKDLIGVQLSGDTLVIKAATTYYDIMTNADVKKAIPAISYLTSVLGDPAVRHRGTIGGSIANNDPAADFPAALISLAATVKTNKRSIAAEDFFKGLFTTALEDGEIITEVSFPVPEKAGYAKMRHPASRFALTGVFVTKTKGGDVRVAATGASQSGVMRVSAIEAALKSNWSASAIDGVSVSAADLLSDIHGSADYRANLVKVMAQRAVQAAG

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
8 2512875024 Mesorhizobium loti R88b Isolate Nodule
9 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
10 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
11 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
12 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
13 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
14 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
15 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
16 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
17 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
18 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
19 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
20 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
21 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
22 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
23 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
24 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
25 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
26 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
27 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
28 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
29 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
30 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
31 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
32 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
33 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
34 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
35 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
36 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
37 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
38 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
39 2643221651 Afipia sp. Root123D2 Isolate Unclassified
40 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
41 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
42 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
43 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
44 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
45 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
46 2738543024 Aminobacter sp. AP02 Isolate Unclassified
47 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
48 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
49 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
50 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
51 2791355199
52 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
53 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
54 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
55 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
56 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
57 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
58 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
59 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
60 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
61 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
62 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
63 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
64 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
65 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
66 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
67 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
68 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
69 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
70 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
71 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
72 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
73 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
74 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
75 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
76 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
77 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
78 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
79 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
80 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
81 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
82 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
83 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
84 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
85 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
86 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
87 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
88 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
89 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
90 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
91 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
92 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
93 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
94 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
95 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
96 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
97 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
98 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
99 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
100 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
101 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
102 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
103 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
104 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
105 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
106 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
107 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
108 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
109 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
110 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
111 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
112 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
113 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
114 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
115 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
116 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
117 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
118 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
119 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
120 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
121 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
122 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
123 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
124 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
125 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
126 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
127 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
128 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
129 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
130 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
131 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
132 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
133 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
134 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
135 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
136 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
137 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
138 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
139 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
140 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
141 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
142 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
143 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
144 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
145 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
146 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
147 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
148 2904699407
149 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
150 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
151 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
152 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
153 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
154 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
155 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
156 2906610324
157 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
158 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
159 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
160 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
161 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
162 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
163 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
164 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
165 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
166 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
167 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
168 2922368715
169 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
170 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
171 2922425934
172 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
173 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
174 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
175 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
176 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
177 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
178 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
179 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
180 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
181 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
182 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
183 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
184 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
185 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
186 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
187 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
188 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
189 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
190 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
191 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
192 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
193 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
194 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
195 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
196 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
197 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
198 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
199 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
200 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
201 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
202 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
203 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
204 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
205 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
206 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
207 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
208 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
209 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
210 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
211 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
212 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
213 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
214 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
215 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
216 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
217 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
218 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
219 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
220 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
221 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
222 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
223 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
224 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
225 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
226 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
227 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
228 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
229 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
230 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
231 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
232 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
233 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
234 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
235 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
236 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
237 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
238 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
239 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
240 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
241 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
242 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
243 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
244 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
245 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
246 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
247 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
248 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
249 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
250 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
251 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
252 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
253 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
254 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
255 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
256 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
257 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
258 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
259 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
260 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
261 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
262 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
263 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
264 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
265 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
266 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
267 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
268 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
269 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
270 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
271 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
272 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
273 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
274 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
275 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
276 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
277 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
278 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
279 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
280 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
281 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
282 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
283 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
284 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
285 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
286 3004167301 Mesorhizobium loti 582 Isolate Unclassified
287 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
288 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
289 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
290 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
291 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
292 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
293 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
294 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
295 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
296 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
297 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
298 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
299 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
300 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
301 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
302 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
303 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
304 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
305 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
306 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
307 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
308 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
309 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
310 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
311 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
312 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
313 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
314 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
315 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
316 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
317 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
318 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
319 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
320 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
321 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
322 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
323 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
324 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
325 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
326 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
327 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
328 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
329 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
330 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
331 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
332 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
333 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
334 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
335 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
336 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
337 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
338 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
339 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
340 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
341 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
342 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
343 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
344 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
345 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
346 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
347 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
348 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
349 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
350 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
351 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
352 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
353 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
354 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
355 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
356 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
357 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
358 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
359 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
360 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
361 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
362 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
363 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
364 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
365 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
366 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
367 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
368 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
369 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
370 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
371 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
372 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
373 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
374 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
375 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
376 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
377 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
378 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
379 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
380 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
381 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
382 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
383 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
384 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
385 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
386 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
387 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
388 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
389 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
390 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
391 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
392 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
393 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
394 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
395 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
396 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
397 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
398 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
399 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
400 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
401 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
402 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
403 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
404 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
405 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
406 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
407 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
408 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
409 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
410 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
411 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
412 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
413 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
414 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
415 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
416 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
417 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
418 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
419 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
420 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
421 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
422 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
423 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
424 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
425 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
426 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
427 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
428 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
429 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
430 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
431 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
432 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
433 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
434 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
435 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
436 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
443 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
444 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
445 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
446 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
447 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
450 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
451 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
452 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
453 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
455 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
456 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
457 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
458 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
459 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
460 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
461 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
462 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
463 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
464 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
465 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
466 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
467 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
468 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
469 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
470 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
471 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
472 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
473 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
474 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
475 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
476 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
477 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
478 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
479 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
480 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
481 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
482 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
483 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
484 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
485 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
486 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
487 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
488 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
489 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
490 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
491 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
492 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
493 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
494 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
495 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
496 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
497 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
498 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
499 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
500 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
501 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
502 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
503 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
504 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
505 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
506 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
507 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
508 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
509 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
510 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
511 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
512 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
513 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
514 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
515 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
516 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
517 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
518 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
519 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
520 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
521 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
522 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
523 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
524 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
525 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
526 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
527 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
528 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
529 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
530 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
531 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
532 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
533 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
534 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
535 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
536 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
537 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
538 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
539 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
540 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
541 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
542 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
543 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
544 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
545 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
546 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
547 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
548 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
549 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
550 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
551 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
552 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
553 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
554 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
555 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
556 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
557 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
558 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
559 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
560 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
561 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
562 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
563 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
564 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
565 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
566 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
567 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
568 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
569 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
570 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
571 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
572 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
573 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
574 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
575 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
576 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
577 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
578 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
579 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
580 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
581 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
582 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
583 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
584 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
585 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
586 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
587 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
588 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
589 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
590 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
591 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
592 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
593 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
594 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
595 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
596 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
597 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
598 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
599 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
600 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
601 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
602 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
603 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
604 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
605 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
606 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
607 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
608 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
609 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
610 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
611 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
612 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
613 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
614 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
615 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
616 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
617 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
618 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
619 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
620 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
621 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
622 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
623 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
624 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
625 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
626 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
627 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
628 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
629 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
630 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
631 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
632 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
633 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
634 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
635 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
636 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
637 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
638 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
639 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
640 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
641 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
642 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
643 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
644 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
645 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
646 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
647 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
648 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
649 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
650 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
651 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
652 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
653 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
654 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
655 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
656 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
657 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
658 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
659 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
660 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
661 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
662 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
663 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
664 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
665 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
666 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
667 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
668 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
669 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
670 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
671 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
672 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
673 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
674 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
675 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
676 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
677 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
678 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
679 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
680 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
681 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
682 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
683 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
684 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
685 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
686 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
687 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
688 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
689 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
690 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
691 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
692 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
693 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
694 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
695 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
696 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
697 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
698 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
699 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
700 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
701 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
702 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
703 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
704 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
705 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
706 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
707 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
708 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
709 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
710 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
711 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
712 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
713 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
714 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
715 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
716 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
717 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
718 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
719 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
720 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
721 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
722 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
723 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
724 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
725 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
726 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
727 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
728 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
729 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
730 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
731 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
732 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
733 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
734 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
735 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
736 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
737 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
738 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
739 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
740 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
741 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
742 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
743 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
744 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
745 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
746 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
747 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
748 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
749 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
750 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
751 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
752 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
753 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
754 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
755 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
756 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
757 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
758 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
759 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
760 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
761 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
762 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
763 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
764 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
765 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
766 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
767 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
768 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
769 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
770 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
771 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
772 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
773 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
774 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
775 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
776 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
777 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
778 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
779 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
780 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
781 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
782 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
783 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
784 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
785 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
786 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
787 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
788 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
789 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
790 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
791 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
792 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
793 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
794 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
795 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
796 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
797 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
798 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
799 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
800 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
801 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
802 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
803 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
804 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
805 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
806 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
807 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
808 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
809 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
810 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
811 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
812 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
813 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
814 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
815 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
816 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
817 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
818 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
819 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
820 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
821 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
822 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
823 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
824 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
825 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
826 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
827 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
828 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
829 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
830 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
831 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
832 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
833 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
834 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
835 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
836 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
837 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.77
Metatranscriptomes 0.33
Isolates 18.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.23
Nodule 15.56
Rhizoplane 5.56
Rhizosphere 58.03
Stem 0
Stem Tuber 0
Unclassified 9.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10063256 3300001989 Bacteria 1165
2 JGI25406J46586_10000887 3300003203 Bacteria 14075
3 JGI25153J46596_10001684 3300003215 Bacteria 13110
4 JGI25153J46596_10002416 3300003215 Bacteria 10769
5 JGI25153J46596_10004047 3300003215 Bacteria 7991
6 JGI25153J46596_10050192 3300003215 Bacteria 1205
7 JGI25160J50197_1003620 3300003354 Bacteria 6863
8 JGI25160J50197_1005514 3300003354 Bacteria 5253
9 Ga0055539_1001740 3300003752 Bacteria 3789
10 Ga0055542_1001266 3300003762 Bacteria 13749
11 Ga0055531_10012840 3300003794 Bacteria 3905
12 Ga0055543_1001860 3300004625 Bacteria 7683
13 Ga0065165_1001256 3300005262 Bacteria 28720
14 Ga0065165_1005779 3300005262 Bacteria 6766
15 Ga0070658_10103957 3300005327 Bacteria 2349
16 Ga0070658_10373856 3300005327 Bacteria 1222
17 Ga0070676_10038287 3300005328 Bacteria 2769
18 Ga0070683_100006785 3300005329 Bacteria 9622
19 Ga0070683_100063089 3300005329 Bacteria 3446
20 Ga0070690_100139173 3300005330 Bacteria 1646
21 Ga0070670_100113110 3300005331 Bacteria 2340
22 Ga0070670_100448063 3300005331 Bacteria 1144
23 Ga0070677_10161434 3300005333 Bacteria 1052
24 Ga0068869_100101482 3300005334 Bacteria 2177
25 Ga0068869_100270717 3300005334 Bacteria 1363
26 Ga0068869_100548301 3300005334 Bacteria 971
27 Ga0068869_100659490 3300005334 Bacteria 889
28 Ga0070666_10210657 3300005335 Bacteria 1369
29 Ga0070680_100020920 3300005336 Bacteria 5194
30 Ga0070680_100176113 3300005336 Bacteria 1801
31 Ga0070680_100232420 3300005336 Bacteria 1557
32 Ga0070682_100076346 3300005337 Bacteria 2157
33 Ga0070682_100220559 3300005337 Bacteria 1349
34 Ga0068868_100020206 3300005338 Bacteria 5000
35 Ga0068868_100038556 3300005338 Bacteria 3710
36 Ga0070660_100016425 3300005339 Bacteria 5371
37 Ga0070660_100025110 3300005339 Bacteria 4427
38 Ga0070660_100125849 3300005339 Bacteria 2048
39 Ga0070660_100504527 3300005339 Bacteria 1007
40 Ga0070661_100004410 3300005344 Bacteria 9700
41 Ga0070661_100057292 3300005344 Bacteria 2855
42 Ga0070661_100162468 3300005344 Bacteria 1692
43 Ga0070668_100016899 3300005347 Bacteria 5457
44 Ga0070668_100035262 3300005347 Bacteria 3814
45 Ga0070668_100039201 3300005347 Bacteria 3623
46 Ga0070668_100049264 3300005347 Bacteria 3241
47 Ga0070668_100166549 3300005347 Bacteria 1791
48 Ga0070669_100165983 3300005353 Bacteria 1719
49 Ga0070675_100630142 3300005354 Bacteria 974
50 Ga0070671_100205637 3300005355 Bacteria 1670
51 Ga0070671_100230494 3300005355 Bacteria 1572
52 Ga0070674_100070086 3300005356 Bacteria 2476
53 Ga0070659_100040136 3300005366 Bacteria 3657
54 Ga0070659_100073417 3300005366 Bacteria 2723
55 Ga0070667_100203864 3300005367 Bacteria 1756
56 Ga0070667_100206712 3300005367 Bacteria 1744
57 Ga0070709_10001864 3300005434 Bacteria 11435
58 Ga0070709_10025801 3300005434 Bacteria 3474
59 Ga0070709_10050531 3300005434 Bacteria 2605
60 Ga0070709_10255161 3300005434 Bacteria 1265
61 Ga0070714_100001530 3300005435 Bacteria 16861
62 Ga0070714_100106301 3300005435 Bacteria 2479
63 Ga0070714_100259577 3300005435 Bacteria 1609
64 Ga0070714_100361708 3300005435 Bacteria 1364
65 Ga0070713_100010561 3300005436 Bacteria 6677
66 Ga0070713_100094497 3300005436 Bacteria 2578
67 Ga0070713_100375905 3300005436 Bacteria 1323
68 Ga0070713_100543274 3300005436 Bacteria 1100
69 Ga0070710_10001292 3300005437 Bacteria 11884
70 Ga0070710_10074620 3300005437 Bacteria 1964
71 Ga0070710_10128812 3300005437 Bacteria 1540
72 Ga0070710_10177177 3300005437 Bacteria 1332
73 Ga0070701_10129409 3300005438 Bacteria 1433
74 Ga0070711_100000566 3300005439 Bacteria 19333
75 Ga0070711_100011045 3300005439 Bacteria 5602
76 Ga0070711_100017968 3300005439 Bacteria 4508
77 Ga0070711_100072221 3300005439 Bacteria 2434
78 Ga0070711_100474838 3300005439 Bacteria 1027
79 Ga0070700_100377799 3300005441 Bacteria 1059
80 Ga0070694_100090188 3300005444 Bacteria 2149
81 Ga0070663_100028641 3300005455 Bacteria 3795
82 Ga0070663_100053700 3300005455 Bacteria 2877
83 Ga0070663_100064496 3300005455 Bacteria 2647
84 Ga0070663_100116012 3300005455 Bacteria 2018
85 Ga0070663_100174049 3300005455 Bacteria 1665
86 Ga0070663_100201513 3300005455 Bacteria 1553
87 Ga0070678_100194755 3300005456 Bacteria 1669
88 Ga0070678_100535655 3300005456 Bacteria 1038
89 Ga0070678_100657486 3300005456 Bacteria 941
90 Ga0070662_100314515 3300005457 Bacteria 1275
91 Ga0070662_100519827 3300005457 Bacteria 994
92 Ga0070681_10025960 3300005458 Bacteria 5889
93 Ga0070681_10037882 3300005458 Bacteria 4835
94 Ga0070681_10067612 3300005458 Bacteria 3541
95 Ga0070681_10110722 3300005458 Bacteria 2685
96 Ga0068867_100337474 3300005459 Bacteria 1254
97 Ga0070707_100410737 3300005468 Bacteria 1314
98 Ga0070698_100451188 3300005471 Bacteria 1222
99 Ga0070679_100088998 3300005530 Bacteria 3074
100 Ga0070684_100039474 3300005535 Bacteria 4060
101 Ga0070684_100043666 3300005535 Bacteria 3872
102 Ga0070684_100073039 3300005535 Bacteria 3022
103 Ga0070684_100159351 3300005535 Bacteria 2047
104 Ga0068853_100025481 3300005539 Bacteria 4963
105 Ga0068853_100145661 3300005539 Bacteria 2128
106 Ga0068853_100234307 3300005539 Bacteria 1680
107 Ga0068853_100415666 3300005539 Bacteria 1261
108 Ga0068853_100468896 3300005539 Bacteria 1186
109 Ga0070686_100209330 3300005544 Bacteria 1403
110 Ga0070695_100326559 3300005545 Bacteria 1142
111 Ga0070665_100017685 3300005548 Bacteria 7159
112 Ga0070665_100060033 3300005548 Bacteria 3812
113 Ga0070665_100069146 3300005548 Bacteria 3539
114 Ga0070665_100093763 3300005548 Bacteria 3007
115 Ga0070665_100108386 3300005548 Bacteria 2780
116 Ga0070665_100371142 3300005548 Bacteria 1438
117 Ga0070665_101015425 3300005548 Bacteria 842
118 Ga0068855_100000022 3300005563 Bacteria 190807
119 Ga0068855_100076020 3300005563 Bacteria 3898
120 Ga0068855_100260361 3300005563 Bacteria 1932
121 Ga0068855_100265765 3300005563 Bacteria 1910
122 Ga0068855_100497810 3300005563 Bacteria 1324
123 Ga0070664_100147623 3300005564 Bacteria 2075
124 Ga0068857_100136152 3300005577 Bacteria 2218
125 Ga0068857_100425486 3300005577 Bacteria 1238
126 Ga0068857_100449258 3300005577 Bacteria 1205
127 Ga0068854_100256004 3300005578 Bacteria 1400
128 Ga0068854_100346474 3300005578 Bacteria 1215
129 Ga0068856_100001018 3300005614 Bacteria 29855
130 Ga0068856_100040360 3300005614 Bacteria 4584
131 Ga0068856_100089449 3300005614 Bacteria 3062
132 Ga0068856_100213940 3300005614 Bacteria 1943
133 Ga0068856_100825474 3300005614 Bacteria 946
134 Ga0070702_100068032 3300005615 Bacteria 2095
135 Ga0070702_100102440 3300005615 Bacteria 1759
136 Ga0068852_100008561 3300005616 Bacteria 7546
137 Ga0068852_100048996 3300005616 Bacteria 3612
138 Ga0068852_100081448 3300005616 Bacteria 2873
139 Ga0068859_100177742 3300005617 Bacteria 2211
140 Ga0068859_100311569 3300005617 Bacteria 1667
141 Ga0068864_100148009 3300005618 Bacteria 2124
142 Ga0068864_100638465 3300005618 Bacteria 1036
143 Ga0068866_10161301 3300005718 Bacteria 1308
144 Ga0068861_100164249 3300005719 Bacteria 1834
145 Ga0068861_100178058 3300005719 Bacteria 1767
146 Ga0068861_100344242 3300005719 Bacteria 1305
147 Ga0068851_10017811 3300005834 Bacteria 3418
148 Ga0068851_10086532 3300005834 Bacteria 1644
149 Ga0068870_10114426 3300005840 Bacteria 1545
150 Ga0068863_100213781 3300005841 Bacteria 1857
151 Ga0068863_100223032 3300005841 Bacteria 1817
152 Ga0068858_100201435 3300005842 Bacteria 1882
153 Ga0068858_100316992 3300005842 Bacteria 1490
154 Ga0068858_100443978 3300005842 Bacteria 1250
155 Ga0068858_100681473 3300005842 Bacteria 1000
156 Ga0068860_100001721 3300005843 Bacteria 23342
157 Ga0068860_100141656 3300005843 Bacteria 2311
158 Ga0068860_100247045 3300005843 Bacteria 1737
159 Ga0068860_100251682 3300005843 Bacteria 1721
160 Ga0068860_100296194 3300005843 Bacteria 1584
161 Ga0068860_100432860 3300005843 Bacteria 1305
162 Ga0068862_100080359 3300005844 Bacteria 2827
163 Ga0068862_100252887 3300005844 Bacteria 1606
164 Ga0081455_10003561 3300005937 Bacteria 17867
165 Ga0081455_10035922 3300005937 Bacteria 4419
166 Ga0081538_10055588 3300005981 Bacteria 2328
167 Ga0081540_1005331 3300005983 Bacteria 9623
168 Ga0081540_1013508 3300005983 Bacteria 5304
169 Ga0081540_1014693 3300005983 Bacteria 5001
170 Ga0081540_1019069 3300005983 Bacteria 4185
171 Ga0081540_1028921 3300005983 Bacteria 3100
172 Ga0081540_1032545 3300005983 Bacteria 2845
173 Ga0081540_1056129 3300005983 Bacteria 1914
174 Ga0081540_1070922 3300005983 Bacteria 1612
175 Ga0081539_10000879 3300005985 Bacteria 57604
176 Ga0081539_10026237 3300005985 Bacteria 3724
177 Ga0081539_10057638 3300005985 Bacteria 2148
178 Ga0081539_10064672 3300005985 Bacteria 1989
179 Ga0070717_10006670 3300006028 Bacteria 8513
180 Ga0070717_10027722 3300006028 Bacteria 4528
181 Ga0070717_10110440 3300006028 Bacteria 2345
182 Ga0070717_10244962 3300006028 Bacteria 1582
183 Ga0070717_10273074 3300006028 Bacteria 1498
184 Ga0070717_10587822 3300006028 Bacteria 1010
185 Ga0075365_10025909 3300006038 Bacteria 3716
186 Ga0075365_10028965 3300006038 Bacteria 3534
187 Ga0075365_10035818 3300006038 Bacteria 3213
188 Ga0075365_10077522 3300006038 Bacteria 2245
189 Ga0075365_10089110 3300006038 Bacteria 2100
190 Ga0075365_10122605 3300006038 Bacteria 1794
191 Ga0075365_10172366 3300006038 Bacteria 1511
192 Ga0075365_10178126 3300006038 Bacteria 1486
193 Ga0075365_10194265 3300006038 Bacteria 1421
194 Ga0075365_10267683 3300006038 Bacteria 1202
195 Ga0075365_10298190 3300006038 Bacteria 1134
196 Ga0075365_10383647 3300006038 Bacteria 991
197 Ga0075368_10015140 3300006042 Bacteria 2856
198 Ga0075368_10018477 3300006042 Bacteria 2620
199 Ga0075368_10051186 3300006042 Bacteria 1642
200 Ga0075363_100011643 3300006048 Bacteria 4218
201 Ga0075363_100041314 3300006048 Bacteria 2432
202 Ga0075363_100102939 3300006048 Bacteria 1582
203 Ga0075364_10042860 3300006051 Bacteria 2941
204 Ga0075364_10076031 3300006051 Bacteria 2216
205 Ga0075364_10122346 3300006051 Bacteria 1742
206 Ga0075364_10139395 3300006051 Bacteria 1630
207 Ga0075364_10167290 3300006051 Bacteria 1486
208 Ga0075364_10243882 3300006051 Bacteria 1221
209 Ga0070715_10000692 3300006163 Bacteria 9042
210 Ga0070715_10056483 3300006163 Bacteria 1708
211 Ga0070715_10070033 3300006163 Bacteria 1564
212 Ga0070716_100047440 3300006173 Bacteria 2423
213 Ga0070712_100000244 3300006175 Bacteria 30649
214 Ga0070712_100002905 3300006175 Bacteria 10618
215 Ga0070712_100004751 3300006175 Bacteria 8399
216 Ga0075362_10043999 3300006177 Bacteria 1979
217 Ga0075362_10052402 3300006177 Bacteria 1829
218 Ga0075367_10024247 3300006178 Bacteria 3421
219 Ga0075367_10060079 3300006178 Bacteria 2265
220 Ga0075367_10068626 3300006178 Bacteria 2127
221 Ga0075367_10073144 3300006178 Bacteria 2064
222 Ga0075367_10078112 3300006178 Bacteria 1999
223 Ga0075367_10107392 3300006178 Bacteria 1711
224 Ga0075367_10207318 3300006178 Bacteria 1225
225 Ga0075369_10020112 3300006186 Bacteria 2732
226 Ga0075369_10044746 3300006186 Bacteria 1902
227 Ga0075366_10014528 3300006195 Bacteria 4497
228 Ga0075366_10103637 3300006195 Bacteria 1709
229 Ga0075366_10117966 3300006195 Bacteria 1598
230 Ga0075366_10244598 3300006195 Bacteria 1094
231 Ga0097621_100203993 3300006237 Bacteria 1718
232 Ga0097621_100276226 3300006237 Bacteria 1478
233 Ga0097621_100401247 3300006237 Bacteria 1227
234 Ga0075370_10029278 3300006353 Bacteria 3067
235 Ga0075370_10075364 3300006353 Bacteria 1934
236 Ga0068871_100033813 3300006358 Bacteria 4051
237 Ga0068871_100154445 3300006358 Bacteria 1959
238 Ga0075431_100355593 3300006847 Bacteria 1472
239 Ga0075434_100015658 3300006871 Bacteria 7278
240 Ga0068865_100170632 3300006881 Bacteria 1667
241 Ga0068865_100417125 3300006881 Bacteria 1103
242 Ga0075436_100152439 3300006914 Bacteria 1627
243 Ga0097620_100177750 3300006931 Bacteria 2211
244 Ga0097620_100311572 3300006931 Bacteria 1667
245 Ga0099822_1024801 3300006943 Bacteria 5314
246 Ga0075435_100193617 3300007076 Bacteria 1721
247 Ga0099794_10028369 3300007265 Bacteria 2604
248 Ga0099794_10089968 3300007265 Bacteria 1522
249 Ga0099794_10092687 3300007265 Bacteria 1500
250 Ga0099795_10034742 3300007788 Bacteria 1758
251 Ga0099795_10039452 3300007788 Bacteria 1672
252 Ga0105250_10143620 3300009092 Bacteria 990
253 Ga0105240_10000479 3300009093 Bacteria 73782
254 Ga0105240_10007458 3300009093 Bacteria 15876
255 Ga0105240_10128815 3300009093 Bacteria 3038
256 Ga0105240_10152375 3300009093 Bacteria 2752
257 Ga0105240_10655677 3300009093 Bacteria 1150
258 Ga0105240_10669412 3300009093 Bacteria 1136
259 Ga0111539_10119914 3300009094 Bacteria 3082
260 Ga0111539_10403435 3300009094 Bacteria 1592
261 Ga0105245_10027097 3300009098 Bacteria 5049
262 Ga0105245_10158408 3300009098 Bacteria 2147
263 Ga0105245_10362223 3300009098 Bacteria 1439
264 Ga0105247_10006862 3300009101 Bacteria 7016
265 Ga0105247_10054723 3300009101 Bacteria 2462
266 Ga0105247_10056060 3300009101 Bacteria 2433
267 Ga0105247_10099147 3300009101 Bacteria 1860
268 Ga0105247_10209355 3300009101 Bacteria 1314
269 Ga0105247_10229794 3300009101 Bacteria 1259
270 Ga0105247_10259585 3300009101 Bacteria 1191
271 Ga0114129_10653701 3300009147 Bacteria 1356
272 Ga0105243_10071509 3300009148 Bacteria 2805
273 Ga0105243_10221113 3300009148 Bacteria 1674
274 Ga0105241_10040448 3300009174 Bacteria 3520
275 Ga0105241_10050885 3300009174 Bacteria 3158
276 Ga0105241_10085698 3300009174 Bacteria 2476
277 Ga0105241_10206836 3300009174 Bacteria 1642
278 Ga0105241_10456516 3300009174 Bacteria 1131
279 Ga0105242_10138748 3300009176 Bacteria 2107
280 Ga0105248_10046836 3300009177 Bacteria 4848
281 Ga0105248_10057103 3300009177 Bacteria 4381
282 Ga0105248_10133843 3300009177 Bacteria 2797
283 Ga0105248_10235465 3300009177 Bacteria 2061
284 Ga0105248_10433820 3300009177 Bacteria 1480
285 Ga0105237_10019409 3300009545 Bacteria 7020
286 Ga0105237_10040511 3300009545 Bacteria 4697
287 Ga0105237_10068946 3300009545 Bacteria 3531
288 Ga0105237_10073153 3300009545 Bacteria 3420
289 Ga0105237_10138669 3300009545 Bacteria 2427
290 Ga0105237_10212444 3300009545 Bacteria 1934
291 Ga0105237_10342503 3300009545 Bacteria 1499
292 Ga0105238_10003574 3300009551 Bacteria 15496
293 Ga0105238_10078604 3300009551 Bacteria 3289
294 Ga0105238_10079172 3300009551 Bacteria 3276
295 Ga0105238_10173018 3300009551 Bacteria 2136
296 Ga0105238_10214235 3300009551 Bacteria 1902
297 Ga0105238_10469780 3300009551 Bacteria 1256
298 Ga0105238_10534798 3300009551 Bacteria 1175
299 Ga0105238_10604499 3300009551 Bacteria 1105
300 Ga0105249_10369740 3300009553 Bacteria 1457
301 Ga0099796_10039618 3300010159 Bacteria 1587
302 Ga0099796_10041721 3300010159 Bacteria 1555
303 Ga0105239_10000773 3300010375 Bacteria 45320
304 Ga0105239_10031784 3300010375 Bacteria 5800
305 Ga0105239_10073781 3300010375 Bacteria 3751
306 Ga0105239_10107432 3300010375 Bacteria 3092
307 Ga0105239_10131733 3300010375 Bacteria 2782
308 Ga0105239_10150962 3300010375 Bacteria 2593
309 Ga0105239_10250822 3300010375 Bacteria 1988
310 Ga0105239_10288295 3300010375 Bacteria 1849
311 Ga0105246_10023203 3300011119 Bacteria 4012
312 Ga0105246_10240449 3300011119 Bacteria 1431
313 Ga0105246_10459867 3300011119 Bacteria 1072
314 Ga0105246_10547430 3300011119 Bacteria 991
315 Ga0157370_10073863 3300013104 Bacteria 3217
316 Ga0157370_10166258 3300013104 Bacteria 2051
317 Ga0157370_10377581 3300013104 Bacteria 1306
318 Ga0157370_10411244 3300013104 Bacteria 1245
319 Ga0157369_10012061 3300013105 Bacteria 9815
320 Ga0157369_10037979 3300013105 Bacteria 5268
321 Ga0157369_10041713 3300013105 Bacteria 5008
322 Ga0157369_10049861 3300013105 Bacteria 4536
323 Ga0157374_10226274 3300013296 Bacteria 1837
324 Ga0157374_10440234 3300013296 Bacteria 1304
325 Ga0157378_10014732 3300013297 Bacteria 6850
326 Ga0157378_10243106 3300013297 Bacteria 1720
327 Ga0157378_10733818 3300013297 Bacteria 1009
328 Ga0157378_10883591 3300013297 Bacteria 924
329 Ga0163162_10207638 3300013306 Bacteria 2088
330 Ga0163162_10524303 3300013306 Bacteria 1314
331 Ga0157372_10523485 3300013307 Bacteria 1382
332 Ga0157372_10657929 3300013307 Bacteria 1220
333 Ga0157375_10049447 3300013308 Bacteria 4120
334 Ga0157375_10455632 3300013308 Bacteria 1445
335 Ga0163163_10062000 3300014325 Bacteria 3705
336 Ga0163163_10096893 3300014325 Bacteria 2970
337 Ga0163163_10110182 3300014325 Bacteria 2781
338 Ga0163163_10260852 3300014325 Bacteria 1784
339 Ga0163163_10477607 3300014325 Bacteria 1307
340 Ga0163163_10507350 3300014325 Bacteria 1268
341 Ga0163163_10540552 3300014325 Bacteria 1228
342 Ga0163163_10625360 3300014325 Bacteria 1140
343 Ga0157380_10073085 3300014326 Bacteria 2779
344 Ga0157380_10134433 3300014326 Bacteria 2114
345 Ga0157380_10523710 3300014326 Bacteria 1157
346 Ga0157379_10094448 3300014968 Bacteria 2683
347 Ga0157379_10102294 3300014968 Bacteria 2572
348 Ga0157376_10103182 3300014969 Bacteria 2496
349 Ga0157376_10128319 3300014969 Bacteria 2259
350 Ga0157376_10175821 3300014969 Bacteria 1953
351 Ga0157376_10671345 3300014969 Bacteria 1039
352 Ga0157376_10671697 3300014969 Bacteria 1038
353 Ga0206356_11680992 3300020070 Bacteria 1781
354 Ga0206352_10327112 3300020078 Bacteria 1135
355 Ga0206350_11175645 3300020080 Bacteria 1459
356 Ga0206353_10360498 3300020082 Bacteria 1655
357 Ga0213873_10048796 3300021358 Bacteria 1114
358 Ga0213872_10035151 3300021361 Bacteria 2292
359 Ga0213876_10000379 3300021384 Bacteria 37697
360 Ga0213876_10027975 3300021384 Bacteria 2973
361 Ga0213876_10060856 3300021384 Bacteria 1992
362 Ga0213875_10058079 3300021388 Bacteria 1812
363 Ga0213871_10012844 3300021441 Bacteria 1956
364 Ga0224712_10004314 3300022467 Bacteria 3821
365 Ga0224712_10068820 3300022467 Bacteria 1431
366 Ga0209563_100900 3300025230 Bacteria 8805
367 Ga0209677_100589 3300025253 Bacteria 19782
368 Ga0209677_100686 3300025253 Bacteria 17323
369 Ga0209148_1000192 3300025254 Bacteria 115724
370 Ga0209233_1001637 3300025261 Bacteria 8720
371 Ga0209233_1030385 3300025261 Bacteria 1273
372 Ga0209455_1000892 3300025272 Bacteria 15629
373 Ga0209455_1008942 3300025272 Bacteria 2671
374 Ga0209455_1010792 3300025272 Bacteria 2297
375 Ga0209758_1000030 3300025297 Bacteria 509217
376 Ga0209758_1000963 3300025297 Bacteria 38837
377 Ga0209758_1001374 3300025297 Bacteria 29041
378 Ga0209758_1002540 3300025297 Bacteria 18393
379 Ga0209758_1002971 3300025297 Bacteria 16255
380 Ga0209758_1006840 3300025297 Bacteria 7988
381 Ga0209758_1056005 3300025297 Bacteria 1334
382 Ga0209256_1007102 3300025299 Bacteria 5650
383 Ga0209256_1030381 3300025299 Bacteria 1493
384 Ga0207426_1001611 3300025302 Bacteria 17898
385 Ga0207426_1002230 3300025302 Bacteria 12929
386 Ga0207426_1045987 3300025302 Bacteria 1324
387 Ga0207426_1049336 3300025302 Bacteria 1260
388 Ga0209051_1040948 3300025303 Bacteria 1654
389 Ga0209257_1000778 3300025304 Bacteria 47189
390 Ga0207656_10249198 3300025321 Bacteria 870
391 Ga0207692_10001095 3300025898 Bacteria 9926
392 Ga0207692_10001486 3300025898 Bacteria 8794
393 Ga0207692_10019848 3300025898 Bacteria 3045
394 Ga0207692_10083894 3300025898 Bacteria 1711
395 Ga0207692_10150991 3300025898 Bacteria 1330
396 Ga0207692_10217558 3300025898 Bacteria 1131
397 Ga0207710_10004750 3300025900 Bacteria 5889
398 Ga0207710_10031359 3300025900 Bacteria 2324
399 Ga0207710_10049449 3300025900 Bacteria 1884
400 Ga0207710_10056106 3300025900 Bacteria 1777
401 Ga0207680_10159343 3300025903 Bacteria 1512
402 Ga0207647_10039838 3300025904 Bacteria 2962
403 Ga0207685_10006479 3300025905 Bacteria 3191
404 Ga0207699_10003048 3300025906 Bacteria 7954
405 Ga0207699_10024107 3300025906 Bacteria 3322
406 Ga0207699_10082251 3300025906 Bacteria 2000
407 Ga0207699_10101524 3300025906 Bacteria 1826
408 Ga0207645_10307664 3300025907 Bacteria 1056
409 Ga0207643_10174427 3300025908 Bacteria 1299
410 Ga0207643_10269159 3300025908 Bacteria 1054
411 Ga0207705_10046628 3300025909 Bacteria 3115
412 Ga0207684_10262757 3300025910 Bacteria 1489
413 Ga0207654_10047021 3300025911 Bacteria 2464
414 Ga0207654_10047597 3300025911 Bacteria 2451
415 Ga0207654_10182504 3300025911 Bacteria 1370
416 Ga0207654_10298750 3300025911 Bacteria 1094
417 Ga0207707_10327035 3300025912 Bacteria 1323
418 Ga0207695_10000018 3300025913 Bacteria 766611
419 Ga0207695_10000059 3300025913 Bacteria 363920
420 Ga0207671_10031638 3300025914 Bacteria 3943
421 Ga0207671_10126097 3300025914 Bacteria 1961
422 Ga0207671_10255242 3300025914 Bacteria 1379
423 Ga0207693_10000135 3300025915 Bacteria 67093
424 Ga0207693_10002846 3300025915 Bacteria 14982
425 Ga0207693_10002989 3300025915 Bacteria 14634
426 Ga0207693_10054373 3300025915 Bacteria 3141
427 Ga0207693_10328824 3300025915 Bacteria 1196
428 Ga0207663_10030130 3300025916 Bacteria 3196
429 Ga0207663_10108560 3300025916 Bacteria 1879
430 Ga0207660_10016173 3300025917 Bacteria 4935
431 Ga0207660_10128437 3300025917 Bacteria 1927
432 Ga0207657_10003421 3300025919 Bacteria 16945
433 Ga0207657_10033247 3300025919 Bacteria 4650
434 Ga0207657_10361687 3300025919 Bacteria 1144
435 Ga0207649_10078949 3300025920 Bacteria 2125
436 Ga0207652_10016392 3300025921 Bacteria 6051
437 Ga0207652_10049462 3300025921 Bacteria 3598
438 Ga0207652_10246762 3300025921 Bacteria 1610
439 Ga0207652_10496463 3300025921 Bacteria 1099
440 Ga0207646_10186796 3300025922 Bacteria 1872
441 Ga0207681_10352857 3300025923 Bacteria 1178
442 Ga0207681_10379656 3300025923 Bacteria 1137
443 Ga0207681_10500556 3300025923 Bacteria 995
444 Ga0207694_10000005 3300025924 Bacteria 823704
445 Ga0207694_10015922 3300025924 Bacteria 5674
446 Ga0207694_10219180 3300025924 Bacteria 1551
447 Ga0207694_10373878 3300025924 Bacteria 1182
448 Ga0207694_10373895 3300025924 Bacteria 1182
449 Ga0207650_10429883 3300025925 Bacteria 1096
450 Ga0207650_10458359 3300025925 Bacteria 1062
451 Ga0207659_10552773 3300025926 Bacteria 979
452 Ga0207687_10015988 3300025927 Bacteria 4923
453 Ga0207687_10053389 3300025927 Bacteria 2823
454 Ga0207687_10240022 3300025927 Bacteria 1436
455 Ga0207700_10037283 3300025928 Bacteria 3519
456 Ga0207700_10050229 3300025928 Bacteria 3107
457 Ga0207700_10165803 3300025928 Bacteria 1838
458 Ga0207700_10193122 3300025928 Bacteria 1712
459 Ga0207700_10242341 3300025928 Bacteria 1537
460 Ga0207664_10014503 3300025929 Bacteria 5694
461 Ga0207664_10143538 3300025929 Bacteria 2022
462 Ga0207644_10061040 3300025931 Bacteria 2729
463 Ga0207690_10477970 3300025932 Bacteria 1005
464 Ga0207706_10040481 3300025933 Bacteria 4130
465 Ga0207706_10152726 3300025933 Bacteria 2031
466 Ga0207706_10155994 3300025933 Bacteria 2008
467 Ga0207706_10471494 3300025933 Bacteria 1085
468 Ga0207686_10045445 3300025934 Bacteria 2702
469 Ga0207709_10043282 3300025935 Bacteria 2713
470 Ga0207669_10006847 3300025937 Bacteria 5242
471 Ga0207669_10116476 3300025937 Bacteria 1803
472 Ga0207704_10248610 3300025938 Bacteria 1333
473 Ga0207704_10348784 3300025938 Bacteria 1152
474 Ga0207665_10001253 3300025939 Bacteria 17114
475 Ga0207665_10008178 3300025939 Bacteria 6906
476 Ga0207665_10013855 3300025939 Bacteria 5302
477 Ga0207665_10069404 3300025939 Bacteria 2403
478 Ga0207665_10111687 3300025939 Bacteria 1921
479 Ga0207665_10121463 3300025939 Bacteria 1846
480 Ga0207665_10139468 3300025939 Bacteria 1727
481 Ga0207665_10532829 3300025939 Bacteria 911
482 Ga0207691_10207495 3300025940 Bacteria 1703
483 Ga0207711_10049144 3300025941 Bacteria 3610
484 Ga0207711_10123067 3300025941 Bacteria 2318
485 Ga0207711_10254340 3300025941 Bacteria 1614
486 Ga0207711_10439987 3300025941 Bacteria 1213
487 Ga0207689_10204450 3300025942 Bacteria 1631
488 Ga0207689_10649328 3300025942 Bacteria 889
489 Ga0207661_10001342 3300025944 Bacteria 16514
490 Ga0207667_10000061 3300025949 Bacteria 190818
491 Ga0207667_10023451 3300025949 Bacteria 6794
492 Ga0207667_10185997 3300025949 Bacteria 2132
493 Ga0207667_10296839 3300025949 Bacteria 1651
494 Ga0207667_10720176 3300025949 Bacteria 999
495 Ga0207651_10180529 3300025960 Bacteria 1674
496 Ga0207651_10472116 3300025960 Bacteria 1080
497 Ga0207712_10625430 3300025961 Bacteria 934
498 Ga0207668_10004124 3300025972 Bacteria 8524
499 Ga0207668_10123496 3300025972 Bacteria 1964
500 Ga0207668_10212140 3300025972 Bacteria 1549
501 Ga0207668_10228602 3300025972 Bacteria 1498
502 Ga0207640_10123629 3300025981 Bacteria 1859
503 Ga0207640_10177133 3300025981 Bacteria 1595
504 Ga0207658_10045657 3300025986 Bacteria 3195
505 Ga0207677_10022538 3300026023 Bacteria 3873
506 Ga0207677_10066679 3300026023 Bacteria 2518
507 Ga0207677_10311058 3300026023 Bacteria 1305
508 Ga0207703_10276266 3300026035 Bacteria 1524
509 Ga0207639_10001314 3300026041 Bacteria 16811
510 Ga0207639_10128686 3300026041 Bacteria 2093
511 Ga0207639_10143561 3300026041 Bacteria 1992
512 Ga0207639_10162448 3300026041 Bacteria 1883
513 Ga0207639_10215547 3300026041 Bacteria 1655
514 Ga0207639_10309103 3300026041 Bacteria 1400
515 Ga0207639_10815690 3300026041 Bacteria 870
516 Ga0207678_10049702 3300026067 Bacteria 3624
517 Ga0207678_10050540 3300026067 Bacteria 3592
518 Ga0207678_10056281 3300026067 Bacteria 3386
519 Ga0207678_10107910 3300026067 Bacteria 2375
520 Ga0207678_10108612 3300026067 Bacteria 2367
521 Ga0207678_10151225 3300026067 Bacteria 1982
522 Ga0207678_10161436 3300026067 Bacteria 1914
523 Ga0207678_10178825 3300026067 Bacteria 1811
524 Ga0207678_10269903 3300026067 Bacteria 1459
525 Ga0207708_10302338 3300026075 Bacteria 1301
526 Ga0207702_10000589 3300026078 Bacteria 40161
527 Ga0207702_10220702 3300026078 Bacteria 1766
528 Ga0207702_10561532 3300026078 Bacteria 1117
529 Ga0207702_10596651 3300026078 Bacteria 1083
530 Ga0207702_10696890 3300026078 Bacteria 1001
531 Ga0207641_10115883 3300026088 Bacteria 2383
532 Ga0207641_10494314 3300026088 Bacteria 1187
533 Ga0207648_10115297 3300026089 Bacteria 2361
534 Ga0207676_10092749 3300026095 Bacteria 2484
535 Ga0207676_10366987 3300026095 Bacteria 1336
536 Ga0207674_10005581 3300026116 Bacteria 14915
537 Ga0207674_10289944 3300026116 Bacteria 1585
538 Ga0207674_10434216 3300026116 Bacteria 1269
539 Ga0207675_100011675 3300026118 Bacteria 8214
540 Ga0207675_100258163 3300026118 Bacteria 1688
541 Ga0207675_100909768 3300026118 Bacteria 896
542 Ga0207683_10069852 3300026121 Bacteria 3102
543 Ga0207683_10087590 3300026121 Bacteria 2769
544 Ga0207683_10216350 3300026121 Bacteria 1745
545 Ga0207683_10237500 3300026121 Bacteria 1662
546 Ga0207698_10003421 3300026142 Bacteria 9550
547 Ga0207698_10075416 3300026142 Bacteria 2695
548 Ga0207698_10250937 3300026142 Bacteria 1619
549 Ga0209589_1000017 3300027357 Bacteria 215546
550 Ga0209489_100018 3300027361 Bacteria 215546
551 Ga0209700_100028 3300027363 Bacteria 215546
552 Ga0209588_1064418 3300027671 Bacteria 1184
553 Ga0209813_10036988 3300027866 Bacteria 1469
554 Ga0207428_10057863 3300027907 Bacteria 3077
555 Ga0268266_10003301 3300028379 Bacteria 16212
556 Ga0268266_10004550 3300028379 Bacteria 13252
557 Ga0268266_10009757 3300028379 Bacteria 8445
558 Ga0268266_10039193 3300028379 Bacteria 4035
559 Ga0268266_10047642 3300028379 Bacteria 3673
560 Ga0268266_10569525 3300028379 Bacteria 1086
561 Ga0268265_10068111 3300028380 Bacteria 2758
562 Ga0268265_10233380 3300028380 Bacteria 1618
563 Ga0268264_10000107 3300028381 Bacteria 209105
564 Ga0268264_10146383 3300028381 Bacteria 2113
565 Ga0268264_10223930 3300028381 Bacteria 1733
566 Ga0268264_10444787 3300028381 Bacteria 1254
567 Ga0265326_10024038 3300028558 Bacteria 1739
568 Ga0265319_1001409 3300028563 Bacteria 14410
569 Ga0265334_10001624 3300028573 Bacteria 10806
570 Ga0265318_10000199 3300028577 Bacteria 52225
571 Ga0265318_10006240 3300028577 Bacteria 5510
572 Ga0265323_10000684 3300028653 Bacteria 18453
573 Ga0265336_10000459 3300028666 Bacteria 24631
574 Ga0307517_10002574 3300028786 Bacteria 28885
575 Ga0307515_10027983 3300028794 Bacteria 9602
576 Ga0307515_10101962 3300028794 Bacteria 3458
577 Ga0307515_10318185 3300028794 Bacteria 1225
578 Ga0307515_10319947 3300028794 Bacteria 1219
579 Ga0265338_10002741 3300028800 Bacteria 25847
580 Ga0265324_10002054 3300029957 Bacteria 10690
581 Ga0307511_10024436 3300030521 Bacteria 5601
582 Ga0307511_10090887 3300030521 Bacteria 2070
583 Ga0265330_10003717 3300031235 Bacteria 7899
584 Ga0265330_10005196 3300031235 Bacteria 6510
585 Ga0265330_10080725 3300031235 Bacteria 1401
586 Ga0265332_10026658 3300031238 Bacteria 2534
587 Ga0265328_10077962 3300031239 Bacteria 1220
588 Ga0265325_10004205 3300031241 Bacteria 9143
589 Ga0265339_10000343 3300031249 Bacteria 37462
590 Ga0265339_10108519 3300031249 Bacteria 1438
591 Ga0265331_10000113 3300031250 Bacteria 105472
592 Ga0265331_10018105 3300031250 Bacteria 3659
593 Ga0265331_10024685 3300031250 Bacteria 3039
594 Ga0265316_10126412 3300031344 Bacteria 1927
595 Ga0265316_10389572 3300031344 Bacteria 1005
596 Ga0307513_10129649 3300031456 Bacteria 2470
597 Ga0307513_10157467 3300031456 Bacteria 2169
598 Ga0307509_10018509 3300031507 Bacteria 7986
599 Ga0307509_10165598 3300031507 Bacteria 2100
600 Ga0307508_10000154 3300031616 Bacteria 82824
601 Ga0307508_10020956 3300031616 Bacteria 5941
602 Ga0307508_10104174 3300031616 Bacteria 2434
603 Ga0265314_10007930 3300031711 Bacteria 9159
604 Ga0265314_10038992 3300031711 Bacteria 3427
605 Ga0265314_10167255 3300031711 Bacteria 1331
606 Ga0265342_10014987 3300031712 Bacteria 5120
607 Ga0265342_10021922 3300031712 Bacteria 4070
608 Ga0265342_10037780 3300031712 Bacteria 2943
609 Ga0307516_10005650 3300031730 Bacteria 14869
610 Ga0307516_10114257 3300031730 Bacteria 2497
611 Ga0307516_10116416 3300031730 Bacteria 2468
612 Ga0307516_10204685 3300031730 Bacteria 1691
613 Ga0307405_10215055 3300031731 Bacteria 1406
614 Ga0307406_10422755 3300031901 Bacteria 1062
615 Ga0307412_10242146 3300031911 Bacteria 1396
616 Ga0307412_10256728 3300031911 Bacteria 1360
617 Ga0307412_10417345 3300031911 Bacteria 1097
618 Ga0307412_10540795 3300031911 Bacteria 977
619 Ga0307409_100019096 3300031995 Bacteria 4630
620 Ga0307416_100404467 3300032002 Bacteria 1404
621 Ga0307416_100525870 3300032002 Bacteria 1252
622 Ga0307416_100801905 3300032002 Bacteria 1037
623 Ga0307416_100992969 3300032002 Bacteria 942
624 Ga0307411_10353908 3300032005 Bacteria 1198
625 Ga0307415_100035272 3300032126 Bacteria 3266
626 Ga0307507_10131484 3300033179 Bacteria 1956
627 Ga0307507_10286597 3300033179 Bacteria 1024
628 Ga0307510_10002191 3300033180 Bacteria 22082
629 Ga0307510_10005503 3300033180 Bacteria 15094
630 Ga0307510_10014423 3300033180 Bacteria 9354
631 Ga0307510_10205698 3300033180 Bacteria 1497
632 Ga0373934_0002927 3300035086 Bacteria 6248
633 Ga0373923_0001517 3300035111 Bacteria 6689
634 Ga0373932_0043812 3300035112 Bacteria 1303
635 Ga0373936_0003688 3300035113 Bacteria 5750
636 Ga0373945_0026797 3300035116 Bacteria 2009
637 Ga0373945_0090801 3300035116 Bacteria 1182
638 Ga0373953_0002334 3300035117 Bacteria 5712
639 Ga0373953_0020514 3300035117 Bacteria 2470
640 Ga0373953_0064608 3300035117 Bacteria 1501
641 Ga0373954_0000308 3300035118 Bacteria 17778
642 Ga0373954_0081215 3300035118 Bacteria 1549
643 Ga0373954_0188012 3300035118 Bacteria 1013
644 Ga0373956_0007091 3300035119 Bacteria 4509
645 Ga0373956_0024134 3300035119 Bacteria 2617
646 Ga0373957_0035099 3300035120 Bacteria 1861
647 Ga0373957_0084416 3300035120 Bacteria 1256
648 Ga0373957_0099505 3300035120 Bacteria 1163
649 Ga0373943_0064203 3300035170 Bacteria 1843
650 Ga0373955_0000479 3300035172 Bacteria 16897
651 Ga0373955_0013850 3300035172 Bacteria 3913
652 Ga0373955_0031548 3300035172 Bacteria 2776
653 Ga0373955_0037818 3300035172 Bacteria 2568
654 Ga0373961_0040437 3300035241 Bacteria 1344
655 Ga0373924_0001372 3300035410 Bacteria 7867
656 Ga0373924_0003769 3300035410 Bacteria 5241
657 Ga0373931_0004987 3300035691 Bacteria 6106
658 Ga0373931_0019791 3300035691 Bacteria 3363
659 Ga0373935_0000119 3300035692 Bacteria 35716
660 Ga0373927_0000965 3300035695 Bacteria 21865
661 Ga0373927_0004272 3300035695 Bacteria 10031
662 Ga0373927_0015399 3300035695 Bacteria 5054
663 Ga0373927_0023855 3300035695 Bacteria 4002
664 Ga0373927_0059057 3300035695 Bacteria 2481
665 Ga0373933_0001108 3300035724 Bacteria 16040
666 Ga0373933_0001668 3300035724 Bacteria 12910
667 Ga0373933_0100519 3300035724 Bacteria 1794
668 Ga0373947_0001785 3300035725 Bacteria 13162
669 Ga0373937_0005638 3300036401 Bacteria 10748
670 Ga0373937_0006200 3300036401 Bacteria 10300
671 Ga0373937_0125029 3300036401 Bacteria 2399
672 Ga0373937_0192146 3300036401 Bacteria 1918
673 Ga0373937_0735686 3300036401 Bacteria 934
674 Ga0373925_0022704 3300037068 Bacteria 4578
675 Ga0373925_0151490 3300037068 Bacteria 1821
676 Ga0373925_0467483 3300037068 Bacteria 1034
677 Ga0395899_0134752 3300037312 Bacteria 1761
678 Ga0395900_0000787 3300037418 Bacteria 41944
679 Ga0395900_0032409 3300037418 Bacteria 5374
680 Ga0395900_0092771 3300037418 Bacteria 3102
681 Ga0395900_0217539 3300037418 Bacteria 1927
682 Ga0395900_0267352 3300037418 Bacteria 1706
683 Ga0395900_0495410 3300037418 Bacteria 1173
684 Ga0395898_0002946 3300037466 Bacteria 19369
685 Ga0395898_0009257 3300037466 Bacteria 10358
686 Ga0395898_0022662 3300037466 Bacteria 6358
687 Ga0395898_0083383 3300037466 Bacteria 3081
688 Ga0395898_0277124 3300037466 Bacteria 1600
689 Ga0395898_0510652 3300037466 Bacteria 1143
690 Ga0395905_0003015 3300037471 Bacteria 18245
691 Ga0395905_0205532 3300037471 Bacteria 1846
692 Ga0436364_1247840 3300037853 Bacteria 1944
693 Ga0436364_1404333 3300037853 Bacteria 1162
694 Ga0436364_1512892 3300037853 Bacteria 3232
695 Ga0395901_0449065 3300038443 Bacteria 1319
696 Ga0395901_0629020 3300038443 Bacteria 1079
697 Ga0395901_0681709 3300038443 Bacteria 1027
698 Ga0436365_0121548 3300039437 Bacteria 1430
699 Ga0436365_0542778 3300039437 Bacteria 2025
700 Ga0436365_0736791 3300039437 Bacteria 1543
701 Ga0436365_0770725 3300039437 Bacteria 1557
702 Ga0436365_1093355 3300039437 Bacteria 1670
703 Ga0436365_1141460 3300039437 Bacteria 3527
704 Ga0436365_1196036 3300039437 Bacteria 119165
705 Ga0436365_1212928 3300039437 Bacteria 2044
706 Ga0436365_1773510 3300039437 Bacteria 8319
707 Ga0436365_1826856 3300039437 Bacteria 869
708 Ga0436360_0502011 3300039438 Bacteria 1286
709 Ga0436360_0799468 3300039438 Bacteria 1226
710 Ga0436360_0876230 3300039438 Bacteria 2266
711 Ga0436360_1176238 3300039438 Bacteria 1621
712 Ga0436361_0601086 3300039447 Bacteria 3100
713 Ga0436361_0628280 3300039447 Bacteria 1812
714 Ga0436363_0333985 3300039450 Bacteria 981
715 Ga0436363_1020580 3300039450 Bacteria 1547
716 Ga0436363_1114338 3300039450 Bacteria 1223
717 Ga0436363_1379096 3300039450 Bacteria 1109
718 Ga0436363_1460349 3300039450 Bacteria 10788
719 Ga0436362_0510213 3300039453 Bacteria 2827
720 Ga0436362_0990892 3300039453 Bacteria 922
721 Ga0439465_0048330 3300041413 Bacteria 1388
722 Ga0451793_0670052 3300041452 Bacteria 1726
723 Ga0451802_0602542 3300041460 Bacteria 1175
724 Ga0439458_0063069 3300042157 Bacteria 928
725 Ga0439458_0063523 3300042157 Bacteria 925
726 Ga0466969_0035525 3300044656 Bacteria 2521
727 Ga0466972_0000286 3300044658 Bacteria 31359
728 Ga0466972_0085742 3300044658 Bacteria 1497
729 Ga0466965_0023487 3300044683 Bacteria 2978
730 Ga0466966_0005407 3300044684 Bacteria 8394
731 Ga0466961_0000446 3300044693 Bacteria 26385
732 Ga0466961_0078250 3300044693 Bacteria 2095
733 Ga0466963_0435136 3300044694 Bacteria 925
734 Ga0466964_0077869 3300044706 Bacteria 1416
735 Ga0466964_0242953 3300044706 Bacteria 884
736 Ga0466968_0015129 3300044735 Bacteria 3057
737 Ga0466960_0087155 3300044901 Bacteria 1584
738 Ga0466959_0015178 3300045049 Bacteria 5610
739 Ga0466959_0049485 3300045049 Bacteria 3088
740 Ga0466967_0018622 3300045976 Bacteria 5556
741 Ga0495617_067131 3300046452 Bacteria 1181
742 Ga0495592_0001710 3300046454 Bacteria 15422
743 Ga0495592_0002892 3300046454 Bacteria 12210
744 Ga0495592_0010188 3300046454 Bacteria 7087
745 Ga0495592_0194101 3300046454 Bacteria 1374
746 Ga0495592_0273579 3300046454 Bacteria 1107
747 Ga0495603_0001895 3300046455 Bacteria 12342
748 Ga0495603_0015122 3300046455 Bacteria 4668
749 Ga0495603_0029402 3300046455 Bacteria 3313
750 Ga0495603_0077918 3300046455 Bacteria 1944
751 Ga0495603_0101825 3300046455 Bacteria 1676
752 Ga0495603_0106449 3300046455 Bacteria 1636
753 Ga0495590_0058882 3300046457 Bacteria 1344
754 Ga0495629_0000348 3300046459 Bacteria 39364
755 Ga0495629_0000353 3300046459 Bacteria 39092
756 Ga0495629_0083140 3300046459 Bacteria 2234
757 Ga0495629_0100825 3300046459 Bacteria 2015
758 Ga0495629_0150241 3300046459 Bacteria 1619
759 Ga0495638_0008632 3300046460 Bacteria 7207
760 Ga0495638_0011137 3300046460 Bacteria 6212
761 Ga0495638_0015142 3300046460 Bacteria 5186
762 Ga0495638_0215063 3300046460 Bacteria 1077
763 Ga0495638_0215336 3300046460 Bacteria 1077
764 Ga0495641_0000972 3300046461 Bacteria 24598
765 Ga0495651_0005720 3300046462 Bacteria 9474
766 Ga0495651_0009935 3300046462 Bacteria 7317
767 Ga0495651_0012448 3300046462 Bacteria 6560
768 Ga0495651_0023259 3300046462 Bacteria 4820
769 Ga0495651_0027908 3300046462 Bacteria 4400
770 Ga0495651_0080407 3300046462 Bacteria 2462
771 Ga0495651_0125451 3300046462 Bacteria 1881
772 Ga0495653_0007405 3300046463 Bacteria 8989
773 Ga0495653_0074094 3300046463 Bacteria 2538
774 Ga0495653_0147515 3300046463 Bacteria 1647
775 Ga0495653_0149706 3300046463 Bacteria 1632
776 Ga0495650_0018520 3300046471 Bacteria 3457
777 Ga0495650_0040687 3300046471 Bacteria 1993
778 Ga0495580_0001291 3300046472 Bacteria 22091
779 Ga0495580_0108232 3300046472 Bacteria 1930
780 Ga0495580_0158865 3300046472 Bacteria 1565
781 Ga0495582_0000444 3300046473 Bacteria 22534
782 Ga0495639_0000177 3300046475 Bacteria 33573
783 Ga0495639_0023674 3300046475 Bacteria 2700
784 Ga0495662_0001662 3300046476 Bacteria 11076
785 Ga0495664_0021304 3300046477 Bacteria 3744
786 Ga0495664_0108480 3300046477 Bacteria 1675
787 Ga0495585_0055573 3300046492 Bacteria 2187
788 Ga0495585_0243050 3300046492 Bacteria 901
789 Ga0495594_0000079 3300046499 Bacteria 42880
790 Ga0495583_0020315 3300046506 Bacteria 3445
791 Ga0495606_0001032 3300046507 Bacteria 40368
792 Ga0495606_0008637 3300046507 Bacteria 8800
793 Ga0495606_0036615 3300046507 Bacteria 3340
794 Ga0495606_0057292 3300046507 Bacteria 2510
795 Ga0495606_0077676 3300046507 Bacteria 2072
796 Ga0495606_0085779 3300046507 Bacteria 1947
797 Ga0495606_0089044 3300046507 Bacteria 1902
798 Ga0495608_0000368 3300046511 Bacteria 31510
799 Ga0495608_0014344 3300046511 Bacteria 5499
800 Ga0495608_0018906 3300046511 Bacteria 4748
801 Ga0495608_0145895 3300046511 Bacteria 1509
802 Ga0495610_0049526 3300046512 Bacteria 2056
803 Ga0495616_0043535 3300046513 Bacteria 2280
804 Ga0495616_0088347 3300046513 Bacteria 1471
805 Ga0495616_0095689 3300046513 Bacteria 1399
806 Ga0495616_0113313 3300046513 Bacteria 1258
807 Ga0495618_0009426 3300046514 Bacteria 5895
808 Ga0495618_0017517 3300046514 Bacteria 4394
809 Ga0495618_0240556 3300046514 Bacteria 1138
810 Ga0495620_0094294 3300046515 Bacteria 1198
811 Ga0495620_0114027 3300046515 Bacteria 1069
812 Ga0495628_0003575 3300046516 Bacteria 13912
813 Ga0495628_0062818 3300046516 Bacteria 2910
814 Ga0495628_0072261 3300046516 Bacteria 2688
815 Ga0495628_0129420 3300046516 Bacteria 1932
816 Ga0495628_0203187 3300046516 Bacteria 1492
817 Ga0495628_0225212 3300046516 Bacteria 1407
818 Ga0495628_0255532 3300046516 Bacteria 1307
819 Ga0495630_0011873 3300046517 Bacteria 6315
820 Ga0495630_0370520 3300046517 Bacteria 1097
821 Ga0495632_0076839 3300046519 Bacteria 1597
822 Ga0495632_0133454 3300046519 Bacteria 1154
823 Ga0495637_0081861 3300046520 Bacteria 1286
824 Ga0495637_0093763 3300046520 Bacteria 1181
825 Ga0495637_0102108 3300046520 Bacteria 1120
826 Ga0495643_0071487 3300046522 Bacteria 1821
827 Ga0495643_0086141 3300046522 Bacteria 1628
828 Ga0495643_0159415 3300046522 Bacteria 1111
829 Ga0495648_0001441 3300046524 Bacteria 23262
830 Ga0495648_0005545 3300046524 Bacteria 10467
831 Ga0495648_0050416 3300046524 Bacteria 2543
832 Ga0495648_0074623 3300046524 Bacteria 1953
833 Ga0495648_0093296 3300046524 Bacteria 1679
834 Ga0495666_0112566 3300046526 Bacteria 1278
835 Ga0495666_0196110 3300046526 Bacteria 929
836 Ga0495652_0003538 3300046529 Bacteria 15351
837 Ga0495652_0012642 3300046529 Bacteria 7606
838 Ga0495652_0044979 3300046529 Bacteria 3800
839 Ga0495652_0056577 3300046529 Bacteria 3330
840 Ga0495652_0216541 3300046529 Bacteria 1442
841 Ga0495652_0302334 3300046529 Bacteria 1162
842 Ga0495652_0303133 3300046529 Bacteria 1160
843 Ga0495654_0032691 3300046530 Bacteria 2636
844 Ga0495654_0046918 3300046530 Bacteria 2125
845 Ga0495665_0000570 3300046531 Bacteria 18750
846 Ga0495640_0000938 3300046533 Bacteria 22518
847 Ga0495640_0008034 3300046533 Bacteria 8288
848 Ga0495640_0029702 3300046533 Bacteria 3921
849 Ga0495640_0110666 3300046533 Bacteria 1795
850 Ga0495586_0265305 3300046535 Bacteria 981
851 Ga0495587_0004424 3300046536 Bacteria 9257
852 Ga0495587_0010725 3300046536 Bacteria 5818
853 Ga0495598_0001754 3300046537 Bacteria 4354
854 Ga0495645_0049455 3300046543 Bacteria 3062
855 Ga0495645_0137973 3300046543 Bacteria 1704
856 Ga0495645_0231641 3300046543 Bacteria 1237
857 Ga0495645_0380495 3300046543 Bacteria 903
858 Ga0495622_0000888 3300046557 Bacteria 16299
859 Ga0495622_0013293 3300046557 Bacteria 3819
860 Ga0495622_0014188 3300046557 Bacteria 3700
861 Ga0495622_0071534 3300046557 Bacteria 1600
862 Ga0495633_0083705 3300046558 Bacteria 1484
863 Ga0495633_0105571 3300046558 Bacteria 1307
864 Ga0495667_0006624 3300046559 Bacteria 7864
865 Ga0495667_0007023 3300046559 Bacteria 7640
866 Ga0495667_0315678 3300046559 Bacteria 989
867 Ga0495667_0365059 3300046559 Bacteria 911
868 Ga0495656_0001212 3300046615 Bacteria 8399
869 Ga0495656_0045656 3300046615 Bacteria 1850
870 Ga0495668_0072630 3300046616 Bacteria 1890
871 Ga0495668_0113544 3300046616 Bacteria 1481
872 Ga0495668_0174264 3300046616 Bacteria 1178
873 Ga0495668_0182158 3300046616 Bacteria 1151
874 Ga0495668_0192483 3300046616 Bacteria 1117
875 Ga0495668_0215629 3300046616 Bacteria 1051
876 Ga0495634_0000334 3300046642 Bacteria 45432
877 Ga0495634_0004641 3300046642 Bacteria 10705
878 Ga0495634_0102275 3300046642 Bacteria 1850
879 Ga0495625_0045332 3300046660 Bacteria 3179
880 Ga0495625_0101996 3300046660 Bacteria 1970
881 Ga0495625_0119561 3300046660 Bacteria 1794
882 Ga0495625_0168405 3300046660 Bacteria 1464
883 Ga0495625_0231017 3300046660 Bacteria 1208
884 Ga0495625_0317373 3300046660 Bacteria 993
885 Ga0495635_0000372 3300046663 Bacteria 28497
886 Ga0495635_0004370 3300046663 Bacteria 9787
887 Ga0495659_0007020 3300046664 Bacteria 3566
888 Ga0495659_0023775 3300046664 Bacteria 2085
889 Ga0495661_0045906 3300046665 Bacteria 2669
890 Ga0495661_0184630 3300046665 Bacteria 1103
891 Ga0495588_0038425 3300046674 Bacteria 2435
892 Ga0495588_0046186 3300046674 Bacteria 2233
893 Ga0495588_0191832 3300046674 Bacteria 1079
894 Ga0495657_0002983 3300046675 Bacteria 14012
895 Ga0495657_0006148 3300046675 Bacteria 9409
896 Ga0495657_0010390 3300046675 Bacteria 7007
897 Ga0495657_0044452 3300046675 Bacteria 3021
898 Ga0495657_0177171 3300046675 Bacteria 1310
899 Ga0495599_0009058 3300046678 Bacteria 6065
900 Ga0495599_0018187 3300046678 Bacteria 4377
901 Ga0495599_0114109 3300046678 Bacteria 1681
902 Ga0495623_0009665 3300046679 Bacteria 6261
903 Ga0495623_0014811 3300046679 Bacteria 5042
904 Ga0495646_0003761 3300046680 Bacteria 9487
905 Ga0495646_0017020 3300046680 Bacteria 4615
906 Ga0495646_0020785 3300046680 Bacteria 4151
907 Ga0495646_0040064 3300046680 Bacteria 2887
908 Ga0495647_0000312 3300046681 Bacteria 13625
909 Ga0495658_0000416 3300046683 Bacteria 23941
910 Ga0495669_0042244 3300046684 Bacteria 2026
911 Ga0495613_0010249 3300046689 Bacteria 6962
912 Ga0495613_0013379 3300046689 Bacteria 6095
913 Ga0495613_0043461 3300046689 Bacteria 3324
914 Ga0495624_0003210 3300046690 Bacteria 12180
915 Ga0495624_0117312 3300046690 Bacteria 1635
916 Ga0495624_0160495 3300046690 Bacteria 1374
917 Ga0495670_0126710 3300046691 Bacteria 1329
918 Ga0495671_0061788 3300046692 Bacteria 1847
919 Ga0495649_0071092 3300046694 Bacteria 1865
920 Ga0495649_0072661 3300046694 Bacteria 1844
921 Ga0495589_0049818 3300046794 Bacteria 2073
922 Ga0495589_0055679 3300046794 Bacteria 1948
923 Ga0495589_0069750 3300046794 Bacteria 1719
924 Ga0495589_0091870 3300046794 Bacteria 1474
925 Ga0495600_0001217 3300046809 Bacteria 14087
926 Ga0495600_0004048 3300046809 Bacteria 8715
927 Ga0495600_0008584 3300046809 Bacteria 6283
928 Ga0495600_0051602 3300046809 Bacteria 2685
929 Ga0495600_0116656 3300046809 Bacteria 1738
930 Ga0495660_0049733 3300046810 Bacteria 2287
931 Ga0495660_0095371 3300046810 Bacteria 1539
932 Ga0495581_0000426 3300047315 Bacteria 21399
933 Ga0495581_0090963 3300047315 Bacteria 1770
934 Ga0495604_0005876 3300047317 Bacteria 9727
935 Ga0495604_0010461 3300047317 Bacteria 7352
936 Ga0495604_0012415 3300047317 Bacteria 6772
937 Ga0495604_0189193 3300047317 Bacteria 1435
938 Ga0495636_0087362 3300047318 Bacteria 1350
939 Ga0495674_0000533 3300047319 Bacteria 35160
940 Ga0495674_0019041 3300047319 Bacteria 6382
941 Ga0495674_0024836 3300047319 Bacteria 5501
942 Ga0495674_0212285 3300047319 Bacteria 1603
943 Ga0495672_0089178 3300047320 Bacteria 1698
944 Ga0495676_0056269 3300047321 Bacteria 3111
945 Ga0495676_0073567 3300047321 Bacteria 2620
946 Ga0495676_0195066 3300047321 Bacteria 1410
947 Ga0495680_0002856 3300047322 Bacteria 17361
948 Ga0495680_0007925 3300047322 Bacteria 9687
949 Ga0495680_0176521 3300047322 Bacteria 1544
950 Ga0495683_0067062 3300047323 Bacteria 1767
951 Ga0495675_0003518 3300047444 Bacteria 9440
952 Ga0495675_0031592 3300047444 Bacteria 3380
953 Ga0495675_0044666 3300047444 Bacteria 2823
954 Ga0495679_037220 3300047446 Bacteria 1532
955 Ga0495685_027462 3300047447 Bacteria 1958
956 Ga0495673_0019403 3300047469 Bacteria 3407
957 Ga0495673_0123858 3300047469 Bacteria 1021
958 Ga0495673_0137047 3300047469 Bacteria 957
959 Ga0495684_0001014 3300047471 Bacteria 22867
960 Ga0495684_0057861 3300047471 Bacteria 2954
961 Ga0495684_0131923 3300047471 Bacteria 1876
962 Ga0495686_0028879 3300047472 Bacteria 3610
963 Ga0495686_0091427 3300047472 Bacteria 1847
964 Ga0495686_0198465 3300047472 Bacteria 1153
965 Ga0495686_0205040 3300047472 Bacteria 1129
966 Ga0495593_0023687 3300047673 Bacteria 3409
967 Ga0495593_0031577 3300047673 Bacteria 2892
968 Ga0495593_0038062 3300047673 Bacteria 2599
969 Ga0495593_0156747 3300047673 Bacteria 1150
970 Ga0495602_0005816 3300048088 Bacteria 12942
971 Ga0495602_0010096 3300048088 Bacteria 9800
972 Ga0495602_0226127 3300048088 Bacteria 1409
973 Ga0495614_0094922 3300048089 Bacteria 1300
974 Ga0495626_0017165 3300048091 Bacteria 3662
975 Ga0495626_0101206 3300048091 Bacteria 1256
976 Ga0496100_0045272 3300048903 Bacteria 2823
977 Ga0496100_0144631 3300048903 Bacteria 1689
978 Ga0496100_0176930 3300048903 Bacteria 1541
979 Ga0496100_0211300 3300048903 Bacteria 1419
980 Ga0496100_0222780 3300048903 Bacteria 1385
981 Ga0496100_0292123 3300048903 Bacteria 1218
982 Ga0496101_0003771 3300048904 Bacteria 9467
983 Ga0496101_0037613 3300048904 Bacteria 3434
984 Ga0496101_0162728 3300048904 Bacteria 1712
985 Ga0496101_0193428 3300048904 Bacteria 1570
986 Ga0496101_0204479 3300048904 Bacteria 1528
987 Ga0496101_0312036 3300048904 Bacteria 1233
988 Ga0496101_0445982 3300048904 Bacteria 1021
989 Ga0496101_0501068 3300048904 Bacteria 959
990 Ga0496102_0005218 3300048905 Bacteria 11031
991 Ga0496102_0076419 3300048905 Bacteria 3081
992 Ga0496102_0104817 3300048905 Bacteria 2630
993 Ga0496102_0137316 3300048905 Bacteria 2291
994 Ga0496102_0434489 3300048905 Bacteria 1232
995 Ga0496102_0474123 3300048905 Bacteria 1173
996 Ga0496102_0630675 3300048905 Bacteria 995
997 Ga0496103_0001945 3300048906 Bacteria 13352
998 Ga0496103_0010723 3300048906 Bacteria 5422
999 Ga0496103_0069056 3300048906 Bacteria 2209
1000 Ga0496104_0016231 3300048907 Bacteria 6762
1001 Ga0496104_0022194 3300048907 Bacteria 5830
1002 Ga0496104_0067394 3300048907 Bacteria 3400
1003 Ga0496104_0098594 3300048907 Bacteria 2797
1004 Ga0496104_0403460 3300048907 Bacteria 1279
1005 Ga0496105_0009741 3300048908 Bacteria 7524
1006 Ga0496105_0019070 3300048908 Bacteria 5528
1007 Ga0496105_0029405 3300048908 Bacteria 4498
1008 Ga0496105_0051296 3300048908 Bacteria 3408
1009 Ga0496105_0060520 3300048908 Bacteria 3125
1010 Ga0496105_0476983 3300048908 Bacteria 982
1011 Ga0496106_0029624 3300048909 Bacteria 4081
1012 Ga0496106_0039923 3300048909 Bacteria 3514
1013 Ga0496106_0117779 3300048909 Bacteria 2073
1014 Ga0496106_0217351 3300048909 Bacteria 1523
1015 Ga0496107_0003550 3300048910 Bacteria 10446
1016 Ga0496107_0035584 3300048910 Bacteria 3570
1017 Ga0496107_0201826 3300048910 Bacteria 1478
1018 Ga0496107_0390940 3300048910 Bacteria 1034
1019 Ga0496108_0002351 3300048911 Bacteria 15142
1020 Ga0496108_0010972 3300048911 Bacteria 7358
1021 Ga0496108_0022679 3300048911 Bacteria 5163
1022 Ga0496108_0183373 3300048911 Bacteria 1813
1023 Ga0496109_0002582 3300048912 Bacteria 15166
1024 Ga0496109_0011126 3300048912 Bacteria 7717
1025 Ga0496109_0073228 3300048912 Bacteria 3148
1026 Ga0496109_0093698 3300048912 Bacteria 2779
1027 Ga0496109_0479465 3300048912 Bacteria 1174
1028 Ga0496109_0703062 3300048912 Bacteria 948
1029 Ga0496110_0007857 3300048913 Bacteria 8545
1030 Ga0496110_0068203 3300048913 Bacteria 3148
1031 Ga0496110_0163439 3300048913 Bacteria 2018
1032 Ga0496110_0208301 3300048913 Bacteria 1777
1033 Ga0496110_0222916 3300048913 Bacteria 1715
1034 Ga0496110_0277699 3300048913 Bacteria 1525
1035 Ga0496110_0410559 3300048913 Bacteria 1234
1036 Ga0496110_0516382 3300048913 Bacteria 1087
1037 Ga0496111_0091112 3300048914 Bacteria 2234
1038 Ga0496111_0104226 3300048914 Bacteria 2086
1039 Ga0496111_0158134 3300048914 Bacteria 1682
1040 Ga0496111_0249749 3300048914 Bacteria 1317
1041 Ga0496111_0317480 3300048914 Bacteria 1154
1042 Ga0496112_0008401 3300048915 Bacteria 9247
1043 Ga0496112_0036493 3300048915 Bacteria 4796
1044 Ga0496112_0056475 3300048915 Bacteria 3863
1045 Ga0496112_0120660 3300048915 Bacteria 2591
1046 Ga0496112_0158316 3300048915 Bacteria 2231
1047 Ga0496112_0188637 3300048915 Bacteria 2024
1048 Ga0496112_0590938 3300048915 Bacteria 1042
1049 Ga0496113_0006395 3300048916 Bacteria 7460
1050 Ga0496113_0012289 3300048916 Bacteria 5750
1051 Ga0496113_0228856 3300048916 Bacteria 1482
1052 Ga0496113_0254832 3300048916 Bacteria 1401
1053 Ga0496113_0403519 3300048916 Bacteria 1097
1054 Ga0496113_0605397 3300048916 Bacteria 877
1055 Ga0496114_0030213 3300048917 Bacteria 4457
1056 Ga0496114_0075310 3300048917 Bacteria 2842
1057 Ga0496114_0080809 3300048917 Bacteria 2745
1058 Ga0496114_0310384 3300048917 Bacteria 1393
1059 Ga0496114_0631560 3300048917 Bacteria 943
1060 Ga0496114_0634809 3300048917 Bacteria 940
1061 Ga0496115_0002700 3300048918 Bacteria 12739
1062 Ga0496115_0006372 3300048918 Bacteria 8646
1063 Ga0496115_0060457 3300048918 Bacteria 3053
1064 Ga0496115_0095775 3300048918 Bacteria 2430
1065 Ga0496115_0132409 3300048918 Bacteria 2055
1066 Ga0496115_0178984 3300048918 Bacteria 1753
1067 Ga0496115_0205941 3300048918 Bacteria 1625
1068 Ga0496115_0209551 3300048918 Bacteria 1610
1069 Ga0496115_0238443 3300048918 Bacteria 1499
1070 Ga0496115_0574503 3300048918 Bacteria 899
1071 Ga0496116_0059189 3300048919 Bacteria 2493
1072 Ga0496116_0076972 3300048919 Bacteria 2087
1073 Ga0496116_0226840 3300048919 Bacteria 951
1074 Ga0496117_0059700 3300048920 Bacteria 2632
1075 Ga0496117_0067197 3300048920 Bacteria 2427
1076 Ga0496117_0134776 3300048920 Bacteria 1490
1077 Ga0496117_0226708 3300048920 Bacteria 1036
1078 Ga0496118_0042278 3300048921 Bacteria 3597
1079 Ga0496118_0093947 3300048921 Bacteria 2052
1080 Ga0496118_0136708 3300048921 Bacteria 1562
1081 Ga0496118_0168951 3300048921 Bacteria 1339
1082 Ga0496118_0252008 3300048921 Bacteria 1003
1083 Ga0496119_0033766 3300048922 Bacteria 3385
1084 Ga0496119_0064740 3300048922 Bacteria 2169
1085 Ga0496119_0064916 3300048922 Bacteria 2165
1086 Ga0496119_0074470 3300048922 Bacteria 1977
1087 Ga0496120_0113877 3300048923 Bacteria 1409
1088 Ga0496120_0149659 3300048923 Bacteria 1175
1089 Ga0496120_0218679 3300048923 Bacteria 911
1090 Ga0496121_0006526 3300048924 Bacteria 14422
1091 Ga0496121_0017298 3300048924 Bacteria 7374
1092 Ga0496121_0020252 3300048924 Bacteria 6596
1093 Ga0496121_0024943 3300048924 Bacteria 5696
1094 Ga0496121_0026087 3300048924 Bacteria 5521
1095 Ga0496121_0054436 3300048924 Bacteria 3343
1096 Ga0496121_0069583 3300048924 Bacteria 2839
1097 Ga0496121_0074527 3300048924 Bacteria 2714
1098 Ga0496121_0125803 3300048924 Bacteria 1927
1099 Ga0496121_0234124 3300048924 Bacteria 1284
1100 Ga0496122_0051864 3300048925 Bacteria 3111
1101 Ga0496122_0088550 3300048925 Bacteria 2121
1102 Ga0496123_0016690 3300048926 Bacteria 5946
1103 Ga0496123_0156129 3300048926 Bacteria 1223
1104 Ga0496124_0084967 3300048927 Bacteria 2594
1105 Ga0496124_0140856 3300048927 Bacteria 1903
1106 Ga0496124_0143720 3300048927 Bacteria 1880
1107 Ga0496124_0234720 3300048927 Bacteria 1368
1108 Ga0496124_0373275 3300048927 Bacteria 1000
1109 Ga0496125_0000420 3300048928 Bacteria 78930
1110 Ga0496125_0001161 3300048928 Bacteria 39899
1111 Ga0496125_0005151 3300048928 Bacteria 14703
1112 Ga0496125_0037965 3300048928 Bacteria 4179
1113 Ga0496125_0046816 3300048928 Bacteria 3624
1114 Ga0496125_0051090 3300048928 Bacteria 3413
1115 Ga0496125_0056665 3300048928 Bacteria 3181
1116 Ga0496125_0150380 3300048928 Bacteria 1600
1117 Ga0496125_0177519 3300048928 Bacteria 1423
1118 Ga0496125_0253585 3300048928 Bacteria 1108
1119 Ga0496126_0003575 3300048929 Bacteria 19498
1120 Ga0496126_0007151 3300048929 Bacteria 12291
1121 Ga0496126_0017087 3300048929 Bacteria 7235
1122 Ga0496126_0036374 3300048929 Bacteria 4604
1123 Ga0496126_0037272 3300048929 Bacteria 4539
1124 Ga0496126_0048345 3300048929 Bacteria 3888
1125 Ga0496126_0099199 3300048929 Bacteria 2551
1126 Ga0496126_0143226 3300048929 Bacteria 2055
1127 Ga0496126_0147360 3300048929 Bacteria 2020
1128 Ga0496126_0155251 3300048929 Bacteria 1959
1129 Ga0496126_0190877 3300048929 Bacteria 1735
1130 Ga0496126_0205744 3300048929 Bacteria 1659
1131 Ga0496126_0206431 3300048929 Bacteria 1656
1132 Ga0496126_0287714 3300048929 Bacteria 1360
1133 Ga0496126_0317197 3300048929 Bacteria 1282
1134 Ga0496126_0327722 3300048929 Bacteria 1257
1135 Ga0496126_0463799 3300048929 Bacteria 1017
1136 Ga0496126_0533885 3300048929 Bacteria 933
1137 Ga0495682_0003694 3300049460 Bacteria 6742
1138 Ga0495682_0019787 3300049460 Bacteria 2529
1139 Ga0495682_0025931 3300049460 Bacteria 2179
1140 Ga0501031_0002387 3300049568 Bacteria 11928
1141 Ga0501031_0002483 3300049568 Bacteria 11770
1142 Ga0501031_0027736 3300049568 Bacteria 3691
1143 Ga0501031_0055697 3300049568 Bacteria 2576
1144 Ga0501031_0257568 3300049568 Bacteria 1134
1145 Ga0501032_0000009 3300049569 Bacteria 228107
1146 Ga0501032_0000227 3300049569 Bacteria 46864
1147 Ga0501032_0000318 3300049569 Bacteria 40445
1148 Ga0501033_0000019 3300049570 Bacteria 204699
1149 Ga0501033_0000443 3300049570 Bacteria 39616
1150 Ga0501033_0004766 3300049570 Bacteria 10838
1151 Ga0501033_0008200 3300049570 Bacteria 8091
1152 Ga0501033_0052402 3300049570 Bacteria 3025
1153 Ga0501033_0361659 3300049570 Bacteria 1015
1154 Ga0501033_0504559 3300049570 Bacteria 837
1155 Ga0501034_0000044 3300049571 Bacteria 227982
1156 Ga0501034_0000061 3300049571 Bacteria 195178
1157 Ga0501034_0000100 3300049571 Bacteria 159536
1158 Ga0501034_0028765 3300049571 Bacteria 5654
1159 Ga0501034_0068429 3300049571 Bacteria 3561
1160 Ga0501034_0069622 3300049571 Bacteria 3529
1161 Ga0501034_0072553 3300049571 Bacteria 3451
1162 Ga0501034_0101777 3300049571 Bacteria 2866
1163 Ga0501034_0180456 3300049571 Bacteria 2076
1164 Ga0501034_0181193 3300049571 Bacteria 2071
1165 Ga0501034_0253526 3300049571 Bacteria 1704
1166 Ga0501036_0000008 3300049572 Bacteria 228106
1167 Ga0501036_0000010 3300049572 Bacteria 163304
1168 Ga0501036_0000387 3300049572 Bacteria 31150
1169 Ga0501036_0020290 3300049572 Bacteria 5582
1170 Ga0501036_0061705 3300049572 Bacteria 3175
1171 Ga0501036_0099029 3300049572 Bacteria 2465
1172 Ga0501036_0175906 3300049572 Bacteria 1802
1173 Ga0501036_0282657 3300049572 Bacteria 1388
1174 Ga0501036_0321690 3300049572 Bacteria 1292
1175 Ga0501037_0000055 3300049573 Bacteria 109790
1176 Ga0501037_0000104 3300049573 Bacteria 80204
1177 Ga0501037_0000183 3300049573 Bacteria 57879
1178 Ga0501037_0005109 3300049573 Bacteria 9545
1179 Ga0501037_0026956 3300049573 Bacteria 4245
1180 Ga0501037_0064315 3300049573 Bacteria 2673
1181 Ga0501037_0080211 3300049573 Bacteria 2368
1182 Ga0501037_0088726 3300049573 Bacteria 2238
1183 Ga0501037_0145197 3300049573 Bacteria 1697
1184 Ga0501037_0387866 3300049573 Bacteria 959
1185 Ga0501038_0000006 3300049574 Bacteria 228107
1186 Ga0501038_0000054 3300049574 Bacteria 94123
1187 Ga0501038_0000340 3300049574 Bacteria 40348
1188 Ga0501038_0008634 3300049574 Bacteria 9354
1189 Ga0501038_0009130 3300049574 Bacteria 9096
1190 Ga0501038_0029904 3300049574 Bacteria 4824
1191 Ga0501038_0068147 3300049574 Bacteria 3025
1192 Ga0501038_0093188 3300049574 Bacteria 2521
1193 Ga0501038_0093901 3300049574 Bacteria 2508
1194 Ga0501038_0102772 3300049574 Bacteria 2377
1195 Ga0501038_0189131 3300049574 Bacteria 1657
1196 Ga0501039_0000014 3300049575 Bacteria 228107
1197 Ga0501039_0000110 3300049575 Bacteria 55320
1198 Ga0501039_0000536 3300049575 Bacteria 27529
1199 Ga0501039_0034134 3300049575 Bacteria 3925
1200 Ga0501039_0186159 3300049575 Bacteria 1633
1201 Ga0501039_0220437 3300049575 Bacteria 1491
1202 Ga0501039_0319562 3300049575 Bacteria 1220
1203 Ga0501039_0505866 3300049575 Bacteria 949
1204 Ga0501040_0016098 3300049576 Bacteria 4945
1205 Ga0501040_0034810 3300049576 Bacteria 3412
1206 Ga0501041_0106141 3300049577 Bacteria 1741
1207 Ga0501042_0029189 3300049578 Bacteria 3889
1208 Ga0501043_0000106 3300049579 Bacteria 77699
1209 Ga0501043_0000161 3300049579 Bacteria 60738
1210 Ga0501043_0001366 3300049579 Bacteria 21372
1211 Ga0501043_0015830 3300049579 Bacteria 5911
1212 Ga0501043_0038102 3300049579 Bacteria 3780
1213 Ga0501043_0119062 3300049579 Bacteria 2071
1214 Ga0501043_0176682 3300049579 Bacteria 1664
1215 Ga0501043_0209758 3300049579 Bacteria 1510
1216 Ga0501043_0292380 3300049579 Bacteria 1247
1217 Ga0501046_0001107 3300049580 Bacteria 26302
1218 Ga0501046_0005134 3300049580 Bacteria 11738
1219 Ga0501046_0012683 3300049580 Bacteria 7166
1220 Ga0501046_0122368 3300049580 Bacteria 1979
1221 Ga0501046_0185983 3300049580 Bacteria 1551
1222 Ga0501047_0000122 3300049581 Bacteria 95307
1223 Ga0501047_0000702 3300049581 Bacteria 34900
1224 Ga0501047_0001105 3300049581 Bacteria 26770
1225 Ga0501047_0032928 3300049581 Bacteria 5004
1226 Ga0501047_0047128 3300049581 Bacteria 4164
1227 Ga0501047_0051165 3300049581 Bacteria 3990
1228 Ga0501047_0085334 3300049581 Bacteria 3033
1229 Ga0501047_0137596 3300049581 Bacteria 2322
1230 Ga0501047_0311940 3300049581 Bacteria 1413
1231 Ga0501047_0367503 3300049581 Bacteria 1274
1232 Ga0501048_0000060 3300049582 Bacteria 54898
1233 Ga0501048_0000456 3300049582 Bacteria 28577
1234 Ga0501048_0031383 3300049582 Bacteria 3842
1235 Ga0501067_0001976 3300049583 Bacteria 11278
1236 Ga0501067_0004998 3300049583 Bacteria 7371
1237 Ga0501067_0028386 3300049583 Bacteria 3099
1238 Ga0501067_0104145 3300049583 Bacteria 1577
1239 Ga0501067_0114284 3300049583 Bacteria 1501
1240 Ga0501068_0000737 3300049584 Bacteria 16779
1241 Ga0501068_0000938 3300049584 Bacteria 15265
1242 Ga0501068_0018828 3300049584 Bacteria 4000
1243 Ga0501068_0067026 3300049584 Bacteria 2187
1244 Ga0501068_0261206 3300049584 Bacteria 1105
1245 Ga0501069_0000315 3300049585 Bacteria 22061
1246 Ga0501069_0003284 3300049585 Bacteria 8300
1247 Ga0501069_0028526 3300049585 Bacteria 3061
1248 Ga0501069_0211785 3300049585 Bacteria 1125
1249 Ga0501070_0000659 3300049586 Bacteria 31835
1250 Ga0501070_0007760 3300049586 Bacteria 9095
1251 Ga0501070_0063684 3300049586 Bacteria 3054
1252 Ga0501070_0096744 3300049586 Bacteria 2442
1253 Ga0501070_0102806 3300049586 Bacteria 2363
1254 Ga0501070_0139416 3300049586 Bacteria 2002
1255 Ga0501070_0212993 3300049586 Bacteria 1585
1256 Ga0501070_0243976 3300049586 Bacteria 1470
1257 Ga0501070_0269532 3300049586 Bacteria 1391
1258 Ga0501070_0379270 3300049586 Bacteria 1145
1259 Ga0501071_0045800 3300049587 Bacteria 3140
1260 Ga0501071_0115738 3300049587 Bacteria 1984
1261 Ga0501071_0154545 3300049587 Bacteria 1713
1262 Ga0501072_0000606 3300049588 Bacteria 25831
1263 Ga0501072_0001167 3300049588 Bacteria 19542
1264 Ga0501072_0047895 3300049588 Bacteria 3366
1265 Ga0501073_0000014 3300049589 Bacteria 159719
1266 Ga0501073_0000238 3300049589 Bacteria 36316
1267 Ga0501073_0029113 3300049589 Bacteria 3946
1268 Ga0501074_0000259 3300049590 Bacteria 30031
1269 Ga0501074_0000995 3300049590 Bacteria 18428
1270 Ga0501074_0021196 3300049590 Bacteria 4720
1271 Ga0501074_0032625 3300049590 Bacteria 3772
1272 Ga0501074_0154843 3300049590 Bacteria 1638
1273 Ga0501075_0153982 3300049591 Bacteria 1753
1274 Ga0501076_0301602 3300049592 Bacteria 1313
1275 Ga0501077_0096296 3300049593 Bacteria 1876
1276 Ga0501079_0014230 3300049741 Bacteria 6065
1277 Ga0501080_0002287 3300049742 Bacteria 16687
1278 Ga0501080_0007524 3300049742 Bacteria 9839
1279 Ga0501080_0011414 3300049742 Bacteria 8135
1280 Ga0501080_0018024 3300049742 Bacteria 6537
1281 Ga0501080_0101039 3300049742 Bacteria 2675
1282 Ga0501080_0118121 3300049742 Bacteria 2458
1283 Ga0501080_0474771 3300049742 Bacteria 1119
1284 Ga0501083_0000550 3300049744 Bacteria 23969
1285 Ga0501083_0010171 3300049744 Bacteria 6629
1286 Ga0501083_0013449 3300049744 Bacteria 5719
1287 Ga0501035_0000096 3300049822 Bacteria 110635
1288 Ga0501035_0000099 3300049822 Bacteria 108224
1289 Ga0501035_0000146 3300049822 Bacteria 86011
1290 Ga0501035_0070990 3300049822 Bacteria 3084
1291 Ga0501035_0102938 3300049822 Bacteria 2505
1292 Ga0501035_0123306 3300049822 Bacteria 2263
1293 Ga0501035_0168274 3300049822 Bacteria 1894
1294 Ga0501044_0000017 3300049823 Bacteria 228107
1295 Ga0501044_0000195 3300049823 Bacteria 76643
1296 Ga0501044_0002385 3300049823 Bacteria 21410
1297 Ga0501044_0030160 3300049823 Bacteria 5716
1298 Ga0501044_0034593 3300049823 Bacteria 5297
1299 Ga0501044_0035811 3300049823 Bacteria 5195
1300 Ga0501044_0039805 3300049823 Bacteria 4901
1301 Ga0501044_0101805 3300049823 Bacteria 2889
1302 Ga0501044_0218231 3300049823 Bacteria 1858
1303 Ga0501044_0270193 3300049823 Bacteria 1636
1304 Ga0501044_0297261 3300049823 Bacteria 1544
1305 Ga0501044_0385295 3300049823 Bacteria 1316
1306 Ga0501044_0431210 3300049823 Bacteria 1227
1307 Ga0501045_0004135 3300049824 Bacteria 10024
1308 Ga0501045_0024453 3300049824 Bacteria 4337
1309 Ga0501045_0070605 3300049824 Bacteria 2570
1310 nmdc:mga03683_37109_c1 3300050489 Bacteria 1985
1311 nmdc:mga03683_61382_c1 3300050489 Bacteria 1589
1312 nmdc:mga03n38_1385_c1 3300050490 Bacteria 6888
1313 nmdc:mga03n38_140458_c1 3300050490 Bacteria 1206
1314 nmdc:mga03n38_148281_c1 3300050490 Bacteria 1178
1315 nmdc:mga03n38_5383_c1 3300050490 Bacteria 4352
1316 nmdc:mga03n38_98787_c1 3300050490 Bacteria 1405
1317 nmdc:mga00v17_191498_c1 3300050491 Bacteria 1321
1318 nmdc:mga00v17_47537_c1 3300050491 Bacteria 2599
1319 nmdc:mga00v17_77401_c1 3300050491 Bacteria 2071
1320 nmdc:mga00v17_85061_c1 3300050491 Bacteria 1980
1321 nmdc:mga0yw44_121517_c1 3300050492 Bacteria 1682
1322 nmdc:mga0yw44_130594_c1 3300050492 Bacteria 1626
1323 nmdc:mga0yw44_32623_c1 3300050492 Bacteria 2373
1324 nmdc:mga0yw44_38554_c1 3300050492 Bacteria 2829
1325 nmdc:mga0yw44_41024_c1 3300050492 Bacteria 2753
1326 nmdc:mga0yw44_85309_c1 3300050492 Bacteria 1987
1327 nmdc:mga0yw44_98070_c1 3300050492 Bacteria 1863
1328 nmdc:mga0k408_2838_c1 3300050493 Bacteria 9200
1329 nmdc:mga0k408_44704_c1 3300050493 Bacteria 1408
1330 nmdc:mga0k408_45315_c1 3300050493 Bacteria 2537
1331 nmdc:mga0k408_77575_c1 3300050493 Bacteria 1943
1332 nmdc:mga06z11_33686_c1 3300050494 Bacteria 2508
1333 nmdc:mga06z11_85306_c1 3300050494 Bacteria 1703
1334 nmdc:mga04h51_40454_c1 3300050495 Bacteria 1519
1335 nmdc:mga07m45_269756_c1 3300050496 Bacteria 990
1336 nmdc:mga07m45_4399_c1 3300050496 Bacteria 6896
1337 nmdc:mga05p37_225116_c1 3300050507 Bacteria 2262
1338 nmdc:mga05p37_458612_c1 3300050507 Bacteria 1473
1339 nmdc:mga08y16_336950_c1 3300050511 Bacteria 1551
1340 nmdc:mga0rr50_7973_c1 3300050513 Bacteria 6571
1341 nmdc:mga08x19_100320_c1 3300050514 Bacteria 1920
1342 nmdc:mga0sz30_112711_c1 3300050516 Bacteria 1193
1343 nmdc:mga0sz30_23385_c1 3300050516 Bacteria 2514
1344 nmdc:mga0sz30_90125_c1 3300050516 Bacteria 1334
1345 Ga0495601_0026087 3300053077 Bacteria 3605
1346 Ga0495601_0031353 3300053077 Bacteria 3303
1347 Ga0495601_0068831 3300053077 Bacteria 2257
1348 Ga0495601_0304869 3300053077 Bacteria 1037
1349 Ga0495612_0022777 3300053078 Bacteria 2511
1350 Ga0500610_0066195 3300053079 Bacteria 1884
1351 Ga0495595_0026287 3300053084 Bacteria 2585
1352 Ga0495595_0060653 3300053084 Bacteria 1770
1353 Ga0495595_0120013 3300053084 Bacteria 1280
1354 Ga0495619_0005683 3300053085 Bacteria 7908
1355 Ga0495619_0139824 3300053085 Bacteria 1667
1356 Ga0495619_0144025 3300053085 Bacteria 1642
1357 Ga0500578_0190699 3300053086 Bacteria 1259
1358 Ga0500643_000270 3300053087 Bacteria 45829
1359 Ga0500581_088318 3300053089 Bacteria 1539
1360 Ga0500647_0082492 3300053091 Bacteria 1542
1361 Ga0500651_0022302 3300053093 Bacteria 3954
1362 Ga0500651_0055248 3300053093 Bacteria 2488
1363 Ga0500651_0165963 3300053093 Bacteria 1318
1364 Ga0500566_0000022 3300053094 Bacteria 81784
1365 Ga0500566_0005084 3300053094 Bacteria 7841
1366 Ga0500566_0012337 3300053094 Bacteria 5032
1367 Ga0500566_0052562 3300053094 Bacteria 2327
1368 Ga0500640_000259 3300053095 Bacteria 11663
1369 Ga0500641_0002387 3300053096 Bacteria 6661
1370 Ga0500641_0002665 3300053096 Bacteria 6302
1371 Ga0500641_0073297 3300053096 Bacteria 1444
1372 Ga0500650_0014048 3300053098 Bacteria 3377
1373 Ga0500554_002353 3300053102 Bacteria 3708
1374 Ga0500554_009543 3300053102 Bacteria 2328
1375 Ga0500555_002818 3300053103 Bacteria 4985
1376 Ga0500556_0000097 3300053104 Bacteria 81329
1377 Ga0500556_0000306 3300053104 Bacteria 37363
1378 Ga0500556_0021119 3300053104 Bacteria 2094
1379 Ga0500556_0075336 3300053104 Bacteria 1268
1380 Ga0500556_0127573 3300053104 Bacteria 995
1381 Ga0500557_000026 3300053105 Bacteria 81867
1382 Ga0500562_012247 3300053108 Bacteria 2180
1383 Ga0500562_014270 3300053108 Bacteria 2034
1384 Ga0500569_011121 3300053109 Bacteria 2140
1385 Ga0500569_022839 3300053109 Bacteria 1672
1386 Ga0500569_079789 3300053109 Bacteria 1045
1387 Ga0500572_001109 3300053111 Bacteria 7863
1388 Ga0500593_000814 3300053117 Bacteria 11671
1389 Ga0500595_000095 3300053119 Bacteria 61248
1390 Ga0500595_016306 3300053119 Bacteria 2771
1391 Ga0500595_023108 3300053119 Bacteria 2189
1392 Ga0500595_023330 3300053119 Bacteria 2176
1393 Ga0500607_170287 3300053121 Bacteria 981
1394 Ga0500608_003379 3300053122 Bacteria 5979
1395 Ga0500608_008047 3300053122 Bacteria 4405
1396 Ga0500642_0000017 3300053130 Bacteria 167670
1397 Ga0500642_0000091 3300053130 Bacteria 45704
1398 Ga0500652_000454 3300053131 Bacteria 14537
1399 Ga0500652_029820 3300053131 Bacteria 2130
1400 Ga0500652_089386 3300053131 Bacteria 1286
1401 Ga0500655_004197 3300053133 Bacteria 2594
1402 Ga0500658_0142942 3300053134 Bacteria 1074
1403 Ga0500559_0000219 3300053136 Bacteria 45843
1404 Ga0500559_0002476 3300053136 Bacteria 9527
1405 Ga0500559_0002864 3300053136 Bacteria 8720
1406 Ga0500568_0011063 3300053139 Bacteria 4203
1407 Ga0500568_0028272 3300053139 Bacteria 2338
1408 Ga0500568_0058922 3300053139 Bacteria 1491
1409 Ga0500588_0128957 3300053146 Bacteria 899
1410 Ga0500590_016900 3300053148 Bacteria 3772
1411 Ga0500590_026597 3300053148 Bacteria 3001
1412 Ga0500590_100780 3300053148 Bacteria 1387
1413 Ga0500590_147655 3300053148 Bacteria 1065
1414 Ga0500603_000192 3300053150 Bacteria 15937
1415 Ga0500603_000199 3300053150 Bacteria 15731
1416 Ga0500603_010461 3300053150 Bacteria 2096
1417 Ga0500604_0000841 3300053151 Bacteria 8474
1418 Ga0500604_0004109 3300053151 Bacteria 3877
1419 Ga0500604_0009783 3300053151 Bacteria 2556
1420 Ga0500604_0130095 3300053151 Bacteria 846
1421 Ga0500616_0000046 3300053153 Bacteria 333409
1422 Ga0500616_0003195 3300053153 Bacteria 12753
1423 Ga0500616_0021691 3300053153 Bacteria 3597
1424 Ga0500619_114011 3300053154 Bacteria 920
1425 Ga0500620_000290 3300053155 Bacteria 9640
1426 Ga0500622_0006911 3300053156 Bacteria 6508
1427 Ga0500622_0029083 3300053156 Bacteria 2907
1428 Ga0500622_0206436 3300053156 Bacteria 890
1429 Ga0500624_009244 3300053157 Bacteria 1398
1430 Ga0500630_010421 3300053159 Bacteria 4569
1431 Ga0500633_0011023 3300053160 Bacteria 2443
1432 Ga0500638_003343 3300053162 Bacteria 5920
1433 Ga0500638_175585 3300053162 Bacteria 929
1434 Ga0500639_032910 3300053163 Bacteria 2739
1435 Ga0500636_0018270 3300053177 Bacteria 4146
1436 Ga0500636_0032000 3300053177 Bacteria 3112
1437 Ga0500636_0056864 3300053177 Bacteria 2289
1438 Ga0500637_0047175 3300053178 Bacteria 2446
1439 Ga0500637_0090301 3300053178 Bacteria 1774
1440 Ga0500637_0112124 3300053178 Bacteria 1581
1441 Ga0500637_0170473 3300053178 Bacteria 1251
1442 Ga0500637_0209872 3300053178 Bacteria 1105
1443 Ga0500645_013732 3300053730 Bacteria 2594
1444 Ga0500645_038402 3300053730 Bacteria 1421
1445 Ga0500609_002794 3300053731 Bacteria 2487
1446 Ga0500596_001884 3300053735 Bacteria 4214
1447 Ga0500601_000223 3300053737 Bacteria 11204
1448 Ga0500601_005136 3300053737 Bacteria 1431
1449 Ga0501084_0001641 3300054114 Bacteria 17770
1450 Ga0501084_0008167 3300054114 Bacteria 8632
1451 Ga0501084_0081306 3300054114 Bacteria 2717
1452 Ga0500661_007090 3300055283 Bacteria 2078
1453 Ga0501082_0003572 3300060353 Bacteria 13578
1454 Ga0501082_0062470 3300060353 Bacteria 3206
1455 Ga0501082_0150757 3300060353 Bacteria 2019

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2922185730 2922193014 223
2 3300049587 Ga0501071_0154545 Ga0501071_0154545_29_712 226
3 3300047444 Ga0495675_0044666 Ga0495675_0044666_2113_2796 227
4 3300049575 Ga0501039_0505866 Ga0501039_0505866_18_704 227
5 3300039450 Ga0436363_1114338 Ga0436363_1114338_12_704 228
6 3300046559 Ga0495667_0365059 Ga0495667_0365059_14_706 228
7 3300053084 Ga0495595_0120013 Ga0495595_0120013_24_713 228
8 3300025928 Ga0207700_10193122 Ga0207700_101931222 229
9 3300042157 Ga0439458_0063523 Ga0439458_0063523_14_703 229
10 iso_pu_bacteria 2906354277 2906357331 230
11 3300031249 Ga0265339_10000343 Ga0265339_1000034328 231
12 3300049570 Ga0501033_0052402 Ga0501033_0052402_1703_2503 231
13 3300049571 Ga0501034_0069622 Ga0501034_0069622_2183_2983 231
14 3300049572 Ga0501036_0020290 Ga0501036_0020290_4143_4943 231
15 3300049573 Ga0501037_0026956 Ga0501037_0026956_2676_3476 231
16 3300049574 Ga0501038_0008634 Ga0501038_0008634_1999_2799 231
17 3300049580 Ga0501046_0185983 Ga0501046_0185983_204_1004 231
18 3300049581 Ga0501047_0047128 Ga0501047_0047128_590_1390 231
19 3300049586 Ga0501070_0102806 Ga0501070_0102806_995_1795 231
20 3300049823 Ga0501044_0034593 Ga0501044_0034593_1601_2401 231
21 3300049590 Ga0501074_0032625 Ga0501074_0032625_1527_2327 232
22 3300005435 Ga0070714_100361708 Ga0070714_1003617082 233
23 iso_pu_bacteria 2938014810 2938018280 234
24 3300031730 Ga0307516_10116416 Ga0307516_101164162 237
25 3300025261 Ga0209233_1001637 Ga0209233_10016375 239
26 3300037418 Ga0395900_0495410 Ga0395900_0495410_212_1012 239
27 3300047319 Ga0495674_0212285 Ga0495674_0212285_153_953 239
28 3300031730 Ga0307516_10114257 Ga0307516_101142572 242
29 3300037853 Ga0436364_1512892 Ga0436364_1512892_1518_2318 242
30 3300009551 Ga0105238_10214235 Ga0105238_102142352 245
31 3300025924 Ga0207694_10373895 Ga0207694_103738952 245
32 3300010375 Ga0105239_10288295 Ga0105239_102882952 246
33 3300013296 Ga0157374_10226274 Ga0157374_102262742 246
34 3300013306 Ga0163162_10524303 Ga0163162_105243033 246
35 3300053148 Ga0500590_016900 Ga0500590_016900_2793_3593 246
36 3300005535 Ga0070684_100039474 Ga0070684_1000394742 247
37 3300005563 Ga0068855_100260361 Ga0068855_1002603611 247
38 3300005614 Ga0068856_100213940 Ga0068856_1002139402 247
39 3300009093 Ga0105240_10128815 Ga0105240_101288153 247
40 3300009545 Ga0105237_10019409 Ga0105237_100194095 247
41 3300013104 Ga0157370_10411244 Ga0157370_104112441 247
42 3300013105 Ga0157369_10012061 Ga0157369_100120616 247
43 3300020070 Ga0206356_11680992 Ga0206356_116809922 247
44 3300020080 Ga0206350_11175645 Ga0206350_111756452 247
45 3300022467 Ga0224712_10004314 Ga0224712_100043143 247
46 3300025933 Ga0207706_10471494 Ga0207706_104714942 247
47 3300025949 Ga0207667_10185997 Ga0207667_101859972 247
48 3300037466 Ga0395898_0002946 Ga0395898_0002946_18428_19228 247
49 3300039437 Ga0436365_1826856 Ga0436365_1826856_51_827 247
50 3300053156 Ga0500622_0206436 Ga0500622_0206436_124_873 247
51 3300030521 Ga0307511_10090887 Ga0307511_100908872 248
52 3300046526 Ga0495666_0196110 Ga0495666_0196110_20_775 249
53 3300028577 Ga0265318_10000199 Ga0265318_1000019915 250
54 3300005937 Ga0081455_10035922 Ga0081455_100359223 251
55 3300031616 Ga0307508_10000154 Ga0307508_1000015413 251
56 3300039450 Ga0436363_1020580 Ga0436363_1020580_681_1481 251
57 3300026078 Ga0207702_10220702 Ga0207702_102207022 252
58 3300031249 Ga0265339_10108519 Ga0265339_101085191 252
59 3300031250 Ga0265331_10024685 Ga0265331_100246852 252
60 3300031712 Ga0265342_10014987 Ga0265342_100149872 252
61 3300053093 Ga0500651_0055248 Ga0500651_0055248_118_918 253
62 3300053109 Ga0500569_011121 Ga0500569_011121_157_957 253
63 3300053146 Ga0500588_0128957 Ga0500588_0128957_22_822 253
64 3300053731 Ga0500609_002794 Ga0500609_002794_398_1198 253
65 3300003354 JGI25160J50197_1003620 JGI25160J50197_10036203 254
66 3300006038 Ga0075365_10122605 Ga0075365_101226052 254
67 3300006042 Ga0075368_10015140 Ga0075368_100151401 254
68 3300006051 Ga0075364_10139395 Ga0075364_101393952 254
69 3300006186 Ga0075369_10020112 Ga0075369_100201122 254
70 3300009093 Ga0105240_10007458 Ga0105240_1000745810 254
71 3300009174 Ga0105241_10040448 Ga0105241_100404482 254
72 3300025302 Ga0207426_1001611 Ga0207426_100161110 254
73 3300025911 Ga0207654_10047021 Ga0207654_100470212 254
74 3300025913 Ga0207695_10000059 Ga0207695_10000059327 254
75 3300025981 Ga0207640_10177133 Ga0207640_101771332 254
76 3300046557 Ga0495622_0014188 Ga0495622_0014188_2614_3414 254
77 3300048928 Ga0496125_0046816 Ga0496125_0046816_963_1763 254
78 3300049575 Ga0501039_0186159 Ga0501039_0186159_517_1317 254
79 3300050491 nmdc:mga00v17_191498_c1 nmdc:mga00v17_191498_c1_439_1239 254
80 3300050492 nmdc:mga0yw44_130594_c1 nmdc:mga0yw44_130594_c1_266_1066 254
81 3300050516 nmdc:mga0sz30_112711_c1 nmdc:mga0sz30_112711_c1_186_986 254
82 3300053094 Ga0500566_0012337 Ga0500566_0012337_500_1300 254
83 3300053122 Ga0500608_003379 Ga0500608_003379_2958_3758 254
84 3300053136 Ga0500559_0002864 Ga0500559_0002864_1095_1895 254
85 3300053148 Ga0500590_100780 Ga0500590_100780_48_848 254
86 3300053177 Ga0500636_0032000 Ga0500636_0032000_753_1553 254
87 3300044658 Ga0466972_0000286 Ga0466972_0000286_15356_16156 255
88 3300046454 Ga0495592_0002892 Ga0495592_0002892_7653_8453 255
89 3300046462 Ga0495651_0012448 Ga0495651_0012448_348_1148 255
90 3300046463 Ga0495653_0147515 Ga0495653_0147515_186_986 255
91 3300046477 Ga0495664_0021304 Ga0495664_0021304_2880_3680 255
92 3300046511 Ga0495608_0014344 Ga0495608_0014344_4427_5227 255
93 3300046516 Ga0495628_0003575 Ga0495628_0003575_7351_8151 255
94 3300046529 Ga0495652_0012642 Ga0495652_0012642_227_1027 255
95 3300046533 Ga0495640_0110666 Ga0495640_0110666_672_1472 255
96 3300046536 Ga0495587_0010725 Ga0495587_0010725_2339_3139 255
97 3300046543 Ga0495645_0049455 Ga0495645_0049455_1121_1921 255
98 3300046559 Ga0495667_0006624 Ga0495667_0006624_2019_2819 255
99 3300046675 Ga0495657_0002983 Ga0495657_0002983_12913_13713 255
100 3300046678 Ga0495599_0009058 Ga0495599_0009058_791_1591 255
101 3300046679 Ga0495623_0014811 Ga0495623_0014811_636_1436 255
102 3300046680 Ga0495646_0017020 Ga0495646_0017020_1097_1897 255
103 3300046689 Ga0495613_0043461 Ga0495613_0043461_2139_2939 255
104 3300046809 Ga0495600_0004048 Ga0495600_0004048_4279_5079 255
105 3300047317 Ga0495604_0005876 Ga0495604_0005876_6588_7388 255
106 3300047319 Ga0495674_0024836 Ga0495674_0024836_3644_4444 255
107 3300047322 Ga0495680_0002856 Ga0495680_0002856_3750_4550 255
108 3300047444 Ga0495675_0031592 Ga0495675_0031592_171_971 255
109 3300047471 Ga0495684_0131923 Ga0495684_0131923_246_1046 255
110 3300048088 Ga0495602_0010096 Ga0495602_0010096_4722_5522 255
111 3300049571 Ga0501034_0101777 Ga0501034_0101777_295_1095 255
112 3300049572 Ga0501036_0061705 Ga0501036_0061705_222_1022 255
113 3300049574 Ga0501038_0093901 Ga0501038_0093901_1098_1898 255
114 3300049579 Ga0501043_0292380 Ga0501043_0292380_346_1146 255
115 3300049585 Ga0501069_0028526 Ga0501069_0028526_2154_2954 255
116 3300049586 Ga0501070_0139416 Ga0501070_0139416_728_1528 255
117 3300049742 Ga0501080_0101039 Ga0501080_0101039_1854_2654 255
118 3300049823 Ga0501044_0297261 Ga0501044_0297261_149_949 255
119 3300053085 Ga0495619_0139824 Ga0495619_0139824_309_1109 255
120 3300053130 Ga0500642_0000017 Ga0500642_0000017_136196_136996 255
121 3300005616 Ga0068852_100048996 Ga0068852_1000489962 256
122 3300009545 Ga0105237_10040511 Ga0105237_100405115 256
123 3300025914 Ga0207671_10255242 Ga0207671_102552422 256
124 3300026041 Ga0207639_10143561 Ga0207639_101435612 256
125 3300026142 Ga0207698_10075416 Ga0207698_100754162 256
126 3300046680 Ga0495646_0040064 Ga0495646_0040064_1608_2405 256
127 3300048914 Ga0496111_0317480 Ga0496111_0317480_234_1034 256
128 3300053121 Ga0500607_170287 Ga0500607_170287_152_952 256
129 3300053148 Ga0500590_026597 Ga0500590_026597_1213_2013 256
130 3300053154 Ga0500619_114011 Ga0500619_114011_53_853 256
131 3300053157 Ga0500624_009244 Ga0500624_009244_452_1252 256
132 3300053178 Ga0500637_0090301 Ga0500637_0090301_243_1043 256
133 iso_pu_bacteria 8019638758 8019640805 256
134 3300005339 Ga0070660_100016425 Ga0070660_1000164254 257
135 3300025272 Ga0209455_1010792 Ga0209455_10107922 257
136 3300025898 Ga0207692_10217558 Ga0207692_102175581 257
137 3300025911 Ga0207654_10298750 Ga0207654_102987502 257
138 3300005339 Ga0070660_100504527 Ga0070660_1005045271 258
139 3300005353 Ga0070669_100165983 Ga0070669_1001659832 258
140 3300005355 Ga0070671_100230494 Ga0070671_1002304941 258
141 3300005563 Ga0068855_100497810 Ga0068855_1004978102 258
142 3300005577 Ga0068857_100425486 Ga0068857_1004254861 258
143 3300005843 Ga0068860_100001721 Ga0068860_1000017212 258
144 3300005843 Ga0068860_100247045 Ga0068860_1002470452 258
145 3300006038 Ga0075365_10383647 Ga0075365_103836471 258
146 3300006048 Ga0075363_100011643 Ga0075363_1000116432 258
147 3300006178 Ga0075367_10068626 Ga0075367_100686262 258
148 3300006195 Ga0075366_10014528 Ga0075366_100145284 258
149 3300006353 Ga0075370_10029278 Ga0075370_100292783 258
150 3300009101 Ga0105247_10054723 Ga0105247_100547232 258
151 3300009174 Ga0105241_10206836 Ga0105241_102068362 258
152 3300009177 Ga0105248_10235465 Ga0105248_102354652 258
153 3300009545 Ga0105237_10073153 Ga0105237_100731533 258
154 3300009551 Ga0105238_10534798 Ga0105238_105347982 258
155 3300010375 Ga0105239_10031784 Ga0105239_100317844 258
156 3300011119 Ga0105246_10240449 Ga0105246_102404492 258
157 3300013296 Ga0157374_10440234 Ga0157374_104402342 258
158 3300014325 Ga0163163_10096893 Ga0163163_100968933 258
159 3300025299 Ga0209256_1030381 Ga0209256_10303812 258
160 3300025900 Ga0207710_10004750 Ga0207710_100047504 258
161 3300025904 Ga0207647_10039838 Ga0207647_100398382 258
162 3300025914 Ga0207671_10031638 Ga0207671_100316383 258
163 3300025919 Ga0207657_10361687 Ga0207657_103616872 258
164 3300025925 Ga0207650_10458359 Ga0207650_104583591 258
165 3300025931 Ga0207644_10061040 Ga0207644_100610402 258
166 3300025941 Ga0207711_10123067 Ga0207711_101230672 258
167 3300025986 Ga0207658_10045657 Ga0207658_100456572 258
168 3300026041 Ga0207639_10162448 Ga0207639_101624482 258
169 3300026067 Ga0207678_10108612 Ga0207678_101086122 258
170 3300026116 Ga0207674_10289944 Ga0207674_102899442 258
171 3300028381 Ga0268264_10000107 Ga0268264_10000107133 258
172 3300037853 Ga0436364_1404333 Ga0436364_1404333_62_862 258
173 3300044694 Ga0466963_0435136 Ga0466963_0435136_106_906 258
174 3300046507 Ga0495606_0036615 Ga0495606_0036615_2120_2920 258
175 3300046513 Ga0495616_0043535 Ga0495616_0043535_1429_2229 258
176 3300046515 Ga0495620_0114027 Ga0495620_0114027_128_928 258
177 3300046616 Ga0495668_0072630 Ga0495668_0072630_949_1749 258
178 3300047323 Ga0495683_0067062 Ga0495683_0067062_225_1025 258
179 3300048091 Ga0495626_0101206 Ga0495626_0101206_253_1053 258
180 3300048903 Ga0496100_0144631 Ga0496100_0144631_94_894 258
181 3300048904 Ga0496101_0204479 Ga0496101_0204479_295_1095 258
182 3300048905 Ga0496102_0104817 Ga0496102_0104817_1541_2341 258
183 3300048906 Ga0496103_0001945 Ga0496103_0001945_11087_11887 258
184 3300048907 Ga0496104_0067394 Ga0496104_0067394_1731_2531 258
185 3300048908 Ga0496105_0051296 Ga0496105_0051296_1541_2341 258
186 3300048911 Ga0496108_0010972 Ga0496108_0010972_5020_5820 258
187 3300048912 Ga0496109_0073228 Ga0496109_0073228_101_901 258
188 3300048913 Ga0496110_0208301 Ga0496110_0208301_195_995 258
189 3300048914 Ga0496111_0104226 Ga0496111_0104226_368_1168 258
190 3300048915 Ga0496112_0120660 Ga0496112_0120660_1628_2428 258
191 3300048919 Ga0496116_0076972 Ga0496116_0076972_17_817 258
192 3300048920 Ga0496117_0059700 Ga0496117_0059700_1419_2219 258
193 3300048922 Ga0496119_0033766 Ga0496119_0033766_1808_2608 258
194 3300048925 Ga0496122_0088550 Ga0496122_0088550_848_1648 258
195 3300048927 Ga0496124_0084967 Ga0496124_0084967_742_1542 258
196 3300048928 Ga0496125_0150380 Ga0496125_0150380_79_879 258
197 3300048929 Ga0496126_0463799 Ga0496126_0463799_24_824 258
198 3300050491 nmdc:mga00v17_77401_c1 nmdc:mga00v17_77401_c1_688_1488 258
199 3300050492 nmdc:mga0yw44_38554_c1 nmdc:mga0yw44_38554_c1_1217_2017 258
200 3300050493 nmdc:mga0k408_77575_c1 nmdc:mga0k408_77575_c1_492_1292 258
201 3300050496 nmdc:mga07m45_4399_c1 nmdc:mga07m45_4399_c1_3744_4544 258
202 3300050516 nmdc:mga0sz30_23385_c1 nmdc:mga0sz30_23385_c1_824_1624 258
203 iso_pu_bacteria 2513237145 2513921978 258
204 iso_pu_bacteria 2879099564 2879106952 258
205 iso_pu_bacteria 2935810662 2935811962 258
206 iso_pu_bacteria 2936037263 2936038545 258
207 3300025297 Ga0209758_1002540 Ga0209758_10025402 259
208 3300048918 Ga0496115_0205941 Ga0496115_0205941_14_814 259
209 iso_pu_bacteria 2842775625 2842778106 259
210 iso_pu_bacteria 2922361189 2922362484 259
211 iso_pu_bacteria 3005710791 3005711317 259
212 iso_pu_bacteria 2507262055 2507505558 260
213 iso_pu_bacteria 2508501009 2508539436 260
214 iso_pu_bacteria 2508501042 2508695775 260
215 iso_pu_bacteria 2508501128 2509152534 260
216 iso_pu_bacteria 2511231028 2511397660 260
217 iso_pu_bacteria 2513237092 2513624794 260
218 iso_pu_bacteria 2513237094 2513642337 260
219 iso_pu_bacteria 2513237095 2513652565 260
220 iso_pu_bacteria 2513237096 2513658095 260
221 iso_pu_bacteria 2513237098 2513671765 260
222 iso_pu_bacteria 2513237102 2513704840 260
223 iso_pu_bacteria 2513237104 2513721868 260
224 iso_pu_bacteria 2513237137 2513863837 260
225 iso_pu_bacteria 2513237139 2513879323 260
226 iso_pu_bacteria 2513237141 2513895151 260
227 iso_pu_bacteria 2513237145 2513922933 260
228 iso_pu_bacteria 2513237161 2514016857 260
229 iso_pu_bacteria 2515154112 2515630146 260
230 iso_pu_bacteria 2517093001 2517107939 260
231 iso_pu_bacteria 2517572143 2517889164 260
232 iso_pu_bacteria 2524023205 2524442002 260
233 iso_pu_bacteria 2524023210 2524470148 260
234 iso_pu_bacteria 2524023228 2524536584 260
235 iso_pu_bacteria 2528768022 2528851848 260
236 iso_pu_bacteria 2602042107 2603858153 260
237 iso_pu_bacteria 2617270735 2617353667 260
238 iso_pu_bacteria 2643221550 2643774234 260
239 iso_pu_bacteria 2643221564 2643837574 260
240 iso_pu_bacteria 2643221651 2644290124 260
241 iso_pu_bacteria 2667528175 2671121554 260
242 iso_pu_bacteria 2721755755 2723841927 260
243 iso_pu_bacteria 2728368998 2728753675 260
244 iso_pu_bacteria 2744054633 2745082380 260
245 iso_pu_bacteria 2791355196 2793065670 260
246 iso_pu_bacteria 2791355197 2793072590 260
247 iso_pu_bacteria 2791355199 2793079143 260
248 iso_pu_bacteria 2802429603 2805921530 260
249 iso_pu_bacteria 2816332527 2818239073 260
250 iso_pu_bacteria 2824600985 2824603006 260
251 iso_pu_bacteria 2824609381 2824615476 260
252 iso_pu_bacteria 2824617872 2824623926 260
253 iso_pu_bacteria 2824626560 2824632595 260
254 iso_pu_bacteria 2824635225 2824639451 260
255 iso_pu_bacteria 2824644064 2824649449 260
256 iso_pu_bacteria 2824653114 2824660315 260
257 iso_pu_bacteria 2824661429 2824668578 260
258 iso_pu_bacteria 2824671348 2824675357 260
259 iso_pu_bacteria 2824679649 2824684682 260
260 iso_pu_bacteria 2824687955 2824691575 260
261 iso_pu_bacteria 2824696289 2824700510 260
262 iso_pu_bacteria 2824714736 2824719331 260
263 iso_pu_bacteria 2824723954 2824727963 260
264 iso_pu_bacteria 2824773399 2824777439 260
265 iso_pu_bacteria 2838122688 2838130205 260
266 iso_pu_bacteria 2841941048 2841947882 260
267 iso_pu_bacteria 2841949485 2841956941 260
268 iso_pu_bacteria 2841957949 2841965070 260
269 iso_pu_bacteria 2841966195 2841972708 260
270 iso_pu_bacteria 2841974524 2841977440 260
271 iso_pu_bacteria 2841983080 2841990662 260
272 iso_pu_bacteria 2842038055 2842041290 260
273 iso_pu_bacteria 2842045827 2842049332 260
274 iso_pu_bacteria 2847939898 2847942462 260
275 iso_pu_bacteria 2849076700 2849083326 260
276 iso_pu_bacteria 2856356410 2856358727 260
277 iso_pu_bacteria 2857509624 2857516484 260
278 iso_pu_bacteria 2857524615 2857527542 260
279 iso_pu_bacteria 2871488783 2871491346 260
280 iso_pu_bacteria 2874590934 2874592633 260
281 iso_pu_bacteria 2874604998 2874610474 260
282 iso_pu_bacteria 2874612657 2874619071 260
283 iso_pu_bacteria 2874620515 2874623034 260
284 iso_pu_bacteria 2874628541 2874636837 260
285 iso_pu_bacteria 2874645413 2874647457 260
286 iso_pu_bacteria 2876761206 2876763727 260
287 iso_pu_bacteria 2876771140 2876772757 260
288 iso_pu_bacteria 2876808645 2876817427 260
289 iso_pu_bacteria 2876818435 2876820090 260
290 iso_pu_bacteria 2878753008 2878757781 260
291 iso_pu_bacteria 2879074833 2879076595 260
292 iso_pu_bacteria 2879099564 2879106786 260
293 iso_pu_bacteria 2879110137 2879115116 260
294 iso_pu_bacteria 2879127579 2879129228 260
295 iso_pu_bacteria 2879142872 2879144867 260
296 iso_pu_bacteria 2881845957 2881849792 260
297 iso_pu_bacteria 2882912400 2882915246 260
298 iso_pu_bacteria 2885318864 2885320484 260
299 iso_pu_bacteria 2885350715 2885351730 260
300 iso_pu_bacteria 2885366525 2885368600 260
301 iso_pu_bacteria 2885374607 2885376102 260
302 iso_pu_bacteria 2885383462 2885390206 260
303 iso_pu_bacteria 2885409591 2885417691 260
304 iso_pu_bacteria 2888378607 2888379274 260
305 iso_pu_bacteria 2888388044 2888390393 260
306 iso_pu_bacteria 2888419890 2888419959 260
307 iso_pu_bacteria 2889033259 2889035153 260
308 iso_pu_bacteria 2903492973 2903506456 260
309 iso_pu_bacteria 2903768456 2903775311 260
310 iso_pu_bacteria 2904666416 2904666654 260
311 iso_pu_bacteria 2904690495 2904690892 260
312 iso_pu_bacteria 2904699407 2904708979 260
313 iso_pu_bacteria 2906610324 2906613445 260
314 iso_pu_bacteria 2906626472 2906629105 260
315 iso_pu_bacteria 2906635258 2906636159 260
316 iso_pu_bacteria 2906660503 2906668478 260
317 iso_pu_bacteria 2908739725 2908747772 260
318 iso_pu_bacteria 2908756301 2908756948 260
319 iso_pu_bacteria 2922361189 2922363415 260
320 iso_pu_bacteria 2922368715 2922369044 260
321 iso_pu_bacteria 2922386360 2922388762 260
322 iso_pu_bacteria 2922393267 2922394703 260
323 iso_pu_bacteria 2922425934 2922433882 260
324 iso_pu_bacteria 2924784321 2924785722 260
325 iso_pu_bacteria 2929615660 2929618913 260
326 iso_pu_bacteria 2929624759 2929630990 260
327 iso_pu_bacteria 2932784394 2932788959 260
328 iso_pu_bacteria 2932794094 2932799992 260
329 iso_pu_bacteria 2932801729 2932809003 260
330 iso_pu_bacteria 2932809354 2932814397 260
331 iso_pu_bacteria 2932818245 2932820523 260
332 iso_pu_bacteria 2932828146 2932834562 260
333 iso_pu_bacteria 2933577622 2933580377 260
334 iso_pu_bacteria 2935608549 2935614617 260
335 iso_pu_bacteria 2935616580 2935624426 260
336 iso_pu_bacteria 2935630451 2935634911 260
337 iso_pu_bacteria 2935638405 2935645934 260
338 iso_pu_bacteria 2935648319 2935654779 260
339 iso_pu_bacteria 2935656913 2935663659 260
340 iso_pu_bacteria 2935665750 2935674477 260
341 iso_pu_bacteria 2935675223 2935682678 260
342 iso_pu_bacteria 2935684952 2935686711 260
343 iso_pu_bacteria 2935694250 2935701613 260
344 iso_pu_bacteria 2935703347 2935710411 260
345 iso_pu_bacteria 2935713505 2935716399 260
346 iso_pu_bacteria 2935722832 2935723476 260
347 iso_pu_bacteria 2935732158 2935735032 260
348 iso_pu_bacteria 2935741537 2935744177 260
349 iso_pu_bacteria 2935750917 2935752677 260
350 iso_pu_bacteria 2935760218 2935764895 260
351 iso_pu_bacteria 2935769743 2935774183 260
352 iso_pu_bacteria 2935777560 2935782360 260
353 iso_pu_bacteria 2935785616 2935789101 260
354 iso_pu_bacteria 2935793552 2935796851 260
355 iso_pu_bacteria 2935801545 2935806065 260
356 iso_pu_bacteria 2935810662 2935816875 260
357 iso_pu_bacteria 2935819856 2935826351 260
358 iso_pu_bacteria 2935827899 2935835165 260
359 iso_pu_bacteria 2935837841 2935841454 260
360 iso_pu_bacteria 2935847175 2935853838 260
361 iso_pu_bacteria 2935855204 2935863145 260
362 iso_pu_bacteria 2935864058 2935873098 260
363 iso_pu_bacteria 2935873716 2935880147 260
364 iso_pu_bacteria 2935883170 2935888204 260
365 iso_pu_bacteria 2935908558 2935915385 260
366 iso_pu_bacteria 2935916978 2935925139 260
367 iso_pu_bacteria 2935926038 2935933280 260
368 iso_pu_bacteria 2935934488 2935941372 260
369 iso_pu_bacteria 2935942939 2935949569 260
370 iso_pu_bacteria 2935951376 2935958256 260
371 iso_pu_bacteria 2935959822 2935966503 260
372 iso_pu_bacteria 2935967501 2935974844 260
373 iso_pu_bacteria 2935975950 2935983105 260
374 iso_pu_bacteria 2935984226 2935985269 260
375 iso_pu_bacteria 2935992306 2936000851 260
376 iso_pu_bacteria 2936002035 2936010352 260
377 iso_pu_bacteria 2936011229 2936017815 260
378 iso_pu_bacteria 2936019824 2936026318 260
379 iso_pu_bacteria 2936028420 2936035065 260
380 iso_pu_bacteria 2936037263 2936043866 260
381 iso_pu_bacteria 2936046547 2936053178 260
382 iso_pu_bacteria 2936055302 2936056969 260
383 iso_pu_bacteria 2940556831 2940558590 260
384 iso_pu_bacteria 2941507105 2941514301 260
385 iso_pu_bacteria 2941515067 2941522262 260
386 iso_pu_bacteria 2941523033 2941530133 260
387 iso_pu_bacteria 2941531003 2941537991 260
388 iso_pu_bacteria 2941538514 2941543680 260
389 iso_pu_bacteria 2961170736 2961174324 260
390 iso_pu_bacteria 2967996073 2968000271 260
391 iso_pu_bacteria 2968003550 2968005457 260
392 iso_pu_bacteria 2970503327 2970506911 260
393 iso_pu_bacteria 2977821940 2977822313 260
394 iso_pu_bacteria 2977828996 2977833297 260
395 iso_pu_bacteria 2979808191 2979812106 260
396 iso_pu_bacteria 3005474847 3005475397 260
397 iso_pu_bacteria 3005506211 3005511502 260
398 iso_pu_bacteria 8004374579 8004379292 260
399 iso_pu_bacteria 8006926726 8006932662 260
400 iso_pu_bacteria 8006933436 8006935887 260
401 iso_pu_bacteria 8006964411 8006969375 260
402 iso_pu_bacteria 8006973647 8006975996 260
403 iso_pu_bacteria 8006984368 8006988420 260
404 iso_pu_bacteria 8006994254 8007000668 260
405 iso_pu_bacteria 8016511872 8016517846 260
406 iso_pu_bacteria 8016530956 8016539498 260
407 iso_pu_bacteria 8016539877 8016543787 260
408 iso_pu_bacteria 8016548790 8016549508 260
409 iso_pu_bacteria 8016557553 8016557930 260
410 iso_pu_bacteria 8016566248 8016569187 260
411 iso_pu_bacteria 8016575299 8016581828 260
412 iso_pu_bacteria 8016583857 8016586025 260
413 iso_pu_bacteria 8016595262 8016595950 260
414 iso_pu_bacteria 8016603502 8016606820 260
415 iso_pu_bacteria 8016613128 8016618727 260
416 iso_pu_bacteria 8016622563 8016622804 260
417 iso_pu_bacteria 8016630954 8016635309 260
418 iso_pu_bacteria 8017057580 8017058787 260
419 iso_pu_bacteria 8019530166 8019530777 260
420 iso_pu_bacteria 8019538911 8019540807 260
421 iso_pu_bacteria 8019547302 8019549807 260
422 iso_pu_bacteria 8019565922 8019572868 260
423 iso_pu_bacteria 8019576017 8019576865 260
424 iso_pu_bacteria 8019586578 8019594922 260
425 iso_pu_bacteria 8019608314 8019611689 260
426 iso_pu_bacteria 8019619141 8019623283 260
427 iso_pu_bacteria 8019648815 8019652080 260
428 iso_pu_bacteria 8019659431 8019666650 260
429 iso_pu_bacteria 8019687851 8019695934 260
430 iso_pu_bacteria 8055742211 8055742762 260
431 iso_pu_bacteria 8056673599 8056678561 260
432 iso_pu_bacteria 8056681323 8056689385 260
433 iso_pu_bacteria 8056689827 8056691919 260
434 iso_pu_bacteria 8056967851 8056975740 260
435 3300050493 nmdc:mga0k408_2838_c1 nmdc:mga0k408_2838_c1_6059_6850 261
436 iso_pu_bacteria 2509276018 2509371163 261
437 iso_pu_bacteria 2510065059 2510313748 261
438 iso_pu_bacteria 2512875024 2512958935 261
439 iso_pu_bacteria 2513237090 2513610911 261
440 iso_pu_bacteria 2513237164 2514038217 261
441 iso_pu_bacteria 2599185301 2599938379 261
442 iso_pu_bacteria 2643221551 2643775272 261
443 iso_pu_bacteria 2643221555 2643793718 261
444 iso_pu_bacteria 2643221595 2643985807 261
445 iso_pu_bacteria 2643221627 2644158421 261
446 iso_pu_bacteria 2687453392 2688598806 261
447 iso_pu_bacteria 2693429783 2694629880 261
448 iso_pu_bacteria 2693429784 2694636247 261
449 iso_pu_bacteria 2738543024 2739308167 261
450 iso_pu_bacteria 2756170246 2756675665 261
451 iso_pu_bacteria 2844002411 2844006169 261
452 iso_pu_bacteria 2856328259 2856331466 261
453 iso_pu_bacteria 2856334872 2856339052 261
454 iso_pu_bacteria 2856364286 2856370489 261
455 iso_pu_bacteria 2857349434 2857350723 261
456 iso_pu_bacteria 2869249662 2869250867 261
457 iso_pu_bacteria 2869264136 2869266681 261
458 iso_pu_bacteria 2869271264 2869272126 261
459 iso_pu_bacteria 2869285874 2869291784 261
460 iso_pu_bacteria 2871429161 2871434993 261
461 iso_pu_bacteria 2871451962 2871459116 261
462 iso_pu_bacteria 2871459585 2871466482 261
463 iso_pu_bacteria 2871466892 2871468154 261
464 iso_pu_bacteria 2874131515 2874134713 261
465 iso_pu_bacteria 2874146452 2874149384 261
466 iso_pu_bacteria 2874155637 2874157647 261
467 iso_pu_bacteria 2874162495 2874166224 261
468 iso_pu_bacteria 2876369609 2876370574 261
469 iso_pu_bacteria 2876392853 2876394586 261
470 iso_pu_bacteria 2876399893 2876406013 261
471 iso_pu_bacteria 2876413966 2876415850 261
472 iso_pu_bacteria 2878745973 2878752128 261
473 iso_pu_bacteria 2881147464 2881151883 261
474 iso_pu_bacteria 2882632389 2882635639 261
475 iso_pu_bacteria 2885305155 2885309786 261
476 iso_pu_bacteria 2885312484 2885317609 261
477 iso_pu_bacteria 2885326080 2885328975 261
478 iso_pu_bacteria 2888350351 2888356122 261
479 iso_pu_bacteria 2889010040 2889011053 261
480 iso_pu_bacteria 2889016732 2889017255 261
481 iso_pu_bacteria 2903492973 2903493314 261
482 iso_pu_bacteria 2904659560 2904661220 261
483 iso_pu_bacteria 2906308376 2906314522 261
484 iso_pu_bacteria 2906321335 2906327690 261
485 iso_pu_bacteria 2906370794 2906371497 261
486 iso_pu_bacteria 2906378014 2906382786 261
487 iso_pu_bacteria 2906393657 2906400934 261
488 iso_pu_bacteria 2906408224 2906412095 261
489 iso_pu_bacteria 2922130491 2922131230 261
490 iso_pu_bacteria 2922151315 2922154650 261
491 iso_pu_bacteria 2922172374 2922177473 261
492 iso_pu_bacteria 2922178524 2922181790 261
493 iso_pu_bacteria 2924733363 2924739348 261
494 iso_pu_bacteria 2924748358 2924748516 261
495 iso_pu_bacteria 2937813078 2937816175 261
496 iso_pu_bacteria 2937843397 2937844813 261
497 iso_pu_bacteria 2958041894 2958043496 261
498 iso_pu_bacteria 2958100919 2958104993 261
499 iso_pu_bacteria 2958122699 2958129632 261
500 iso_pu_bacteria 2958130278 2958136182 261
501 iso_pu_bacteria 2958137437 2958139483 261
502 iso_pu_bacteria 2958158011 2958163021 261
503 iso_pu_bacteria 2958172287 2958175287 261
504 iso_pu_bacteria 2958179912 2958185650 261
505 iso_pu_bacteria 2961077736 2961084027 261
506 iso_pu_bacteria 2961114664 2961116371 261
507 iso_pu_bacteria 2961136820 2961144642 261
508 iso_pu_bacteria 2965025482 2965026525 261
509 iso_pu_bacteria 2965032056 2965035273 261
510 iso_pu_bacteria 2965040258 2965040422 261
511 iso_pu_bacteria 2965047637 2965055185 261
512 iso_pu_bacteria 2965089291 2965095342 261
513 iso_pu_bacteria 2965102966 2965107099 261
514 iso_pu_bacteria 2965110997 2965114528 261
515 iso_pu_bacteria 2965119406 2965122089 261
516 iso_pu_bacteria 2968110612 2968112277 261
517 iso_pu_bacteria 2968117919 2968121041 261
518 iso_pu_bacteria 2970489779 2970495709 261
519 iso_pu_bacteria 2970547951 2970554700 261
520 iso_pu_bacteria 2977843712 2977846411 261
521 iso_pu_bacteria 2977872689 2977875146 261
522 iso_pu_bacteria 2977915119 2977917266 261
523 iso_pu_bacteria 2977935797 2977940420 261
524 iso_pu_bacteria 2977942078 2977947582 261
525 iso_pu_bacteria 2977950692 2977955203 261
526 iso_pu_bacteria 2977957713 2977961716 261
527 iso_pu_bacteria 2977971508 2977974288 261
528 iso_pu_bacteria 2979710463 2979710486 261
529 iso_pu_bacteria 2979793036 2979793836 261
530 iso_pu_bacteria 2987636660 2987637907 261
531 iso_pu_bacteria 2987645492 2987646798 261
532 iso_pu_bacteria 2987673487 2987674549 261
533 iso_pu_bacteria 3000135777 3000140230 261
534 iso_pu_bacteria 3004167301 3004169300 261
535 iso_pu_bacteria 3004195979 3004197588 261
536 iso_pu_bacteria 3004203850 3004205771 261
537 iso_pu_bacteria 3004239961 3004243965 261
538 iso_pu_bacteria 3004268573 3004268903 261
539 iso_pu_bacteria 649633066 649873324 261
540 iso_pu_bacteria 8002285264 8002288716 261
541 iso_pu_bacteria 8004300914 8004301861 261
542 iso_pu_bacteria 8004387939 8004394490 261
543 iso_pu_bacteria 8004640170 8004640452 261
544 iso_pu_bacteria 8004695233 8004696030 261
545 iso_pu_bacteria 8004714634 8004720783 261
546 3300005434 Ga0070709_10050531 Ga0070709_100505312 262
547 3300005435 Ga0070714_100259577 Ga0070714_1002595771 262
548 3300005436 Ga0070713_100094497 Ga0070713_1000944972 262
549 3300005437 Ga0070710_10128812 Ga0070710_101288122 262
550 3300005439 Ga0070711_100000566 Ga0070711_1000005667 262
551 3300006163 Ga0070715_10056483 Ga0070715_100564833 262
552 3300006175 Ga0070712_100004751 Ga0070712_1000047515 262
553 3300025928 Ga0207700_10242341 Ga0207700_102423412 262
554 3300025939 Ga0207665_10008178 Ga0207665_100081783 262
555 3300030521 Ga0307511_10024436 Ga0307511_100244365 262
556 3300031507 Ga0307509_10018509 Ga0307509_100185096 262
557 3300031730 Ga0307516_10005650 Ga0307516_100056508 262
558 3300039453 Ga0436362_0990892 Ga0436362_0990892_68_874 262
559 3300046506 Ga0495583_0020315 Ga0495583_0020315_476_1270 262
560 3300046507 Ga0495606_0001032 Ga0495606_0001032_3240_4034 262
561 3300046524 Ga0495648_0005545 Ga0495648_0005545_6745_7539 262
562 3300046660 Ga0495625_0168405 Ga0495625_0168405_286_1080 262
563 3300046694 Ga0495649_0072661 Ga0495649_0072661_261_1055 262
564 3300049460 Ga0495682_0019787 Ga0495682_0019787_1203_1997 262
565 3300049568 Ga0501031_0055697 Ga0501031_0055697_1505_2299 262
566 3300049571 Ga0501034_0072553 Ga0501034_0072553_2166_2960 262
567 3300049571 Ga0501034_0181193 Ga0501034_0181193_617_1411 262
568 3300049572 Ga0501036_0099029 Ga0501036_0099029_1074_1868 262
569 3300049573 Ga0501037_0080211 Ga0501037_0080211_82_876 262
570 3300049574 Ga0501038_0102772 Ga0501038_0102772_608_1402 262
571 3300049574 Ga0501038_0189131 Ga0501038_0189131_716_1510 262
572 3300049575 Ga0501039_0220437 Ga0501039_0220437_532_1326 262
573 3300049579 Ga0501043_0176682 Ga0501043_0176682_281_1075 262
574 3300049581 Ga0501047_0311940 Ga0501047_0311940_504_1298 262
575 3300049586 Ga0501070_0096744 Ga0501070_0096744_1336_2130 262
576 3300053178 Ga0500637_0170473 Ga0500637_0170473_252_1046 262
577 3300003203 JGI25406J46586_10000887 JGI25406J46586_100008875 263
578 3300005344 Ga0070661_100162468 Ga0070661_1001624683 263
579 3300005458 Ga0070681_10037882 Ga0070681_100378824 263
580 3300005563 Ga0068855_100000022 Ga0068855_100000022174 263
581 3300005616 Ga0068852_100008561 Ga0068852_1000085617 263
582 3300005616 Ga0068852_100081448 Ga0068852_1000814483 263
583 3300005985 Ga0081539_10000879 Ga0081539_1000087936 263
584 3300006038 Ga0075365_10035818 Ga0075365_100358182 263
585 3300006051 Ga0075364_10042860 Ga0075364_100428602 263
586 3300006175 Ga0070712_100000244 Ga0070712_10000024427 263
587 3300006178 Ga0075367_10060079 Ga0075367_100600793 263
588 3300009093 Ga0105240_10000479 Ga0105240_1000047934 263
589 3300009093 Ga0105240_10655677 Ga0105240_106556772 263
590 3300009101 Ga0105247_10006862 Ga0105247_100068627 263
591 3300010375 Ga0105239_10000773 Ga0105239_1000077324 263
592 3300013105 Ga0157369_10041713 Ga0157369_100417134 263
593 3300013297 Ga0157378_10243106 Ga0157378_102431062 263
594 3300025913 Ga0207695_10000018 Ga0207695_10000018675 263
595 3300025915 Ga0207693_10000135 Ga0207693_1000013561 263
596 3300025924 Ga0207694_10000005 Ga0207694_10000005125 263
597 3300025949 Ga0207667_10000061 Ga0207667_10000061171 263
598 3300026023 Ga0207677_10311058 Ga0207677_103110581 263
599 3300026142 Ga0207698_10003421 Ga0207698_100034219 263
600 3300031250 Ga0265331_10018105 Ga0265331_100181052 263
601 3300031344 Ga0265316_10126412 Ga0265316_101264123 263
602 3300031711 Ga0265314_10038992 Ga0265314_100389922 263
603 3300031911 Ga0307412_10540795 Ga0307412_105407951 263
604 3300039437 Ga0436365_1773510 Ga0436365_1773510_4514_5311 263
605 3300046455 Ga0495603_0015122 Ga0495603_0015122_3695_4492 263
606 3300046507 Ga0495606_0089044 Ga0495606_0089044_916_1713 263
607 3300046516 Ga0495628_0255532 Ga0495628_0255532_316_1116 263
608 3300046529 Ga0495652_0216541 Ga0495652_0216541_469_1269 263
609 3300046543 Ga0495645_0137973 Ga0495645_0137973_29_829 263
610 3300049460 Ga0495682_0003694 Ga0495682_0003694_949_1749 263
611 3300049742 Ga0501080_0011414 Ga0501080_0011414_1260_2060 263
612 3300050492 nmdc:mga0yw44_121517_c1 nmdc:mga0yw44_121517_c1_568_1365 263
613 3300050513 nmdc:mga0rr50_7973_c1 nmdc:mga0rr50_7973_c1_3619_4419 263
614 3300053119 Ga0500595_016306 Ga0500595_016306_182_979 263
615 3300053133 Ga0500655_004197 Ga0500655_004197_360_1160 263
616 3300003215 JGI25153J46596_10001684 JGI25153J46596_100016842 264
617 3300003215 JGI25153J46596_10002416 JGI25153J46596_100024167 264
618 3300003215 JGI25153J46596_10004047 JGI25153J46596_100040472 264
619 3300003215 JGI25153J46596_10050192 JGI25153J46596_100501922 264
620 3300003354 JGI25160J50197_1005514 JGI25160J50197_10055144 264
621 3300003752 Ga0055539_1001740 Ga0055539_10017402 264
622 3300003794 Ga0055531_10012840 Ga0055531_100128403 264
623 3300004625 Ga0055543_1001860 Ga0055543_10018606 264
624 3300005262 Ga0065165_1001256 Ga0065165_10012564 264
625 3300005262 Ga0065165_1005779 Ga0065165_10057792 264
626 3300005327 Ga0070658_10103957 Ga0070658_101039572 264
627 3300005327 Ga0070658_10373856 Ga0070658_103738562 264
628 3300005328 Ga0070676_10038287 Ga0070676_100382872 264
629 3300005329 Ga0070683_100006785 Ga0070683_1000067857 264
630 3300005329 Ga0070683_100063089 Ga0070683_1000630892 264
631 3300005330 Ga0070690_100139173 Ga0070690_1001391731 264
632 3300005331 Ga0070670_100113110 Ga0070670_1001131102 264
633 3300005331 Ga0070670_100448063 Ga0070670_1004480632 264
634 3300005333 Ga0070677_10161434 Ga0070677_101614341 264
635 3300005334 Ga0068869_100101482 Ga0068869_1001014822 264
636 3300005334 Ga0068869_100270717 Ga0068869_1002707171 264
637 3300005334 Ga0068869_100548301 Ga0068869_1005483011 264
638 3300005334 Ga0068869_100659490 Ga0068869_1006594901 264
639 3300005335 Ga0070666_10210657 Ga0070666_102106572 264
640 3300005336 Ga0070680_100020920 Ga0070680_1000209204 264
641 3300005336 Ga0070680_100176113 Ga0070680_1001761132 264
642 3300005336 Ga0070680_100232420 Ga0070680_1002324202 264
643 3300005337 Ga0070682_100076346 Ga0070682_1000763462 264
644 3300005337 Ga0070682_100220559 Ga0070682_1002205592 264
645 3300005338 Ga0068868_100020206 Ga0068868_1000202062 264
646 3300005338 Ga0068868_100038556 Ga0068868_1000385562 264
647 3300005339 Ga0070660_100025110 Ga0070660_1000251102 264
648 3300005344 Ga0070661_100004410 Ga0070661_1000044104 264
649 3300005344 Ga0070661_100057292 Ga0070661_1000572922 264
650 3300005347 Ga0070668_100016899 Ga0070668_1000168992 264
651 3300005347 Ga0070668_100035262 Ga0070668_1000352623 264
652 3300005347 Ga0070668_100039201 Ga0070668_1000392012 264
653 3300005347 Ga0070668_100049264 Ga0070668_1000492642 264
654 3300005347 Ga0070668_100166549 Ga0070668_1001665492 264
655 3300005354 Ga0070675_100630142 Ga0070675_1006301421 264
656 3300005355 Ga0070671_100205637 Ga0070671_1002056372 264
657 3300005366 Ga0070659_100040136 Ga0070659_1000401362 264
658 3300005366 Ga0070659_100073417 Ga0070659_1000734173 264
659 3300005367 Ga0070667_100203864 Ga0070667_1002038642 264
660 3300005367 Ga0070667_100206712 Ga0070667_1002067122 264
661 3300005434 Ga0070709_10001864 Ga0070709_100018641 264
662 3300005434 Ga0070709_10025801 Ga0070709_100258012 264
663 3300005434 Ga0070709_10255161 Ga0070709_102551612 264
664 3300005435 Ga0070714_100001530 Ga0070714_1000015307 264
665 3300005435 Ga0070714_100106301 Ga0070714_1001063013 264
666 3300005436 Ga0070713_100010561 Ga0070713_1000105612 264
667 3300005436 Ga0070713_100375905 Ga0070713_1003759052 264
668 3300005436 Ga0070713_100543274 Ga0070713_1005432741 264
669 3300005437 Ga0070710_10001292 Ga0070710_100012925 264
670 3300005437 Ga0070710_10074620 Ga0070710_100746202 264
671 3300005437 Ga0070710_10177177 Ga0070710_101771771 264
672 3300005438 Ga0070701_10129409 Ga0070701_101294091 264
673 3300005439 Ga0070711_100011045 Ga0070711_1000110455 264
674 3300005439 Ga0070711_100017968 Ga0070711_1000179683 264
675 3300005439 Ga0070711_100072221 Ga0070711_1000722213 264
676 3300005439 Ga0070711_100474838 Ga0070711_1004748381 264
677 3300005441 Ga0070700_100377799 Ga0070700_1003777992 264
678 3300005444 Ga0070694_100090188 Ga0070694_1000901882 264
679 3300005455 Ga0070663_100028641 Ga0070663_1000286412 264
680 3300005455 Ga0070663_100053700 Ga0070663_1000537002 264
681 3300005455 Ga0070663_100064496 Ga0070663_1000644963 264
682 3300005455 Ga0070663_100116012 Ga0070663_1001160122 264
683 3300005455 Ga0070663_100174049 Ga0070663_1001740492 264
684 3300005455 Ga0070663_100201513 Ga0070663_1002015132 264
685 3300005456 Ga0070678_100194755 Ga0070678_1001947552 264
686 3300005456 Ga0070678_100535655 Ga0070678_1005356552 264
687 3300005456 Ga0070678_100657486 Ga0070678_1006574861 264
688 3300005457 Ga0070662_100314515 Ga0070662_1003145151 264
689 3300005457 Ga0070662_100519827 Ga0070662_1005198271 264
690 3300005458 Ga0070681_10025960 Ga0070681_100259603 264
691 3300005458 Ga0070681_10067612 Ga0070681_100676122 264
692 3300005458 Ga0070681_10110722 Ga0070681_101107222 264
693 3300005459 Ga0068867_100337474 Ga0068867_1003374741 264
694 3300005468 Ga0070707_100410737 Ga0070707_1004107372 264
695 3300005471 Ga0070698_100451188 Ga0070698_1004511882 264
696 3300005530 Ga0070679_100088998 Ga0070679_1000889982 264
697 3300005535 Ga0070684_100043666 Ga0070684_1000436662 264
698 3300005535 Ga0070684_100073039 Ga0070684_1000730393 264
699 3300005535 Ga0070684_100159351 Ga0070684_1001593512 264
700 3300005539 Ga0068853_100025481 Ga0068853_1000254812 264
701 3300005539 Ga0068853_100145661 Ga0068853_1001456612 264
702 3300005539 Ga0068853_100234307 Ga0068853_1002343072 264
703 3300005539 Ga0068853_100415666 Ga0068853_1004156662 264
704 3300005539 Ga0068853_100468896 Ga0068853_1004688961 264
705 3300005544 Ga0070686_100209330 Ga0070686_1002093302 264
706 3300005545 Ga0070695_100326559 Ga0070695_1003265591 264
707 3300005548 Ga0070665_100017685 Ga0070665_1000176855 264
708 3300005548 Ga0070665_100060033 Ga0070665_1000600333 264
709 3300005548 Ga0070665_100069146 Ga0070665_1000691462 264
710 3300005548 Ga0070665_100093763 Ga0070665_1000937632 264
711 3300005548 Ga0070665_100108386 Ga0070665_1001083862 264
712 3300005548 Ga0070665_100371142 Ga0070665_1003711421 264
713 3300005548 Ga0070665_101015425 Ga0070665_1010154251 264
714 3300005563 Ga0068855_100076020 Ga0068855_1000760204 264
715 3300005563 Ga0068855_100265765 Ga0068855_1002657652 264
716 3300005564 Ga0070664_100147623 Ga0070664_1001476232 264
717 3300005577 Ga0068857_100136152 Ga0068857_1001361522 264
718 3300005577 Ga0068857_100449258 Ga0068857_1004492581 264
719 3300005578 Ga0068854_100256004 Ga0068854_1002560041 264
720 3300005578 Ga0068854_100346474 Ga0068854_1003464742 264
721 3300005614 Ga0068856_100001018 Ga0068856_1000010183 264
722 3300005614 Ga0068856_100040360 Ga0068856_1000403602 264
723 3300005614 Ga0068856_100089449 Ga0068856_1000894493 264
724 3300005614 Ga0068856_100825474 Ga0068856_1008254741 264
725 3300005615 Ga0070702_100068032 Ga0070702_1000680322 264
726 3300005615 Ga0070702_100102440 Ga0070702_1001024402 264
727 3300005617 Ga0068859_100177742 Ga0068859_1001777422 264
728 3300005617 Ga0068859_100311569 Ga0068859_1003115692 264
729 3300005618 Ga0068864_100148009 Ga0068864_1001480092 264
730 3300005618 Ga0068864_100638465 Ga0068864_1006384651 264
731 3300005718 Ga0068866_10161301 Ga0068866_101613012 264
732 3300005719 Ga0068861_100164249 Ga0068861_1001642492 264
733 3300005719 Ga0068861_100178058 Ga0068861_1001780582 264
734 3300005719 Ga0068861_100344242 Ga0068861_1003442422 264
735 3300005834 Ga0068851_10017811 Ga0068851_100178112 264
736 3300005834 Ga0068851_10086532 Ga0068851_100865322 264
737 3300005840 Ga0068870_10114426 Ga0068870_101144261 264
738 3300005841 Ga0068863_100213781 Ga0068863_1002137812 264
739 3300005841 Ga0068863_100223032 Ga0068863_1002230322 264
740 3300005842 Ga0068858_100201435 Ga0068858_1002014352 264
741 3300005842 Ga0068858_100316992 Ga0068858_1003169922 264
742 3300005842 Ga0068858_100443978 Ga0068858_1004439782 264
743 3300005842 Ga0068858_100681473 Ga0068858_1006814731 264
744 3300005843 Ga0068860_100141656 Ga0068860_1001416562 264
745 3300005843 Ga0068860_100251682 Ga0068860_1002516821 264
746 3300005843 Ga0068860_100296194 Ga0068860_1002961942 264
747 3300005843 Ga0068860_100432860 Ga0068860_1004328601 264
748 3300005844 Ga0068862_100080359 Ga0068862_1000803592 264
749 3300005844 Ga0068862_100252887 Ga0068862_1002528872 264
750 3300005937 Ga0081455_10003561 Ga0081455_1000356113 264
751 3300005981 Ga0081538_10055588 Ga0081538_100555882 264
752 3300005983 Ga0081540_1005331 Ga0081540_10053316 264
753 3300005983 Ga0081540_1013508 Ga0081540_10135081 264
754 3300005983 Ga0081540_1014693 Ga0081540_10146932 264
755 3300005983 Ga0081540_1019069 Ga0081540_10190692 264
756 3300005983 Ga0081540_1028921 Ga0081540_10289212 264
757 3300005983 Ga0081540_1032545 Ga0081540_10325452 264
758 3300005983 Ga0081540_1056129 Ga0081540_10561292 264
759 3300005983 Ga0081540_1070922 Ga0081540_10709222 264
760 3300005985 Ga0081539_10026237 Ga0081539_100262372 264
761 3300005985 Ga0081539_10057638 Ga0081539_100576382 264
762 3300005985 Ga0081539_10064672 Ga0081539_100646722 264
763 3300006028 Ga0070717_10006670 Ga0070717_100066706 264
764 3300006028 Ga0070717_10027722 Ga0070717_100277222 264
765 3300006028 Ga0070717_10110440 Ga0070717_101104402 264
766 3300006028 Ga0070717_10244962 Ga0070717_102449621 264
767 3300006028 Ga0070717_10273074 Ga0070717_102730742 264
768 3300006028 Ga0070717_10587822 Ga0070717_105878221 264
769 3300006038 Ga0075365_10025909 Ga0075365_100259092 264
770 3300006038 Ga0075365_10077522 Ga0075365_100775222 264
771 3300006038 Ga0075365_10089110 Ga0075365_100891102 264
772 3300006038 Ga0075365_10172366 Ga0075365_101723662 264
773 3300006038 Ga0075365_10178126 Ga0075365_101781262 264
774 3300006038 Ga0075365_10194265 Ga0075365_101942652 264
775 3300006038 Ga0075365_10267683 Ga0075365_102676832 264
776 3300006038 Ga0075365_10298190 Ga0075365_102981901 264
777 3300006042 Ga0075368_10051186 Ga0075368_100511862 264
778 3300006048 Ga0075363_100041314 Ga0075363_1000413142 264
779 3300006048 Ga0075363_100102939 Ga0075363_1001029392 264
780 3300006051 Ga0075364_10076031 Ga0075364_100760312 264
781 3300006051 Ga0075364_10122346 Ga0075364_101223462 264
782 3300006051 Ga0075364_10167290 Ga0075364_101672903 264
783 3300006051 Ga0075364_10243882 Ga0075364_102438822 264
784 3300006163 Ga0070715_10000692 Ga0070715_100006925 264
785 3300006163 Ga0070715_10070033 Ga0070715_100700332 264
786 3300006173 Ga0070716_100047440 Ga0070716_1000474401 264
787 3300006175 Ga0070712_100002905 Ga0070712_1000029054 264
788 3300006177 Ga0075362_10052402 Ga0075362_100524022 264
789 3300006178 Ga0075367_10024247 Ga0075367_100242472 264
790 3300006178 Ga0075367_10073144 Ga0075367_100731442 264
791 3300006178 Ga0075367_10078112 Ga0075367_100781122 264
792 3300006178 Ga0075367_10107392 Ga0075367_101073922 264
793 3300006178 Ga0075367_10207318 Ga0075367_102073181 264
794 3300006186 Ga0075369_10044746 Ga0075369_100447462 264
795 3300006195 Ga0075366_10103637 Ga0075366_101036372 264
796 3300006195 Ga0075366_10117966 Ga0075366_101179661 264
797 3300006195 Ga0075366_10244598 Ga0075366_102445981 264
798 3300006237 Ga0097621_100203993 Ga0097621_1002039932 264
799 3300006237 Ga0097621_100276226 Ga0097621_1002762262 264
800 3300006237 Ga0097621_100401247 Ga0097621_1004012471 264
801 3300006353 Ga0075370_10075364 Ga0075370_100753641 264
802 3300006358 Ga0068871_100033813 Ga0068871_1000338133 264
803 3300006358 Ga0068871_100154445 Ga0068871_1001544452 264
804 3300006847 Ga0075431_100355593 Ga0075431_1003555931 264
805 3300006871 Ga0075434_100015658 Ga0075434_1000156582 264
806 3300006881 Ga0068865_100170632 Ga0068865_1001706322 264
807 3300006881 Ga0068865_100417125 Ga0068865_1004171252 264
808 3300006914 Ga0075436_100152439 Ga0075436_1001524392 264
809 3300006931 Ga0097620_100177750 Ga0097620_1001777501 264
810 3300006931 Ga0097620_100311572 Ga0097620_1003115722 264
811 3300006943 Ga0099822_1024801 Ga0099822_10248012 264
812 3300007076 Ga0075435_100193617 Ga0075435_1001936172 264
813 3300007265 Ga0099794_10028369 Ga0099794_100283692 264
814 3300007265 Ga0099794_10089968 Ga0099794_100899682 264
815 3300007265 Ga0099794_10092687 Ga0099794_100926872 264
816 3300007788 Ga0099795_10034742 Ga0099795_100347422 264
817 3300007788 Ga0099795_10039452 Ga0099795_100394522 264
818 3300009092 Ga0105250_10143620 Ga0105250_101436201 264
819 3300009093 Ga0105240_10152375 Ga0105240_101523752 264
820 3300009093 Ga0105240_10669412 Ga0105240_106694121 264
821 3300009094 Ga0111539_10119914 Ga0111539_101199142 264
822 3300009094 Ga0111539_10403435 Ga0111539_104034352 264
823 3300009098 Ga0105245_10027097 Ga0105245_100270973 264
824 3300009098 Ga0105245_10158408 Ga0105245_101584081 264
825 3300009098 Ga0105245_10362223 Ga0105245_103622232 264
826 3300009101 Ga0105247_10056060 Ga0105247_100560602 264
827 3300009101 Ga0105247_10099147 Ga0105247_100991472 264
828 3300009101 Ga0105247_10209355 Ga0105247_102093552 264
829 3300009101 Ga0105247_10229794 Ga0105247_102297942 264
830 3300009101 Ga0105247_10259585 Ga0105247_102595851 264
831 3300009147 Ga0114129_10653701 Ga0114129_106537012 264
832 3300009148 Ga0105243_10071509 Ga0105243_100715093 264
833 3300009148 Ga0105243_10221113 Ga0105243_102211132 264
834 3300009174 Ga0105241_10050885 Ga0105241_100508852 264
835 3300009174 Ga0105241_10085698 Ga0105241_100856982 264
836 3300009174 Ga0105241_10456516 Ga0105241_104565161 264
837 3300009176 Ga0105242_10138748 Ga0105242_101387482 264
838 3300009177 Ga0105248_10046836 Ga0105248_100468366 264
839 3300009177 Ga0105248_10057103 Ga0105248_100571033 264
840 3300009177 Ga0105248_10133843 Ga0105248_101338431 264
841 3300009177 Ga0105248_10433820 Ga0105248_104338202 264
842 3300009545 Ga0105237_10068946 Ga0105237_100689463 264
843 3300009545 Ga0105237_10138669 Ga0105237_101386692 264
844 3300009545 Ga0105237_10212444 Ga0105237_102124442 264
845 3300009545 Ga0105237_10342503 Ga0105237_103425032 264
846 3300009551 Ga0105238_10003574 Ga0105238_1000357413 264
847 3300009551 Ga0105238_10078604 Ga0105238_100786043 264
848 3300009551 Ga0105238_10079172 Ga0105238_100791723 264
849 3300009551 Ga0105238_10173018 Ga0105238_101730182 264
850 3300009551 Ga0105238_10469780 Ga0105238_104697802 264
851 3300009551 Ga0105238_10604499 Ga0105238_106044992 264
852 3300009553 Ga0105249_10369740 Ga0105249_103697402 264
853 3300010159 Ga0099796_10039618 Ga0099796_100396182 264
854 3300010159 Ga0099796_10041721 Ga0099796_100417212 264
855 3300010375 Ga0105239_10073781 Ga0105239_100737812 264
856 3300010375 Ga0105239_10107432 Ga0105239_101074322 264
857 3300010375 Ga0105239_10131733 Ga0105239_101317332 264
858 3300010375 Ga0105239_10150962 Ga0105239_101509622 264
859 3300010375 Ga0105239_10250822 Ga0105239_102508222 264
860 3300011119 Ga0105246_10023203 Ga0105246_100232032 264
861 3300011119 Ga0105246_10459867 Ga0105246_104598671 264
862 3300011119 Ga0105246_10547430 Ga0105246_105474301 264
863 3300013104 Ga0157370_10073863 Ga0157370_100738633 264
864 3300013104 Ga0157370_10166258 Ga0157370_101662582 264
865 3300013104 Ga0157370_10377581 Ga0157370_103775812 264
866 3300013105 Ga0157369_10037979 Ga0157369_100379796 264
867 3300013105 Ga0157369_10049861 Ga0157369_100498612 264
868 3300013297 Ga0157378_10014732 Ga0157378_100147326 264
869 3300013297 Ga0157378_10733818 Ga0157378_107338181 264
870 3300013297 Ga0157378_10883591 Ga0157378_108835912 264
871 3300013306 Ga0163162_10207638 Ga0163162_102076382 264
872 3300013307 Ga0157372_10523485 Ga0157372_105234852 264
873 3300013307 Ga0157372_10657929 Ga0157372_106579292 264
874 3300013308 Ga0157375_10049447 Ga0157375_100494473 264
875 3300013308 Ga0157375_10455632 Ga0157375_104556321 264
876 3300014325 Ga0163163_10062000 Ga0163163_100620003 264
877 3300014325 Ga0163163_10110182 Ga0163163_101101822 264
878 3300014325 Ga0163163_10260852 Ga0163163_102608522 264
879 3300014325 Ga0163163_10477607 Ga0163163_104776071 264
880 3300014325 Ga0163163_10507350 Ga0163163_105073501 264
881 3300014325 Ga0163163_10540552 Ga0163163_105405522 264
882 3300014325 Ga0163163_10625360 Ga0163163_106253601 264
883 3300014326 Ga0157380_10073085 Ga0157380_100730851 264
884 3300014326 Ga0157380_10134433 Ga0157380_101344332 264
885 3300014326 Ga0157380_10523710 Ga0157380_105237102 264
886 3300014968 Ga0157379_10094448 Ga0157379_100944483 264
887 3300014968 Ga0157379_10102294 Ga0157379_101022942 264
888 3300014969 Ga0157376_10103182 Ga0157376_101031822 264
889 3300014969 Ga0157376_10128319 Ga0157376_101283192 264
890 3300014969 Ga0157376_10175821 Ga0157376_101758212 264
891 3300014969 Ga0157376_10671345 Ga0157376_106713451 264
892 3300014969 Ga0157376_10671697 Ga0157376_106716971 264
893 3300020078 Ga0206352_10327112 Ga0206352_103271122 264
894 3300020082 Ga0206353_10360498 Ga0206353_103604982 264
895 3300021358 Ga0213873_10048796 Ga0213873_100487961 264
896 3300021361 Ga0213872_10035151 Ga0213872_100351512 264
897 3300021384 Ga0213876_10000379 Ga0213876_1000037940 264
898 3300021384 Ga0213876_10027975 Ga0213876_100279752 264
899 3300021384 Ga0213876_10060856 Ga0213876_100608562 264
900 3300021388 Ga0213875_10058079 Ga0213875_100580792 264
901 3300021441 Ga0213871_10012844 Ga0213871_100128442 264
902 3300022467 Ga0224712_10068820 Ga0224712_100688202 264
903 3300025230 Ga0209563_100900 Ga0209563_1009002 264
904 3300025253 Ga0209677_100589 Ga0209677_1005897 264
905 3300025253 Ga0209677_100686 Ga0209677_1006864 264
906 3300025254 Ga0209148_1000192 Ga0209148_100019283 264
907 3300025261 Ga0209233_1030385 Ga0209233_10303851 264
908 3300025272 Ga0209455_1000892 Ga0209455_10008924 264
909 3300025272 Ga0209455_1008942 Ga0209455_10089424 264
910 3300025297 Ga0209758_1000030 Ga0209758_100003096 264
911 3300025297 Ga0209758_1000963 Ga0209758_10009632 264
912 3300025297 Ga0209758_1001374 Ga0209758_100137420 264
913 3300025297 Ga0209758_1002971 Ga0209758_100297112 264
914 3300025297 Ga0209758_1006840 Ga0209758_10068407 264
915 3300025297 Ga0209758_1056005 Ga0209758_10560051 264
916 3300025299 Ga0209256_1007102 Ga0209256_10071022 264
917 3300025302 Ga0207426_1002230 Ga0207426_100223014 264
918 3300025302 Ga0207426_1045987 Ga0207426_10459871 264
919 3300025302 Ga0207426_1049336 Ga0207426_10493362 264
920 3300025303 Ga0209051_1040948 Ga0209051_10409482 264
921 3300025304 Ga0209257_1000778 Ga0209257_10007782 264
922 3300025321 Ga0207656_10249198 Ga0207656_102491981 264
923 3300025898 Ga0207692_10001095 Ga0207692_1000109510 264
924 3300025898 Ga0207692_10001486 Ga0207692_100014868 264
925 3300025898 Ga0207692_10019848 Ga0207692_100198482 264
926 3300025898 Ga0207692_10083894 Ga0207692_100838942 264
927 3300025898 Ga0207692_10150991 Ga0207692_101509912 264
928 3300025900 Ga0207710_10031359 Ga0207710_100313592 264
929 3300025900 Ga0207710_10049449 Ga0207710_100494492 264
930 3300025900 Ga0207710_10056106 Ga0207710_100561062 264
931 3300025903 Ga0207680_10159343 Ga0207680_101593432 264
932 3300025905 Ga0207685_10006479 Ga0207685_100064792 264
933 3300025906 Ga0207699_10003048 Ga0207699_100030485 264
934 3300025906 Ga0207699_10024107 Ga0207699_100241072 264
935 3300025906 Ga0207699_10082251 Ga0207699_100822512 264
936 3300025906 Ga0207699_10101524 Ga0207699_101015241 264
937 3300025908 Ga0207643_10174427 Ga0207643_101744271 264
938 3300025908 Ga0207643_10269159 Ga0207643_102691592 264
939 3300025909 Ga0207705_10046628 Ga0207705_100466282 264
940 3300025910 Ga0207684_10262757 Ga0207684_102627572 264
941 3300025911 Ga0207654_10047597 Ga0207654_100475972 264
942 3300025911 Ga0207654_10182504 Ga0207654_101825042 264
943 3300025912 Ga0207707_10327035 Ga0207707_103270352 264
944 3300025914 Ga0207671_10126097 Ga0207671_101260972 264
945 3300025915 Ga0207693_10002846 Ga0207693_1000284610 264
946 3300025915 Ga0207693_10002989 Ga0207693_100029894 264
947 3300025915 Ga0207693_10054373 Ga0207693_100543732 264
948 3300025915 Ga0207693_10328824 Ga0207693_103288241 264
949 3300025916 Ga0207663_10030130 Ga0207663_100301302 264
950 3300025916 Ga0207663_10108560 Ga0207663_101085602 264
951 3300025917 Ga0207660_10016173 Ga0207660_100161733 264
952 3300025917 Ga0207660_10128437 Ga0207660_101284372 264
953 3300025919 Ga0207657_10003421 Ga0207657_100034213 264
954 3300025919 Ga0207657_10033247 Ga0207657_100332472 264
955 3300025920 Ga0207649_10078949 Ga0207649_100789492 264
956 3300025921 Ga0207652_10016392 Ga0207652_100163925 264
957 3300025921 Ga0207652_10049462 Ga0207652_100494621 264
958 3300025921 Ga0207652_10246762 Ga0207652_102467622 264
959 3300025921 Ga0207652_10496463 Ga0207652_104964631 264
960 3300025922 Ga0207646_10186796 Ga0207646_101867962 264
961 3300025923 Ga0207681_10352857 Ga0207681_103528571 264
962 3300025923 Ga0207681_10379656 Ga0207681_103796562 264
963 3300025923 Ga0207681_10500556 Ga0207681_105005562 264
964 3300025924 Ga0207694_10015922 Ga0207694_100159223 264
965 3300025924 Ga0207694_10219180 Ga0207694_102191802 264
966 3300025924 Ga0207694_10373878 Ga0207694_103738781 264
967 3300025925 Ga0207650_10429883 Ga0207650_104298831 264
968 3300025926 Ga0207659_10552773 Ga0207659_105527731 264
969 3300025927 Ga0207687_10015988 Ga0207687_100159882 264
970 3300025927 Ga0207687_10053389 Ga0207687_100533892 264
971 3300025927 Ga0207687_10240022 Ga0207687_102400222 264
972 3300025928 Ga0207700_10037283 Ga0207700_100372833 264
973 3300025928 Ga0207700_10050229 Ga0207700_100502294 264
974 3300025928 Ga0207700_10165803 Ga0207700_101658032 264
975 3300025929 Ga0207664_10014503 Ga0207664_100145032 264
976 3300025929 Ga0207664_10143538 Ga0207664_101435382 264
977 3300025932 Ga0207690_10477970 Ga0207690_104779701 264
978 3300025933 Ga0207706_10040481 Ga0207706_100404811 264
979 3300025933 Ga0207706_10152726 Ga0207706_101527262 264
980 3300025933 Ga0207706_10155994 Ga0207706_101559942 264
981 3300025934 Ga0207686_10045445 Ga0207686_100454452 264
982 3300025935 Ga0207709_10043282 Ga0207709_100432823 264
983 3300025937 Ga0207669_10006847 Ga0207669_100068474 264
984 3300025937 Ga0207669_10116476 Ga0207669_101164762 264
985 3300025938 Ga0207704_10248610 Ga0207704_102486101 264
986 3300025938 Ga0207704_10348784 Ga0207704_103487842 264
987 3300025939 Ga0207665_10001253 Ga0207665_100012536 264
988 3300025939 Ga0207665_10013855 Ga0207665_100138552 264
989 3300025939 Ga0207665_10069404 Ga0207665_100694041 264
990 3300025939 Ga0207665_10111687 Ga0207665_101116871 264
991 3300025939 Ga0207665_10121463 Ga0207665_101214632 264
992 3300025939 Ga0207665_10139468 Ga0207665_101394682 264
993 3300025939 Ga0207665_10532829 Ga0207665_105328292 264
994 3300025940 Ga0207691_10207495 Ga0207691_102074952 264
995 3300025941 Ga0207711_10049144 Ga0207711_100491442 264
996 3300025941 Ga0207711_10254340 Ga0207711_102543401 264
997 3300025941 Ga0207711_10439987 Ga0207711_104399872 264
998 3300025942 Ga0207689_10204450 Ga0207689_102044502 264
999 3300025942 Ga0207689_10649328 Ga0207689_106493281 264
1000 3300025944 Ga0207661_10001342 Ga0207661_100013423 264
1001 3300025949 Ga0207667_10023451 Ga0207667_100234515 264
1002 3300025949 Ga0207667_10296839 Ga0207667_102968392 264
1003 3300025949 Ga0207667_10720176 Ga0207667_107201761 264
1004 3300025960 Ga0207651_10180529 Ga0207651_101805292 264
1005 3300025960 Ga0207651_10472116 Ga0207651_104721161 264
1006 3300025961 Ga0207712_10625430 Ga0207712_106254302 264
1007 3300025972 Ga0207668_10004124 Ga0207668_100041247 264
1008 3300025972 Ga0207668_10123496 Ga0207668_101234962 264
1009 3300025972 Ga0207668_10212140 Ga0207668_102121402 264
1010 3300025972 Ga0207668_10228602 Ga0207668_102286022 264
1011 3300025981 Ga0207640_10123629 Ga0207640_101236292 264
1012 3300026023 Ga0207677_10022538 Ga0207677_100225383 264
1013 3300026023 Ga0207677_10066679 Ga0207677_100666792 264
1014 3300026035 Ga0207703_10276266 Ga0207703_102762662 264
1015 3300026041 Ga0207639_10001314 Ga0207639_100013141 264
1016 3300026041 Ga0207639_10128686 Ga0207639_101286862 264
1017 3300026041 Ga0207639_10215547 Ga0207639_102155472 264
1018 3300026041 Ga0207639_10309103 Ga0207639_103091032 264
1019 3300026067 Ga0207678_10049702 Ga0207678_100497022 264
1020 3300026067 Ga0207678_10050540 Ga0207678_100505401 264
1021 3300026067 Ga0207678_10056281 Ga0207678_100562812 264
1022 3300026067 Ga0207678_10107910 Ga0207678_101079102 264
1023 3300026067 Ga0207678_10151225 Ga0207678_101512252 264
1024 3300026067 Ga0207678_10161436 Ga0207678_101614362 264
1025 3300026067 Ga0207678_10178825 Ga0207678_101788252 264
1026 3300026067 Ga0207678_10269903 Ga0207678_102699032 264
1027 3300026075 Ga0207708_10302338 Ga0207708_103023382 264
1028 3300026078 Ga0207702_10000589 Ga0207702_1000058924 264
1029 3300026078 Ga0207702_10561532 Ga0207702_105615322 264
1030 3300026078 Ga0207702_10596651 Ga0207702_105966511 264
1031 3300026078 Ga0207702_10696890 Ga0207702_106968901 264
1032 3300026088 Ga0207641_10115883 Ga0207641_101158832 264
1033 3300026088 Ga0207641_10494314 Ga0207641_104943142 264
1034 3300026089 Ga0207648_10115297 Ga0207648_101152972 264
1035 3300026095 Ga0207676_10092749 Ga0207676_100927492 264
1036 3300026095 Ga0207676_10366987 Ga0207676_103669872 264
1037 3300026116 Ga0207674_10005581 Ga0207674_100055813 264
1038 3300026116 Ga0207674_10434216 Ga0207674_104342162 264
1039 3300026118 Ga0207675_100011675 Ga0207675_1000116755 264
1040 3300026118 Ga0207675_100258163 Ga0207675_1002581632 264
1041 3300026121 Ga0207683_10069852 Ga0207683_100698523 264
1042 3300026121 Ga0207683_10087590 Ga0207683_100875902 264
1043 3300026121 Ga0207683_10216350 Ga0207683_102163502 264
1044 3300026121 Ga0207683_10237500 Ga0207683_102375002 264
1045 3300026142 Ga0207698_10250937 Ga0207698_102509372 264
1046 3300027357 Ga0209589_1000017 Ga0209589_10000172 264
1047 3300027361 Ga0209489_100018 Ga0209489_1000182 264
1048 3300027363 Ga0209700_100028 Ga0209700_1000282 264
1049 3300027671 Ga0209588_1064418 Ga0209588_10644181 264
1050 3300027907 Ga0207428_10057863 Ga0207428_100578632 264
1051 3300028379 Ga0268266_10003301 Ga0268266_1000330114 264
1052 3300028379 Ga0268266_10004550 Ga0268266_100045502 264
1053 3300028379 Ga0268266_10009757 Ga0268266_100097572 264
1054 3300028379 Ga0268266_10039193 Ga0268266_100391934 264
1055 3300028379 Ga0268266_10047642 Ga0268266_100476422 264
1056 3300028379 Ga0268266_10569525 Ga0268266_105695251 264
1057 3300028380 Ga0268265_10068111 Ga0268265_100681112 264
1058 3300028380 Ga0268265_10233380 Ga0268265_102333802 264
1059 3300028381 Ga0268264_10146383 Ga0268264_101463832 264
1060 3300028381 Ga0268264_10223930 Ga0268264_102239301 264
1061 3300028381 Ga0268264_10444787 Ga0268264_104447871 264
1062 3300028558 Ga0265326_10024038 Ga0265326_100240381 264
1063 3300028563 Ga0265319_1001409 Ga0265319_100140913 264
1064 3300028573 Ga0265334_10001624 Ga0265334_100016248 264
1065 3300028577 Ga0265318_10006240 Ga0265318_100062402 264
1066 3300028653 Ga0265323_10000684 Ga0265323_1000068410 264
1067 3300028666 Ga0265336_10000459 Ga0265336_1000045913 264
1068 3300028786 Ga0307517_10002574 Ga0307517_100025747 264
1069 3300028794 Ga0307515_10027983 Ga0307515_100279833 264
1070 3300028794 Ga0307515_10101962 Ga0307515_101019622 264
1071 3300028794 Ga0307515_10318185 Ga0307515_103181852 264
1072 3300028794 Ga0307515_10319947 Ga0307515_103199472 264
1073 3300028800 Ga0265338_10002741 Ga0265338_1000274110 264
1074 3300029957 Ga0265324_10002054 Ga0265324_100020547 264
1075 3300031235 Ga0265330_10003717 Ga0265330_100037175 264
1076 3300031235 Ga0265330_10005196 Ga0265330_100051963 264
1077 3300031235 Ga0265330_10080725 Ga0265330_100807252 264
1078 3300031238 Ga0265332_10026658 Ga0265332_100266582 264
1079 3300031239 Ga0265328_10077962 Ga0265328_100779621 264
1080 3300031241 Ga0265325_10004205 Ga0265325_100042056 264
1081 3300031250 Ga0265331_10000113 Ga0265331_1000011369 264
1082 3300031344 Ga0265316_10389572 Ga0265316_103895721 264
1083 3300031456 Ga0307513_10129649 Ga0307513_101296492 264
1084 3300031456 Ga0307513_10157467 Ga0307513_101574672 264
1085 3300031507 Ga0307509_10165598 Ga0307509_101655981 264
1086 3300031616 Ga0307508_10020956 Ga0307508_100209564 264
1087 3300031616 Ga0307508_10104174 Ga0307508_101041741 264
1088 3300031711 Ga0265314_10007930 Ga0265314_1000793011 264
1089 3300031711 Ga0265314_10167255 Ga0265314_101672552 264
1090 3300031712 Ga0265342_10021922 Ga0265342_100219222 264
1091 3300031712 Ga0265342_10037780 Ga0265342_100377801 264
1092 3300031730 Ga0307516_10204685 Ga0307516_102046852 264
1093 3300031731 Ga0307405_10215055 Ga0307405_102150551 264
1094 3300031901 Ga0307406_10422755 Ga0307406_104227551 264
1095 3300031911 Ga0307412_10242146 Ga0307412_102421462 264
1096 3300031911 Ga0307412_10256728 Ga0307412_102567282 264
1097 3300031995 Ga0307409_100019096 Ga0307409_1000190963 264
1098 3300032002 Ga0307416_100525870 Ga0307416_1005258702 264
1099 3300032002 Ga0307416_100801905 Ga0307416_1008019051 264
1100 3300032002 Ga0307416_100992969 Ga0307416_1009929691 264
1101 3300032005 Ga0307411_10353908 Ga0307411_103539081 264
1102 3300032126 Ga0307415_100035272 Ga0307415_1000352723 264
1103 3300033179 Ga0307507_10131484 Ga0307507_101314842 264
1104 3300033179 Ga0307507_10286597 Ga0307507_102865971 264
1105 3300033180 Ga0307510_10002191 Ga0307510_1000219115 264
1106 3300033180 Ga0307510_10005503 Ga0307510_1000550310 264
1107 3300033180 Ga0307510_10014423 Ga0307510_100144235 264
1108 3300033180 Ga0307510_10205698 Ga0307510_102056982 264
1109 3300035086 Ga0373934_0002927 Ga0373934_0002927_4504_5304 264
1110 3300035111 Ga0373923_0001517 Ga0373923_0001517_5714_6514 264
1111 3300035112 Ga0373932_0043812 Ga0373932_0043812_461_1261 264
1112 3300035113 Ga0373936_0003688 Ga0373936_0003688_4158_4958 264
1113 3300035116 Ga0373945_0026797 Ga0373945_0026797_516_1316 264
1114 3300035116 Ga0373945_0090801 Ga0373945_0090801_54_854 264
1115 3300035117 Ga0373953_0002334 Ga0373953_0002334_902_1702 264
1116 3300035117 Ga0373953_0020514 Ga0373953_0020514_1627_2427 264
1117 3300035117 Ga0373953_0064608 Ga0373953_0064608_317_1120 264
1118 3300035118 Ga0373954_0000308 Ga0373954_0000308_5601_6401 264
1119 3300035118 Ga0373954_0081215 Ga0373954_0081215_218_1021 264
1120 3300035118 Ga0373954_0188012 Ga0373954_0188012_133_933 264
1121 3300035119 Ga0373956_0007091 Ga0373956_0007091_763_1563 264
1122 3300035119 Ga0373956_0024134 Ga0373956_0024134_919_1719 264
1123 3300035120 Ga0373957_0035099 Ga0373957_0035099_281_1081 264
1124 3300035120 Ga0373957_0084416 Ga0373957_0084416_315_1115 264
1125 3300035120 Ga0373957_0099505 Ga0373957_0099505_180_980 264
1126 3300035170 Ga0373943_0064203 Ga0373943_0064203_67_867 264
1127 3300035172 Ga0373955_0000479 Ga0373955_0000479_6691_7491 264
1128 3300035172 Ga0373955_0013850 Ga0373955_0013850_1363_2166 264
1129 3300035172 Ga0373955_0031548 Ga0373955_0031548_964_1764 264
1130 3300035172 Ga0373955_0037818 Ga0373955_0037818_381_1181 264
1131 3300035241 Ga0373961_0040437 Ga0373961_0040437_326_1126 264
1132 3300035410 Ga0373924_0001372 Ga0373924_0001372_481_1281 264
1133 3300035410 Ga0373924_0003769 Ga0373924_0003769_4011_4811 264
1134 3300035691 Ga0373931_0004987 Ga0373931_0004987_1183_1983 264
1135 3300035691 Ga0373931_0019791 Ga0373931_0019791_2181_2981 264
1136 3300035692 Ga0373935_0000119 Ga0373935_0000119_16767_17567 264
1137 3300035695 Ga0373927_0000965 Ga0373927_0000965_3395_4195 264
1138 3300035695 Ga0373927_0004272 Ga0373927_0004272_9021_9821 264
1139 3300035695 Ga0373927_0015399 Ga0373927_0015399_1409_2209 264
1140 3300035695 Ga0373927_0023855 Ga0373927_0023855_955_1755 264
1141 3300035695 Ga0373927_0059057 Ga0373927_0059057_1510_2310 264
1142 3300035724 Ga0373933_0001108 Ga0373933_0001108_4681_5481 264
1143 3300035724 Ga0373933_0001668 Ga0373933_0001668_11116_11916 264
1144 3300035724 Ga0373933_0100519 Ga0373933_0100519_270_1070 264
1145 3300035725 Ga0373947_0001785 Ga0373947_0001785_786_1586 264
1146 3300036401 Ga0373937_0005638 Ga0373937_0005638_6197_6997 264
1147 3300036401 Ga0373937_0006200 Ga0373937_0006200_8383_9186 264
1148 3300036401 Ga0373937_0125029 Ga0373937_0125029_472_1272 264
1149 3300036401 Ga0373937_0192146 Ga0373937_0192146_330_1130 264
1150 3300036401 Ga0373937_0735686 Ga0373937_0735686_17_817 264
1151 3300037068 Ga0373925_0022704 Ga0373925_0022704_581_1381 264
1152 3300037068 Ga0373925_0151490 Ga0373925_0151490_402_1202 264
1153 3300037068 Ga0373925_0467483 Ga0373925_0467483_107_907 264
1154 3300037312 Ga0395899_0134752 Ga0395899_0134752_233_1033 264
1155 3300037418 Ga0395900_0000787 Ga0395900_0000787_29465_30265 264
1156 3300037418 Ga0395900_0092771 Ga0395900_0092771_2234_3034 264
1157 3300037418 Ga0395900_0217539 Ga0395900_0217539_1035_1835 264
1158 3300037466 Ga0395898_0009257 Ga0395898_0009257_6513_7313 264
1159 3300037466 Ga0395898_0022662 Ga0395898_0022662_1123_1920 264
1160 3300037466 Ga0395898_0083383 Ga0395898_0083383_173_973 264
1161 3300037466 Ga0395898_0277124 Ga0395898_0277124_505_1305 264
1162 3300037471 Ga0395905_0003015 Ga0395905_0003015_2206_3006 264
1163 3300037471 Ga0395905_0205532 Ga0395905_0205532_948_1748 264
1164 3300037853 Ga0436364_1247840 Ga0436364_1247840_559_1359 264
1165 3300038443 Ga0395901_0449065 Ga0395901_0449065_337_1137 264
1166 3300038443 Ga0395901_0629020 Ga0395901_0629020_68_868 264
1167 3300039437 Ga0436365_0121548 Ga0436365_0121548_265_1065 264
1168 3300039437 Ga0436365_0542778 Ga0436365_0542778_297_1097 264
1169 3300039437 Ga0436365_0736791 Ga0436365_0736791_50_850 264
1170 3300039437 Ga0436365_0770725 Ga0436365_0770725_441_1241 264
1171 3300039437 Ga0436365_1093355 Ga0436365_1093355_809_1609 264
1172 3300039437 Ga0436365_1141460 Ga0436365_1141460_739_1539 264
1173 3300039437 Ga0436365_1196036 Ga0436365_1196036_48480_49286 264
1174 3300039437 Ga0436365_1212928 Ga0436365_1212928_1147_1947 264
1175 3300039438 Ga0436360_0502011 Ga0436360_0502011_253_1053 264
1176 3300039438 Ga0436360_0799468 Ga0436360_0799468_287_1087 264
1177 3300039438 Ga0436360_0876230 Ga0436360_0876230_1040_1840 264
1178 3300039438 Ga0436360_1176238 Ga0436360_1176238_441_1241 264
1179 3300039447 Ga0436361_0601086 Ga0436361_0601086_976_1776 264
1180 3300039447 Ga0436361_0628280 Ga0436361_0628280_892_1692 264
1181 3300039450 Ga0436363_0333985 Ga0436363_0333985_82_882 264
1182 3300039450 Ga0436363_1379096 Ga0436363_1379096_178_978 264
1183 3300039450 Ga0436363_1460349 Ga0436363_1460349_8686_9486 264
1184 3300039453 Ga0436362_0510213 Ga0436362_0510213_42_842 264
1185 3300041413 Ga0439465_0048330 Ga0439465_0048330_530_1330 264
1186 3300041452 Ga0451793_0670052 Ga0451793_0670052_370_1170 264
1187 3300041460 Ga0451802_0602542 Ga0451802_0602542_217_1017 264
1188 3300042157 Ga0439458_0063069 Ga0439458_0063069_116_916 264
1189 3300044656 Ga0466969_0035525 Ga0466969_0035525_851_1651 264
1190 3300044658 Ga0466972_0085742 Ga0466972_0085742_663_1463 264
1191 3300044683 Ga0466965_0023487 Ga0466965_0023487_1021_1821 264
1192 3300044684 Ga0466966_0005407 Ga0466966_0005407_5154_5954 264
1193 3300044693 Ga0466961_0000446 Ga0466961_0000446_12211_13011 264
1194 3300044693 Ga0466961_0078250 Ga0466961_0078250_1193_1993 264
1195 3300044706 Ga0466964_0077869 Ga0466964_0077869_450_1250 264
1196 3300044706 Ga0466964_0242953 Ga0466964_0242953_64_864 264
1197 3300044735 Ga0466968_0015129 Ga0466968_0015129_969_1769 264
1198 3300044901 Ga0466960_0087155 Ga0466960_0087155_709_1509 264
1199 3300045049 Ga0466959_0015178 Ga0466959_0015178_3611_4411 264
1200 3300045049 Ga0466959_0049485 Ga0466959_0049485_1556_2356 264
1201 3300045976 Ga0466967_0018622 Ga0466967_0018622_2916_3716 264
1202 3300046452 Ga0495617_067131 Ga0495617_067131_211_1011 264
1203 3300046454 Ga0495592_0001710 Ga0495592_0001710_3670_4470 264
1204 3300046454 Ga0495592_0010188 Ga0495592_0010188_2256_3056 264
1205 3300046454 Ga0495592_0194101 Ga0495592_0194101_343_1143 264
1206 3300046454 Ga0495592_0273579 Ga0495592_0273579_196_996 264
1207 3300046455 Ga0495603_0001895 Ga0495603_0001895_805_1605 264
1208 3300046455 Ga0495603_0029402 Ga0495603_0029402_1022_1822 264
1209 3300046455 Ga0495603_0077918 Ga0495603_0077918_203_1003 264
1210 3300046455 Ga0495603_0101825 Ga0495603_0101825_154_954 264
1211 3300046455 Ga0495603_0106449 Ga0495603_0106449_823_1623 264
1212 3300046457 Ga0495590_0058882 Ga0495590_0058882_261_1061 264
1213 3300046459 Ga0495629_0000348 Ga0495629_0000348_27310_28110 264
1214 3300046459 Ga0495629_0000353 Ga0495629_0000353_12732_13532 264
1215 3300046459 Ga0495629_0083140 Ga0495629_0083140_108_908 264
1216 3300046459 Ga0495629_0100825 Ga0495629_0100825_326_1126 264
1217 3300046459 Ga0495629_0150241 Ga0495629_0150241_800_1600 264
1218 3300046460 Ga0495638_0008632 Ga0495638_0008632_4438_5238 264
1219 3300046460 Ga0495638_0011137 Ga0495638_0011137_377_1177 264
1220 3300046460 Ga0495638_0015142 Ga0495638_0015142_2497_3297 264
1221 3300046460 Ga0495638_0215063 Ga0495638_0215063_56_856 264
1222 3300046461 Ga0495641_0000972 Ga0495641_0000972_6239_7039 264
1223 3300046462 Ga0495651_0005720 Ga0495651_0005720_1848_2648 264
1224 3300046462 Ga0495651_0009935 Ga0495651_0009935_800_1600 264
1225 3300046462 Ga0495651_0023259 Ga0495651_0023259_3781_4581 264
1226 3300046462 Ga0495651_0027908 Ga0495651_0027908_2325_3125 264
1227 3300046462 Ga0495651_0080407 Ga0495651_0080407_902_1702 264
1228 3300046462 Ga0495651_0125451 Ga0495651_0125451_135_935 264
1229 3300046463 Ga0495653_0007405 Ga0495653_0007405_243_1043 264
1230 3300046463 Ga0495653_0074094 Ga0495653_0074094_1482_2282 264
1231 3300046463 Ga0495653_0149706 Ga0495653_0149706_60_860 264
1232 3300046471 Ga0495650_0018520 Ga0495650_0018520_1063_1863 264
1233 3300046471 Ga0495650_0040687 Ga0495650_0040687_658_1458 264
1234 3300046472 Ga0495580_0001291 Ga0495580_0001291_596_1396 264
1235 3300046472 Ga0495580_0108232 Ga0495580_0108232_208_1008 264
1236 3300046472 Ga0495580_0158865 Ga0495580_0158865_751_1551 264
1237 3300046473 Ga0495582_0000444 Ga0495582_0000444_11841_12641 264
1238 3300046475 Ga0495639_0000177 Ga0495639_0000177_25561_26361 264
1239 3300046475 Ga0495639_0023674 Ga0495639_0023674_476_1276 264
1240 3300046476 Ga0495662_0001662 Ga0495662_0001662_9897_10697 264
1241 3300046477 Ga0495664_0108480 Ga0495664_0108480_96_896 264
1242 3300046492 Ga0495585_0055573 Ga0495585_0055573_491_1291 264
1243 3300046492 Ga0495585_0243050 Ga0495585_0243050_73_873 264
1244 3300046499 Ga0495594_0000079 Ga0495594_0000079_12150_12950 264
1245 3300046507 Ga0495606_0008637 Ga0495606_0008637_7138_7938 264
1246 3300046507 Ga0495606_0057292 Ga0495606_0057292_1031_1831 264
1247 3300046507 Ga0495606_0077676 Ga0495606_0077676_711_1511 264
1248 3300046507 Ga0495606_0085779 Ga0495606_0085779_103_903 264
1249 3300046511 Ga0495608_0000368 Ga0495608_0000368_25066_25866 264
1250 3300046511 Ga0495608_0018906 Ga0495608_0018906_1074_1874 264
1251 3300046511 Ga0495608_0145895 Ga0495608_0145895_212_1012 264
1252 3300046512 Ga0495610_0049526 Ga0495610_0049526_965_1765 264
1253 3300046513 Ga0495616_0088347 Ga0495616_0088347_41_841 264
1254 3300046513 Ga0495616_0095689 Ga0495616_0095689_87_887 264
1255 3300046513 Ga0495616_0113313 Ga0495616_0113313_424_1224 264
1256 3300046514 Ga0495618_0009426 Ga0495618_0009426_3852_4652 264
1257 3300046514 Ga0495618_0017517 Ga0495618_0017517_408_1208 264
1258 3300046514 Ga0495618_0240556 Ga0495618_0240556_112_912 264
1259 3300046515 Ga0495620_0094294 Ga0495620_0094294_294_1094 264
1260 3300046516 Ga0495628_0062818 Ga0495628_0062818_36_836 264
1261 3300046516 Ga0495628_0072261 Ga0495628_0072261_1583_2383 264
1262 3300046516 Ga0495628_0129420 Ga0495628_0129420_490_1290 264
1263 3300046516 Ga0495628_0203187 Ga0495628_0203187_61_861 264
1264 3300046516 Ga0495628_0225212 Ga0495628_0225212_488_1288 264
1265 3300046517 Ga0495630_0011873 Ga0495630_0011873_2112_2912 264
1266 3300046517 Ga0495630_0370520 Ga0495630_0370520_38_838 264
1267 3300046519 Ga0495632_0076839 Ga0495632_0076839_303_1103 264
1268 3300046519 Ga0495632_0133454 Ga0495632_0133454_152_952 264
1269 3300046520 Ga0495637_0081861 Ga0495637_0081861_219_1019 264
1270 3300046520 Ga0495637_0093763 Ga0495637_0093763_144_944 264
1271 3300046520 Ga0495637_0102108 Ga0495637_0102108_183_983 264
1272 3300046522 Ga0495643_0071487 Ga0495643_0071487_349_1149 264
1273 3300046522 Ga0495643_0159415 Ga0495643_0159415_169_969 264
1274 3300046524 Ga0495648_0001441 Ga0495648_0001441_4230_5030 264
1275 3300046524 Ga0495648_0050416 Ga0495648_0050416_1599_2399 264
1276 3300046524 Ga0495648_0074623 Ga0495648_0074623_140_940 264
1277 3300046524 Ga0495648_0093296 Ga0495648_0093296_145_945 264
1278 3300046526 Ga0495666_0112566 Ga0495666_0112566_251_1051 264
1279 3300046529 Ga0495652_0003538 Ga0495652_0003538_7702_8502 264
1280 3300046529 Ga0495652_0044979 Ga0495652_0044979_2125_2925 264
1281 3300046529 Ga0495652_0056577 Ga0495652_0056577_159_959 264
1282 3300046529 Ga0495652_0302334 Ga0495652_0302334_247_1047 264
1283 3300046529 Ga0495652_0303133 Ga0495652_0303133_305_1105 264
1284 3300046530 Ga0495654_0032691 Ga0495654_0032691_771_1571 264
1285 3300046530 Ga0495654_0046918 Ga0495654_0046918_615_1415 264
1286 3300046531 Ga0495665_0000570 Ga0495665_0000570_442_1242 264
1287 3300046533 Ga0495640_0000938 Ga0495640_0000938_19498_20298 264
1288 3300046533 Ga0495640_0008034 Ga0495640_0008034_4611_5411 264
1289 3300046533 Ga0495640_0029702 Ga0495640_0029702_2983_3783 264
1290 3300046535 Ga0495586_0265305 Ga0495586_0265305_97_897 264
1291 3300046536 Ga0495587_0004424 Ga0495587_0004424_464_1264 264
1292 3300046537 Ga0495598_0001754 Ga0495598_0001754_935_1735 264
1293 3300046543 Ga0495645_0231641 Ga0495645_0231641_29_829 264
1294 3300046543 Ga0495645_0380495 Ga0495645_0380495_72_872 264
1295 3300046557 Ga0495622_0000888 Ga0495622_0000888_12255_13055 264
1296 3300046557 Ga0495622_0013293 Ga0495622_0013293_1553_2353 264
1297 3300046557 Ga0495622_0071534 Ga0495622_0071534_260_1060 264
1298 3300046558 Ga0495633_0083705 Ga0495633_0083705_636_1436 264
1299 3300046558 Ga0495633_0105571 Ga0495633_0105571_401_1201 264
1300 3300046559 Ga0495667_0007023 Ga0495667_0007023_3351_4151 264
1301 3300046559 Ga0495667_0315678 Ga0495667_0315678_105_905 264
1302 3300046615 Ga0495656_0001212 Ga0495656_0001212_858_1658 264
1303 3300046615 Ga0495656_0045656 Ga0495656_0045656_935_1735 264
1304 3300046616 Ga0495668_0113544 Ga0495668_0113544_530_1330 264
1305 3300046616 Ga0495668_0174264 Ga0495668_0174264_304_1104 264
1306 3300046616 Ga0495668_0182158 Ga0495668_0182158_169_969 264
1307 3300046616 Ga0495668_0192483 Ga0495668_0192483_262_1062 264
1308 3300046616 Ga0495668_0215629 Ga0495668_0215629_81_881 264
1309 3300046642 Ga0495634_0000334 Ga0495634_0000334_18082_18882 264
1310 3300046642 Ga0495634_0004641 Ga0495634_0004641_8588_9388 264
1311 3300046642 Ga0495634_0102275 Ga0495634_0102275_612_1412 264
1312 3300046660 Ga0495625_0045332 Ga0495625_0045332_111_911 264
1313 3300046660 Ga0495625_0101996 Ga0495625_0101996_740_1540 264
1314 3300046660 Ga0495625_0119561 Ga0495625_0119561_873_1673 264
1315 3300046660 Ga0495625_0231017 Ga0495625_0231017_83_883 264
1316 3300046660 Ga0495625_0317373 Ga0495625_0317373_102_902 264
1317 3300046663 Ga0495635_0000372 Ga0495635_0000372_21983_22783 264
1318 3300046663 Ga0495635_0004370 Ga0495635_0004370_1278_2078 264
1319 3300046664 Ga0495659_0007020 Ga0495659_0007020_789_1589 264
1320 3300046664 Ga0495659_0023775 Ga0495659_0023775_273_1073 264
1321 3300046665 Ga0495661_0045906 Ga0495661_0045906_1164_1964 264
1322 3300046665 Ga0495661_0184630 Ga0495661_0184630_27_827 264
1323 3300046674 Ga0495588_0038425 Ga0495588_0038425_1092_1892 264
1324 3300046674 Ga0495588_0046186 Ga0495588_0046186_316_1116 264
1325 3300046674 Ga0495588_0191832 Ga0495588_0191832_207_1007 264
1326 3300046675 Ga0495657_0006148 Ga0495657_0006148_4146_4946 264
1327 3300046675 Ga0495657_0010390 Ga0495657_0010390_1393_2193 264
1328 3300046675 Ga0495657_0044452 Ga0495657_0044452_294_1094 264
1329 3300046675 Ga0495657_0177171 Ga0495657_0177171_449_1249 264
1330 3300046678 Ga0495599_0018187 Ga0495599_0018187_1103_1903 264
1331 3300046678 Ga0495599_0114109 Ga0495599_0114109_419_1219 264
1332 3300046679 Ga0495623_0009665 Ga0495623_0009665_995_1795 264
1333 3300046680 Ga0495646_0003761 Ga0495646_0003761_3009_3809 264
1334 3300046680 Ga0495646_0020785 Ga0495646_0020785_1223_2023 264
1335 3300046681 Ga0495647_0000312 Ga0495647_0000312_805_1605 264
1336 3300046683 Ga0495658_0000416 Ga0495658_0000416_1445_2245 264
1337 3300046684 Ga0495669_0042244 Ga0495669_0042244_246_1046 264
1338 3300046689 Ga0495613_0010249 Ga0495613_0010249_2127_2927 264
1339 3300046689 Ga0495613_0013379 Ga0495613_0013379_1741_2541 264
1340 3300046690 Ga0495624_0003210 Ga0495624_0003210_1606_2406 264
1341 3300046690 Ga0495624_0117312 Ga0495624_0117312_253_1053 264
1342 3300046690 Ga0495624_0160495 Ga0495624_0160495_289_1089 264
1343 3300046691 Ga0495670_0126710 Ga0495670_0126710_391_1191 264
1344 3300046692 Ga0495671_0061788 Ga0495671_0061788_284_1084 264
1345 3300046694 Ga0495649_0071092 Ga0495649_0071092_409_1209 264
1346 3300046794 Ga0495589_0049818 Ga0495589_0049818_814_1614 264
1347 3300046794 Ga0495589_0055679 Ga0495589_0055679_705_1505 264
1348 3300046794 Ga0495589_0069750 Ga0495589_0069750_458_1258 264
1349 3300046794 Ga0495589_0091870 Ga0495589_0091870_103_903 264
1350 3300046809 Ga0495600_0001217 Ga0495600_0001217_7573_8373 264
1351 3300046809 Ga0495600_0008584 Ga0495600_0008584_4171_4971 264
1352 3300046809 Ga0495600_0051602 Ga0495600_0051602_1129_1929 264
1353 3300046809 Ga0495600_0116656 Ga0495600_0116656_96_896 264
1354 3300046810 Ga0495660_0049733 Ga0495660_0049733_337_1137 264
1355 3300046810 Ga0495660_0095371 Ga0495660_0095371_150_950 264
1356 3300047315 Ga0495581_0000426 Ga0495581_0000426_7975_8775 264
1357 3300047315 Ga0495581_0090963 Ga0495581_0090963_472_1272 264
1358 3300047317 Ga0495604_0010461 Ga0495604_0010461_3865_4665 264
1359 3300047317 Ga0495604_0012415 Ga0495604_0012415_1976_2776 264
1360 3300047317 Ga0495604_0189193 Ga0495604_0189193_560_1360 264
1361 3300047318 Ga0495636_0087362 Ga0495636_0087362_471_1271 264
1362 3300047319 Ga0495674_0000533 Ga0495674_0000533_17143_17943 264
1363 3300047319 Ga0495674_0019041 Ga0495674_0019041_111_911 264
1364 3300047320 Ga0495672_0089178 Ga0495672_0089178_390_1190 264
1365 3300047321 Ga0495676_0056269 Ga0495676_0056269_1184_1984 264
1366 3300047321 Ga0495676_0073567 Ga0495676_0073567_1115_1915 264
1367 3300047321 Ga0495676_0195066 Ga0495676_0195066_78_878 264
1368 3300047322 Ga0495680_0007925 Ga0495680_0007925_3655_4455 264
1369 3300047322 Ga0495680_0176521 Ga0495680_0176521_421_1221 264
1370 3300047444 Ga0495675_0003518 Ga0495675_0003518_3601_4401 264
1371 3300047446 Ga0495679_037220 Ga0495679_037220_11_811 264
1372 3300047447 Ga0495685_027462 Ga0495685_027462_872_1672 264
1373 3300047469 Ga0495673_0019403 Ga0495673_0019403_946_1746 264
1374 3300047469 Ga0495673_0123858 Ga0495673_0123858_181_981 264
1375 3300047469 Ga0495673_0137047 Ga0495673_0137047_24_824 264
1376 3300047471 Ga0495684_0001014 Ga0495684_0001014_11496_12296 264
1377 3300047471 Ga0495684_0057861 Ga0495684_0057861_620_1420 264
1378 3300047472 Ga0495686_0028879 Ga0495686_0028879_261_1061 264
1379 3300047472 Ga0495686_0091427 Ga0495686_0091427_121_921 264
1380 3300047472 Ga0495686_0198465 Ga0495686_0198465_61_861 264
1381 3300047472 Ga0495686_0205040 Ga0495686_0205040_205_1005 264
1382 3300047673 Ga0495593_0023687 Ga0495593_0023687_805_1605 264
1383 3300047673 Ga0495593_0031577 Ga0495593_0031577_637_1437 264
1384 3300047673 Ga0495593_0038062 Ga0495593_0038062_1708_2508 264
1385 3300047673 Ga0495593_0156747 Ga0495593_0156747_223_1023 264
1386 3300048088 Ga0495602_0005816 Ga0495602_0005816_5669_6469 264
1387 3300048088 Ga0495602_0226127 Ga0495602_0226127_181_981 264
1388 3300048089 Ga0495614_0094922 Ga0495614_0094922_153_953 264
1389 3300048091 Ga0495626_0017165 Ga0495626_0017165_1275_2075 264
1390 3300048903 Ga0496100_0045272 Ga0496100_0045272_1856_2656 264
1391 3300048903 Ga0496100_0176930 Ga0496100_0176930_117_917 264
1392 3300048903 Ga0496100_0211300 Ga0496100_0211300_431_1231 264
1393 3300048903 Ga0496100_0222780 Ga0496100_0222780_523_1323 264
1394 3300048903 Ga0496100_0292123 Ga0496100_0292123_57_857 264
1395 3300048904 Ga0496101_0003771 Ga0496101_0003771_1569_2369 264
1396 3300048904 Ga0496101_0037613 Ga0496101_0037613_1341_2141 264
1397 3300048904 Ga0496101_0162728 Ga0496101_0162728_22_822 264
1398 3300048904 Ga0496101_0193428 Ga0496101_0193428_205_1005 264
1399 3300048904 Ga0496101_0312036 Ga0496101_0312036_408_1208 264
1400 3300048904 Ga0496101_0445982 Ga0496101_0445982_50_850 264
1401 3300048904 Ga0496101_0501068 Ga0496101_0501068_105_905 264
1402 3300048905 Ga0496102_0005218 Ga0496102_0005218_5406_6206 264
1403 3300048905 Ga0496102_0076419 Ga0496102_0076419_376_1176 264
1404 3300048905 Ga0496102_0137316 Ga0496102_0137316_481_1281 264
1405 3300048905 Ga0496102_0434489 Ga0496102_0434489_420_1220 264
1406 3300048905 Ga0496102_0474123 Ga0496102_0474123_329_1129 264
1407 3300048905 Ga0496102_0630675 Ga0496102_0630675_40_840 264
1408 3300048906 Ga0496103_0010723 Ga0496103_0010723_4577_5377 264
1409 3300048906 Ga0496103_0069056 Ga0496103_0069056_496_1296 264
1410 3300048907 Ga0496104_0016231 Ga0496104_0016231_2621_3421 264
1411 3300048907 Ga0496104_0022194 Ga0496104_0022194_28_828 264
1412 3300048907 Ga0496104_0098594 Ga0496104_0098594_106_906 264
1413 3300048907 Ga0496104_0403460 Ga0496104_0403460_194_994 264
1414 3300048908 Ga0496105_0009741 Ga0496105_0009741_1246_2046 264
1415 3300048908 Ga0496105_0019070 Ga0496105_0019070_3342_4142 264
1416 3300048908 Ga0496105_0029405 Ga0496105_0029405_260_1060 264
1417 3300048908 Ga0496105_0060520 Ga0496105_0060520_536_1336 264
1418 3300048908 Ga0496105_0476983 Ga0496105_0476983_141_941 264
1419 3300048909 Ga0496106_0029624 Ga0496106_0029624_2358_3158 264
1420 3300048909 Ga0496106_0039923 Ga0496106_0039923_543_1343 264
1421 3300048909 Ga0496106_0117779 Ga0496106_0117779_286_1086 264
1422 3300048909 Ga0496106_0217351 Ga0496106_0217351_307_1107 264
1423 3300048910 Ga0496107_0003550 Ga0496107_0003550_6074_6874 264
1424 3300048910 Ga0496107_0035584 Ga0496107_0035584_1322_2122 264
1425 3300048910 Ga0496107_0201826 Ga0496107_0201826_275_1075 264
1426 3300048910 Ga0496107_0390940 Ga0496107_0390940_29_829 264
1427 3300048911 Ga0496108_0002351 Ga0496108_0002351_12635_13435 264
1428 3300048911 Ga0496108_0022679 Ga0496108_0022679_1713_2513 264
1429 3300048911 Ga0496108_0183373 Ga0496108_0183373_407_1207 264
1430 3300048912 Ga0496109_0002582 Ga0496109_0002582_3483_4283 264
1431 3300048912 Ga0496109_0011126 Ga0496109_0011126_4352_5152 264
1432 3300048912 Ga0496109_0093698 Ga0496109_0093698_1526_2326 264
1433 3300048912 Ga0496109_0479465 Ga0496109_0479465_26_826 264
1434 3300048912 Ga0496109_0703062 Ga0496109_0703062_19_819 264
1435 3300048913 Ga0496110_0007857 Ga0496110_0007857_3342_4142 264
1436 3300048913 Ga0496110_0068203 Ga0496110_0068203_2105_2905 264
1437 3300048913 Ga0496110_0163439 Ga0496110_0163439_59_859 264
1438 3300048913 Ga0496110_0222916 Ga0496110_0222916_146_946 264
1439 3300048913 Ga0496110_0277699 Ga0496110_0277699_632_1432 264
1440 3300048913 Ga0496110_0410559 Ga0496110_0410559_424_1224 264
1441 3300048913 Ga0496110_0516382 Ga0496110_0516382_241_1041 264
1442 3300048914 Ga0496111_0091112 Ga0496111_0091112_34_834 264
1443 3300048914 Ga0496111_0158134 Ga0496111_0158134_531_1331 264
1444 3300048914 Ga0496111_0249749 Ga0496111_0249749_349_1149 264
1445 3300048915 Ga0496112_0008401 Ga0496112_0008401_305_1105 264
1446 3300048915 Ga0496112_0036493 Ga0496112_0036493_706_1506 264
1447 3300048915 Ga0496112_0056475 Ga0496112_0056475_2257_3057 264
1448 3300048915 Ga0496112_0158316 Ga0496112_0158316_672_1472 264
1449 3300048915 Ga0496112_0188637 Ga0496112_0188637_819_1619 264
1450 3300048915 Ga0496112_0590938 Ga0496112_0590938_185_985 264
1451 3300048916 Ga0496113_0006395 Ga0496113_0006395_1635_2435 264
1452 3300048916 Ga0496113_0012289 Ga0496113_0012289_34_834 264
1453 3300048916 Ga0496113_0228856 Ga0496113_0228856_566_1366 264
1454 3300048916 Ga0496113_0254832 Ga0496113_0254832_336_1136 264
1455 3300048916 Ga0496113_0403519 Ga0496113_0403519_233_1033 264
1456 3300048916 Ga0496113_0605397 Ga0496113_0605397_14_814 264
1457 3300048917 Ga0496114_0030213 Ga0496114_0030213_1492_2292 264
1458 3300048917 Ga0496114_0075310 Ga0496114_0075310_1473_2273 264
1459 3300048917 Ga0496114_0080809 Ga0496114_0080809_1536_2336 264
1460 3300048917 Ga0496114_0310384 Ga0496114_0310384_74_874 264
1461 3300048917 Ga0496114_0631560 Ga0496114_0631560_87_887 264
1462 3300048917 Ga0496114_0634809 Ga0496114_0634809_121_921 264
1463 3300048918 Ga0496115_0002700 Ga0496115_0002700_5068_5868 264
1464 3300048918 Ga0496115_0006372 Ga0496115_0006372_1457_2257 264
1465 3300048918 Ga0496115_0060457 Ga0496115_0060457_1605_2405 264
1466 3300048918 Ga0496115_0095775 Ga0496115_0095775_761_1561 264
1467 3300048918 Ga0496115_0132409 Ga0496115_0132409_896_1696 264
1468 3300048918 Ga0496115_0178984 Ga0496115_0178984_630_1430 264
1469 3300048918 Ga0496115_0209551 Ga0496115_0209551_798_1598 264
1470 3300048918 Ga0496115_0238443 Ga0496115_0238443_448_1248 264
1471 3300048918 Ga0496115_0574503 Ga0496115_0574503_62_862 264
1472 3300048919 Ga0496116_0059189 Ga0496116_0059189_1292_2092 264
1473 3300048919 Ga0496116_0226840 Ga0496116_0226840_79_879 264
1474 3300048920 Ga0496117_0067197 Ga0496117_0067197_1551_2351 264
1475 3300048920 Ga0496117_0134776 Ga0496117_0134776_270_1070 264
1476 3300048920 Ga0496117_0226708 Ga0496117_0226708_188_988 264
1477 3300048921 Ga0496118_0042278 Ga0496118_0042278_899_1699 264
1478 3300048921 Ga0496118_0093947 Ga0496118_0093947_1229_2029 264
1479 3300048921 Ga0496118_0136708 Ga0496118_0136708_285_1085 264
1480 3300048921 Ga0496118_0168951 Ga0496118_0168951_508_1308 264
1481 3300048921 Ga0496118_0252008 Ga0496118_0252008_64_864 264
1482 3300048922 Ga0496119_0064740 Ga0496119_0064740_12_812 264
1483 3300048922 Ga0496119_0064916 Ga0496119_0064916_1261_2061 264
1484 3300048922 Ga0496119_0074470 Ga0496119_0074470_175_975 264
1485 3300048923 Ga0496120_0113877 Ga0496120_0113877_166_966 264
1486 3300048923 Ga0496120_0149659 Ga0496120_0149659_167_967 264
1487 3300048923 Ga0496120_0218679 Ga0496120_0218679_53_853 264
1488 3300048924 Ga0496121_0006526 Ga0496121_0006526_126_926 264
1489 3300048924 Ga0496121_0017298 Ga0496121_0017298_1364_2164 264
1490 3300048924 Ga0496121_0020252 Ga0496121_0020252_3248_4048 264
1491 3300048924 Ga0496121_0024943 Ga0496121_0024943_64_864 264
1492 3300048924 Ga0496121_0026087 Ga0496121_0026087_2853_3653 264
1493 3300048924 Ga0496121_0054436 Ga0496121_0054436_162_962 264
1494 3300048924 Ga0496121_0069583 Ga0496121_0069583_420_1220 264
1495 3300048924 Ga0496121_0074527 Ga0496121_0074527_567_1367 264
1496 3300048924 Ga0496121_0125803 Ga0496121_0125803_890_1690 264
1497 3300048924 Ga0496121_0234124 Ga0496121_0234124_305_1105 264
1498 3300048925 Ga0496122_0051864 Ga0496122_0051864_859_1659 264
1499 3300048926 Ga0496123_0016690 Ga0496123_0016690_1832_2632 264
1500 3300048926 Ga0496123_0156129 Ga0496123_0156129_85_885 264
1501 3300048927 Ga0496124_0140856 Ga0496124_0140856_29_829 264
1502 3300048927 Ga0496124_0143720 Ga0496124_0143720_766_1566 264
1503 3300048927 Ga0496124_0234720 Ga0496124_0234720_355_1155 264
1504 3300048927 Ga0496124_0373275 Ga0496124_0373275_169_969 264
1505 3300048928 Ga0496125_0000420 Ga0496125_0000420_51539_52339 264
1506 3300048928 Ga0496125_0001161 Ga0496125_0001161_12418_13218 264
1507 3300048928 Ga0496125_0005151 Ga0496125_0005151_9642_10442 264
1508 3300048928 Ga0496125_0037965 Ga0496125_0037965_1721_2521 264
1509 3300048928 Ga0496125_0051090 Ga0496125_0051090_27_827 264
1510 3300048928 Ga0496125_0056665 Ga0496125_0056665_40_840 264
1511 3300048928 Ga0496125_0177519 Ga0496125_0177519_21_821 264
1512 3300048928 Ga0496125_0253585 Ga0496125_0253585_215_1015 264
1513 3300048929 Ga0496126_0003575 Ga0496126_0003575_8193_8993 264
1514 3300048929 Ga0496126_0007151 Ga0496126_0007151_698_1498 264
1515 3300048929 Ga0496126_0017087 Ga0496126_0017087_6226_7026 264
1516 3300048929 Ga0496126_0036374 Ga0496126_0036374_3515_4315 264
1517 3300048929 Ga0496126_0037272 Ga0496126_0037272_2538_3338 264
1518 3300048929 Ga0496126_0048345 Ga0496126_0048345_700_1500 264
1519 3300048929 Ga0496126_0099199 Ga0496126_0099199_232_1032 264
1520 3300048929 Ga0496126_0143226 Ga0496126_0143226_106_906 264
1521 3300048929 Ga0496126_0147360 Ga0496126_0147360_192_992 264
1522 3300048929 Ga0496126_0155251 Ga0496126_0155251_938_1738 264
1523 3300048929 Ga0496126_0205744 Ga0496126_0205744_516_1316 264
1524 3300048929 Ga0496126_0206431 Ga0496126_0206431_571_1374 264
1525 3300048929 Ga0496126_0287714 Ga0496126_0287714_508_1308 264
1526 3300048929 Ga0496126_0317197 Ga0496126_0317197_377_1177 264
1527 3300048929 Ga0496126_0327722 Ga0496126_0327722_18_818 264
1528 3300048929 Ga0496126_0533885 Ga0496126_0533885_103_903 264
1529 3300049460 Ga0495682_0025931 Ga0495682_0025931_873_1673 264
1530 3300049568 Ga0501031_0002387 Ga0501031_0002387_7054_7854 264
1531 3300049568 Ga0501031_0002483 Ga0501031_0002483_6103_6909 264
1532 3300049568 Ga0501031_0257568 Ga0501031_0257568_248_1048 264
1533 3300049569 Ga0501032_0000227 Ga0501032_0000227_16547_17347 264
1534 3300049569 Ga0501032_0000318 Ga0501032_0000318_17233_18039 264
1535 3300049570 Ga0501033_0000443 Ga0501033_0000443_11011_11817 264
1536 3300049570 Ga0501033_0004766 Ga0501033_0004766_724_1524 264
1537 3300049570 Ga0501033_0008200 Ga0501033_0008200_2472_3272 264
1538 3300049570 Ga0501033_0361659 Ga0501033_0361659_156_956 264
1539 3300049571 Ga0501034_0000061 Ga0501034_0000061_34033_34839 264
1540 3300049571 Ga0501034_0000100 Ga0501034_0000100_18483_19283 264
1541 3300049571 Ga0501034_0028765 Ga0501034_0028765_2044_2844 264
1542 3300049571 Ga0501034_0068429 Ga0501034_0068429_212_1012 264
1543 3300049571 Ga0501034_0180456 Ga0501034_0180456_278_1078 264
1544 3300049572 Ga0501036_0000010 Ga0501036_0000010_66588_67388 264
1545 3300049572 Ga0501036_0000387 Ga0501036_0000387_7573_8379 264
1546 3300049572 Ga0501036_0175906 Ga0501036_0175906_887_1687 264
1547 3300049572 Ga0501036_0282657 Ga0501036_0282657_339_1139 264
1548 3300049572 Ga0501036_0321690 Ga0501036_0321690_475_1275 264
1549 3300049573 Ga0501037_0000104 Ga0501037_0000104_56690_57496 264
1550 3300049573 Ga0501037_0000183 Ga0501037_0000183_43916_44716 264
1551 3300049573 Ga0501037_0005109 Ga0501037_0005109_266_1072 264
1552 3300049573 Ga0501037_0064315 Ga0501037_0064315_465_1265 264
1553 3300049573 Ga0501037_0088726 Ga0501037_0088726_27_827 264
1554 3300049573 Ga0501037_0145197 Ga0501037_0145197_158_958 264
1555 3300049573 Ga0501037_0387866 Ga0501037_0387866_25_825 264
1556 3300049574 Ga0501038_0000054 Ga0501038_0000054_50352_51152 264
1557 3300049574 Ga0501038_0000340 Ga0501038_0000340_37678_38484 264
1558 3300049574 Ga0501038_0009130 Ga0501038_0009130_3489_4289 264
1559 3300049574 Ga0501038_0029904 Ga0501038_0029904_2703_3503 264
1560 3300049574 Ga0501038_0068147 Ga0501038_0068147_184_984 264
1561 3300049574 Ga0501038_0093188 Ga0501038_0093188_256_1056 264
1562 3300049575 Ga0501039_0000110 Ga0501039_0000110_20014_20814 264
1563 3300049575 Ga0501039_0000536 Ga0501039_0000536_22177_22983 264
1564 3300049575 Ga0501039_0034134 Ga0501039_0034134_3060_3860 264
1565 3300049575 Ga0501039_0319562 Ga0501039_0319562_91_891 264
1566 3300049576 Ga0501040_0016098 Ga0501040_0016098_3426_4226 264
1567 3300049577 Ga0501041_0106141 Ga0501041_0106141_499_1299 264
1568 3300049578 Ga0501042_0029189 Ga0501042_0029189_3067_3867 264
1569 3300049579 Ga0501043_0000106 Ga0501043_0000106_73873_74673 264
1570 3300049579 Ga0501043_0000161 Ga0501043_0000161_14615_15421 264
1571 3300049579 Ga0501043_0015830 Ga0501043_0015830_3143_3943 264
1572 3300049579 Ga0501043_0038102 Ga0501043_0038102_208_1008 264
1573 3300049579 Ga0501043_0119062 Ga0501043_0119062_735_1535 264
1574 3300049579 Ga0501043_0209758 Ga0501043_0209758_638_1438 264
1575 3300049580 Ga0501046_0001107 Ga0501046_0001107_12292_13098 264
1576 3300049580 Ga0501046_0005134 Ga0501046_0005134_6119_6919 264
1577 3300049580 Ga0501046_0012683 Ga0501046_0012683_5315_6115 264
1578 3300049580 Ga0501046_0122368 Ga0501046_0122368_115_915 264
1579 3300049581 Ga0501047_0000122 Ga0501047_0000122_27800_28606 264
1580 3300049581 Ga0501047_0000702 Ga0501047_0000702_172_972 264
1581 3300049581 Ga0501047_0032928 Ga0501047_0032928_2163_2963 264
1582 3300049581 Ga0501047_0051165 Ga0501047_0051165_2782_3582 264
1583 3300049581 Ga0501047_0085334 Ga0501047_0085334_1953_2753 264
1584 3300049581 Ga0501047_0137596 Ga0501047_0137596_1378_2178 264
1585 3300049581 Ga0501047_0367503 Ga0501047_0367503_381_1181 264
1586 3300049582 Ga0501048_0000060 Ga0501048_0000060_46651_47457 264
1587 3300049582 Ga0501048_0000456 Ga0501048_0000456_11883_12683 264
1588 3300049582 Ga0501048_0031383 Ga0501048_0031383_3001_3801 264
1589 3300049583 Ga0501067_0001976 Ga0501067_0001976_2159_2965 264
1590 3300049583 Ga0501067_0004998 Ga0501067_0004998_4574_5374 264
1591 3300049583 Ga0501067_0028386 Ga0501067_0028386_184_984 264
1592 3300049583 Ga0501067_0104145 Ga0501067_0104145_326_1126 264
1593 3300049583 Ga0501067_0114284 Ga0501067_0114284_296_1090 264
1594 3300049584 Ga0501068_0000737 Ga0501068_0000737_9162_9968 264
1595 3300049584 Ga0501068_0000938 Ga0501068_0000938_8986_9786 264
1596 3300049584 Ga0501068_0018828 Ga0501068_0018828_2809_3609 264
1597 3300049584 Ga0501068_0067026 Ga0501068_0067026_59_859 264
1598 3300049584 Ga0501068_0261206 Ga0501068_0261206_39_839 264
1599 3300049585 Ga0501069_0000315 Ga0501069_0000315_8065_8865 264
1600 3300049585 Ga0501069_0003284 Ga0501069_0003284_2310_3116 264
1601 3300049585 Ga0501069_0211785 Ga0501069_0211785_283_1083 264
1602 3300049586 Ga0501070_0000659 Ga0501070_0000659_296_1102 264
1603 3300049586 Ga0501070_0007760 Ga0501070_0007760_5845_6645 264
1604 3300049586 Ga0501070_0063684 Ga0501070_0063684_1048_1848 264
1605 3300049586 Ga0501070_0243976 Ga0501070_0243976_562_1368 264
1606 3300049586 Ga0501070_0269532 Ga0501070_0269532_263_1063 264
1607 3300049586 Ga0501070_0379270 Ga0501070_0379270_202_1002 264
1608 3300049587 Ga0501071_0045800 Ga0501071_0045800_1524_2330 264
1609 3300049587 Ga0501071_0115738 Ga0501071_0115738_532_1332 264
1610 3300049588 Ga0501072_0000606 Ga0501072_0000606_22259_23065 264
1611 3300049588 Ga0501072_0001167 Ga0501072_0001167_7129_7929 264
1612 3300049588 Ga0501072_0047895 Ga0501072_0047895_1515_2315 264
1613 3300049589 Ga0501073_0000014 Ga0501073_0000014_10715_11521 264
1614 3300049589 Ga0501073_0000238 Ga0501073_0000238_16348_17148 264
1615 3300049589 Ga0501073_0029113 Ga0501073_0029113_2893_3693 264
1616 3300049590 Ga0501074_0000259 Ga0501074_0000259_23642_24442 264
1617 3300049590 Ga0501074_0000995 Ga0501074_0000995_10432_11238 264
1618 3300049590 Ga0501074_0021196 Ga0501074_0021196_2983_3783 264
1619 3300049590 Ga0501074_0154843 Ga0501074_0154843_558_1358 264
1620 3300049591 Ga0501075_0153982 Ga0501075_0153982_601_1404 264
1621 3300049592 Ga0501076_0301602 Ga0501076_0301602_351_1157 264
1622 3300049593 Ga0501077_0096296 Ga0501077_0096296_1008_1811 264
1623 3300049741 Ga0501079_0014230 Ga0501079_0014230_2190_2990 264
1624 3300049742 Ga0501080_0002287 Ga0501080_0002287_5854_6654 264
1625 3300049742 Ga0501080_0007524 Ga0501080_0007524_296_1102 264
1626 3300049742 Ga0501080_0018024 Ga0501080_0018024_5554_6354 264
1627 3300049742 Ga0501080_0118121 Ga0501080_0118121_1482_2282 264
1628 3300049742 Ga0501080_0474771 Ga0501080_0474771_246_1046 264
1629 3300049744 Ga0501083_0000550 Ga0501083_0000550_9232_10032 264
1630 3300049744 Ga0501083_0010171 Ga0501083_0010171_3638_4444 264
1631 3300049744 Ga0501083_0013449 Ga0501083_0013449_1493_2293 264
1632 3300049822 Ga0501035_0000099 Ga0501035_0000099_12292_13098 264
1633 3300049822 Ga0501035_0000146 Ga0501035_0000146_6425_7225 264
1634 3300049822 Ga0501035_0070990 Ga0501035_0070990_401_1201 264
1635 3300049822 Ga0501035_0102938 Ga0501035_0102938_1076_1876 264
1636 3300049822 Ga0501035_0123306 Ga0501035_0123306_301_1101 264
1637 3300049822 Ga0501035_0168274 Ga0501035_0168274_260_1060 264
1638 3300049823 Ga0501044_0000195 Ga0501044_0000195_63546_64352 264
1639 3300049823 Ga0501044_0002385 Ga0501044_0002385_5708_6508 264
1640 3300049823 Ga0501044_0030160 Ga0501044_0030160_4046_4846 264
1641 3300049823 Ga0501044_0035811 Ga0501044_0035811_1584_2384 264
1642 3300049823 Ga0501044_0039805 Ga0501044_0039805_66_866 264
1643 3300049823 Ga0501044_0101805 Ga0501044_0101805_1024_1824 264
1644 3300049823 Ga0501044_0218231 Ga0501044_0218231_887_1687 264
1645 3300049823 Ga0501044_0270193 Ga0501044_0270193_61_861 264
1646 3300049823 Ga0501044_0385295 Ga0501044_0385295_383_1183 264
1647 3300049823 Ga0501044_0431210 Ga0501044_0431210_186_986 264
1648 3300049824 Ga0501045_0004135 Ga0501045_0004135_2966_3766 264
1649 3300049824 Ga0501045_0024453 Ga0501045_0024453_672_1478 264
1650 3300049824 Ga0501045_0070605 Ga0501045_0070605_16_816 264
1651 3300050489 nmdc:mga03683_37109_c1 nmdc:mga03683_37109_c1_549_1349 264
1652 3300050490 nmdc:mga03n38_1385_c1 nmdc:mga03n38_1385_c1_5697_6497 264
1653 3300050490 nmdc:mga03n38_140458_c1 nmdc:mga03n38_140458_c1_396_1196 264
1654 3300050490 nmdc:mga03n38_148281_c1 nmdc:mga03n38_148281_c1_306_1130 264
1655 3300050490 nmdc:mga03n38_5383_c1 nmdc:mga03n38_5383_c1_2120_2920 264
1656 3300050491 nmdc:mga00v17_47537_c1 nmdc:mga00v17_47537_c1_658_1458 264
1657 3300050491 nmdc:mga00v17_85061_c1 nmdc:mga00v17_85061_c1_741_1541 264
1658 3300050492 nmdc:mga0yw44_32623_c1 nmdc:mga0yw44_32623_c1_1117_1917 264
1659 3300050492 nmdc:mga0yw44_41024_c1 nmdc:mga0yw44_41024_c1_1290_2090 264
1660 3300050492 nmdc:mga0yw44_85309_c1 nmdc:mga0yw44_85309_c1_619_1419 264
1661 3300050492 nmdc:mga0yw44_98070_c1 nmdc:mga0yw44_98070_c1_782_1582 264
1662 3300050493 nmdc:mga0k408_44704_c1 nmdc:mga0k408_44704_c1_377_1177 264
1663 3300050493 nmdc:mga0k408_45315_c1 nmdc:mga0k408_45315_c1_918_1718 264
1664 3300050494 nmdc:mga06z11_33686_c1 nmdc:mga06z11_33686_c1_339_1139 264
1665 3300050494 nmdc:mga06z11_85306_c1 nmdc:mga06z11_85306_c1_28_828 264
1666 3300050496 nmdc:mga07m45_269756_c1 nmdc:mga07m45_269756_c1_51_851 264
1667 3300050507 nmdc:mga05p37_225116_c1 nmdc:mga05p37_225116_c1_990_1790 264
1668 3300050507 nmdc:mga05p37_458612_c1 nmdc:mga05p37_458612_c1_648_1448 264
1669 3300050511 nmdc:mga08y16_336950_c1 nmdc:mga08y16_336950_c1_496_1296 264
1670 3300050514 nmdc:mga08x19_100320_c1 nmdc:mga08x19_100320_c1_168_968 264
1671 3300050516 nmdc:mga0sz30_90125_c1 nmdc:mga0sz30_90125_c1_407_1207 264
1672 3300053077 Ga0495601_0026087 Ga0495601_0026087_916_1716 264
1673 3300053077 Ga0495601_0031353 Ga0495601_0031353_1402_2202 264
1674 3300053077 Ga0495601_0068831 Ga0495601_0068831_78_878 264
1675 3300053077 Ga0495601_0304869 Ga0495601_0304869_38_841 264
1676 3300053078 Ga0495612_0022777 Ga0495612_0022777_1201_2001 264
1677 3300053084 Ga0495595_0026287 Ga0495595_0026287_1453_2253 264
1678 3300053084 Ga0495595_0060653 Ga0495595_0060653_94_894 264
1679 3300053085 Ga0495619_0005683 Ga0495619_0005683_4115_4915 264
1680 3300053085 Ga0495619_0144025 Ga0495619_0144025_341_1141 264
1681 3300053086 Ga0500578_0190699 Ga0500578_0190699_322_1122 264
1682 3300053087 Ga0500643_000270 Ga0500643_000270_5165_5965 264
1683 3300053089 Ga0500581_088318 Ga0500581_088318_112_912 264
1684 3300053091 Ga0500647_0082492 Ga0500647_0082492_552_1352 264
1685 3300053093 Ga0500651_0022302 Ga0500651_0022302_3138_3938 264
1686 3300053093 Ga0500651_0165963 Ga0500651_0165963_398_1198 264
1687 3300053094 Ga0500566_0000022 Ga0500566_0000022_39397_40197 264
1688 3300053094 Ga0500566_0005084 Ga0500566_0005084_1454_2254 264
1689 3300053094 Ga0500566_0052562 Ga0500566_0052562_773_1573 264
1690 3300053095 Ga0500640_000259 Ga0500640_000259_10670_11470 264
1691 3300053096 Ga0500641_0002387 Ga0500641_0002387_4566_5366 264
1692 3300053096 Ga0500641_0002665 Ga0500641_0002665_4514_5314 264
1693 3300053096 Ga0500641_0073297 Ga0500641_0073297_142_942 264
1694 3300053098 Ga0500650_0014048 Ga0500650_0014048_857_1657 264
1695 3300053102 Ga0500554_002353 Ga0500554_002353_193_993 264
1696 3300053102 Ga0500554_009543 Ga0500554_009543_196_996 264
1697 3300053103 Ga0500555_002818 Ga0500555_002818_140_940 264
1698 3300053104 Ga0500556_0000306 Ga0500556_0000306_25195_25995 264
1699 3300053104 Ga0500556_0021119 Ga0500556_0021119_1264_2064 264
1700 3300053104 Ga0500556_0075336 Ga0500556_0075336_81_881 264
1701 3300053104 Ga0500556_0127573 Ga0500556_0127573_92_892 264
1702 3300053105 Ga0500557_000026 Ga0500557_000026_37263_38063 264
1703 3300053108 Ga0500562_012247 Ga0500562_012247_21_821 264
1704 3300053108 Ga0500562_014270 Ga0500562_014270_772_1572 264
1705 3300053109 Ga0500569_022839 Ga0500569_022839_839_1639 264
1706 3300053109 Ga0500569_079789 Ga0500569_079789_51_851 264
1707 3300053111 Ga0500572_001109 Ga0500572_001109_5450_6250 264
1708 3300053117 Ga0500593_000814 Ga0500593_000814_4361_5197 264
1709 3300053119 Ga0500595_000095 Ga0500595_000095_1340_2140 264
1710 3300053119 Ga0500595_023108 Ga0500595_023108_795_1595 264
1711 3300053119 Ga0500595_023330 Ga0500595_023330_37_837 264
1712 3300053122 Ga0500608_008047 Ga0500608_008047_330_1130 264
1713 3300053130 Ga0500642_0000091 Ga0500642_0000091_5278_6078 264
1714 3300053131 Ga0500652_000454 Ga0500652_000454_11913_12713 264
1715 3300053131 Ga0500652_029820 Ga0500652_029820_156_956 264
1716 3300053131 Ga0500652_089386 Ga0500652_089386_305_1105 264
1717 3300053134 Ga0500658_0142942 Ga0500658_0142942_131_931 264
1718 3300053136 Ga0500559_0000219 Ga0500559_0000219_31315_32115 264
1719 3300053136 Ga0500559_0002476 Ga0500559_0002476_1489_2289 264
1720 3300053139 Ga0500568_0011063 Ga0500568_0011063_2666_3466 264
1721 3300053139 Ga0500568_0028272 Ga0500568_0028272_180_980 264
1722 3300053139 Ga0500568_0058922 Ga0500568_0058922_168_968 264
1723 3300053148 Ga0500590_147655 Ga0500590_147655_188_988 264
1724 3300053150 Ga0500603_000192 Ga0500603_000192_3033_3833 264
1725 3300053150 Ga0500603_000199 Ga0500603_000199_4251_5051 264
1726 3300053150 Ga0500603_010461 Ga0500603_010461_949_1749 264
1727 3300053151 Ga0500604_0000841 Ga0500604_0000841_356_1156 264
1728 3300053151 Ga0500604_0009783 Ga0500604_0009783_1222_2022 264
1729 3300053151 Ga0500604_0130095 Ga0500604_0130095_24_824 264
1730 3300053153 Ga0500616_0000046 Ga0500616_0000046_26162_26962 264
1731 3300053153 Ga0500616_0003195 Ga0500616_0003195_8829_9629 264
1732 3300053153 Ga0500616_0021691 Ga0500616_0021691_2017_2817 264
1733 3300053156 Ga0500622_0006911 Ga0500622_0006911_2318_3118 264
1734 3300053156 Ga0500622_0029083 Ga0500622_0029083_271_1071 264
1735 3300053159 Ga0500630_010421 Ga0500630_010421_2507_3307 264
1736 3300053160 Ga0500633_0011023 Ga0500633_0011023_1327_2127 264
1737 3300053162 Ga0500638_003343 Ga0500638_003343_4670_5470 264
1738 3300053162 Ga0500638_175585 Ga0500638_175585_108_908 264
1739 3300053163 Ga0500639_032910 Ga0500639_032910_1333_2133 264
1740 3300053177 Ga0500636_0018270 Ga0500636_0018270_1060_1860 264
1741 3300053177 Ga0500636_0056864 Ga0500636_0056864_1235_2035 264
1742 3300053178 Ga0500637_0047175 Ga0500637_0047175_930_1730 264
1743 3300053178 Ga0500637_0112124 Ga0500637_0112124_17_817 264
1744 3300053178 Ga0500637_0209872 Ga0500637_0209872_14_814 264
1745 3300053730 Ga0500645_013732 Ga0500645_013732_1658_2458 264
1746 3300053730 Ga0500645_038402 Ga0500645_038402_279_1079 264
1747 3300053735 Ga0500596_001884 Ga0500596_001884_1155_1955 264
1748 3300053737 Ga0500601_000223 Ga0500601_000223_53_853 264
1749 3300053737 Ga0500601_005136 Ga0500601_005136_39_839 264
1750 3300054114 Ga0501084_0001641 Ga0501084_0001641_6667_7473 264
1751 3300054114 Ga0501084_0008167 Ga0501084_0008167_4947_5747 264
1752 3300054114 Ga0501084_0081306 Ga0501084_0081306_1416_2216 264
1753 3300055283 Ga0500661_007090 Ga0500661_007090_1129_1929 264
1754 3300060353 Ga0501082_0003572 Ga0501082_0003572_6761_7561 264
1755 3300060353 Ga0501082_0062470 Ga0501082_0062470_2209_3015 264
1756 3300060353 Ga0501082_0150757 Ga0501082_0150757_193_993 264
1757 3300001989 JGI24739J22299_10063256 JGI24739J22299_100632561 265
1758 3300003762 Ga0055542_1001266 Ga0055542_10012669 265
1759 3300005339 Ga0070660_100125849 Ga0070660_1001258492 265
1760 3300005356 Ga0070674_100070086 Ga0070674_1000700861 265
1761 3300006038 Ga0075365_10028965 Ga0075365_100289654 265
1762 3300006042 Ga0075368_10018477 Ga0075368_100184772 265
1763 3300006177 Ga0075362_10043999 Ga0075362_100439993 265
1764 3300025907 Ga0207645_10307664 Ga0207645_103076641 265
1765 3300026041 Ga0207639_10815690 Ga0207639_108156901 265
1766 3300026118 Ga0207675_100909768 Ga0207675_1009097681 265
1767 3300027866 Ga0209813_10036988 Ga0209813_100369882 265
1768 3300031911 Ga0307412_10417345 Ga0307412_104173451 265
1769 3300032002 Ga0307416_100404467 Ga0307416_1004044672 265
1770 3300037418 Ga0395900_0032409 Ga0395900_0032409_1898_2695 265
1771 3300037418 Ga0395900_0267352 Ga0395900_0267352_554_1351 265
1772 3300037466 Ga0395898_0510652 Ga0395898_0510652_265_1062 265
1773 3300038443 Ga0395901_0681709 Ga0395901_0681709_59_856 265
1774 3300046460 Ga0495638_0215336 Ga0495638_0215336_181_978 265
1775 3300046522 Ga0495643_0086141 Ga0495643_0086141_413_1210 265
1776 3300048929 Ga0496126_0190877 Ga0496126_0190877_510_1307 265
1777 3300049568 Ga0501031_0027736 Ga0501031_0027736_2166_2963 265
1778 3300049569 Ga0501032_0000009 Ga0501032_0000009_128667_129464 265
1779 3300049570 Ga0501033_0000019 Ga0501033_0000019_98644_99441 265
1780 3300049570 Ga0501033_0504559 Ga0501033_0504559_20_820 265
1781 3300049571 Ga0501034_0000044 Ga0501034_0000044_128667_129464 265
1782 3300049571 Ga0501034_0253526 Ga0501034_0253526_543_1343 265
1783 3300049572 Ga0501036_0000008 Ga0501036_0000008_128667_129464 265
1784 3300049573 Ga0501037_0000055 Ga0501037_0000055_65630_66427 265
1785 3300049574 Ga0501038_0000006 Ga0501038_0000006_128667_129464 265
1786 3300049575 Ga0501039_0000014 Ga0501039_0000014_98644_99441 265
1787 3300049576 Ga0501040_0034810 Ga0501040_0034810_549_1346 265
1788 3300049579 Ga0501043_0001366 Ga0501043_0001366_2173_2970 265
1789 3300049581 Ga0501047_0001105 Ga0501047_0001105_10836_11633 265
1790 3300049586 Ga0501070_0212993 Ga0501070_0212993_111_908 265
1791 3300049822 Ga0501035_0000096 Ga0501035_0000096_44181_44978 265
1792 3300049823 Ga0501044_0000017 Ga0501044_0000017_98644_99441 265
1793 3300050489 nmdc:mga03683_61382_c1 nmdc:mga03683_61382_c1_601_1398 265
1794 3300050490 nmdc:mga03n38_98787_c1 nmdc:mga03n38_98787_c1_244_1041 265
1795 3300050495 nmdc:mga04h51_40454_c1 nmdc:mga04h51_40454_c1_31_828 265
1796 3300053079 Ga0500610_0066195 Ga0500610_0066195_1059_1856 265
1797 3300053104 Ga0500556_0000097 Ga0500556_0000097_76850_77662 265
1798 3300053151 Ga0500604_0004109 Ga0500604_0004109_2887_3684 265
1799 3300053155 Ga0500620_000290 Ga0500620_000290_8143_8940 265

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00941

FAD_binding_5

FAD binding domain in molybdopterin dehydrogenase

21

192

0.98

PF03450

CO_deh_flav_C

CO dehydrogenase flavoprotein C-terminal domain

196

289

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zxi-assembly1.cif.gz_F reconstituted co dehydrogenase from oligotropha carboxidovorans 0.9013 3 261
1zxi-assembly1.cif.gz_F reconstituted co dehydrogenase from oligotropha carboxidovorans 0.8852 3 261
1ffv-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.8816 3 261
1n5w-assembly1.cif.gz_C crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.867 3 261
7dqx-assembly1.cif.gz_B crystal structure of xanthine dehydrogenase family protein 0.8667 3 261
ID Description Score Start End Superfamily
af_I6Y7N2_57_165_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9521 63 163 3.30.465.10
1t3qF02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9461 54 166 3.30.465.10
1ffvC03 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9389 56 163 3.30.465.10
af_Q46800_56_173_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9294 55 164 3.30.465.10
af_P64557_52_156_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9017 55 163 3.30.465.10
ID Description Score Start End GO Terms
AF-A0A527DEU0-F1-model_v4 Carbon monoxide dehydrogenase 0.9968 132 263
AF-A0A3S1U3F1-F1-model_v4 deleted 0.995 145 263
AF-A0A529ZII5-F1-model_v4 Carbon monoxide dehydrogenase 0.9909 186 263
AF-A0A2S6TG65-F1-model_v4 FAD-binding PCMH-type domain-containing protein 0.9899 56 260 GO:0016491
GO:0071949
AF-A0A659UIX0-F1-model_v4 Carbon monoxide dehydrogenase 0.9807 63 164 GO:0016491
GO:0071949

Feature Viewer

pLDDT pTM Quality
93.35 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map