F495735
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1799 | 837 | 1455 | 264 |
Family's Representative Sequence
| Representative Sequence | 3300009101|Ga0105247_10056060|Ga0105247_100560602 |
| Length | 290 |
| Sequence | LIVTPGRAPARPRNDLDKKFREIPMYETTYHRASSIDEAAALFAKGSEAKFLAGGHTLLPVMKQRLASPSDVIDIGKIKDLIGVQLSGDTLVIKAATTYYDIMTNADVKKAIPAISYLTSVLGDPAVRHRGTIGGSIANNDPAADFPAALISLAATVKTNKRSIAAEDFFKGLFTTALEDGEIITEVSFPVPEKAGYAKMRHPASRFALTGVFVTKTKGGDVRVAATGASQSGVMRVSAIEAALKSNWSASAIDGVSVSAADLLSDIHGSADYRANLVKVMAQRAVQAAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 6 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 7 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 8 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 9 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 10 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 11 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 12 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 13 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 14 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 15 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 16 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 17 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 18 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 19 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 20 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 21 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 22 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 23 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 24 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 25 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 26 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 27 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 28 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 29 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 30 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 31 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 32 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 33 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 34 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 35 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 36 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 37 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 38 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 39 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 40 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 41 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 42 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 43 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 44 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 45 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 46 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 47 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 48 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 49 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 50 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 51 | 2791355199 | |||
| 52 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 53 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 54 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 55 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 56 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 57 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 58 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 59 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 60 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 61 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 62 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 63 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 64 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 65 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 66 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 67 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 68 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 69 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 70 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 71 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 72 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 73 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 74 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 75 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 76 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 77 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 78 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 79 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 80 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 81 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 82 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 83 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 84 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 85 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 86 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 87 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 88 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 89 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 90 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 91 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 92 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 93 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 94 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 95 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 96 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 97 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 98 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 99 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 100 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 101 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 102 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 103 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 104 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 105 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 106 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 107 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 108 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 109 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 110 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 111 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 112 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 113 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 114 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 115 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 116 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 117 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 118 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 119 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 120 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 121 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 122 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 123 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 124 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 125 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 126 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 127 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 128 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 129 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 130 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 131 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 132 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 133 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 134 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 135 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 136 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 137 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 138 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 139 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 140 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 141 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 142 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 143 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 144 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 145 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 146 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 147 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 148 | 2904699407 | |||
| 149 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 150 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 151 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 152 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 153 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 154 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 155 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 156 | 2906610324 | |||
| 157 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 158 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 159 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 160 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 161 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 162 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 163 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 164 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 165 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 166 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 167 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 168 | 2922368715 | |||
| 169 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 170 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 171 | 2922425934 | |||
| 172 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 173 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 174 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 175 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 176 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 177 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 178 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 179 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 180 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 181 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 182 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 183 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 184 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 185 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 186 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 187 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 188 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 189 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 190 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 191 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 192 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 193 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 194 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 195 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 196 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 197 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 198 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 199 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 200 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 201 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 202 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 203 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 204 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 205 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 206 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 207 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 208 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 209 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 210 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 211 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 212 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 213 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 214 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 215 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 216 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 217 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 218 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 219 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 220 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 221 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 222 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 223 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 224 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 225 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 226 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 227 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 228 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 229 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 230 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 231 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 232 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 233 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 234 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 235 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 236 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 237 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 238 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 239 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 240 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 241 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 242 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 243 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 244 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 245 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 246 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 247 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 248 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 249 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 250 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 251 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 252 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 253 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 254 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 255 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 256 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 257 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 258 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 259 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 260 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 261 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 262 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 263 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 264 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 265 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 266 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 267 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 268 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 269 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 270 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 271 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 272 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 273 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 274 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 275 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 276 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 277 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 278 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 279 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 280 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 281 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 282 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 283 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 284 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 285 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 286 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 287 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 288 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 289 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 290 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 291 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 292 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 293 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 294 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 295 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 296 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 297 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 298 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 299 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 300 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 301 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 302 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 303 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 304 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 305 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 306 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 307 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 308 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 309 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 310 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 311 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 312 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 313 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 314 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 315 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 316 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 317 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 318 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 319 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 320 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 321 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 322 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 323 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 324 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 325 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 326 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 327 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 328 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 329 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 330 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 331 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 332 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 333 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 334 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 335 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 336 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 337 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 338 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 339 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 340 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 341 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 342 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 343 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 344 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 345 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 346 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 347 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 348 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 349 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 350 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 351 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 352 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 353 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 354 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 355 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 356 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 357 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 358 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 359 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 360 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 361 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 362 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 363 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 364 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 365 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 366 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 367 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 368 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 369 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 370 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 371 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 372 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 373 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 374 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 375 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 376 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 377 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 379 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 380 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 381 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 382 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 383 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 384 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 386 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 387 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 388 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 389 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 390 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 391 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 393 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 394 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 396 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 397 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 398 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 399 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 400 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 401 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 402 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 403 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 404 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 405 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 406 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 407 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 408 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 409 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 410 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 411 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 412 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 413 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 414 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 415 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 416 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 417 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 418 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 419 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 420 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 421 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 422 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 423 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 424 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 425 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 426 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 427 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 428 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 429 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 430 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 431 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 432 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 433 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 434 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 435 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 436 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 437 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 438 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 439 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 440 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 441 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 442 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 443 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 444 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 445 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 446 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 447 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 448 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 449 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 450 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 451 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 452 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 453 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 454 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 455 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 456 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 457 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 458 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 459 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 460 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 461 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 462 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 463 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 464 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 465 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 466 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 467 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 468 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 469 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 470 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 471 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 472 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 473 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 474 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 475 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 476 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 477 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 478 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 479 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 480 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 481 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 482 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 483 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 484 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 485 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 486 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 487 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 488 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 489 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 490 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 491 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 492 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 493 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 494 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 495 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 496 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 497 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 498 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 499 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 500 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 501 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 502 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 503 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 504 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 505 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 506 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 507 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 508 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 509 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 510 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 511 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 512 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 513 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 514 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 515 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 516 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 517 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 518 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 519 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 520 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 521 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 522 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 523 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 524 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 525 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 526 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 527 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 528 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 529 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 530 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 531 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 532 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 533 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 534 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 535 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 536 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 537 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 538 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 539 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 540 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 541 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 542 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 543 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 544 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 545 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 546 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 547 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 548 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 549 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 550 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 551 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 552 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 553 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 554 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 555 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 556 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 557 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 558 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 559 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 560 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 561 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 562 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 563 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 564 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 565 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 566 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 567 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 568 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 569 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 570 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 571 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 572 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 573 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 574 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 575 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 576 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 577 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 578 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 579 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 580 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 581 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 582 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 583 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 584 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 631 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 639 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 640 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 641 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 642 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 643 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 644 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 645 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 646 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 647 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 648 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 649 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 650 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 651 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 652 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 653 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 654 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 655 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 656 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 657 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 658 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 659 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 660 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 661 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 662 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 663 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 664 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 665 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 666 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 667 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 668 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 669 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 670 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 671 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 672 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 673 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 674 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 675 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 676 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 677 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 678 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 679 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 680 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 681 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 682 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 683 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 684 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 685 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 686 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 687 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 688 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 689 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 690 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 691 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 692 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 693 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 694 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 695 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 696 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 697 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 698 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 699 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 700 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 701 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 702 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 703 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 704 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 705 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 706 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 707 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 708 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 709 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 710 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 711 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 712 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 713 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 714 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 715 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 716 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 717 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 718 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 719 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 720 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 721 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 722 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 723 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 724 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 725 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 726 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 727 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 728 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 729 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 730 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 731 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 732 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 733 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 734 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 735 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 736 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 737 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 738 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 739 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 740 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 741 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 742 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 743 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 744 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 745 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 746 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 747 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 748 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 749 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 750 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 751 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 752 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 753 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 754 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 755 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 756 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 757 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 758 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 759 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 760 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 761 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 762 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 763 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 764 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 765 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 766 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 767 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 768 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 769 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 770 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 771 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 772 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 773 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 774 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 775 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 776 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 777 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 778 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 779 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 780 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 781 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 782 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 783 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 784 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 785 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 786 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 787 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 788 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 789 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 790 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 791 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 792 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 793 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 794 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 795 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 796 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 797 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 798 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 799 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 800 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 801 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 802 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 803 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 804 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 805 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 806 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 807 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 808 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 809 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 810 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 811 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 812 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 813 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 814 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 815 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 816 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 817 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 818 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 819 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 820 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 821 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 822 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 823 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 824 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 825 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 826 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 827 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 828 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 829 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 830 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 831 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 832 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 833 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 834 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 835 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 836 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 837 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.77 |
| Metatranscriptomes | 0.33 |
| Isolates | 18.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.23 |
| Nodule | 15.56 |
| Rhizoplane | 5.56 |
| Rhizosphere | 58.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10063256 | 3300001989 | Bacteria | 1165 |
| 2 | JGI25406J46586_10000887 | 3300003203 | Bacteria | 14075 |
| 3 | JGI25153J46596_10001684 | 3300003215 | Bacteria | 13110 |
| 4 | JGI25153J46596_10002416 | 3300003215 | Bacteria | 10769 |
| 5 | JGI25153J46596_10004047 | 3300003215 | Bacteria | 7991 |
| 6 | JGI25153J46596_10050192 | 3300003215 | Bacteria | 1205 |
| 7 | JGI25160J50197_1003620 | 3300003354 | Bacteria | 6863 |
| 8 | JGI25160J50197_1005514 | 3300003354 | Bacteria | 5253 |
| 9 | Ga0055539_1001740 | 3300003752 | Bacteria | 3789 |
| 10 | Ga0055542_1001266 | 3300003762 | Bacteria | 13749 |
| 11 | Ga0055531_10012840 | 3300003794 | Bacteria | 3905 |
| 12 | Ga0055543_1001860 | 3300004625 | Bacteria | 7683 |
| 13 | Ga0065165_1001256 | 3300005262 | Bacteria | 28720 |
| 14 | Ga0065165_1005779 | 3300005262 | Bacteria | 6766 |
| 15 | Ga0070658_10103957 | 3300005327 | Bacteria | 2349 |
| 16 | Ga0070658_10373856 | 3300005327 | Bacteria | 1222 |
| 17 | Ga0070676_10038287 | 3300005328 | Bacteria | 2769 |
| 18 | Ga0070683_100006785 | 3300005329 | Bacteria | 9622 |
| 19 | Ga0070683_100063089 | 3300005329 | Bacteria | 3446 |
| 20 | Ga0070690_100139173 | 3300005330 | Bacteria | 1646 |
| 21 | Ga0070670_100113110 | 3300005331 | Bacteria | 2340 |
| 22 | Ga0070670_100448063 | 3300005331 | Bacteria | 1144 |
| 23 | Ga0070677_10161434 | 3300005333 | Bacteria | 1052 |
| 24 | Ga0068869_100101482 | 3300005334 | Bacteria | 2177 |
| 25 | Ga0068869_100270717 | 3300005334 | Bacteria | 1363 |
| 26 | Ga0068869_100548301 | 3300005334 | Bacteria | 971 |
| 27 | Ga0068869_100659490 | 3300005334 | Bacteria | 889 |
| 28 | Ga0070666_10210657 | 3300005335 | Bacteria | 1369 |
| 29 | Ga0070680_100020920 | 3300005336 | Bacteria | 5194 |
| 30 | Ga0070680_100176113 | 3300005336 | Bacteria | 1801 |
| 31 | Ga0070680_100232420 | 3300005336 | Bacteria | 1557 |
| 32 | Ga0070682_100076346 | 3300005337 | Bacteria | 2157 |
| 33 | Ga0070682_100220559 | 3300005337 | Bacteria | 1349 |
| 34 | Ga0068868_100020206 | 3300005338 | Bacteria | 5000 |
| 35 | Ga0068868_100038556 | 3300005338 | Bacteria | 3710 |
| 36 | Ga0070660_100016425 | 3300005339 | Bacteria | 5371 |
| 37 | Ga0070660_100025110 | 3300005339 | Bacteria | 4427 |
| 38 | Ga0070660_100125849 | 3300005339 | Bacteria | 2048 |
| 39 | Ga0070660_100504527 | 3300005339 | Bacteria | 1007 |
| 40 | Ga0070661_100004410 | 3300005344 | Bacteria | 9700 |
| 41 | Ga0070661_100057292 | 3300005344 | Bacteria | 2855 |
| 42 | Ga0070661_100162468 | 3300005344 | Bacteria | 1692 |
| 43 | Ga0070668_100016899 | 3300005347 | Bacteria | 5457 |
| 44 | Ga0070668_100035262 | 3300005347 | Bacteria | 3814 |
| 45 | Ga0070668_100039201 | 3300005347 | Bacteria | 3623 |
| 46 | Ga0070668_100049264 | 3300005347 | Bacteria | 3241 |
| 47 | Ga0070668_100166549 | 3300005347 | Bacteria | 1791 |
| 48 | Ga0070669_100165983 | 3300005353 | Bacteria | 1719 |
| 49 | Ga0070675_100630142 | 3300005354 | Bacteria | 974 |
| 50 | Ga0070671_100205637 | 3300005355 | Bacteria | 1670 |
| 51 | Ga0070671_100230494 | 3300005355 | Bacteria | 1572 |
| 52 | Ga0070674_100070086 | 3300005356 | Bacteria | 2476 |
| 53 | Ga0070659_100040136 | 3300005366 | Bacteria | 3657 |
| 54 | Ga0070659_100073417 | 3300005366 | Bacteria | 2723 |
| 55 | Ga0070667_100203864 | 3300005367 | Bacteria | 1756 |
| 56 | Ga0070667_100206712 | 3300005367 | Bacteria | 1744 |
| 57 | Ga0070709_10001864 | 3300005434 | Bacteria | 11435 |
| 58 | Ga0070709_10025801 | 3300005434 | Bacteria | 3474 |
| 59 | Ga0070709_10050531 | 3300005434 | Bacteria | 2605 |
| 60 | Ga0070709_10255161 | 3300005434 | Bacteria | 1265 |
| 61 | Ga0070714_100001530 | 3300005435 | Bacteria | 16861 |
| 62 | Ga0070714_100106301 | 3300005435 | Bacteria | 2479 |
| 63 | Ga0070714_100259577 | 3300005435 | Bacteria | 1609 |
| 64 | Ga0070714_100361708 | 3300005435 | Bacteria | 1364 |
| 65 | Ga0070713_100010561 | 3300005436 | Bacteria | 6677 |
| 66 | Ga0070713_100094497 | 3300005436 | Bacteria | 2578 |
| 67 | Ga0070713_100375905 | 3300005436 | Bacteria | 1323 |
| 68 | Ga0070713_100543274 | 3300005436 | Bacteria | 1100 |
| 69 | Ga0070710_10001292 | 3300005437 | Bacteria | 11884 |
| 70 | Ga0070710_10074620 | 3300005437 | Bacteria | 1964 |
| 71 | Ga0070710_10128812 | 3300005437 | Bacteria | 1540 |
| 72 | Ga0070710_10177177 | 3300005437 | Bacteria | 1332 |
| 73 | Ga0070701_10129409 | 3300005438 | Bacteria | 1433 |
| 74 | Ga0070711_100000566 | 3300005439 | Bacteria | 19333 |
| 75 | Ga0070711_100011045 | 3300005439 | Bacteria | 5602 |
| 76 | Ga0070711_100017968 | 3300005439 | Bacteria | 4508 |
| 77 | Ga0070711_100072221 | 3300005439 | Bacteria | 2434 |
| 78 | Ga0070711_100474838 | 3300005439 | Bacteria | 1027 |
| 79 | Ga0070700_100377799 | 3300005441 | Bacteria | 1059 |
| 80 | Ga0070694_100090188 | 3300005444 | Bacteria | 2149 |
| 81 | Ga0070663_100028641 | 3300005455 | Bacteria | 3795 |
| 82 | Ga0070663_100053700 | 3300005455 | Bacteria | 2877 |
| 83 | Ga0070663_100064496 | 3300005455 | Bacteria | 2647 |
| 84 | Ga0070663_100116012 | 3300005455 | Bacteria | 2018 |
| 85 | Ga0070663_100174049 | 3300005455 | Bacteria | 1665 |
| 86 | Ga0070663_100201513 | 3300005455 | Bacteria | 1553 |
| 87 | Ga0070678_100194755 | 3300005456 | Bacteria | 1669 |
| 88 | Ga0070678_100535655 | 3300005456 | Bacteria | 1038 |
| 89 | Ga0070678_100657486 | 3300005456 | Bacteria | 941 |
| 90 | Ga0070662_100314515 | 3300005457 | Bacteria | 1275 |
| 91 | Ga0070662_100519827 | 3300005457 | Bacteria | 994 |
| 92 | Ga0070681_10025960 | 3300005458 | Bacteria | 5889 |
| 93 | Ga0070681_10037882 | 3300005458 | Bacteria | 4835 |
| 94 | Ga0070681_10067612 | 3300005458 | Bacteria | 3541 |
| 95 | Ga0070681_10110722 | 3300005458 | Bacteria | 2685 |
| 96 | Ga0068867_100337474 | 3300005459 | Bacteria | 1254 |
| 97 | Ga0070707_100410737 | 3300005468 | Bacteria | 1314 |
| 98 | Ga0070698_100451188 | 3300005471 | Bacteria | 1222 |
| 99 | Ga0070679_100088998 | 3300005530 | Bacteria | 3074 |
| 100 | Ga0070684_100039474 | 3300005535 | Bacteria | 4060 |
| 101 | Ga0070684_100043666 | 3300005535 | Bacteria | 3872 |
| 102 | Ga0070684_100073039 | 3300005535 | Bacteria | 3022 |
| 103 | Ga0070684_100159351 | 3300005535 | Bacteria | 2047 |
| 104 | Ga0068853_100025481 | 3300005539 | Bacteria | 4963 |
| 105 | Ga0068853_100145661 | 3300005539 | Bacteria | 2128 |
| 106 | Ga0068853_100234307 | 3300005539 | Bacteria | 1680 |
| 107 | Ga0068853_100415666 | 3300005539 | Bacteria | 1261 |
| 108 | Ga0068853_100468896 | 3300005539 | Bacteria | 1186 |
| 109 | Ga0070686_100209330 | 3300005544 | Bacteria | 1403 |
| 110 | Ga0070695_100326559 | 3300005545 | Bacteria | 1142 |
| 111 | Ga0070665_100017685 | 3300005548 | Bacteria | 7159 |
| 112 | Ga0070665_100060033 | 3300005548 | Bacteria | 3812 |
| 113 | Ga0070665_100069146 | 3300005548 | Bacteria | 3539 |
| 114 | Ga0070665_100093763 | 3300005548 | Bacteria | 3007 |
| 115 | Ga0070665_100108386 | 3300005548 | Bacteria | 2780 |
| 116 | Ga0070665_100371142 | 3300005548 | Bacteria | 1438 |
| 117 | Ga0070665_101015425 | 3300005548 | Bacteria | 842 |
| 118 | Ga0068855_100000022 | 3300005563 | Bacteria | 190807 |
| 119 | Ga0068855_100076020 | 3300005563 | Bacteria | 3898 |
| 120 | Ga0068855_100260361 | 3300005563 | Bacteria | 1932 |
| 121 | Ga0068855_100265765 | 3300005563 | Bacteria | 1910 |
| 122 | Ga0068855_100497810 | 3300005563 | Bacteria | 1324 |
| 123 | Ga0070664_100147623 | 3300005564 | Bacteria | 2075 |
| 124 | Ga0068857_100136152 | 3300005577 | Bacteria | 2218 |
| 125 | Ga0068857_100425486 | 3300005577 | Bacteria | 1238 |
| 126 | Ga0068857_100449258 | 3300005577 | Bacteria | 1205 |
| 127 | Ga0068854_100256004 | 3300005578 | Bacteria | 1400 |
| 128 | Ga0068854_100346474 | 3300005578 | Bacteria | 1215 |
| 129 | Ga0068856_100001018 | 3300005614 | Bacteria | 29855 |
| 130 | Ga0068856_100040360 | 3300005614 | Bacteria | 4584 |
| 131 | Ga0068856_100089449 | 3300005614 | Bacteria | 3062 |
| 132 | Ga0068856_100213940 | 3300005614 | Bacteria | 1943 |
| 133 | Ga0068856_100825474 | 3300005614 | Bacteria | 946 |
| 134 | Ga0070702_100068032 | 3300005615 | Bacteria | 2095 |
| 135 | Ga0070702_100102440 | 3300005615 | Bacteria | 1759 |
| 136 | Ga0068852_100008561 | 3300005616 | Bacteria | 7546 |
| 137 | Ga0068852_100048996 | 3300005616 | Bacteria | 3612 |
| 138 | Ga0068852_100081448 | 3300005616 | Bacteria | 2873 |
| 139 | Ga0068859_100177742 | 3300005617 | Bacteria | 2211 |
| 140 | Ga0068859_100311569 | 3300005617 | Bacteria | 1667 |
| 141 | Ga0068864_100148009 | 3300005618 | Bacteria | 2124 |
| 142 | Ga0068864_100638465 | 3300005618 | Bacteria | 1036 |
| 143 | Ga0068866_10161301 | 3300005718 | Bacteria | 1308 |
| 144 | Ga0068861_100164249 | 3300005719 | Bacteria | 1834 |
| 145 | Ga0068861_100178058 | 3300005719 | Bacteria | 1767 |
| 146 | Ga0068861_100344242 | 3300005719 | Bacteria | 1305 |
| 147 | Ga0068851_10017811 | 3300005834 | Bacteria | 3418 |
| 148 | Ga0068851_10086532 | 3300005834 | Bacteria | 1644 |
| 149 | Ga0068870_10114426 | 3300005840 | Bacteria | 1545 |
| 150 | Ga0068863_100213781 | 3300005841 | Bacteria | 1857 |
| 151 | Ga0068863_100223032 | 3300005841 | Bacteria | 1817 |
| 152 | Ga0068858_100201435 | 3300005842 | Bacteria | 1882 |
| 153 | Ga0068858_100316992 | 3300005842 | Bacteria | 1490 |
| 154 | Ga0068858_100443978 | 3300005842 | Bacteria | 1250 |
| 155 | Ga0068858_100681473 | 3300005842 | Bacteria | 1000 |
| 156 | Ga0068860_100001721 | 3300005843 | Bacteria | 23342 |
| 157 | Ga0068860_100141656 | 3300005843 | Bacteria | 2311 |
| 158 | Ga0068860_100247045 | 3300005843 | Bacteria | 1737 |
| 159 | Ga0068860_100251682 | 3300005843 | Bacteria | 1721 |
| 160 | Ga0068860_100296194 | 3300005843 | Bacteria | 1584 |
| 161 | Ga0068860_100432860 | 3300005843 | Bacteria | 1305 |
| 162 | Ga0068862_100080359 | 3300005844 | Bacteria | 2827 |
| 163 | Ga0068862_100252887 | 3300005844 | Bacteria | 1606 |
| 164 | Ga0081455_10003561 | 3300005937 | Bacteria | 17867 |
| 165 | Ga0081455_10035922 | 3300005937 | Bacteria | 4419 |
| 166 | Ga0081538_10055588 | 3300005981 | Bacteria | 2328 |
| 167 | Ga0081540_1005331 | 3300005983 | Bacteria | 9623 |
| 168 | Ga0081540_1013508 | 3300005983 | Bacteria | 5304 |
| 169 | Ga0081540_1014693 | 3300005983 | Bacteria | 5001 |
| 170 | Ga0081540_1019069 | 3300005983 | Bacteria | 4185 |
| 171 | Ga0081540_1028921 | 3300005983 | Bacteria | 3100 |
| 172 | Ga0081540_1032545 | 3300005983 | Bacteria | 2845 |
| 173 | Ga0081540_1056129 | 3300005983 | Bacteria | 1914 |
| 174 | Ga0081540_1070922 | 3300005983 | Bacteria | 1612 |
| 175 | Ga0081539_10000879 | 3300005985 | Bacteria | 57604 |
| 176 | Ga0081539_10026237 | 3300005985 | Bacteria | 3724 |
| 177 | Ga0081539_10057638 | 3300005985 | Bacteria | 2148 |
| 178 | Ga0081539_10064672 | 3300005985 | Bacteria | 1989 |
| 179 | Ga0070717_10006670 | 3300006028 | Bacteria | 8513 |
| 180 | Ga0070717_10027722 | 3300006028 | Bacteria | 4528 |
| 181 | Ga0070717_10110440 | 3300006028 | Bacteria | 2345 |
| 182 | Ga0070717_10244962 | 3300006028 | Bacteria | 1582 |
| 183 | Ga0070717_10273074 | 3300006028 | Bacteria | 1498 |
| 184 | Ga0070717_10587822 | 3300006028 | Bacteria | 1010 |
| 185 | Ga0075365_10025909 | 3300006038 | Bacteria | 3716 |
| 186 | Ga0075365_10028965 | 3300006038 | Bacteria | 3534 |
| 187 | Ga0075365_10035818 | 3300006038 | Bacteria | 3213 |
| 188 | Ga0075365_10077522 | 3300006038 | Bacteria | 2245 |
| 189 | Ga0075365_10089110 | 3300006038 | Bacteria | 2100 |
| 190 | Ga0075365_10122605 | 3300006038 | Bacteria | 1794 |
| 191 | Ga0075365_10172366 | 3300006038 | Bacteria | 1511 |
| 192 | Ga0075365_10178126 | 3300006038 | Bacteria | 1486 |
| 193 | Ga0075365_10194265 | 3300006038 | Bacteria | 1421 |
| 194 | Ga0075365_10267683 | 3300006038 | Bacteria | 1202 |
| 195 | Ga0075365_10298190 | 3300006038 | Bacteria | 1134 |
| 196 | Ga0075365_10383647 | 3300006038 | Bacteria | 991 |
| 197 | Ga0075368_10015140 | 3300006042 | Bacteria | 2856 |
| 198 | Ga0075368_10018477 | 3300006042 | Bacteria | 2620 |
| 199 | Ga0075368_10051186 | 3300006042 | Bacteria | 1642 |
| 200 | Ga0075363_100011643 | 3300006048 | Bacteria | 4218 |
| 201 | Ga0075363_100041314 | 3300006048 | Bacteria | 2432 |
| 202 | Ga0075363_100102939 | 3300006048 | Bacteria | 1582 |
| 203 | Ga0075364_10042860 | 3300006051 | Bacteria | 2941 |
| 204 | Ga0075364_10076031 | 3300006051 | Bacteria | 2216 |
| 205 | Ga0075364_10122346 | 3300006051 | Bacteria | 1742 |
| 206 | Ga0075364_10139395 | 3300006051 | Bacteria | 1630 |
| 207 | Ga0075364_10167290 | 3300006051 | Bacteria | 1486 |
| 208 | Ga0075364_10243882 | 3300006051 | Bacteria | 1221 |
| 209 | Ga0070715_10000692 | 3300006163 | Bacteria | 9042 |
| 210 | Ga0070715_10056483 | 3300006163 | Bacteria | 1708 |
| 211 | Ga0070715_10070033 | 3300006163 | Bacteria | 1564 |
| 212 | Ga0070716_100047440 | 3300006173 | Bacteria | 2423 |
| 213 | Ga0070712_100000244 | 3300006175 | Bacteria | 30649 |
| 214 | Ga0070712_100002905 | 3300006175 | Bacteria | 10618 |
| 215 | Ga0070712_100004751 | 3300006175 | Bacteria | 8399 |
| 216 | Ga0075362_10043999 | 3300006177 | Bacteria | 1979 |
| 217 | Ga0075362_10052402 | 3300006177 | Bacteria | 1829 |
| 218 | Ga0075367_10024247 | 3300006178 | Bacteria | 3421 |
| 219 | Ga0075367_10060079 | 3300006178 | Bacteria | 2265 |
| 220 | Ga0075367_10068626 | 3300006178 | Bacteria | 2127 |
| 221 | Ga0075367_10073144 | 3300006178 | Bacteria | 2064 |
| 222 | Ga0075367_10078112 | 3300006178 | Bacteria | 1999 |
| 223 | Ga0075367_10107392 | 3300006178 | Bacteria | 1711 |
| 224 | Ga0075367_10207318 | 3300006178 | Bacteria | 1225 |
| 225 | Ga0075369_10020112 | 3300006186 | Bacteria | 2732 |
| 226 | Ga0075369_10044746 | 3300006186 | Bacteria | 1902 |
| 227 | Ga0075366_10014528 | 3300006195 | Bacteria | 4497 |
| 228 | Ga0075366_10103637 | 3300006195 | Bacteria | 1709 |
| 229 | Ga0075366_10117966 | 3300006195 | Bacteria | 1598 |
| 230 | Ga0075366_10244598 | 3300006195 | Bacteria | 1094 |
| 231 | Ga0097621_100203993 | 3300006237 | Bacteria | 1718 |
| 232 | Ga0097621_100276226 | 3300006237 | Bacteria | 1478 |
| 233 | Ga0097621_100401247 | 3300006237 | Bacteria | 1227 |
| 234 | Ga0075370_10029278 | 3300006353 | Bacteria | 3067 |
| 235 | Ga0075370_10075364 | 3300006353 | Bacteria | 1934 |
| 236 | Ga0068871_100033813 | 3300006358 | Bacteria | 4051 |
| 237 | Ga0068871_100154445 | 3300006358 | Bacteria | 1959 |
| 238 | Ga0075431_100355593 | 3300006847 | Bacteria | 1472 |
| 239 | Ga0075434_100015658 | 3300006871 | Bacteria | 7278 |
| 240 | Ga0068865_100170632 | 3300006881 | Bacteria | 1667 |
| 241 | Ga0068865_100417125 | 3300006881 | Bacteria | 1103 |
| 242 | Ga0075436_100152439 | 3300006914 | Bacteria | 1627 |
| 243 | Ga0097620_100177750 | 3300006931 | Bacteria | 2211 |
| 244 | Ga0097620_100311572 | 3300006931 | Bacteria | 1667 |
| 245 | Ga0099822_1024801 | 3300006943 | Bacteria | 5314 |
| 246 | Ga0075435_100193617 | 3300007076 | Bacteria | 1721 |
| 247 | Ga0099794_10028369 | 3300007265 | Bacteria | 2604 |
| 248 | Ga0099794_10089968 | 3300007265 | Bacteria | 1522 |
| 249 | Ga0099794_10092687 | 3300007265 | Bacteria | 1500 |
| 250 | Ga0099795_10034742 | 3300007788 | Bacteria | 1758 |
| 251 | Ga0099795_10039452 | 3300007788 | Bacteria | 1672 |
| 252 | Ga0105250_10143620 | 3300009092 | Bacteria | 990 |
| 253 | Ga0105240_10000479 | 3300009093 | Bacteria | 73782 |
| 254 | Ga0105240_10007458 | 3300009093 | Bacteria | 15876 |
| 255 | Ga0105240_10128815 | 3300009093 | Bacteria | 3038 |
| 256 | Ga0105240_10152375 | 3300009093 | Bacteria | 2752 |
| 257 | Ga0105240_10655677 | 3300009093 | Bacteria | 1150 |
| 258 | Ga0105240_10669412 | 3300009093 | Bacteria | 1136 |
| 259 | Ga0111539_10119914 | 3300009094 | Bacteria | 3082 |
| 260 | Ga0111539_10403435 | 3300009094 | Bacteria | 1592 |
| 261 | Ga0105245_10027097 | 3300009098 | Bacteria | 5049 |
| 262 | Ga0105245_10158408 | 3300009098 | Bacteria | 2147 |
| 263 | Ga0105245_10362223 | 3300009098 | Bacteria | 1439 |
| 264 | Ga0105247_10006862 | 3300009101 | Bacteria | 7016 |
| 265 | Ga0105247_10054723 | 3300009101 | Bacteria | 2462 |
| 266 | Ga0105247_10056060 | 3300009101 | Bacteria | 2433 |
| 267 | Ga0105247_10099147 | 3300009101 | Bacteria | 1860 |
| 268 | Ga0105247_10209355 | 3300009101 | Bacteria | 1314 |
| 269 | Ga0105247_10229794 | 3300009101 | Bacteria | 1259 |
| 270 | Ga0105247_10259585 | 3300009101 | Bacteria | 1191 |
| 271 | Ga0114129_10653701 | 3300009147 | Bacteria | 1356 |
| 272 | Ga0105243_10071509 | 3300009148 | Bacteria | 2805 |
| 273 | Ga0105243_10221113 | 3300009148 | Bacteria | 1674 |
| 274 | Ga0105241_10040448 | 3300009174 | Bacteria | 3520 |
| 275 | Ga0105241_10050885 | 3300009174 | Bacteria | 3158 |
| 276 | Ga0105241_10085698 | 3300009174 | Bacteria | 2476 |
| 277 | Ga0105241_10206836 | 3300009174 | Bacteria | 1642 |
| 278 | Ga0105241_10456516 | 3300009174 | Bacteria | 1131 |
| 279 | Ga0105242_10138748 | 3300009176 | Bacteria | 2107 |
| 280 | Ga0105248_10046836 | 3300009177 | Bacteria | 4848 |
| 281 | Ga0105248_10057103 | 3300009177 | Bacteria | 4381 |
| 282 | Ga0105248_10133843 | 3300009177 | Bacteria | 2797 |
| 283 | Ga0105248_10235465 | 3300009177 | Bacteria | 2061 |
| 284 | Ga0105248_10433820 | 3300009177 | Bacteria | 1480 |
| 285 | Ga0105237_10019409 | 3300009545 | Bacteria | 7020 |
| 286 | Ga0105237_10040511 | 3300009545 | Bacteria | 4697 |
| 287 | Ga0105237_10068946 | 3300009545 | Bacteria | 3531 |
| 288 | Ga0105237_10073153 | 3300009545 | Bacteria | 3420 |
| 289 | Ga0105237_10138669 | 3300009545 | Bacteria | 2427 |
| 290 | Ga0105237_10212444 | 3300009545 | Bacteria | 1934 |
| 291 | Ga0105237_10342503 | 3300009545 | Bacteria | 1499 |
| 292 | Ga0105238_10003574 | 3300009551 | Bacteria | 15496 |
| 293 | Ga0105238_10078604 | 3300009551 | Bacteria | 3289 |
| 294 | Ga0105238_10079172 | 3300009551 | Bacteria | 3276 |
| 295 | Ga0105238_10173018 | 3300009551 | Bacteria | 2136 |
| 296 | Ga0105238_10214235 | 3300009551 | Bacteria | 1902 |
| 297 | Ga0105238_10469780 | 3300009551 | Bacteria | 1256 |
| 298 | Ga0105238_10534798 | 3300009551 | Bacteria | 1175 |
| 299 | Ga0105238_10604499 | 3300009551 | Bacteria | 1105 |
| 300 | Ga0105249_10369740 | 3300009553 | Bacteria | 1457 |
| 301 | Ga0099796_10039618 | 3300010159 | Bacteria | 1587 |
| 302 | Ga0099796_10041721 | 3300010159 | Bacteria | 1555 |
| 303 | Ga0105239_10000773 | 3300010375 | Bacteria | 45320 |
| 304 | Ga0105239_10031784 | 3300010375 | Bacteria | 5800 |
| 305 | Ga0105239_10073781 | 3300010375 | Bacteria | 3751 |
| 306 | Ga0105239_10107432 | 3300010375 | Bacteria | 3092 |
| 307 | Ga0105239_10131733 | 3300010375 | Bacteria | 2782 |
| 308 | Ga0105239_10150962 | 3300010375 | Bacteria | 2593 |
| 309 | Ga0105239_10250822 | 3300010375 | Bacteria | 1988 |
| 310 | Ga0105239_10288295 | 3300010375 | Bacteria | 1849 |
| 311 | Ga0105246_10023203 | 3300011119 | Bacteria | 4012 |
| 312 | Ga0105246_10240449 | 3300011119 | Bacteria | 1431 |
| 313 | Ga0105246_10459867 | 3300011119 | Bacteria | 1072 |
| 314 | Ga0105246_10547430 | 3300011119 | Bacteria | 991 |
| 315 | Ga0157370_10073863 | 3300013104 | Bacteria | 3217 |
| 316 | Ga0157370_10166258 | 3300013104 | Bacteria | 2051 |
| 317 | Ga0157370_10377581 | 3300013104 | Bacteria | 1306 |
| 318 | Ga0157370_10411244 | 3300013104 | Bacteria | 1245 |
| 319 | Ga0157369_10012061 | 3300013105 | Bacteria | 9815 |
| 320 | Ga0157369_10037979 | 3300013105 | Bacteria | 5268 |
| 321 | Ga0157369_10041713 | 3300013105 | Bacteria | 5008 |
| 322 | Ga0157369_10049861 | 3300013105 | Bacteria | 4536 |
| 323 | Ga0157374_10226274 | 3300013296 | Bacteria | 1837 |
| 324 | Ga0157374_10440234 | 3300013296 | Bacteria | 1304 |
| 325 | Ga0157378_10014732 | 3300013297 | Bacteria | 6850 |
| 326 | Ga0157378_10243106 | 3300013297 | Bacteria | 1720 |
| 327 | Ga0157378_10733818 | 3300013297 | Bacteria | 1009 |
| 328 | Ga0157378_10883591 | 3300013297 | Bacteria | 924 |
| 329 | Ga0163162_10207638 | 3300013306 | Bacteria | 2088 |
| 330 | Ga0163162_10524303 | 3300013306 | Bacteria | 1314 |
| 331 | Ga0157372_10523485 | 3300013307 | Bacteria | 1382 |
| 332 | Ga0157372_10657929 | 3300013307 | Bacteria | 1220 |
| 333 | Ga0157375_10049447 | 3300013308 | Bacteria | 4120 |
| 334 | Ga0157375_10455632 | 3300013308 | Bacteria | 1445 |
| 335 | Ga0163163_10062000 | 3300014325 | Bacteria | 3705 |
| 336 | Ga0163163_10096893 | 3300014325 | Bacteria | 2970 |
| 337 | Ga0163163_10110182 | 3300014325 | Bacteria | 2781 |
| 338 | Ga0163163_10260852 | 3300014325 | Bacteria | 1784 |
| 339 | Ga0163163_10477607 | 3300014325 | Bacteria | 1307 |
| 340 | Ga0163163_10507350 | 3300014325 | Bacteria | 1268 |
| 341 | Ga0163163_10540552 | 3300014325 | Bacteria | 1228 |
| 342 | Ga0163163_10625360 | 3300014325 | Bacteria | 1140 |
| 343 | Ga0157380_10073085 | 3300014326 | Bacteria | 2779 |
| 344 | Ga0157380_10134433 | 3300014326 | Bacteria | 2114 |
| 345 | Ga0157380_10523710 | 3300014326 | Bacteria | 1157 |
| 346 | Ga0157379_10094448 | 3300014968 | Bacteria | 2683 |
| 347 | Ga0157379_10102294 | 3300014968 | Bacteria | 2572 |
| 348 | Ga0157376_10103182 | 3300014969 | Bacteria | 2496 |
| 349 | Ga0157376_10128319 | 3300014969 | Bacteria | 2259 |
| 350 | Ga0157376_10175821 | 3300014969 | Bacteria | 1953 |
| 351 | Ga0157376_10671345 | 3300014969 | Bacteria | 1039 |
| 352 | Ga0157376_10671697 | 3300014969 | Bacteria | 1038 |
| 353 | Ga0206356_11680992 | 3300020070 | Bacteria | 1781 |
| 354 | Ga0206352_10327112 | 3300020078 | Bacteria | 1135 |
| 355 | Ga0206350_11175645 | 3300020080 | Bacteria | 1459 |
| 356 | Ga0206353_10360498 | 3300020082 | Bacteria | 1655 |
| 357 | Ga0213873_10048796 | 3300021358 | Bacteria | 1114 |
| 358 | Ga0213872_10035151 | 3300021361 | Bacteria | 2292 |
| 359 | Ga0213876_10000379 | 3300021384 | Bacteria | 37697 |
| 360 | Ga0213876_10027975 | 3300021384 | Bacteria | 2973 |
| 361 | Ga0213876_10060856 | 3300021384 | Bacteria | 1992 |
| 362 | Ga0213875_10058079 | 3300021388 | Bacteria | 1812 |
| 363 | Ga0213871_10012844 | 3300021441 | Bacteria | 1956 |
| 364 | Ga0224712_10004314 | 3300022467 | Bacteria | 3821 |
| 365 | Ga0224712_10068820 | 3300022467 | Bacteria | 1431 |
| 366 | Ga0209563_100900 | 3300025230 | Bacteria | 8805 |
| 367 | Ga0209677_100589 | 3300025253 | Bacteria | 19782 |
| 368 | Ga0209677_100686 | 3300025253 | Bacteria | 17323 |
| 369 | Ga0209148_1000192 | 3300025254 | Bacteria | 115724 |
| 370 | Ga0209233_1001637 | 3300025261 | Bacteria | 8720 |
| 371 | Ga0209233_1030385 | 3300025261 | Bacteria | 1273 |
| 372 | Ga0209455_1000892 | 3300025272 | Bacteria | 15629 |
| 373 | Ga0209455_1008942 | 3300025272 | Bacteria | 2671 |
| 374 | Ga0209455_1010792 | 3300025272 | Bacteria | 2297 |
| 375 | Ga0209758_1000030 | 3300025297 | Bacteria | 509217 |
| 376 | Ga0209758_1000963 | 3300025297 | Bacteria | 38837 |
| 377 | Ga0209758_1001374 | 3300025297 | Bacteria | 29041 |
| 378 | Ga0209758_1002540 | 3300025297 | Bacteria | 18393 |
| 379 | Ga0209758_1002971 | 3300025297 | Bacteria | 16255 |
| 380 | Ga0209758_1006840 | 3300025297 | Bacteria | 7988 |
| 381 | Ga0209758_1056005 | 3300025297 | Bacteria | 1334 |
| 382 | Ga0209256_1007102 | 3300025299 | Bacteria | 5650 |
| 383 | Ga0209256_1030381 | 3300025299 | Bacteria | 1493 |
| 384 | Ga0207426_1001611 | 3300025302 | Bacteria | 17898 |
| 385 | Ga0207426_1002230 | 3300025302 | Bacteria | 12929 |
| 386 | Ga0207426_1045987 | 3300025302 | Bacteria | 1324 |
| 387 | Ga0207426_1049336 | 3300025302 | Bacteria | 1260 |
| 388 | Ga0209051_1040948 | 3300025303 | Bacteria | 1654 |
| 389 | Ga0209257_1000778 | 3300025304 | Bacteria | 47189 |
| 390 | Ga0207656_10249198 | 3300025321 | Bacteria | 870 |
| 391 | Ga0207692_10001095 | 3300025898 | Bacteria | 9926 |
| 392 | Ga0207692_10001486 | 3300025898 | Bacteria | 8794 |
| 393 | Ga0207692_10019848 | 3300025898 | Bacteria | 3045 |
| 394 | Ga0207692_10083894 | 3300025898 | Bacteria | 1711 |
| 395 | Ga0207692_10150991 | 3300025898 | Bacteria | 1330 |
| 396 | Ga0207692_10217558 | 3300025898 | Bacteria | 1131 |
| 397 | Ga0207710_10004750 | 3300025900 | Bacteria | 5889 |
| 398 | Ga0207710_10031359 | 3300025900 | Bacteria | 2324 |
| 399 | Ga0207710_10049449 | 3300025900 | Bacteria | 1884 |
| 400 | Ga0207710_10056106 | 3300025900 | Bacteria | 1777 |
| 401 | Ga0207680_10159343 | 3300025903 | Bacteria | 1512 |
| 402 | Ga0207647_10039838 | 3300025904 | Bacteria | 2962 |
| 403 | Ga0207685_10006479 | 3300025905 | Bacteria | 3191 |
| 404 | Ga0207699_10003048 | 3300025906 | Bacteria | 7954 |
| 405 | Ga0207699_10024107 | 3300025906 | Bacteria | 3322 |
| 406 | Ga0207699_10082251 | 3300025906 | Bacteria | 2000 |
| 407 | Ga0207699_10101524 | 3300025906 | Bacteria | 1826 |
| 408 | Ga0207645_10307664 | 3300025907 | Bacteria | 1056 |
| 409 | Ga0207643_10174427 | 3300025908 | Bacteria | 1299 |
| 410 | Ga0207643_10269159 | 3300025908 | Bacteria | 1054 |
| 411 | Ga0207705_10046628 | 3300025909 | Bacteria | 3115 |
| 412 | Ga0207684_10262757 | 3300025910 | Bacteria | 1489 |
| 413 | Ga0207654_10047021 | 3300025911 | Bacteria | 2464 |
| 414 | Ga0207654_10047597 | 3300025911 | Bacteria | 2451 |
| 415 | Ga0207654_10182504 | 3300025911 | Bacteria | 1370 |
| 416 | Ga0207654_10298750 | 3300025911 | Bacteria | 1094 |
| 417 | Ga0207707_10327035 | 3300025912 | Bacteria | 1323 |
| 418 | Ga0207695_10000018 | 3300025913 | Bacteria | 766611 |
| 419 | Ga0207695_10000059 | 3300025913 | Bacteria | 363920 |
| 420 | Ga0207671_10031638 | 3300025914 | Bacteria | 3943 |
| 421 | Ga0207671_10126097 | 3300025914 | Bacteria | 1961 |
| 422 | Ga0207671_10255242 | 3300025914 | Bacteria | 1379 |
| 423 | Ga0207693_10000135 | 3300025915 | Bacteria | 67093 |
| 424 | Ga0207693_10002846 | 3300025915 | Bacteria | 14982 |
| 425 | Ga0207693_10002989 | 3300025915 | Bacteria | 14634 |
| 426 | Ga0207693_10054373 | 3300025915 | Bacteria | 3141 |
| 427 | Ga0207693_10328824 | 3300025915 | Bacteria | 1196 |
| 428 | Ga0207663_10030130 | 3300025916 | Bacteria | 3196 |
| 429 | Ga0207663_10108560 | 3300025916 | Bacteria | 1879 |
| 430 | Ga0207660_10016173 | 3300025917 | Bacteria | 4935 |
| 431 | Ga0207660_10128437 | 3300025917 | Bacteria | 1927 |
| 432 | Ga0207657_10003421 | 3300025919 | Bacteria | 16945 |
| 433 | Ga0207657_10033247 | 3300025919 | Bacteria | 4650 |
| 434 | Ga0207657_10361687 | 3300025919 | Bacteria | 1144 |
| 435 | Ga0207649_10078949 | 3300025920 | Bacteria | 2125 |
| 436 | Ga0207652_10016392 | 3300025921 | Bacteria | 6051 |
| 437 | Ga0207652_10049462 | 3300025921 | Bacteria | 3598 |
| 438 | Ga0207652_10246762 | 3300025921 | Bacteria | 1610 |
| 439 | Ga0207652_10496463 | 3300025921 | Bacteria | 1099 |
| 440 | Ga0207646_10186796 | 3300025922 | Bacteria | 1872 |
| 441 | Ga0207681_10352857 | 3300025923 | Bacteria | 1178 |
| 442 | Ga0207681_10379656 | 3300025923 | Bacteria | 1137 |
| 443 | Ga0207681_10500556 | 3300025923 | Bacteria | 995 |
| 444 | Ga0207694_10000005 | 3300025924 | Bacteria | 823704 |
| 445 | Ga0207694_10015922 | 3300025924 | Bacteria | 5674 |
| 446 | Ga0207694_10219180 | 3300025924 | Bacteria | 1551 |
| 447 | Ga0207694_10373878 | 3300025924 | Bacteria | 1182 |
| 448 | Ga0207694_10373895 | 3300025924 | Bacteria | 1182 |
| 449 | Ga0207650_10429883 | 3300025925 | Bacteria | 1096 |
| 450 | Ga0207650_10458359 | 3300025925 | Bacteria | 1062 |
| 451 | Ga0207659_10552773 | 3300025926 | Bacteria | 979 |
| 452 | Ga0207687_10015988 | 3300025927 | Bacteria | 4923 |
| 453 | Ga0207687_10053389 | 3300025927 | Bacteria | 2823 |
| 454 | Ga0207687_10240022 | 3300025927 | Bacteria | 1436 |
| 455 | Ga0207700_10037283 | 3300025928 | Bacteria | 3519 |
| 456 | Ga0207700_10050229 | 3300025928 | Bacteria | 3107 |
| 457 | Ga0207700_10165803 | 3300025928 | Bacteria | 1838 |
| 458 | Ga0207700_10193122 | 3300025928 | Bacteria | 1712 |
| 459 | Ga0207700_10242341 | 3300025928 | Bacteria | 1537 |
| 460 | Ga0207664_10014503 | 3300025929 | Bacteria | 5694 |
| 461 | Ga0207664_10143538 | 3300025929 | Bacteria | 2022 |
| 462 | Ga0207644_10061040 | 3300025931 | Bacteria | 2729 |
| 463 | Ga0207690_10477970 | 3300025932 | Bacteria | 1005 |
| 464 | Ga0207706_10040481 | 3300025933 | Bacteria | 4130 |
| 465 | Ga0207706_10152726 | 3300025933 | Bacteria | 2031 |
| 466 | Ga0207706_10155994 | 3300025933 | Bacteria | 2008 |
| 467 | Ga0207706_10471494 | 3300025933 | Bacteria | 1085 |
| 468 | Ga0207686_10045445 | 3300025934 | Bacteria | 2702 |
| 469 | Ga0207709_10043282 | 3300025935 | Bacteria | 2713 |
| 470 | Ga0207669_10006847 | 3300025937 | Bacteria | 5242 |
| 471 | Ga0207669_10116476 | 3300025937 | Bacteria | 1803 |
| 472 | Ga0207704_10248610 | 3300025938 | Bacteria | 1333 |
| 473 | Ga0207704_10348784 | 3300025938 | Bacteria | 1152 |
| 474 | Ga0207665_10001253 | 3300025939 | Bacteria | 17114 |
| 475 | Ga0207665_10008178 | 3300025939 | Bacteria | 6906 |
| 476 | Ga0207665_10013855 | 3300025939 | Bacteria | 5302 |
| 477 | Ga0207665_10069404 | 3300025939 | Bacteria | 2403 |
| 478 | Ga0207665_10111687 | 3300025939 | Bacteria | 1921 |
| 479 | Ga0207665_10121463 | 3300025939 | Bacteria | 1846 |
| 480 | Ga0207665_10139468 | 3300025939 | Bacteria | 1727 |
| 481 | Ga0207665_10532829 | 3300025939 | Bacteria | 911 |
| 482 | Ga0207691_10207495 | 3300025940 | Bacteria | 1703 |
| 483 | Ga0207711_10049144 | 3300025941 | Bacteria | 3610 |
| 484 | Ga0207711_10123067 | 3300025941 | Bacteria | 2318 |
| 485 | Ga0207711_10254340 | 3300025941 | Bacteria | 1614 |
| 486 | Ga0207711_10439987 | 3300025941 | Bacteria | 1213 |
| 487 | Ga0207689_10204450 | 3300025942 | Bacteria | 1631 |
| 488 | Ga0207689_10649328 | 3300025942 | Bacteria | 889 |
| 489 | Ga0207661_10001342 | 3300025944 | Bacteria | 16514 |
| 490 | Ga0207667_10000061 | 3300025949 | Bacteria | 190818 |
| 491 | Ga0207667_10023451 | 3300025949 | Bacteria | 6794 |
| 492 | Ga0207667_10185997 | 3300025949 | Bacteria | 2132 |
| 493 | Ga0207667_10296839 | 3300025949 | Bacteria | 1651 |
| 494 | Ga0207667_10720176 | 3300025949 | Bacteria | 999 |
| 495 | Ga0207651_10180529 | 3300025960 | Bacteria | 1674 |
| 496 | Ga0207651_10472116 | 3300025960 | Bacteria | 1080 |
| 497 | Ga0207712_10625430 | 3300025961 | Bacteria | 934 |
| 498 | Ga0207668_10004124 | 3300025972 | Bacteria | 8524 |
| 499 | Ga0207668_10123496 | 3300025972 | Bacteria | 1964 |
| 500 | Ga0207668_10212140 | 3300025972 | Bacteria | 1549 |
| 501 | Ga0207668_10228602 | 3300025972 | Bacteria | 1498 |
| 502 | Ga0207640_10123629 | 3300025981 | Bacteria | 1859 |
| 503 | Ga0207640_10177133 | 3300025981 | Bacteria | 1595 |
| 504 | Ga0207658_10045657 | 3300025986 | Bacteria | 3195 |
| 505 | Ga0207677_10022538 | 3300026023 | Bacteria | 3873 |
| 506 | Ga0207677_10066679 | 3300026023 | Bacteria | 2518 |
| 507 | Ga0207677_10311058 | 3300026023 | Bacteria | 1305 |
| 508 | Ga0207703_10276266 | 3300026035 | Bacteria | 1524 |
| 509 | Ga0207639_10001314 | 3300026041 | Bacteria | 16811 |
| 510 | Ga0207639_10128686 | 3300026041 | Bacteria | 2093 |
| 511 | Ga0207639_10143561 | 3300026041 | Bacteria | 1992 |
| 512 | Ga0207639_10162448 | 3300026041 | Bacteria | 1883 |
| 513 | Ga0207639_10215547 | 3300026041 | Bacteria | 1655 |
| 514 | Ga0207639_10309103 | 3300026041 | Bacteria | 1400 |
| 515 | Ga0207639_10815690 | 3300026041 | Bacteria | 870 |
| 516 | Ga0207678_10049702 | 3300026067 | Bacteria | 3624 |
| 517 | Ga0207678_10050540 | 3300026067 | Bacteria | 3592 |
| 518 | Ga0207678_10056281 | 3300026067 | Bacteria | 3386 |
| 519 | Ga0207678_10107910 | 3300026067 | Bacteria | 2375 |
| 520 | Ga0207678_10108612 | 3300026067 | Bacteria | 2367 |
| 521 | Ga0207678_10151225 | 3300026067 | Bacteria | 1982 |
| 522 | Ga0207678_10161436 | 3300026067 | Bacteria | 1914 |
| 523 | Ga0207678_10178825 | 3300026067 | Bacteria | 1811 |
| 524 | Ga0207678_10269903 | 3300026067 | Bacteria | 1459 |
| 525 | Ga0207708_10302338 | 3300026075 | Bacteria | 1301 |
| 526 | Ga0207702_10000589 | 3300026078 | Bacteria | 40161 |
| 527 | Ga0207702_10220702 | 3300026078 | Bacteria | 1766 |
| 528 | Ga0207702_10561532 | 3300026078 | Bacteria | 1117 |
| 529 | Ga0207702_10596651 | 3300026078 | Bacteria | 1083 |
| 530 | Ga0207702_10696890 | 3300026078 | Bacteria | 1001 |
| 531 | Ga0207641_10115883 | 3300026088 | Bacteria | 2383 |
| 532 | Ga0207641_10494314 | 3300026088 | Bacteria | 1187 |
| 533 | Ga0207648_10115297 | 3300026089 | Bacteria | 2361 |
| 534 | Ga0207676_10092749 | 3300026095 | Bacteria | 2484 |
| 535 | Ga0207676_10366987 | 3300026095 | Bacteria | 1336 |
| 536 | Ga0207674_10005581 | 3300026116 | Bacteria | 14915 |
| 537 | Ga0207674_10289944 | 3300026116 | Bacteria | 1585 |
| 538 | Ga0207674_10434216 | 3300026116 | Bacteria | 1269 |
| 539 | Ga0207675_100011675 | 3300026118 | Bacteria | 8214 |
| 540 | Ga0207675_100258163 | 3300026118 | Bacteria | 1688 |
| 541 | Ga0207675_100909768 | 3300026118 | Bacteria | 896 |
| 542 | Ga0207683_10069852 | 3300026121 | Bacteria | 3102 |
| 543 | Ga0207683_10087590 | 3300026121 | Bacteria | 2769 |
| 544 | Ga0207683_10216350 | 3300026121 | Bacteria | 1745 |
| 545 | Ga0207683_10237500 | 3300026121 | Bacteria | 1662 |
| 546 | Ga0207698_10003421 | 3300026142 | Bacteria | 9550 |
| 547 | Ga0207698_10075416 | 3300026142 | Bacteria | 2695 |
| 548 | Ga0207698_10250937 | 3300026142 | Bacteria | 1619 |
| 549 | Ga0209589_1000017 | 3300027357 | Bacteria | 215546 |
| 550 | Ga0209489_100018 | 3300027361 | Bacteria | 215546 |
| 551 | Ga0209700_100028 | 3300027363 | Bacteria | 215546 |
| 552 | Ga0209588_1064418 | 3300027671 | Bacteria | 1184 |
| 553 | Ga0209813_10036988 | 3300027866 | Bacteria | 1469 |
| 554 | Ga0207428_10057863 | 3300027907 | Bacteria | 3077 |
| 555 | Ga0268266_10003301 | 3300028379 | Bacteria | 16212 |
| 556 | Ga0268266_10004550 | 3300028379 | Bacteria | 13252 |
| 557 | Ga0268266_10009757 | 3300028379 | Bacteria | 8445 |
| 558 | Ga0268266_10039193 | 3300028379 | Bacteria | 4035 |
| 559 | Ga0268266_10047642 | 3300028379 | Bacteria | 3673 |
| 560 | Ga0268266_10569525 | 3300028379 | Bacteria | 1086 |
| 561 | Ga0268265_10068111 | 3300028380 | Bacteria | 2758 |
| 562 | Ga0268265_10233380 | 3300028380 | Bacteria | 1618 |
| 563 | Ga0268264_10000107 | 3300028381 | Bacteria | 209105 |
| 564 | Ga0268264_10146383 | 3300028381 | Bacteria | 2113 |
| 565 | Ga0268264_10223930 | 3300028381 | Bacteria | 1733 |
| 566 | Ga0268264_10444787 | 3300028381 | Bacteria | 1254 |
| 567 | Ga0265326_10024038 | 3300028558 | Bacteria | 1739 |
| 568 | Ga0265319_1001409 | 3300028563 | Bacteria | 14410 |
| 569 | Ga0265334_10001624 | 3300028573 | Bacteria | 10806 |
| 570 | Ga0265318_10000199 | 3300028577 | Bacteria | 52225 |
| 571 | Ga0265318_10006240 | 3300028577 | Bacteria | 5510 |
| 572 | Ga0265323_10000684 | 3300028653 | Bacteria | 18453 |
| 573 | Ga0265336_10000459 | 3300028666 | Bacteria | 24631 |
| 574 | Ga0307517_10002574 | 3300028786 | Bacteria | 28885 |
| 575 | Ga0307515_10027983 | 3300028794 | Bacteria | 9602 |
| 576 | Ga0307515_10101962 | 3300028794 | Bacteria | 3458 |
| 577 | Ga0307515_10318185 | 3300028794 | Bacteria | 1225 |
| 578 | Ga0307515_10319947 | 3300028794 | Bacteria | 1219 |
| 579 | Ga0265338_10002741 | 3300028800 | Bacteria | 25847 |
| 580 | Ga0265324_10002054 | 3300029957 | Bacteria | 10690 |
| 581 | Ga0307511_10024436 | 3300030521 | Bacteria | 5601 |
| 582 | Ga0307511_10090887 | 3300030521 | Bacteria | 2070 |
| 583 | Ga0265330_10003717 | 3300031235 | Bacteria | 7899 |
| 584 | Ga0265330_10005196 | 3300031235 | Bacteria | 6510 |
| 585 | Ga0265330_10080725 | 3300031235 | Bacteria | 1401 |
| 586 | Ga0265332_10026658 | 3300031238 | Bacteria | 2534 |
| 587 | Ga0265328_10077962 | 3300031239 | Bacteria | 1220 |
| 588 | Ga0265325_10004205 | 3300031241 | Bacteria | 9143 |
| 589 | Ga0265339_10000343 | 3300031249 | Bacteria | 37462 |
| 590 | Ga0265339_10108519 | 3300031249 | Bacteria | 1438 |
| 591 | Ga0265331_10000113 | 3300031250 | Bacteria | 105472 |
| 592 | Ga0265331_10018105 | 3300031250 | Bacteria | 3659 |
| 593 | Ga0265331_10024685 | 3300031250 | Bacteria | 3039 |
| 594 | Ga0265316_10126412 | 3300031344 | Bacteria | 1927 |
| 595 | Ga0265316_10389572 | 3300031344 | Bacteria | 1005 |
| 596 | Ga0307513_10129649 | 3300031456 | Bacteria | 2470 |
| 597 | Ga0307513_10157467 | 3300031456 | Bacteria | 2169 |
| 598 | Ga0307509_10018509 | 3300031507 | Bacteria | 7986 |
| 599 | Ga0307509_10165598 | 3300031507 | Bacteria | 2100 |
| 600 | Ga0307508_10000154 | 3300031616 | Bacteria | 82824 |
| 601 | Ga0307508_10020956 | 3300031616 | Bacteria | 5941 |
| 602 | Ga0307508_10104174 | 3300031616 | Bacteria | 2434 |
| 603 | Ga0265314_10007930 | 3300031711 | Bacteria | 9159 |
| 604 | Ga0265314_10038992 | 3300031711 | Bacteria | 3427 |
| 605 | Ga0265314_10167255 | 3300031711 | Bacteria | 1331 |
| 606 | Ga0265342_10014987 | 3300031712 | Bacteria | 5120 |
| 607 | Ga0265342_10021922 | 3300031712 | Bacteria | 4070 |
| 608 | Ga0265342_10037780 | 3300031712 | Bacteria | 2943 |
| 609 | Ga0307516_10005650 | 3300031730 | Bacteria | 14869 |
| 610 | Ga0307516_10114257 | 3300031730 | Bacteria | 2497 |
| 611 | Ga0307516_10116416 | 3300031730 | Bacteria | 2468 |
| 612 | Ga0307516_10204685 | 3300031730 | Bacteria | 1691 |
| 613 | Ga0307405_10215055 | 3300031731 | Bacteria | 1406 |
| 614 | Ga0307406_10422755 | 3300031901 | Bacteria | 1062 |
| 615 | Ga0307412_10242146 | 3300031911 | Bacteria | 1396 |
| 616 | Ga0307412_10256728 | 3300031911 | Bacteria | 1360 |
| 617 | Ga0307412_10417345 | 3300031911 | Bacteria | 1097 |
| 618 | Ga0307412_10540795 | 3300031911 | Bacteria | 977 |
| 619 | Ga0307409_100019096 | 3300031995 | Bacteria | 4630 |
| 620 | Ga0307416_100404467 | 3300032002 | Bacteria | 1404 |
| 621 | Ga0307416_100525870 | 3300032002 | Bacteria | 1252 |
| 622 | Ga0307416_100801905 | 3300032002 | Bacteria | 1037 |
| 623 | Ga0307416_100992969 | 3300032002 | Bacteria | 942 |
| 624 | Ga0307411_10353908 | 3300032005 | Bacteria | 1198 |
| 625 | Ga0307415_100035272 | 3300032126 | Bacteria | 3266 |
| 626 | Ga0307507_10131484 | 3300033179 | Bacteria | 1956 |
| 627 | Ga0307507_10286597 | 3300033179 | Bacteria | 1024 |
| 628 | Ga0307510_10002191 | 3300033180 | Bacteria | 22082 |
| 629 | Ga0307510_10005503 | 3300033180 | Bacteria | 15094 |
| 630 | Ga0307510_10014423 | 3300033180 | Bacteria | 9354 |
| 631 | Ga0307510_10205698 | 3300033180 | Bacteria | 1497 |
| 632 | Ga0373934_0002927 | 3300035086 | Bacteria | 6248 |
| 633 | Ga0373923_0001517 | 3300035111 | Bacteria | 6689 |
| 634 | Ga0373932_0043812 | 3300035112 | Bacteria | 1303 |
| 635 | Ga0373936_0003688 | 3300035113 | Bacteria | 5750 |
| 636 | Ga0373945_0026797 | 3300035116 | Bacteria | 2009 |
| 637 | Ga0373945_0090801 | 3300035116 | Bacteria | 1182 |
| 638 | Ga0373953_0002334 | 3300035117 | Bacteria | 5712 |
| 639 | Ga0373953_0020514 | 3300035117 | Bacteria | 2470 |
| 640 | Ga0373953_0064608 | 3300035117 | Bacteria | 1501 |
| 641 | Ga0373954_0000308 | 3300035118 | Bacteria | 17778 |
| 642 | Ga0373954_0081215 | 3300035118 | Bacteria | 1549 |
| 643 | Ga0373954_0188012 | 3300035118 | Bacteria | 1013 |
| 644 | Ga0373956_0007091 | 3300035119 | Bacteria | 4509 |
| 645 | Ga0373956_0024134 | 3300035119 | Bacteria | 2617 |
| 646 | Ga0373957_0035099 | 3300035120 | Bacteria | 1861 |
| 647 | Ga0373957_0084416 | 3300035120 | Bacteria | 1256 |
| 648 | Ga0373957_0099505 | 3300035120 | Bacteria | 1163 |
| 649 | Ga0373943_0064203 | 3300035170 | Bacteria | 1843 |
| 650 | Ga0373955_0000479 | 3300035172 | Bacteria | 16897 |
| 651 | Ga0373955_0013850 | 3300035172 | Bacteria | 3913 |
| 652 | Ga0373955_0031548 | 3300035172 | Bacteria | 2776 |
| 653 | Ga0373955_0037818 | 3300035172 | Bacteria | 2568 |
| 654 | Ga0373961_0040437 | 3300035241 | Bacteria | 1344 |
| 655 | Ga0373924_0001372 | 3300035410 | Bacteria | 7867 |
| 656 | Ga0373924_0003769 | 3300035410 | Bacteria | 5241 |
| 657 | Ga0373931_0004987 | 3300035691 | Bacteria | 6106 |
| 658 | Ga0373931_0019791 | 3300035691 | Bacteria | 3363 |
| 659 | Ga0373935_0000119 | 3300035692 | Bacteria | 35716 |
| 660 | Ga0373927_0000965 | 3300035695 | Bacteria | 21865 |
| 661 | Ga0373927_0004272 | 3300035695 | Bacteria | 10031 |
| 662 | Ga0373927_0015399 | 3300035695 | Bacteria | 5054 |
| 663 | Ga0373927_0023855 | 3300035695 | Bacteria | 4002 |
| 664 | Ga0373927_0059057 | 3300035695 | Bacteria | 2481 |
| 665 | Ga0373933_0001108 | 3300035724 | Bacteria | 16040 |
| 666 | Ga0373933_0001668 | 3300035724 | Bacteria | 12910 |
| 667 | Ga0373933_0100519 | 3300035724 | Bacteria | 1794 |
| 668 | Ga0373947_0001785 | 3300035725 | Bacteria | 13162 |
| 669 | Ga0373937_0005638 | 3300036401 | Bacteria | 10748 |
| 670 | Ga0373937_0006200 | 3300036401 | Bacteria | 10300 |
| 671 | Ga0373937_0125029 | 3300036401 | Bacteria | 2399 |
| 672 | Ga0373937_0192146 | 3300036401 | Bacteria | 1918 |
| 673 | Ga0373937_0735686 | 3300036401 | Bacteria | 934 |
| 674 | Ga0373925_0022704 | 3300037068 | Bacteria | 4578 |
| 675 | Ga0373925_0151490 | 3300037068 | Bacteria | 1821 |
| 676 | Ga0373925_0467483 | 3300037068 | Bacteria | 1034 |
| 677 | Ga0395899_0134752 | 3300037312 | Bacteria | 1761 |
| 678 | Ga0395900_0000787 | 3300037418 | Bacteria | 41944 |
| 679 | Ga0395900_0032409 | 3300037418 | Bacteria | 5374 |
| 680 | Ga0395900_0092771 | 3300037418 | Bacteria | 3102 |
| 681 | Ga0395900_0217539 | 3300037418 | Bacteria | 1927 |
| 682 | Ga0395900_0267352 | 3300037418 | Bacteria | 1706 |
| 683 | Ga0395900_0495410 | 3300037418 | Bacteria | 1173 |
| 684 | Ga0395898_0002946 | 3300037466 | Bacteria | 19369 |
| 685 | Ga0395898_0009257 | 3300037466 | Bacteria | 10358 |
| 686 | Ga0395898_0022662 | 3300037466 | Bacteria | 6358 |
| 687 | Ga0395898_0083383 | 3300037466 | Bacteria | 3081 |
| 688 | Ga0395898_0277124 | 3300037466 | Bacteria | 1600 |
| 689 | Ga0395898_0510652 | 3300037466 | Bacteria | 1143 |
| 690 | Ga0395905_0003015 | 3300037471 | Bacteria | 18245 |
| 691 | Ga0395905_0205532 | 3300037471 | Bacteria | 1846 |
| 692 | Ga0436364_1247840 | 3300037853 | Bacteria | 1944 |
| 693 | Ga0436364_1404333 | 3300037853 | Bacteria | 1162 |
| 694 | Ga0436364_1512892 | 3300037853 | Bacteria | 3232 |
| 695 | Ga0395901_0449065 | 3300038443 | Bacteria | 1319 |
| 696 | Ga0395901_0629020 | 3300038443 | Bacteria | 1079 |
| 697 | Ga0395901_0681709 | 3300038443 | Bacteria | 1027 |
| 698 | Ga0436365_0121548 | 3300039437 | Bacteria | 1430 |
| 699 | Ga0436365_0542778 | 3300039437 | Bacteria | 2025 |
| 700 | Ga0436365_0736791 | 3300039437 | Bacteria | 1543 |
| 701 | Ga0436365_0770725 | 3300039437 | Bacteria | 1557 |
| 702 | Ga0436365_1093355 | 3300039437 | Bacteria | 1670 |
| 703 | Ga0436365_1141460 | 3300039437 | Bacteria | 3527 |
| 704 | Ga0436365_1196036 | 3300039437 | Bacteria | 119165 |
| 705 | Ga0436365_1212928 | 3300039437 | Bacteria | 2044 |
| 706 | Ga0436365_1773510 | 3300039437 | Bacteria | 8319 |
| 707 | Ga0436365_1826856 | 3300039437 | Bacteria | 869 |
| 708 | Ga0436360_0502011 | 3300039438 | Bacteria | 1286 |
| 709 | Ga0436360_0799468 | 3300039438 | Bacteria | 1226 |
| 710 | Ga0436360_0876230 | 3300039438 | Bacteria | 2266 |
| 711 | Ga0436360_1176238 | 3300039438 | Bacteria | 1621 |
| 712 | Ga0436361_0601086 | 3300039447 | Bacteria | 3100 |
| 713 | Ga0436361_0628280 | 3300039447 | Bacteria | 1812 |
| 714 | Ga0436363_0333985 | 3300039450 | Bacteria | 981 |
| 715 | Ga0436363_1020580 | 3300039450 | Bacteria | 1547 |
| 716 | Ga0436363_1114338 | 3300039450 | Bacteria | 1223 |
| 717 | Ga0436363_1379096 | 3300039450 | Bacteria | 1109 |
| 718 | Ga0436363_1460349 | 3300039450 | Bacteria | 10788 |
| 719 | Ga0436362_0510213 | 3300039453 | Bacteria | 2827 |
| 720 | Ga0436362_0990892 | 3300039453 | Bacteria | 922 |
| 721 | Ga0439465_0048330 | 3300041413 | Bacteria | 1388 |
| 722 | Ga0451793_0670052 | 3300041452 | Bacteria | 1726 |
| 723 | Ga0451802_0602542 | 3300041460 | Bacteria | 1175 |
| 724 | Ga0439458_0063069 | 3300042157 | Bacteria | 928 |
| 725 | Ga0439458_0063523 | 3300042157 | Bacteria | 925 |
| 726 | Ga0466969_0035525 | 3300044656 | Bacteria | 2521 |
| 727 | Ga0466972_0000286 | 3300044658 | Bacteria | 31359 |
| 728 | Ga0466972_0085742 | 3300044658 | Bacteria | 1497 |
| 729 | Ga0466965_0023487 | 3300044683 | Bacteria | 2978 |
| 730 | Ga0466966_0005407 | 3300044684 | Bacteria | 8394 |
| 731 | Ga0466961_0000446 | 3300044693 | Bacteria | 26385 |
| 732 | Ga0466961_0078250 | 3300044693 | Bacteria | 2095 |
| 733 | Ga0466963_0435136 | 3300044694 | Bacteria | 925 |
| 734 | Ga0466964_0077869 | 3300044706 | Bacteria | 1416 |
| 735 | Ga0466964_0242953 | 3300044706 | Bacteria | 884 |
| 736 | Ga0466968_0015129 | 3300044735 | Bacteria | 3057 |
| 737 | Ga0466960_0087155 | 3300044901 | Bacteria | 1584 |
| 738 | Ga0466959_0015178 | 3300045049 | Bacteria | 5610 |
| 739 | Ga0466959_0049485 | 3300045049 | Bacteria | 3088 |
| 740 | Ga0466967_0018622 | 3300045976 | Bacteria | 5556 |
| 741 | Ga0495617_067131 | 3300046452 | Bacteria | 1181 |
| 742 | Ga0495592_0001710 | 3300046454 | Bacteria | 15422 |
| 743 | Ga0495592_0002892 | 3300046454 | Bacteria | 12210 |
| 744 | Ga0495592_0010188 | 3300046454 | Bacteria | 7087 |
| 745 | Ga0495592_0194101 | 3300046454 | Bacteria | 1374 |
| 746 | Ga0495592_0273579 | 3300046454 | Bacteria | 1107 |
| 747 | Ga0495603_0001895 | 3300046455 | Bacteria | 12342 |
| 748 | Ga0495603_0015122 | 3300046455 | Bacteria | 4668 |
| 749 | Ga0495603_0029402 | 3300046455 | Bacteria | 3313 |
| 750 | Ga0495603_0077918 | 3300046455 | Bacteria | 1944 |
| 751 | Ga0495603_0101825 | 3300046455 | Bacteria | 1676 |
| 752 | Ga0495603_0106449 | 3300046455 | Bacteria | 1636 |
| 753 | Ga0495590_0058882 | 3300046457 | Bacteria | 1344 |
| 754 | Ga0495629_0000348 | 3300046459 | Bacteria | 39364 |
| 755 | Ga0495629_0000353 | 3300046459 | Bacteria | 39092 |
| 756 | Ga0495629_0083140 | 3300046459 | Bacteria | 2234 |
| 757 | Ga0495629_0100825 | 3300046459 | Bacteria | 2015 |
| 758 | Ga0495629_0150241 | 3300046459 | Bacteria | 1619 |
| 759 | Ga0495638_0008632 | 3300046460 | Bacteria | 7207 |
| 760 | Ga0495638_0011137 | 3300046460 | Bacteria | 6212 |
| 761 | Ga0495638_0015142 | 3300046460 | Bacteria | 5186 |
| 762 | Ga0495638_0215063 | 3300046460 | Bacteria | 1077 |
| 763 | Ga0495638_0215336 | 3300046460 | Bacteria | 1077 |
| 764 | Ga0495641_0000972 | 3300046461 | Bacteria | 24598 |
| 765 | Ga0495651_0005720 | 3300046462 | Bacteria | 9474 |
| 766 | Ga0495651_0009935 | 3300046462 | Bacteria | 7317 |
| 767 | Ga0495651_0012448 | 3300046462 | Bacteria | 6560 |
| 768 | Ga0495651_0023259 | 3300046462 | Bacteria | 4820 |
| 769 | Ga0495651_0027908 | 3300046462 | Bacteria | 4400 |
| 770 | Ga0495651_0080407 | 3300046462 | Bacteria | 2462 |
| 771 | Ga0495651_0125451 | 3300046462 | Bacteria | 1881 |
| 772 | Ga0495653_0007405 | 3300046463 | Bacteria | 8989 |
| 773 | Ga0495653_0074094 | 3300046463 | Bacteria | 2538 |
| 774 | Ga0495653_0147515 | 3300046463 | Bacteria | 1647 |
| 775 | Ga0495653_0149706 | 3300046463 | Bacteria | 1632 |
| 776 | Ga0495650_0018520 | 3300046471 | Bacteria | 3457 |
| 777 | Ga0495650_0040687 | 3300046471 | Bacteria | 1993 |
| 778 | Ga0495580_0001291 | 3300046472 | Bacteria | 22091 |
| 779 | Ga0495580_0108232 | 3300046472 | Bacteria | 1930 |
| 780 | Ga0495580_0158865 | 3300046472 | Bacteria | 1565 |
| 781 | Ga0495582_0000444 | 3300046473 | Bacteria | 22534 |
| 782 | Ga0495639_0000177 | 3300046475 | Bacteria | 33573 |
| 783 | Ga0495639_0023674 | 3300046475 | Bacteria | 2700 |
| 784 | Ga0495662_0001662 | 3300046476 | Bacteria | 11076 |
| 785 | Ga0495664_0021304 | 3300046477 | Bacteria | 3744 |
| 786 | Ga0495664_0108480 | 3300046477 | Bacteria | 1675 |
| 787 | Ga0495585_0055573 | 3300046492 | Bacteria | 2187 |
| 788 | Ga0495585_0243050 | 3300046492 | Bacteria | 901 |
| 789 | Ga0495594_0000079 | 3300046499 | Bacteria | 42880 |
| 790 | Ga0495583_0020315 | 3300046506 | Bacteria | 3445 |
| 791 | Ga0495606_0001032 | 3300046507 | Bacteria | 40368 |
| 792 | Ga0495606_0008637 | 3300046507 | Bacteria | 8800 |
| 793 | Ga0495606_0036615 | 3300046507 | Bacteria | 3340 |
| 794 | Ga0495606_0057292 | 3300046507 | Bacteria | 2510 |
| 795 | Ga0495606_0077676 | 3300046507 | Bacteria | 2072 |
| 796 | Ga0495606_0085779 | 3300046507 | Bacteria | 1947 |
| 797 | Ga0495606_0089044 | 3300046507 | Bacteria | 1902 |
| 798 | Ga0495608_0000368 | 3300046511 | Bacteria | 31510 |
| 799 | Ga0495608_0014344 | 3300046511 | Bacteria | 5499 |
| 800 | Ga0495608_0018906 | 3300046511 | Bacteria | 4748 |
| 801 | Ga0495608_0145895 | 3300046511 | Bacteria | 1509 |
| 802 | Ga0495610_0049526 | 3300046512 | Bacteria | 2056 |
| 803 | Ga0495616_0043535 | 3300046513 | Bacteria | 2280 |
| 804 | Ga0495616_0088347 | 3300046513 | Bacteria | 1471 |
| 805 | Ga0495616_0095689 | 3300046513 | Bacteria | 1399 |
| 806 | Ga0495616_0113313 | 3300046513 | Bacteria | 1258 |
| 807 | Ga0495618_0009426 | 3300046514 | Bacteria | 5895 |
| 808 | Ga0495618_0017517 | 3300046514 | Bacteria | 4394 |
| 809 | Ga0495618_0240556 | 3300046514 | Bacteria | 1138 |
| 810 | Ga0495620_0094294 | 3300046515 | Bacteria | 1198 |
| 811 | Ga0495620_0114027 | 3300046515 | Bacteria | 1069 |
| 812 | Ga0495628_0003575 | 3300046516 | Bacteria | 13912 |
| 813 | Ga0495628_0062818 | 3300046516 | Bacteria | 2910 |
| 814 | Ga0495628_0072261 | 3300046516 | Bacteria | 2688 |
| 815 | Ga0495628_0129420 | 3300046516 | Bacteria | 1932 |
| 816 | Ga0495628_0203187 | 3300046516 | Bacteria | 1492 |
| 817 | Ga0495628_0225212 | 3300046516 | Bacteria | 1407 |
| 818 | Ga0495628_0255532 | 3300046516 | Bacteria | 1307 |
| 819 | Ga0495630_0011873 | 3300046517 | Bacteria | 6315 |
| 820 | Ga0495630_0370520 | 3300046517 | Bacteria | 1097 |
| 821 | Ga0495632_0076839 | 3300046519 | Bacteria | 1597 |
| 822 | Ga0495632_0133454 | 3300046519 | Bacteria | 1154 |
| 823 | Ga0495637_0081861 | 3300046520 | Bacteria | 1286 |
| 824 | Ga0495637_0093763 | 3300046520 | Bacteria | 1181 |
| 825 | Ga0495637_0102108 | 3300046520 | Bacteria | 1120 |
| 826 | Ga0495643_0071487 | 3300046522 | Bacteria | 1821 |
| 827 | Ga0495643_0086141 | 3300046522 | Bacteria | 1628 |
| 828 | Ga0495643_0159415 | 3300046522 | Bacteria | 1111 |
| 829 | Ga0495648_0001441 | 3300046524 | Bacteria | 23262 |
| 830 | Ga0495648_0005545 | 3300046524 | Bacteria | 10467 |
| 831 | Ga0495648_0050416 | 3300046524 | Bacteria | 2543 |
| 832 | Ga0495648_0074623 | 3300046524 | Bacteria | 1953 |
| 833 | Ga0495648_0093296 | 3300046524 | Bacteria | 1679 |
| 834 | Ga0495666_0112566 | 3300046526 | Bacteria | 1278 |
| 835 | Ga0495666_0196110 | 3300046526 | Bacteria | 929 |
| 836 | Ga0495652_0003538 | 3300046529 | Bacteria | 15351 |
| 837 | Ga0495652_0012642 | 3300046529 | Bacteria | 7606 |
| 838 | Ga0495652_0044979 | 3300046529 | Bacteria | 3800 |
| 839 | Ga0495652_0056577 | 3300046529 | Bacteria | 3330 |
| 840 | Ga0495652_0216541 | 3300046529 | Bacteria | 1442 |
| 841 | Ga0495652_0302334 | 3300046529 | Bacteria | 1162 |
| 842 | Ga0495652_0303133 | 3300046529 | Bacteria | 1160 |
| 843 | Ga0495654_0032691 | 3300046530 | Bacteria | 2636 |
| 844 | Ga0495654_0046918 | 3300046530 | Bacteria | 2125 |
| 845 | Ga0495665_0000570 | 3300046531 | Bacteria | 18750 |
| 846 | Ga0495640_0000938 | 3300046533 | Bacteria | 22518 |
| 847 | Ga0495640_0008034 | 3300046533 | Bacteria | 8288 |
| 848 | Ga0495640_0029702 | 3300046533 | Bacteria | 3921 |
| 849 | Ga0495640_0110666 | 3300046533 | Bacteria | 1795 |
| 850 | Ga0495586_0265305 | 3300046535 | Bacteria | 981 |
| 851 | Ga0495587_0004424 | 3300046536 | Bacteria | 9257 |
| 852 | Ga0495587_0010725 | 3300046536 | Bacteria | 5818 |
| 853 | Ga0495598_0001754 | 3300046537 | Bacteria | 4354 |
| 854 | Ga0495645_0049455 | 3300046543 | Bacteria | 3062 |
| 855 | Ga0495645_0137973 | 3300046543 | Bacteria | 1704 |
| 856 | Ga0495645_0231641 | 3300046543 | Bacteria | 1237 |
| 857 | Ga0495645_0380495 | 3300046543 | Bacteria | 903 |
| 858 | Ga0495622_0000888 | 3300046557 | Bacteria | 16299 |
| 859 | Ga0495622_0013293 | 3300046557 | Bacteria | 3819 |
| 860 | Ga0495622_0014188 | 3300046557 | Bacteria | 3700 |
| 861 | Ga0495622_0071534 | 3300046557 | Bacteria | 1600 |
| 862 | Ga0495633_0083705 | 3300046558 | Bacteria | 1484 |
| 863 | Ga0495633_0105571 | 3300046558 | Bacteria | 1307 |
| 864 | Ga0495667_0006624 | 3300046559 | Bacteria | 7864 |
| 865 | Ga0495667_0007023 | 3300046559 | Bacteria | 7640 |
| 866 | Ga0495667_0315678 | 3300046559 | Bacteria | 989 |
| 867 | Ga0495667_0365059 | 3300046559 | Bacteria | 911 |
| 868 | Ga0495656_0001212 | 3300046615 | Bacteria | 8399 |
| 869 | Ga0495656_0045656 | 3300046615 | Bacteria | 1850 |
| 870 | Ga0495668_0072630 | 3300046616 | Bacteria | 1890 |
| 871 | Ga0495668_0113544 | 3300046616 | Bacteria | 1481 |
| 872 | Ga0495668_0174264 | 3300046616 | Bacteria | 1178 |
| 873 | Ga0495668_0182158 | 3300046616 | Bacteria | 1151 |
| 874 | Ga0495668_0192483 | 3300046616 | Bacteria | 1117 |
| 875 | Ga0495668_0215629 | 3300046616 | Bacteria | 1051 |
| 876 | Ga0495634_0000334 | 3300046642 | Bacteria | 45432 |
| 877 | Ga0495634_0004641 | 3300046642 | Bacteria | 10705 |
| 878 | Ga0495634_0102275 | 3300046642 | Bacteria | 1850 |
| 879 | Ga0495625_0045332 | 3300046660 | Bacteria | 3179 |
| 880 | Ga0495625_0101996 | 3300046660 | Bacteria | 1970 |
| 881 | Ga0495625_0119561 | 3300046660 | Bacteria | 1794 |
| 882 | Ga0495625_0168405 | 3300046660 | Bacteria | 1464 |
| 883 | Ga0495625_0231017 | 3300046660 | Bacteria | 1208 |
| 884 | Ga0495625_0317373 | 3300046660 | Bacteria | 993 |
| 885 | Ga0495635_0000372 | 3300046663 | Bacteria | 28497 |
| 886 | Ga0495635_0004370 | 3300046663 | Bacteria | 9787 |
| 887 | Ga0495659_0007020 | 3300046664 | Bacteria | 3566 |
| 888 | Ga0495659_0023775 | 3300046664 | Bacteria | 2085 |
| 889 | Ga0495661_0045906 | 3300046665 | Bacteria | 2669 |
| 890 | Ga0495661_0184630 | 3300046665 | Bacteria | 1103 |
| 891 | Ga0495588_0038425 | 3300046674 | Bacteria | 2435 |
| 892 | Ga0495588_0046186 | 3300046674 | Bacteria | 2233 |
| 893 | Ga0495588_0191832 | 3300046674 | Bacteria | 1079 |
| 894 | Ga0495657_0002983 | 3300046675 | Bacteria | 14012 |
| 895 | Ga0495657_0006148 | 3300046675 | Bacteria | 9409 |
| 896 | Ga0495657_0010390 | 3300046675 | Bacteria | 7007 |
| 897 | Ga0495657_0044452 | 3300046675 | Bacteria | 3021 |
| 898 | Ga0495657_0177171 | 3300046675 | Bacteria | 1310 |
| 899 | Ga0495599_0009058 | 3300046678 | Bacteria | 6065 |
| 900 | Ga0495599_0018187 | 3300046678 | Bacteria | 4377 |
| 901 | Ga0495599_0114109 | 3300046678 | Bacteria | 1681 |
| 902 | Ga0495623_0009665 | 3300046679 | Bacteria | 6261 |
| 903 | Ga0495623_0014811 | 3300046679 | Bacteria | 5042 |
| 904 | Ga0495646_0003761 | 3300046680 | Bacteria | 9487 |
| 905 | Ga0495646_0017020 | 3300046680 | Bacteria | 4615 |
| 906 | Ga0495646_0020785 | 3300046680 | Bacteria | 4151 |
| 907 | Ga0495646_0040064 | 3300046680 | Bacteria | 2887 |
| 908 | Ga0495647_0000312 | 3300046681 | Bacteria | 13625 |
| 909 | Ga0495658_0000416 | 3300046683 | Bacteria | 23941 |
| 910 | Ga0495669_0042244 | 3300046684 | Bacteria | 2026 |
| 911 | Ga0495613_0010249 | 3300046689 | Bacteria | 6962 |
| 912 | Ga0495613_0013379 | 3300046689 | Bacteria | 6095 |
| 913 | Ga0495613_0043461 | 3300046689 | Bacteria | 3324 |
| 914 | Ga0495624_0003210 | 3300046690 | Bacteria | 12180 |
| 915 | Ga0495624_0117312 | 3300046690 | Bacteria | 1635 |
| 916 | Ga0495624_0160495 | 3300046690 | Bacteria | 1374 |
| 917 | Ga0495670_0126710 | 3300046691 | Bacteria | 1329 |
| 918 | Ga0495671_0061788 | 3300046692 | Bacteria | 1847 |
| 919 | Ga0495649_0071092 | 3300046694 | Bacteria | 1865 |
| 920 | Ga0495649_0072661 | 3300046694 | Bacteria | 1844 |
| 921 | Ga0495589_0049818 | 3300046794 | Bacteria | 2073 |
| 922 | Ga0495589_0055679 | 3300046794 | Bacteria | 1948 |
| 923 | Ga0495589_0069750 | 3300046794 | Bacteria | 1719 |
| 924 | Ga0495589_0091870 | 3300046794 | Bacteria | 1474 |
| 925 | Ga0495600_0001217 | 3300046809 | Bacteria | 14087 |
| 926 | Ga0495600_0004048 | 3300046809 | Bacteria | 8715 |
| 927 | Ga0495600_0008584 | 3300046809 | Bacteria | 6283 |
| 928 | Ga0495600_0051602 | 3300046809 | Bacteria | 2685 |
| 929 | Ga0495600_0116656 | 3300046809 | Bacteria | 1738 |
| 930 | Ga0495660_0049733 | 3300046810 | Bacteria | 2287 |
| 931 | Ga0495660_0095371 | 3300046810 | Bacteria | 1539 |
| 932 | Ga0495581_0000426 | 3300047315 | Bacteria | 21399 |
| 933 | Ga0495581_0090963 | 3300047315 | Bacteria | 1770 |
| 934 | Ga0495604_0005876 | 3300047317 | Bacteria | 9727 |
| 935 | Ga0495604_0010461 | 3300047317 | Bacteria | 7352 |
| 936 | Ga0495604_0012415 | 3300047317 | Bacteria | 6772 |
| 937 | Ga0495604_0189193 | 3300047317 | Bacteria | 1435 |
| 938 | Ga0495636_0087362 | 3300047318 | Bacteria | 1350 |
| 939 | Ga0495674_0000533 | 3300047319 | Bacteria | 35160 |
| 940 | Ga0495674_0019041 | 3300047319 | Bacteria | 6382 |
| 941 | Ga0495674_0024836 | 3300047319 | Bacteria | 5501 |
| 942 | Ga0495674_0212285 | 3300047319 | Bacteria | 1603 |
| 943 | Ga0495672_0089178 | 3300047320 | Bacteria | 1698 |
| 944 | Ga0495676_0056269 | 3300047321 | Bacteria | 3111 |
| 945 | Ga0495676_0073567 | 3300047321 | Bacteria | 2620 |
| 946 | Ga0495676_0195066 | 3300047321 | Bacteria | 1410 |
| 947 | Ga0495680_0002856 | 3300047322 | Bacteria | 17361 |
| 948 | Ga0495680_0007925 | 3300047322 | Bacteria | 9687 |
| 949 | Ga0495680_0176521 | 3300047322 | Bacteria | 1544 |
| 950 | Ga0495683_0067062 | 3300047323 | Bacteria | 1767 |
| 951 | Ga0495675_0003518 | 3300047444 | Bacteria | 9440 |
| 952 | Ga0495675_0031592 | 3300047444 | Bacteria | 3380 |
| 953 | Ga0495675_0044666 | 3300047444 | Bacteria | 2823 |
| 954 | Ga0495679_037220 | 3300047446 | Bacteria | 1532 |
| 955 | Ga0495685_027462 | 3300047447 | Bacteria | 1958 |
| 956 | Ga0495673_0019403 | 3300047469 | Bacteria | 3407 |
| 957 | Ga0495673_0123858 | 3300047469 | Bacteria | 1021 |
| 958 | Ga0495673_0137047 | 3300047469 | Bacteria | 957 |
| 959 | Ga0495684_0001014 | 3300047471 | Bacteria | 22867 |
| 960 | Ga0495684_0057861 | 3300047471 | Bacteria | 2954 |
| 961 | Ga0495684_0131923 | 3300047471 | Bacteria | 1876 |
| 962 | Ga0495686_0028879 | 3300047472 | Bacteria | 3610 |
| 963 | Ga0495686_0091427 | 3300047472 | Bacteria | 1847 |
| 964 | Ga0495686_0198465 | 3300047472 | Bacteria | 1153 |
| 965 | Ga0495686_0205040 | 3300047472 | Bacteria | 1129 |
| 966 | Ga0495593_0023687 | 3300047673 | Bacteria | 3409 |
| 967 | Ga0495593_0031577 | 3300047673 | Bacteria | 2892 |
| 968 | Ga0495593_0038062 | 3300047673 | Bacteria | 2599 |
| 969 | Ga0495593_0156747 | 3300047673 | Bacteria | 1150 |
| 970 | Ga0495602_0005816 | 3300048088 | Bacteria | 12942 |
| 971 | Ga0495602_0010096 | 3300048088 | Bacteria | 9800 |
| 972 | Ga0495602_0226127 | 3300048088 | Bacteria | 1409 |
| 973 | Ga0495614_0094922 | 3300048089 | Bacteria | 1300 |
| 974 | Ga0495626_0017165 | 3300048091 | Bacteria | 3662 |
| 975 | Ga0495626_0101206 | 3300048091 | Bacteria | 1256 |
| 976 | Ga0496100_0045272 | 3300048903 | Bacteria | 2823 |
| 977 | Ga0496100_0144631 | 3300048903 | Bacteria | 1689 |
| 978 | Ga0496100_0176930 | 3300048903 | Bacteria | 1541 |
| 979 | Ga0496100_0211300 | 3300048903 | Bacteria | 1419 |
| 980 | Ga0496100_0222780 | 3300048903 | Bacteria | 1385 |
| 981 | Ga0496100_0292123 | 3300048903 | Bacteria | 1218 |
| 982 | Ga0496101_0003771 | 3300048904 | Bacteria | 9467 |
| 983 | Ga0496101_0037613 | 3300048904 | Bacteria | 3434 |
| 984 | Ga0496101_0162728 | 3300048904 | Bacteria | 1712 |
| 985 | Ga0496101_0193428 | 3300048904 | Bacteria | 1570 |
| 986 | Ga0496101_0204479 | 3300048904 | Bacteria | 1528 |
| 987 | Ga0496101_0312036 | 3300048904 | Bacteria | 1233 |
| 988 | Ga0496101_0445982 | 3300048904 | Bacteria | 1021 |
| 989 | Ga0496101_0501068 | 3300048904 | Bacteria | 959 |
| 990 | Ga0496102_0005218 | 3300048905 | Bacteria | 11031 |
| 991 | Ga0496102_0076419 | 3300048905 | Bacteria | 3081 |
| 992 | Ga0496102_0104817 | 3300048905 | Bacteria | 2630 |
| 993 | Ga0496102_0137316 | 3300048905 | Bacteria | 2291 |
| 994 | Ga0496102_0434489 | 3300048905 | Bacteria | 1232 |
| 995 | Ga0496102_0474123 | 3300048905 | Bacteria | 1173 |
| 996 | Ga0496102_0630675 | 3300048905 | Bacteria | 995 |
| 997 | Ga0496103_0001945 | 3300048906 | Bacteria | 13352 |
| 998 | Ga0496103_0010723 | 3300048906 | Bacteria | 5422 |
| 999 | Ga0496103_0069056 | 3300048906 | Bacteria | 2209 |
| 1000 | Ga0496104_0016231 | 3300048907 | Bacteria | 6762 |
| 1001 | Ga0496104_0022194 | 3300048907 | Bacteria | 5830 |
| 1002 | Ga0496104_0067394 | 3300048907 | Bacteria | 3400 |
| 1003 | Ga0496104_0098594 | 3300048907 | Bacteria | 2797 |
| 1004 | Ga0496104_0403460 | 3300048907 | Bacteria | 1279 |
| 1005 | Ga0496105_0009741 | 3300048908 | Bacteria | 7524 |
| 1006 | Ga0496105_0019070 | 3300048908 | Bacteria | 5528 |
| 1007 | Ga0496105_0029405 | 3300048908 | Bacteria | 4498 |
| 1008 | Ga0496105_0051296 | 3300048908 | Bacteria | 3408 |
| 1009 | Ga0496105_0060520 | 3300048908 | Bacteria | 3125 |
| 1010 | Ga0496105_0476983 | 3300048908 | Bacteria | 982 |
| 1011 | Ga0496106_0029624 | 3300048909 | Bacteria | 4081 |
| 1012 | Ga0496106_0039923 | 3300048909 | Bacteria | 3514 |
| 1013 | Ga0496106_0117779 | 3300048909 | Bacteria | 2073 |
| 1014 | Ga0496106_0217351 | 3300048909 | Bacteria | 1523 |
| 1015 | Ga0496107_0003550 | 3300048910 | Bacteria | 10446 |
| 1016 | Ga0496107_0035584 | 3300048910 | Bacteria | 3570 |
| 1017 | Ga0496107_0201826 | 3300048910 | Bacteria | 1478 |
| 1018 | Ga0496107_0390940 | 3300048910 | Bacteria | 1034 |
| 1019 | Ga0496108_0002351 | 3300048911 | Bacteria | 15142 |
| 1020 | Ga0496108_0010972 | 3300048911 | Bacteria | 7358 |
| 1021 | Ga0496108_0022679 | 3300048911 | Bacteria | 5163 |
| 1022 | Ga0496108_0183373 | 3300048911 | Bacteria | 1813 |
| 1023 | Ga0496109_0002582 | 3300048912 | Bacteria | 15166 |
| 1024 | Ga0496109_0011126 | 3300048912 | Bacteria | 7717 |
| 1025 | Ga0496109_0073228 | 3300048912 | Bacteria | 3148 |
| 1026 | Ga0496109_0093698 | 3300048912 | Bacteria | 2779 |
| 1027 | Ga0496109_0479465 | 3300048912 | Bacteria | 1174 |
| 1028 | Ga0496109_0703062 | 3300048912 | Bacteria | 948 |
| 1029 | Ga0496110_0007857 | 3300048913 | Bacteria | 8545 |
| 1030 | Ga0496110_0068203 | 3300048913 | Bacteria | 3148 |
| 1031 | Ga0496110_0163439 | 3300048913 | Bacteria | 2018 |
| 1032 | Ga0496110_0208301 | 3300048913 | Bacteria | 1777 |
| 1033 | Ga0496110_0222916 | 3300048913 | Bacteria | 1715 |
| 1034 | Ga0496110_0277699 | 3300048913 | Bacteria | 1525 |
| 1035 | Ga0496110_0410559 | 3300048913 | Bacteria | 1234 |
| 1036 | Ga0496110_0516382 | 3300048913 | Bacteria | 1087 |
| 1037 | Ga0496111_0091112 | 3300048914 | Bacteria | 2234 |
| 1038 | Ga0496111_0104226 | 3300048914 | Bacteria | 2086 |
| 1039 | Ga0496111_0158134 | 3300048914 | Bacteria | 1682 |
| 1040 | Ga0496111_0249749 | 3300048914 | Bacteria | 1317 |
| 1041 | Ga0496111_0317480 | 3300048914 | Bacteria | 1154 |
| 1042 | Ga0496112_0008401 | 3300048915 | Bacteria | 9247 |
| 1043 | Ga0496112_0036493 | 3300048915 | Bacteria | 4796 |
| 1044 | Ga0496112_0056475 | 3300048915 | Bacteria | 3863 |
| 1045 | Ga0496112_0120660 | 3300048915 | Bacteria | 2591 |
| 1046 | Ga0496112_0158316 | 3300048915 | Bacteria | 2231 |
| 1047 | Ga0496112_0188637 | 3300048915 | Bacteria | 2024 |
| 1048 | Ga0496112_0590938 | 3300048915 | Bacteria | 1042 |
| 1049 | Ga0496113_0006395 | 3300048916 | Bacteria | 7460 |
| 1050 | Ga0496113_0012289 | 3300048916 | Bacteria | 5750 |
| 1051 | Ga0496113_0228856 | 3300048916 | Bacteria | 1482 |
| 1052 | Ga0496113_0254832 | 3300048916 | Bacteria | 1401 |
| 1053 | Ga0496113_0403519 | 3300048916 | Bacteria | 1097 |
| 1054 | Ga0496113_0605397 | 3300048916 | Bacteria | 877 |
| 1055 | Ga0496114_0030213 | 3300048917 | Bacteria | 4457 |
| 1056 | Ga0496114_0075310 | 3300048917 | Bacteria | 2842 |
| 1057 | Ga0496114_0080809 | 3300048917 | Bacteria | 2745 |
| 1058 | Ga0496114_0310384 | 3300048917 | Bacteria | 1393 |
| 1059 | Ga0496114_0631560 | 3300048917 | Bacteria | 943 |
| 1060 | Ga0496114_0634809 | 3300048917 | Bacteria | 940 |
| 1061 | Ga0496115_0002700 | 3300048918 | Bacteria | 12739 |
| 1062 | Ga0496115_0006372 | 3300048918 | Bacteria | 8646 |
| 1063 | Ga0496115_0060457 | 3300048918 | Bacteria | 3053 |
| 1064 | Ga0496115_0095775 | 3300048918 | Bacteria | 2430 |
| 1065 | Ga0496115_0132409 | 3300048918 | Bacteria | 2055 |
| 1066 | Ga0496115_0178984 | 3300048918 | Bacteria | 1753 |
| 1067 | Ga0496115_0205941 | 3300048918 | Bacteria | 1625 |
| 1068 | Ga0496115_0209551 | 3300048918 | Bacteria | 1610 |
| 1069 | Ga0496115_0238443 | 3300048918 | Bacteria | 1499 |
| 1070 | Ga0496115_0574503 | 3300048918 | Bacteria | 899 |
| 1071 | Ga0496116_0059189 | 3300048919 | Bacteria | 2493 |
| 1072 | Ga0496116_0076972 | 3300048919 | Bacteria | 2087 |
| 1073 | Ga0496116_0226840 | 3300048919 | Bacteria | 951 |
| 1074 | Ga0496117_0059700 | 3300048920 | Bacteria | 2632 |
| 1075 | Ga0496117_0067197 | 3300048920 | Bacteria | 2427 |
| 1076 | Ga0496117_0134776 | 3300048920 | Bacteria | 1490 |
| 1077 | Ga0496117_0226708 | 3300048920 | Bacteria | 1036 |
| 1078 | Ga0496118_0042278 | 3300048921 | Bacteria | 3597 |
| 1079 | Ga0496118_0093947 | 3300048921 | Bacteria | 2052 |
| 1080 | Ga0496118_0136708 | 3300048921 | Bacteria | 1562 |
| 1081 | Ga0496118_0168951 | 3300048921 | Bacteria | 1339 |
| 1082 | Ga0496118_0252008 | 3300048921 | Bacteria | 1003 |
| 1083 | Ga0496119_0033766 | 3300048922 | Bacteria | 3385 |
| 1084 | Ga0496119_0064740 | 3300048922 | Bacteria | 2169 |
| 1085 | Ga0496119_0064916 | 3300048922 | Bacteria | 2165 |
| 1086 | Ga0496119_0074470 | 3300048922 | Bacteria | 1977 |
| 1087 | Ga0496120_0113877 | 3300048923 | Bacteria | 1409 |
| 1088 | Ga0496120_0149659 | 3300048923 | Bacteria | 1175 |
| 1089 | Ga0496120_0218679 | 3300048923 | Bacteria | 911 |
| 1090 | Ga0496121_0006526 | 3300048924 | Bacteria | 14422 |
| 1091 | Ga0496121_0017298 | 3300048924 | Bacteria | 7374 |
| 1092 | Ga0496121_0020252 | 3300048924 | Bacteria | 6596 |
| 1093 | Ga0496121_0024943 | 3300048924 | Bacteria | 5696 |
| 1094 | Ga0496121_0026087 | 3300048924 | Bacteria | 5521 |
| 1095 | Ga0496121_0054436 | 3300048924 | Bacteria | 3343 |
| 1096 | Ga0496121_0069583 | 3300048924 | Bacteria | 2839 |
| 1097 | Ga0496121_0074527 | 3300048924 | Bacteria | 2714 |
| 1098 | Ga0496121_0125803 | 3300048924 | Bacteria | 1927 |
| 1099 | Ga0496121_0234124 | 3300048924 | Bacteria | 1284 |
| 1100 | Ga0496122_0051864 | 3300048925 | Bacteria | 3111 |
| 1101 | Ga0496122_0088550 | 3300048925 | Bacteria | 2121 |
| 1102 | Ga0496123_0016690 | 3300048926 | Bacteria | 5946 |
| 1103 | Ga0496123_0156129 | 3300048926 | Bacteria | 1223 |
| 1104 | Ga0496124_0084967 | 3300048927 | Bacteria | 2594 |
| 1105 | Ga0496124_0140856 | 3300048927 | Bacteria | 1903 |
| 1106 | Ga0496124_0143720 | 3300048927 | Bacteria | 1880 |
| 1107 | Ga0496124_0234720 | 3300048927 | Bacteria | 1368 |
| 1108 | Ga0496124_0373275 | 3300048927 | Bacteria | 1000 |
| 1109 | Ga0496125_0000420 | 3300048928 | Bacteria | 78930 |
| 1110 | Ga0496125_0001161 | 3300048928 | Bacteria | 39899 |
| 1111 | Ga0496125_0005151 | 3300048928 | Bacteria | 14703 |
| 1112 | Ga0496125_0037965 | 3300048928 | Bacteria | 4179 |
| 1113 | Ga0496125_0046816 | 3300048928 | Bacteria | 3624 |
| 1114 | Ga0496125_0051090 | 3300048928 | Bacteria | 3413 |
| 1115 | Ga0496125_0056665 | 3300048928 | Bacteria | 3181 |
| 1116 | Ga0496125_0150380 | 3300048928 | Bacteria | 1600 |
| 1117 | Ga0496125_0177519 | 3300048928 | Bacteria | 1423 |
| 1118 | Ga0496125_0253585 | 3300048928 | Bacteria | 1108 |
| 1119 | Ga0496126_0003575 | 3300048929 | Bacteria | 19498 |
| 1120 | Ga0496126_0007151 | 3300048929 | Bacteria | 12291 |
| 1121 | Ga0496126_0017087 | 3300048929 | Bacteria | 7235 |
| 1122 | Ga0496126_0036374 | 3300048929 | Bacteria | 4604 |
| 1123 | Ga0496126_0037272 | 3300048929 | Bacteria | 4539 |
| 1124 | Ga0496126_0048345 | 3300048929 | Bacteria | 3888 |
| 1125 | Ga0496126_0099199 | 3300048929 | Bacteria | 2551 |
| 1126 | Ga0496126_0143226 | 3300048929 | Bacteria | 2055 |
| 1127 | Ga0496126_0147360 | 3300048929 | Bacteria | 2020 |
| 1128 | Ga0496126_0155251 | 3300048929 | Bacteria | 1959 |
| 1129 | Ga0496126_0190877 | 3300048929 | Bacteria | 1735 |
| 1130 | Ga0496126_0205744 | 3300048929 | Bacteria | 1659 |
| 1131 | Ga0496126_0206431 | 3300048929 | Bacteria | 1656 |
| 1132 | Ga0496126_0287714 | 3300048929 | Bacteria | 1360 |
| 1133 | Ga0496126_0317197 | 3300048929 | Bacteria | 1282 |
| 1134 | Ga0496126_0327722 | 3300048929 | Bacteria | 1257 |
| 1135 | Ga0496126_0463799 | 3300048929 | Bacteria | 1017 |
| 1136 | Ga0496126_0533885 | 3300048929 | Bacteria | 933 |
| 1137 | Ga0495682_0003694 | 3300049460 | Bacteria | 6742 |
| 1138 | Ga0495682_0019787 | 3300049460 | Bacteria | 2529 |
| 1139 | Ga0495682_0025931 | 3300049460 | Bacteria | 2179 |
| 1140 | Ga0501031_0002387 | 3300049568 | Bacteria | 11928 |
| 1141 | Ga0501031_0002483 | 3300049568 | Bacteria | 11770 |
| 1142 | Ga0501031_0027736 | 3300049568 | Bacteria | 3691 |
| 1143 | Ga0501031_0055697 | 3300049568 | Bacteria | 2576 |
| 1144 | Ga0501031_0257568 | 3300049568 | Bacteria | 1134 |
| 1145 | Ga0501032_0000009 | 3300049569 | Bacteria | 228107 |
| 1146 | Ga0501032_0000227 | 3300049569 | Bacteria | 46864 |
| 1147 | Ga0501032_0000318 | 3300049569 | Bacteria | 40445 |
| 1148 | Ga0501033_0000019 | 3300049570 | Bacteria | 204699 |
| 1149 | Ga0501033_0000443 | 3300049570 | Bacteria | 39616 |
| 1150 | Ga0501033_0004766 | 3300049570 | Bacteria | 10838 |
| 1151 | Ga0501033_0008200 | 3300049570 | Bacteria | 8091 |
| 1152 | Ga0501033_0052402 | 3300049570 | Bacteria | 3025 |
| 1153 | Ga0501033_0361659 | 3300049570 | Bacteria | 1015 |
| 1154 | Ga0501033_0504559 | 3300049570 | Bacteria | 837 |
| 1155 | Ga0501034_0000044 | 3300049571 | Bacteria | 227982 |
| 1156 | Ga0501034_0000061 | 3300049571 | Bacteria | 195178 |
| 1157 | Ga0501034_0000100 | 3300049571 | Bacteria | 159536 |
| 1158 | Ga0501034_0028765 | 3300049571 | Bacteria | 5654 |
| 1159 | Ga0501034_0068429 | 3300049571 | Bacteria | 3561 |
| 1160 | Ga0501034_0069622 | 3300049571 | Bacteria | 3529 |
| 1161 | Ga0501034_0072553 | 3300049571 | Bacteria | 3451 |
| 1162 | Ga0501034_0101777 | 3300049571 | Bacteria | 2866 |
| 1163 | Ga0501034_0180456 | 3300049571 | Bacteria | 2076 |
| 1164 | Ga0501034_0181193 | 3300049571 | Bacteria | 2071 |
| 1165 | Ga0501034_0253526 | 3300049571 | Bacteria | 1704 |
| 1166 | Ga0501036_0000008 | 3300049572 | Bacteria | 228106 |
| 1167 | Ga0501036_0000010 | 3300049572 | Bacteria | 163304 |
| 1168 | Ga0501036_0000387 | 3300049572 | Bacteria | 31150 |
| 1169 | Ga0501036_0020290 | 3300049572 | Bacteria | 5582 |
| 1170 | Ga0501036_0061705 | 3300049572 | Bacteria | 3175 |
| 1171 | Ga0501036_0099029 | 3300049572 | Bacteria | 2465 |
| 1172 | Ga0501036_0175906 | 3300049572 | Bacteria | 1802 |
| 1173 | Ga0501036_0282657 | 3300049572 | Bacteria | 1388 |
| 1174 | Ga0501036_0321690 | 3300049572 | Bacteria | 1292 |
| 1175 | Ga0501037_0000055 | 3300049573 | Bacteria | 109790 |
| 1176 | Ga0501037_0000104 | 3300049573 | Bacteria | 80204 |
| 1177 | Ga0501037_0000183 | 3300049573 | Bacteria | 57879 |
| 1178 | Ga0501037_0005109 | 3300049573 | Bacteria | 9545 |
| 1179 | Ga0501037_0026956 | 3300049573 | Bacteria | 4245 |
| 1180 | Ga0501037_0064315 | 3300049573 | Bacteria | 2673 |
| 1181 | Ga0501037_0080211 | 3300049573 | Bacteria | 2368 |
| 1182 | Ga0501037_0088726 | 3300049573 | Bacteria | 2238 |
| 1183 | Ga0501037_0145197 | 3300049573 | Bacteria | 1697 |
| 1184 | Ga0501037_0387866 | 3300049573 | Bacteria | 959 |
| 1185 | Ga0501038_0000006 | 3300049574 | Bacteria | 228107 |
| 1186 | Ga0501038_0000054 | 3300049574 | Bacteria | 94123 |
| 1187 | Ga0501038_0000340 | 3300049574 | Bacteria | 40348 |
| 1188 | Ga0501038_0008634 | 3300049574 | Bacteria | 9354 |
| 1189 | Ga0501038_0009130 | 3300049574 | Bacteria | 9096 |
| 1190 | Ga0501038_0029904 | 3300049574 | Bacteria | 4824 |
| 1191 | Ga0501038_0068147 | 3300049574 | Bacteria | 3025 |
| 1192 | Ga0501038_0093188 | 3300049574 | Bacteria | 2521 |
| 1193 | Ga0501038_0093901 | 3300049574 | Bacteria | 2508 |
| 1194 | Ga0501038_0102772 | 3300049574 | Bacteria | 2377 |
| 1195 | Ga0501038_0189131 | 3300049574 | Bacteria | 1657 |
| 1196 | Ga0501039_0000014 | 3300049575 | Bacteria | 228107 |
| 1197 | Ga0501039_0000110 | 3300049575 | Bacteria | 55320 |
| 1198 | Ga0501039_0000536 | 3300049575 | Bacteria | 27529 |
| 1199 | Ga0501039_0034134 | 3300049575 | Bacteria | 3925 |
| 1200 | Ga0501039_0186159 | 3300049575 | Bacteria | 1633 |
| 1201 | Ga0501039_0220437 | 3300049575 | Bacteria | 1491 |
| 1202 | Ga0501039_0319562 | 3300049575 | Bacteria | 1220 |
| 1203 | Ga0501039_0505866 | 3300049575 | Bacteria | 949 |
| 1204 | Ga0501040_0016098 | 3300049576 | Bacteria | 4945 |
| 1205 | Ga0501040_0034810 | 3300049576 | Bacteria | 3412 |
| 1206 | Ga0501041_0106141 | 3300049577 | Bacteria | 1741 |
| 1207 | Ga0501042_0029189 | 3300049578 | Bacteria | 3889 |
| 1208 | Ga0501043_0000106 | 3300049579 | Bacteria | 77699 |
| 1209 | Ga0501043_0000161 | 3300049579 | Bacteria | 60738 |
| 1210 | Ga0501043_0001366 | 3300049579 | Bacteria | 21372 |
| 1211 | Ga0501043_0015830 | 3300049579 | Bacteria | 5911 |
| 1212 | Ga0501043_0038102 | 3300049579 | Bacteria | 3780 |
| 1213 | Ga0501043_0119062 | 3300049579 | Bacteria | 2071 |
| 1214 | Ga0501043_0176682 | 3300049579 | Bacteria | 1664 |
| 1215 | Ga0501043_0209758 | 3300049579 | Bacteria | 1510 |
| 1216 | Ga0501043_0292380 | 3300049579 | Bacteria | 1247 |
| 1217 | Ga0501046_0001107 | 3300049580 | Bacteria | 26302 |
| 1218 | Ga0501046_0005134 | 3300049580 | Bacteria | 11738 |
| 1219 | Ga0501046_0012683 | 3300049580 | Bacteria | 7166 |
| 1220 | Ga0501046_0122368 | 3300049580 | Bacteria | 1979 |
| 1221 | Ga0501046_0185983 | 3300049580 | Bacteria | 1551 |
| 1222 | Ga0501047_0000122 | 3300049581 | Bacteria | 95307 |
| 1223 | Ga0501047_0000702 | 3300049581 | Bacteria | 34900 |
| 1224 | Ga0501047_0001105 | 3300049581 | Bacteria | 26770 |
| 1225 | Ga0501047_0032928 | 3300049581 | Bacteria | 5004 |
| 1226 | Ga0501047_0047128 | 3300049581 | Bacteria | 4164 |
| 1227 | Ga0501047_0051165 | 3300049581 | Bacteria | 3990 |
| 1228 | Ga0501047_0085334 | 3300049581 | Bacteria | 3033 |
| 1229 | Ga0501047_0137596 | 3300049581 | Bacteria | 2322 |
| 1230 | Ga0501047_0311940 | 3300049581 | Bacteria | 1413 |
| 1231 | Ga0501047_0367503 | 3300049581 | Bacteria | 1274 |
| 1232 | Ga0501048_0000060 | 3300049582 | Bacteria | 54898 |
| 1233 | Ga0501048_0000456 | 3300049582 | Bacteria | 28577 |
| 1234 | Ga0501048_0031383 | 3300049582 | Bacteria | 3842 |
| 1235 | Ga0501067_0001976 | 3300049583 | Bacteria | 11278 |
| 1236 | Ga0501067_0004998 | 3300049583 | Bacteria | 7371 |
| 1237 | Ga0501067_0028386 | 3300049583 | Bacteria | 3099 |
| 1238 | Ga0501067_0104145 | 3300049583 | Bacteria | 1577 |
| 1239 | Ga0501067_0114284 | 3300049583 | Bacteria | 1501 |
| 1240 | Ga0501068_0000737 | 3300049584 | Bacteria | 16779 |
| 1241 | Ga0501068_0000938 | 3300049584 | Bacteria | 15265 |
| 1242 | Ga0501068_0018828 | 3300049584 | Bacteria | 4000 |
| 1243 | Ga0501068_0067026 | 3300049584 | Bacteria | 2187 |
| 1244 | Ga0501068_0261206 | 3300049584 | Bacteria | 1105 |
| 1245 | Ga0501069_0000315 | 3300049585 | Bacteria | 22061 |
| 1246 | Ga0501069_0003284 | 3300049585 | Bacteria | 8300 |
| 1247 | Ga0501069_0028526 | 3300049585 | Bacteria | 3061 |
| 1248 | Ga0501069_0211785 | 3300049585 | Bacteria | 1125 |
| 1249 | Ga0501070_0000659 | 3300049586 | Bacteria | 31835 |
| 1250 | Ga0501070_0007760 | 3300049586 | Bacteria | 9095 |
| 1251 | Ga0501070_0063684 | 3300049586 | Bacteria | 3054 |
| 1252 | Ga0501070_0096744 | 3300049586 | Bacteria | 2442 |
| 1253 | Ga0501070_0102806 | 3300049586 | Bacteria | 2363 |
| 1254 | Ga0501070_0139416 | 3300049586 | Bacteria | 2002 |
| 1255 | Ga0501070_0212993 | 3300049586 | Bacteria | 1585 |
| 1256 | Ga0501070_0243976 | 3300049586 | Bacteria | 1470 |
| 1257 | Ga0501070_0269532 | 3300049586 | Bacteria | 1391 |
| 1258 | Ga0501070_0379270 | 3300049586 | Bacteria | 1145 |
| 1259 | Ga0501071_0045800 | 3300049587 | Bacteria | 3140 |
| 1260 | Ga0501071_0115738 | 3300049587 | Bacteria | 1984 |
| 1261 | Ga0501071_0154545 | 3300049587 | Bacteria | 1713 |
| 1262 | Ga0501072_0000606 | 3300049588 | Bacteria | 25831 |
| 1263 | Ga0501072_0001167 | 3300049588 | Bacteria | 19542 |
| 1264 | Ga0501072_0047895 | 3300049588 | Bacteria | 3366 |
| 1265 | Ga0501073_0000014 | 3300049589 | Bacteria | 159719 |
| 1266 | Ga0501073_0000238 | 3300049589 | Bacteria | 36316 |
| 1267 | Ga0501073_0029113 | 3300049589 | Bacteria | 3946 |
| 1268 | Ga0501074_0000259 | 3300049590 | Bacteria | 30031 |
| 1269 | Ga0501074_0000995 | 3300049590 | Bacteria | 18428 |
| 1270 | Ga0501074_0021196 | 3300049590 | Bacteria | 4720 |
| 1271 | Ga0501074_0032625 | 3300049590 | Bacteria | 3772 |
| 1272 | Ga0501074_0154843 | 3300049590 | Bacteria | 1638 |
| 1273 | Ga0501075_0153982 | 3300049591 | Bacteria | 1753 |
| 1274 | Ga0501076_0301602 | 3300049592 | Bacteria | 1313 |
| 1275 | Ga0501077_0096296 | 3300049593 | Bacteria | 1876 |
| 1276 | Ga0501079_0014230 | 3300049741 | Bacteria | 6065 |
| 1277 | Ga0501080_0002287 | 3300049742 | Bacteria | 16687 |
| 1278 | Ga0501080_0007524 | 3300049742 | Bacteria | 9839 |
| 1279 | Ga0501080_0011414 | 3300049742 | Bacteria | 8135 |
| 1280 | Ga0501080_0018024 | 3300049742 | Bacteria | 6537 |
| 1281 | Ga0501080_0101039 | 3300049742 | Bacteria | 2675 |
| 1282 | Ga0501080_0118121 | 3300049742 | Bacteria | 2458 |
| 1283 | Ga0501080_0474771 | 3300049742 | Bacteria | 1119 |
| 1284 | Ga0501083_0000550 | 3300049744 | Bacteria | 23969 |
| 1285 | Ga0501083_0010171 | 3300049744 | Bacteria | 6629 |
| 1286 | Ga0501083_0013449 | 3300049744 | Bacteria | 5719 |
| 1287 | Ga0501035_0000096 | 3300049822 | Bacteria | 110635 |
| 1288 | Ga0501035_0000099 | 3300049822 | Bacteria | 108224 |
| 1289 | Ga0501035_0000146 | 3300049822 | Bacteria | 86011 |
| 1290 | Ga0501035_0070990 | 3300049822 | Bacteria | 3084 |
| 1291 | Ga0501035_0102938 | 3300049822 | Bacteria | 2505 |
| 1292 | Ga0501035_0123306 | 3300049822 | Bacteria | 2263 |
| 1293 | Ga0501035_0168274 | 3300049822 | Bacteria | 1894 |
| 1294 | Ga0501044_0000017 | 3300049823 | Bacteria | 228107 |
| 1295 | Ga0501044_0000195 | 3300049823 | Bacteria | 76643 |
| 1296 | Ga0501044_0002385 | 3300049823 | Bacteria | 21410 |
| 1297 | Ga0501044_0030160 | 3300049823 | Bacteria | 5716 |
| 1298 | Ga0501044_0034593 | 3300049823 | Bacteria | 5297 |
| 1299 | Ga0501044_0035811 | 3300049823 | Bacteria | 5195 |
| 1300 | Ga0501044_0039805 | 3300049823 | Bacteria | 4901 |
| 1301 | Ga0501044_0101805 | 3300049823 | Bacteria | 2889 |
| 1302 | Ga0501044_0218231 | 3300049823 | Bacteria | 1858 |
| 1303 | Ga0501044_0270193 | 3300049823 | Bacteria | 1636 |
| 1304 | Ga0501044_0297261 | 3300049823 | Bacteria | 1544 |
| 1305 | Ga0501044_0385295 | 3300049823 | Bacteria | 1316 |
| 1306 | Ga0501044_0431210 | 3300049823 | Bacteria | 1227 |
| 1307 | Ga0501045_0004135 | 3300049824 | Bacteria | 10024 |
| 1308 | Ga0501045_0024453 | 3300049824 | Bacteria | 4337 |
| 1309 | Ga0501045_0070605 | 3300049824 | Bacteria | 2570 |
| 1310 | nmdc:mga03683_37109_c1 | 3300050489 | Bacteria | 1985 |
| 1311 | nmdc:mga03683_61382_c1 | 3300050489 | Bacteria | 1589 |
| 1312 | nmdc:mga03n38_1385_c1 | 3300050490 | Bacteria | 6888 |
| 1313 | nmdc:mga03n38_140458_c1 | 3300050490 | Bacteria | 1206 |
| 1314 | nmdc:mga03n38_148281_c1 | 3300050490 | Bacteria | 1178 |
| 1315 | nmdc:mga03n38_5383_c1 | 3300050490 | Bacteria | 4352 |
| 1316 | nmdc:mga03n38_98787_c1 | 3300050490 | Bacteria | 1405 |
| 1317 | nmdc:mga00v17_191498_c1 | 3300050491 | Bacteria | 1321 |
| 1318 | nmdc:mga00v17_47537_c1 | 3300050491 | Bacteria | 2599 |
| 1319 | nmdc:mga00v17_77401_c1 | 3300050491 | Bacteria | 2071 |
| 1320 | nmdc:mga00v17_85061_c1 | 3300050491 | Bacteria | 1980 |
| 1321 | nmdc:mga0yw44_121517_c1 | 3300050492 | Bacteria | 1682 |
| 1322 | nmdc:mga0yw44_130594_c1 | 3300050492 | Bacteria | 1626 |
| 1323 | nmdc:mga0yw44_32623_c1 | 3300050492 | Bacteria | 2373 |
| 1324 | nmdc:mga0yw44_38554_c1 | 3300050492 | Bacteria | 2829 |
| 1325 | nmdc:mga0yw44_41024_c1 | 3300050492 | Bacteria | 2753 |
| 1326 | nmdc:mga0yw44_85309_c1 | 3300050492 | Bacteria | 1987 |
| 1327 | nmdc:mga0yw44_98070_c1 | 3300050492 | Bacteria | 1863 |
| 1328 | nmdc:mga0k408_2838_c1 | 3300050493 | Bacteria | 9200 |
| 1329 | nmdc:mga0k408_44704_c1 | 3300050493 | Bacteria | 1408 |
| 1330 | nmdc:mga0k408_45315_c1 | 3300050493 | Bacteria | 2537 |
| 1331 | nmdc:mga0k408_77575_c1 | 3300050493 | Bacteria | 1943 |
| 1332 | nmdc:mga06z11_33686_c1 | 3300050494 | Bacteria | 2508 |
| 1333 | nmdc:mga06z11_85306_c1 | 3300050494 | Bacteria | 1703 |
| 1334 | nmdc:mga04h51_40454_c1 | 3300050495 | Bacteria | 1519 |
| 1335 | nmdc:mga07m45_269756_c1 | 3300050496 | Bacteria | 990 |
| 1336 | nmdc:mga07m45_4399_c1 | 3300050496 | Bacteria | 6896 |
| 1337 | nmdc:mga05p37_225116_c1 | 3300050507 | Bacteria | 2262 |
| 1338 | nmdc:mga05p37_458612_c1 | 3300050507 | Bacteria | 1473 |
| 1339 | nmdc:mga08y16_336950_c1 | 3300050511 | Bacteria | 1551 |
| 1340 | nmdc:mga0rr50_7973_c1 | 3300050513 | Bacteria | 6571 |
| 1341 | nmdc:mga08x19_100320_c1 | 3300050514 | Bacteria | 1920 |
| 1342 | nmdc:mga0sz30_112711_c1 | 3300050516 | Bacteria | 1193 |
| 1343 | nmdc:mga0sz30_23385_c1 | 3300050516 | Bacteria | 2514 |
| 1344 | nmdc:mga0sz30_90125_c1 | 3300050516 | Bacteria | 1334 |
| 1345 | Ga0495601_0026087 | 3300053077 | Bacteria | 3605 |
| 1346 | Ga0495601_0031353 | 3300053077 | Bacteria | 3303 |
| 1347 | Ga0495601_0068831 | 3300053077 | Bacteria | 2257 |
| 1348 | Ga0495601_0304869 | 3300053077 | Bacteria | 1037 |
| 1349 | Ga0495612_0022777 | 3300053078 | Bacteria | 2511 |
| 1350 | Ga0500610_0066195 | 3300053079 | Bacteria | 1884 |
| 1351 | Ga0495595_0026287 | 3300053084 | Bacteria | 2585 |
| 1352 | Ga0495595_0060653 | 3300053084 | Bacteria | 1770 |
| 1353 | Ga0495595_0120013 | 3300053084 | Bacteria | 1280 |
| 1354 | Ga0495619_0005683 | 3300053085 | Bacteria | 7908 |
| 1355 | Ga0495619_0139824 | 3300053085 | Bacteria | 1667 |
| 1356 | Ga0495619_0144025 | 3300053085 | Bacteria | 1642 |
| 1357 | Ga0500578_0190699 | 3300053086 | Bacteria | 1259 |
| 1358 | Ga0500643_000270 | 3300053087 | Bacteria | 45829 |
| 1359 | Ga0500581_088318 | 3300053089 | Bacteria | 1539 |
| 1360 | Ga0500647_0082492 | 3300053091 | Bacteria | 1542 |
| 1361 | Ga0500651_0022302 | 3300053093 | Bacteria | 3954 |
| 1362 | Ga0500651_0055248 | 3300053093 | Bacteria | 2488 |
| 1363 | Ga0500651_0165963 | 3300053093 | Bacteria | 1318 |
| 1364 | Ga0500566_0000022 | 3300053094 | Bacteria | 81784 |
| 1365 | Ga0500566_0005084 | 3300053094 | Bacteria | 7841 |
| 1366 | Ga0500566_0012337 | 3300053094 | Bacteria | 5032 |
| 1367 | Ga0500566_0052562 | 3300053094 | Bacteria | 2327 |
| 1368 | Ga0500640_000259 | 3300053095 | Bacteria | 11663 |
| 1369 | Ga0500641_0002387 | 3300053096 | Bacteria | 6661 |
| 1370 | Ga0500641_0002665 | 3300053096 | Bacteria | 6302 |
| 1371 | Ga0500641_0073297 | 3300053096 | Bacteria | 1444 |
| 1372 | Ga0500650_0014048 | 3300053098 | Bacteria | 3377 |
| 1373 | Ga0500554_002353 | 3300053102 | Bacteria | 3708 |
| 1374 | Ga0500554_009543 | 3300053102 | Bacteria | 2328 |
| 1375 | Ga0500555_002818 | 3300053103 | Bacteria | 4985 |
| 1376 | Ga0500556_0000097 | 3300053104 | Bacteria | 81329 |
| 1377 | Ga0500556_0000306 | 3300053104 | Bacteria | 37363 |
| 1378 | Ga0500556_0021119 | 3300053104 | Bacteria | 2094 |
| 1379 | Ga0500556_0075336 | 3300053104 | Bacteria | 1268 |
| 1380 | Ga0500556_0127573 | 3300053104 | Bacteria | 995 |
| 1381 | Ga0500557_000026 | 3300053105 | Bacteria | 81867 |
| 1382 | Ga0500562_012247 | 3300053108 | Bacteria | 2180 |
| 1383 | Ga0500562_014270 | 3300053108 | Bacteria | 2034 |
| 1384 | Ga0500569_011121 | 3300053109 | Bacteria | 2140 |
| 1385 | Ga0500569_022839 | 3300053109 | Bacteria | 1672 |
| 1386 | Ga0500569_079789 | 3300053109 | Bacteria | 1045 |
| 1387 | Ga0500572_001109 | 3300053111 | Bacteria | 7863 |
| 1388 | Ga0500593_000814 | 3300053117 | Bacteria | 11671 |
| 1389 | Ga0500595_000095 | 3300053119 | Bacteria | 61248 |
| 1390 | Ga0500595_016306 | 3300053119 | Bacteria | 2771 |
| 1391 | Ga0500595_023108 | 3300053119 | Bacteria | 2189 |
| 1392 | Ga0500595_023330 | 3300053119 | Bacteria | 2176 |
| 1393 | Ga0500607_170287 | 3300053121 | Bacteria | 981 |
| 1394 | Ga0500608_003379 | 3300053122 | Bacteria | 5979 |
| 1395 | Ga0500608_008047 | 3300053122 | Bacteria | 4405 |
| 1396 | Ga0500642_0000017 | 3300053130 | Bacteria | 167670 |
| 1397 | Ga0500642_0000091 | 3300053130 | Bacteria | 45704 |
| 1398 | Ga0500652_000454 | 3300053131 | Bacteria | 14537 |
| 1399 | Ga0500652_029820 | 3300053131 | Bacteria | 2130 |
| 1400 | Ga0500652_089386 | 3300053131 | Bacteria | 1286 |
| 1401 | Ga0500655_004197 | 3300053133 | Bacteria | 2594 |
| 1402 | Ga0500658_0142942 | 3300053134 | Bacteria | 1074 |
| 1403 | Ga0500559_0000219 | 3300053136 | Bacteria | 45843 |
| 1404 | Ga0500559_0002476 | 3300053136 | Bacteria | 9527 |
| 1405 | Ga0500559_0002864 | 3300053136 | Bacteria | 8720 |
| 1406 | Ga0500568_0011063 | 3300053139 | Bacteria | 4203 |
| 1407 | Ga0500568_0028272 | 3300053139 | Bacteria | 2338 |
| 1408 | Ga0500568_0058922 | 3300053139 | Bacteria | 1491 |
| 1409 | Ga0500588_0128957 | 3300053146 | Bacteria | 899 |
| 1410 | Ga0500590_016900 | 3300053148 | Bacteria | 3772 |
| 1411 | Ga0500590_026597 | 3300053148 | Bacteria | 3001 |
| 1412 | Ga0500590_100780 | 3300053148 | Bacteria | 1387 |
| 1413 | Ga0500590_147655 | 3300053148 | Bacteria | 1065 |
| 1414 | Ga0500603_000192 | 3300053150 | Bacteria | 15937 |
| 1415 | Ga0500603_000199 | 3300053150 | Bacteria | 15731 |
| 1416 | Ga0500603_010461 | 3300053150 | Bacteria | 2096 |
| 1417 | Ga0500604_0000841 | 3300053151 | Bacteria | 8474 |
| 1418 | Ga0500604_0004109 | 3300053151 | Bacteria | 3877 |
| 1419 | Ga0500604_0009783 | 3300053151 | Bacteria | 2556 |
| 1420 | Ga0500604_0130095 | 3300053151 | Bacteria | 846 |
| 1421 | Ga0500616_0000046 | 3300053153 | Bacteria | 333409 |
| 1422 | Ga0500616_0003195 | 3300053153 | Bacteria | 12753 |
| 1423 | Ga0500616_0021691 | 3300053153 | Bacteria | 3597 |
| 1424 | Ga0500619_114011 | 3300053154 | Bacteria | 920 |
| 1425 | Ga0500620_000290 | 3300053155 | Bacteria | 9640 |
| 1426 | Ga0500622_0006911 | 3300053156 | Bacteria | 6508 |
| 1427 | Ga0500622_0029083 | 3300053156 | Bacteria | 2907 |
| 1428 | Ga0500622_0206436 | 3300053156 | Bacteria | 890 |
| 1429 | Ga0500624_009244 | 3300053157 | Bacteria | 1398 |
| 1430 | Ga0500630_010421 | 3300053159 | Bacteria | 4569 |
| 1431 | Ga0500633_0011023 | 3300053160 | Bacteria | 2443 |
| 1432 | Ga0500638_003343 | 3300053162 | Bacteria | 5920 |
| 1433 | Ga0500638_175585 | 3300053162 | Bacteria | 929 |
| 1434 | Ga0500639_032910 | 3300053163 | Bacteria | 2739 |
| 1435 | Ga0500636_0018270 | 3300053177 | Bacteria | 4146 |
| 1436 | Ga0500636_0032000 | 3300053177 | Bacteria | 3112 |
| 1437 | Ga0500636_0056864 | 3300053177 | Bacteria | 2289 |
| 1438 | Ga0500637_0047175 | 3300053178 | Bacteria | 2446 |
| 1439 | Ga0500637_0090301 | 3300053178 | Bacteria | 1774 |
| 1440 | Ga0500637_0112124 | 3300053178 | Bacteria | 1581 |
| 1441 | Ga0500637_0170473 | 3300053178 | Bacteria | 1251 |
| 1442 | Ga0500637_0209872 | 3300053178 | Bacteria | 1105 |
| 1443 | Ga0500645_013732 | 3300053730 | Bacteria | 2594 |
| 1444 | Ga0500645_038402 | 3300053730 | Bacteria | 1421 |
| 1445 | Ga0500609_002794 | 3300053731 | Bacteria | 2487 |
| 1446 | Ga0500596_001884 | 3300053735 | Bacteria | 4214 |
| 1447 | Ga0500601_000223 | 3300053737 | Bacteria | 11204 |
| 1448 | Ga0500601_005136 | 3300053737 | Bacteria | 1431 |
| 1449 | Ga0501084_0001641 | 3300054114 | Bacteria | 17770 |
| 1450 | Ga0501084_0008167 | 3300054114 | Bacteria | 8632 |
| 1451 | Ga0501084_0081306 | 3300054114 | Bacteria | 2717 |
| 1452 | Ga0500661_007090 | 3300055283 | Bacteria | 2078 |
| 1453 | Ga0501082_0003572 | 3300060353 | Bacteria | 13578 |
| 1454 | Ga0501082_0062470 | 3300060353 | Bacteria | 3206 |
| 1455 | Ga0501082_0150757 | 3300060353 | Bacteria | 2019 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2922185730 | 2922193014 | 223 |
| 2 | 3300049587 | Ga0501071_0154545 | Ga0501071_0154545_29_712 | 226 |
| 3 | 3300047444 | Ga0495675_0044666 | Ga0495675_0044666_2113_2796 | 227 |
| 4 | 3300049575 | Ga0501039_0505866 | Ga0501039_0505866_18_704 | 227 |
| 5 | 3300039450 | Ga0436363_1114338 | Ga0436363_1114338_12_704 | 228 |
| 6 | 3300046559 | Ga0495667_0365059 | Ga0495667_0365059_14_706 | 228 |
| 7 | 3300053084 | Ga0495595_0120013 | Ga0495595_0120013_24_713 | 228 |
| 8 | 3300025928 | Ga0207700_10193122 | Ga0207700_101931222 | 229 |
| 9 | 3300042157 | Ga0439458_0063523 | Ga0439458_0063523_14_703 | 229 |
| 10 | iso_pu_bacteria | 2906354277 | 2906357331 | 230 |
| 11 | 3300031249 | Ga0265339_10000343 | Ga0265339_1000034328 | 231 |
| 12 | 3300049570 | Ga0501033_0052402 | Ga0501033_0052402_1703_2503 | 231 |
| 13 | 3300049571 | Ga0501034_0069622 | Ga0501034_0069622_2183_2983 | 231 |
| 14 | 3300049572 | Ga0501036_0020290 | Ga0501036_0020290_4143_4943 | 231 |
| 15 | 3300049573 | Ga0501037_0026956 | Ga0501037_0026956_2676_3476 | 231 |
| 16 | 3300049574 | Ga0501038_0008634 | Ga0501038_0008634_1999_2799 | 231 |
| 17 | 3300049580 | Ga0501046_0185983 | Ga0501046_0185983_204_1004 | 231 |
| 18 | 3300049581 | Ga0501047_0047128 | Ga0501047_0047128_590_1390 | 231 |
| 19 | 3300049586 | Ga0501070_0102806 | Ga0501070_0102806_995_1795 | 231 |
| 20 | 3300049823 | Ga0501044_0034593 | Ga0501044_0034593_1601_2401 | 231 |
| 21 | 3300049590 | Ga0501074_0032625 | Ga0501074_0032625_1527_2327 | 232 |
| 22 | 3300005435 | Ga0070714_100361708 | Ga0070714_1003617082 | 233 |
| 23 | iso_pu_bacteria | 2938014810 | 2938018280 | 234 |
| 24 | 3300031730 | Ga0307516_10116416 | Ga0307516_101164162 | 237 |
| 25 | 3300025261 | Ga0209233_1001637 | Ga0209233_10016375 | 239 |
| 26 | 3300037418 | Ga0395900_0495410 | Ga0395900_0495410_212_1012 | 239 |
| 27 | 3300047319 | Ga0495674_0212285 | Ga0495674_0212285_153_953 | 239 |
| 28 | 3300031730 | Ga0307516_10114257 | Ga0307516_101142572 | 242 |
| 29 | 3300037853 | Ga0436364_1512892 | Ga0436364_1512892_1518_2318 | 242 |
| 30 | 3300009551 | Ga0105238_10214235 | Ga0105238_102142352 | 245 |
| 31 | 3300025924 | Ga0207694_10373895 | Ga0207694_103738952 | 245 |
| 32 | 3300010375 | Ga0105239_10288295 | Ga0105239_102882952 | 246 |
| 33 | 3300013296 | Ga0157374_10226274 | Ga0157374_102262742 | 246 |
| 34 | 3300013306 | Ga0163162_10524303 | Ga0163162_105243033 | 246 |
| 35 | 3300053148 | Ga0500590_016900 | Ga0500590_016900_2793_3593 | 246 |
| 36 | 3300005535 | Ga0070684_100039474 | Ga0070684_1000394742 | 247 |
| 37 | 3300005563 | Ga0068855_100260361 | Ga0068855_1002603611 | 247 |
| 38 | 3300005614 | Ga0068856_100213940 | Ga0068856_1002139402 | 247 |
| 39 | 3300009093 | Ga0105240_10128815 | Ga0105240_101288153 | 247 |
| 40 | 3300009545 | Ga0105237_10019409 | Ga0105237_100194095 | 247 |
| 41 | 3300013104 | Ga0157370_10411244 | Ga0157370_104112441 | 247 |
| 42 | 3300013105 | Ga0157369_10012061 | Ga0157369_100120616 | 247 |
| 43 | 3300020070 | Ga0206356_11680992 | Ga0206356_116809922 | 247 |
| 44 | 3300020080 | Ga0206350_11175645 | Ga0206350_111756452 | 247 |
| 45 | 3300022467 | Ga0224712_10004314 | Ga0224712_100043143 | 247 |
| 46 | 3300025933 | Ga0207706_10471494 | Ga0207706_104714942 | 247 |
| 47 | 3300025949 | Ga0207667_10185997 | Ga0207667_101859972 | 247 |
| 48 | 3300037466 | Ga0395898_0002946 | Ga0395898_0002946_18428_19228 | 247 |
| 49 | 3300039437 | Ga0436365_1826856 | Ga0436365_1826856_51_827 | 247 |
| 50 | 3300053156 | Ga0500622_0206436 | Ga0500622_0206436_124_873 | 247 |
| 51 | 3300030521 | Ga0307511_10090887 | Ga0307511_100908872 | 248 |
| 52 | 3300046526 | Ga0495666_0196110 | Ga0495666_0196110_20_775 | 249 |
| 53 | 3300028577 | Ga0265318_10000199 | Ga0265318_1000019915 | 250 |
| 54 | 3300005937 | Ga0081455_10035922 | Ga0081455_100359223 | 251 |
| 55 | 3300031616 | Ga0307508_10000154 | Ga0307508_1000015413 | 251 |
| 56 | 3300039450 | Ga0436363_1020580 | Ga0436363_1020580_681_1481 | 251 |
| 57 | 3300026078 | Ga0207702_10220702 | Ga0207702_102207022 | 252 |
| 58 | 3300031249 | Ga0265339_10108519 | Ga0265339_101085191 | 252 |
| 59 | 3300031250 | Ga0265331_10024685 | Ga0265331_100246852 | 252 |
| 60 | 3300031712 | Ga0265342_10014987 | Ga0265342_100149872 | 252 |
| 61 | 3300053093 | Ga0500651_0055248 | Ga0500651_0055248_118_918 | 253 |
| 62 | 3300053109 | Ga0500569_011121 | Ga0500569_011121_157_957 | 253 |
| 63 | 3300053146 | Ga0500588_0128957 | Ga0500588_0128957_22_822 | 253 |
| 64 | 3300053731 | Ga0500609_002794 | Ga0500609_002794_398_1198 | 253 |
| 65 | 3300003354 | JGI25160J50197_1003620 | JGI25160J50197_10036203 | 254 |
| 66 | 3300006038 | Ga0075365_10122605 | Ga0075365_101226052 | 254 |
| 67 | 3300006042 | Ga0075368_10015140 | Ga0075368_100151401 | 254 |
| 68 | 3300006051 | Ga0075364_10139395 | Ga0075364_101393952 | 254 |
| 69 | 3300006186 | Ga0075369_10020112 | Ga0075369_100201122 | 254 |
| 70 | 3300009093 | Ga0105240_10007458 | Ga0105240_1000745810 | 254 |
| 71 | 3300009174 | Ga0105241_10040448 | Ga0105241_100404482 | 254 |
| 72 | 3300025302 | Ga0207426_1001611 | Ga0207426_100161110 | 254 |
| 73 | 3300025911 | Ga0207654_10047021 | Ga0207654_100470212 | 254 |
| 74 | 3300025913 | Ga0207695_10000059 | Ga0207695_10000059327 | 254 |
| 75 | 3300025981 | Ga0207640_10177133 | Ga0207640_101771332 | 254 |
| 76 | 3300046557 | Ga0495622_0014188 | Ga0495622_0014188_2614_3414 | 254 |
| 77 | 3300048928 | Ga0496125_0046816 | Ga0496125_0046816_963_1763 | 254 |
| 78 | 3300049575 | Ga0501039_0186159 | Ga0501039_0186159_517_1317 | 254 |
| 79 | 3300050491 | nmdc:mga00v17_191498_c1 | nmdc:mga00v17_191498_c1_439_1239 | 254 |
| 80 | 3300050492 | nmdc:mga0yw44_130594_c1 | nmdc:mga0yw44_130594_c1_266_1066 | 254 |
| 81 | 3300050516 | nmdc:mga0sz30_112711_c1 | nmdc:mga0sz30_112711_c1_186_986 | 254 |
| 82 | 3300053094 | Ga0500566_0012337 | Ga0500566_0012337_500_1300 | 254 |
| 83 | 3300053122 | Ga0500608_003379 | Ga0500608_003379_2958_3758 | 254 |
| 84 | 3300053136 | Ga0500559_0002864 | Ga0500559_0002864_1095_1895 | 254 |
| 85 | 3300053148 | Ga0500590_100780 | Ga0500590_100780_48_848 | 254 |
| 86 | 3300053177 | Ga0500636_0032000 | Ga0500636_0032000_753_1553 | 254 |
| 87 | 3300044658 | Ga0466972_0000286 | Ga0466972_0000286_15356_16156 | 255 |
| 88 | 3300046454 | Ga0495592_0002892 | Ga0495592_0002892_7653_8453 | 255 |
| 89 | 3300046462 | Ga0495651_0012448 | Ga0495651_0012448_348_1148 | 255 |
| 90 | 3300046463 | Ga0495653_0147515 | Ga0495653_0147515_186_986 | 255 |
| 91 | 3300046477 | Ga0495664_0021304 | Ga0495664_0021304_2880_3680 | 255 |
| 92 | 3300046511 | Ga0495608_0014344 | Ga0495608_0014344_4427_5227 | 255 |
| 93 | 3300046516 | Ga0495628_0003575 | Ga0495628_0003575_7351_8151 | 255 |
| 94 | 3300046529 | Ga0495652_0012642 | Ga0495652_0012642_227_1027 | 255 |
| 95 | 3300046533 | Ga0495640_0110666 | Ga0495640_0110666_672_1472 | 255 |
| 96 | 3300046536 | Ga0495587_0010725 | Ga0495587_0010725_2339_3139 | 255 |
| 97 | 3300046543 | Ga0495645_0049455 | Ga0495645_0049455_1121_1921 | 255 |
| 98 | 3300046559 | Ga0495667_0006624 | Ga0495667_0006624_2019_2819 | 255 |
| 99 | 3300046675 | Ga0495657_0002983 | Ga0495657_0002983_12913_13713 | 255 |
| 100 | 3300046678 | Ga0495599_0009058 | Ga0495599_0009058_791_1591 | 255 |
| 101 | 3300046679 | Ga0495623_0014811 | Ga0495623_0014811_636_1436 | 255 |
| 102 | 3300046680 | Ga0495646_0017020 | Ga0495646_0017020_1097_1897 | 255 |
| 103 | 3300046689 | Ga0495613_0043461 | Ga0495613_0043461_2139_2939 | 255 |
| 104 | 3300046809 | Ga0495600_0004048 | Ga0495600_0004048_4279_5079 | 255 |
| 105 | 3300047317 | Ga0495604_0005876 | Ga0495604_0005876_6588_7388 | 255 |
| 106 | 3300047319 | Ga0495674_0024836 | Ga0495674_0024836_3644_4444 | 255 |
| 107 | 3300047322 | Ga0495680_0002856 | Ga0495680_0002856_3750_4550 | 255 |
| 108 | 3300047444 | Ga0495675_0031592 | Ga0495675_0031592_171_971 | 255 |
| 109 | 3300047471 | Ga0495684_0131923 | Ga0495684_0131923_246_1046 | 255 |
| 110 | 3300048088 | Ga0495602_0010096 | Ga0495602_0010096_4722_5522 | 255 |
| 111 | 3300049571 | Ga0501034_0101777 | Ga0501034_0101777_295_1095 | 255 |
| 112 | 3300049572 | Ga0501036_0061705 | Ga0501036_0061705_222_1022 | 255 |
| 113 | 3300049574 | Ga0501038_0093901 | Ga0501038_0093901_1098_1898 | 255 |
| 114 | 3300049579 | Ga0501043_0292380 | Ga0501043_0292380_346_1146 | 255 |
| 115 | 3300049585 | Ga0501069_0028526 | Ga0501069_0028526_2154_2954 | 255 |
| 116 | 3300049586 | Ga0501070_0139416 | Ga0501070_0139416_728_1528 | 255 |
| 117 | 3300049742 | Ga0501080_0101039 | Ga0501080_0101039_1854_2654 | 255 |
| 118 | 3300049823 | Ga0501044_0297261 | Ga0501044_0297261_149_949 | 255 |
| 119 | 3300053085 | Ga0495619_0139824 | Ga0495619_0139824_309_1109 | 255 |
| 120 | 3300053130 | Ga0500642_0000017 | Ga0500642_0000017_136196_136996 | 255 |
| 121 | 3300005616 | Ga0068852_100048996 | Ga0068852_1000489962 | 256 |
| 122 | 3300009545 | Ga0105237_10040511 | Ga0105237_100405115 | 256 |
| 123 | 3300025914 | Ga0207671_10255242 | Ga0207671_102552422 | 256 |
| 124 | 3300026041 | Ga0207639_10143561 | Ga0207639_101435612 | 256 |
| 125 | 3300026142 | Ga0207698_10075416 | Ga0207698_100754162 | 256 |
| 126 | 3300046680 | Ga0495646_0040064 | Ga0495646_0040064_1608_2405 | 256 |
| 127 | 3300048914 | Ga0496111_0317480 | Ga0496111_0317480_234_1034 | 256 |
| 128 | 3300053121 | Ga0500607_170287 | Ga0500607_170287_152_952 | 256 |
| 129 | 3300053148 | Ga0500590_026597 | Ga0500590_026597_1213_2013 | 256 |
| 130 | 3300053154 | Ga0500619_114011 | Ga0500619_114011_53_853 | 256 |
| 131 | 3300053157 | Ga0500624_009244 | Ga0500624_009244_452_1252 | 256 |
| 132 | 3300053178 | Ga0500637_0090301 | Ga0500637_0090301_243_1043 | 256 |
| 133 | iso_pu_bacteria | 8019638758 | 8019640805 | 256 |
| 134 | 3300005339 | Ga0070660_100016425 | Ga0070660_1000164254 | 257 |
| 135 | 3300025272 | Ga0209455_1010792 | Ga0209455_10107922 | 257 |
| 136 | 3300025898 | Ga0207692_10217558 | Ga0207692_102175581 | 257 |
| 137 | 3300025911 | Ga0207654_10298750 | Ga0207654_102987502 | 257 |
| 138 | 3300005339 | Ga0070660_100504527 | Ga0070660_1005045271 | 258 |
| 139 | 3300005353 | Ga0070669_100165983 | Ga0070669_1001659832 | 258 |
| 140 | 3300005355 | Ga0070671_100230494 | Ga0070671_1002304941 | 258 |
| 141 | 3300005563 | Ga0068855_100497810 | Ga0068855_1004978102 | 258 |
| 142 | 3300005577 | Ga0068857_100425486 | Ga0068857_1004254861 | 258 |
| 143 | 3300005843 | Ga0068860_100001721 | Ga0068860_1000017212 | 258 |
| 144 | 3300005843 | Ga0068860_100247045 | Ga0068860_1002470452 | 258 |
| 145 | 3300006038 | Ga0075365_10383647 | Ga0075365_103836471 | 258 |
| 146 | 3300006048 | Ga0075363_100011643 | Ga0075363_1000116432 | 258 |
| 147 | 3300006178 | Ga0075367_10068626 | Ga0075367_100686262 | 258 |
| 148 | 3300006195 | Ga0075366_10014528 | Ga0075366_100145284 | 258 |
| 149 | 3300006353 | Ga0075370_10029278 | Ga0075370_100292783 | 258 |
| 150 | 3300009101 | Ga0105247_10054723 | Ga0105247_100547232 | 258 |
| 151 | 3300009174 | Ga0105241_10206836 | Ga0105241_102068362 | 258 |
| 152 | 3300009177 | Ga0105248_10235465 | Ga0105248_102354652 | 258 |
| 153 | 3300009545 | Ga0105237_10073153 | Ga0105237_100731533 | 258 |
| 154 | 3300009551 | Ga0105238_10534798 | Ga0105238_105347982 | 258 |
| 155 | 3300010375 | Ga0105239_10031784 | Ga0105239_100317844 | 258 |
| 156 | 3300011119 | Ga0105246_10240449 | Ga0105246_102404492 | 258 |
| 157 | 3300013296 | Ga0157374_10440234 | Ga0157374_104402342 | 258 |
| 158 | 3300014325 | Ga0163163_10096893 | Ga0163163_100968933 | 258 |
| 159 | 3300025299 | Ga0209256_1030381 | Ga0209256_10303812 | 258 |
| 160 | 3300025900 | Ga0207710_10004750 | Ga0207710_100047504 | 258 |
| 161 | 3300025904 | Ga0207647_10039838 | Ga0207647_100398382 | 258 |
| 162 | 3300025914 | Ga0207671_10031638 | Ga0207671_100316383 | 258 |
| 163 | 3300025919 | Ga0207657_10361687 | Ga0207657_103616872 | 258 |
| 164 | 3300025925 | Ga0207650_10458359 | Ga0207650_104583591 | 258 |
| 165 | 3300025931 | Ga0207644_10061040 | Ga0207644_100610402 | 258 |
| 166 | 3300025941 | Ga0207711_10123067 | Ga0207711_101230672 | 258 |
| 167 | 3300025986 | Ga0207658_10045657 | Ga0207658_100456572 | 258 |
| 168 | 3300026041 | Ga0207639_10162448 | Ga0207639_101624482 | 258 |
| 169 | 3300026067 | Ga0207678_10108612 | Ga0207678_101086122 | 258 |
| 170 | 3300026116 | Ga0207674_10289944 | Ga0207674_102899442 | 258 |
| 171 | 3300028381 | Ga0268264_10000107 | Ga0268264_10000107133 | 258 |
| 172 | 3300037853 | Ga0436364_1404333 | Ga0436364_1404333_62_862 | 258 |
| 173 | 3300044694 | Ga0466963_0435136 | Ga0466963_0435136_106_906 | 258 |
| 174 | 3300046507 | Ga0495606_0036615 | Ga0495606_0036615_2120_2920 | 258 |
| 175 | 3300046513 | Ga0495616_0043535 | Ga0495616_0043535_1429_2229 | 258 |
| 176 | 3300046515 | Ga0495620_0114027 | Ga0495620_0114027_128_928 | 258 |
| 177 | 3300046616 | Ga0495668_0072630 | Ga0495668_0072630_949_1749 | 258 |
| 178 | 3300047323 | Ga0495683_0067062 | Ga0495683_0067062_225_1025 | 258 |
| 179 | 3300048091 | Ga0495626_0101206 | Ga0495626_0101206_253_1053 | 258 |
| 180 | 3300048903 | Ga0496100_0144631 | Ga0496100_0144631_94_894 | 258 |
| 181 | 3300048904 | Ga0496101_0204479 | Ga0496101_0204479_295_1095 | 258 |
| 182 | 3300048905 | Ga0496102_0104817 | Ga0496102_0104817_1541_2341 | 258 |
| 183 | 3300048906 | Ga0496103_0001945 | Ga0496103_0001945_11087_11887 | 258 |
| 184 | 3300048907 | Ga0496104_0067394 | Ga0496104_0067394_1731_2531 | 258 |
| 185 | 3300048908 | Ga0496105_0051296 | Ga0496105_0051296_1541_2341 | 258 |
| 186 | 3300048911 | Ga0496108_0010972 | Ga0496108_0010972_5020_5820 | 258 |
| 187 | 3300048912 | Ga0496109_0073228 | Ga0496109_0073228_101_901 | 258 |
| 188 | 3300048913 | Ga0496110_0208301 | Ga0496110_0208301_195_995 | 258 |
| 189 | 3300048914 | Ga0496111_0104226 | Ga0496111_0104226_368_1168 | 258 |
| 190 | 3300048915 | Ga0496112_0120660 | Ga0496112_0120660_1628_2428 | 258 |
| 191 | 3300048919 | Ga0496116_0076972 | Ga0496116_0076972_17_817 | 258 |
| 192 | 3300048920 | Ga0496117_0059700 | Ga0496117_0059700_1419_2219 | 258 |
| 193 | 3300048922 | Ga0496119_0033766 | Ga0496119_0033766_1808_2608 | 258 |
| 194 | 3300048925 | Ga0496122_0088550 | Ga0496122_0088550_848_1648 | 258 |
| 195 | 3300048927 | Ga0496124_0084967 | Ga0496124_0084967_742_1542 | 258 |
| 196 | 3300048928 | Ga0496125_0150380 | Ga0496125_0150380_79_879 | 258 |
| 197 | 3300048929 | Ga0496126_0463799 | Ga0496126_0463799_24_824 | 258 |
| 198 | 3300050491 | nmdc:mga00v17_77401_c1 | nmdc:mga00v17_77401_c1_688_1488 | 258 |
| 199 | 3300050492 | nmdc:mga0yw44_38554_c1 | nmdc:mga0yw44_38554_c1_1217_2017 | 258 |
| 200 | 3300050493 | nmdc:mga0k408_77575_c1 | nmdc:mga0k408_77575_c1_492_1292 | 258 |
| 201 | 3300050496 | nmdc:mga07m45_4399_c1 | nmdc:mga07m45_4399_c1_3744_4544 | 258 |
| 202 | 3300050516 | nmdc:mga0sz30_23385_c1 | nmdc:mga0sz30_23385_c1_824_1624 | 258 |
| 203 | iso_pu_bacteria | 2513237145 | 2513921978 | 258 |
| 204 | iso_pu_bacteria | 2879099564 | 2879106952 | 258 |
| 205 | iso_pu_bacteria | 2935810662 | 2935811962 | 258 |
| 206 | iso_pu_bacteria | 2936037263 | 2936038545 | 258 |
| 207 | 3300025297 | Ga0209758_1002540 | Ga0209758_10025402 | 259 |
| 208 | 3300048918 | Ga0496115_0205941 | Ga0496115_0205941_14_814 | 259 |
| 209 | iso_pu_bacteria | 2842775625 | 2842778106 | 259 |
| 210 | iso_pu_bacteria | 2922361189 | 2922362484 | 259 |
| 211 | iso_pu_bacteria | 3005710791 | 3005711317 | 259 |
| 212 | iso_pu_bacteria | 2507262055 | 2507505558 | 260 |
| 213 | iso_pu_bacteria | 2508501009 | 2508539436 | 260 |
| 214 | iso_pu_bacteria | 2508501042 | 2508695775 | 260 |
| 215 | iso_pu_bacteria | 2508501128 | 2509152534 | 260 |
| 216 | iso_pu_bacteria | 2511231028 | 2511397660 | 260 |
| 217 | iso_pu_bacteria | 2513237092 | 2513624794 | 260 |
| 218 | iso_pu_bacteria | 2513237094 | 2513642337 | 260 |
| 219 | iso_pu_bacteria | 2513237095 | 2513652565 | 260 |
| 220 | iso_pu_bacteria | 2513237096 | 2513658095 | 260 |
| 221 | iso_pu_bacteria | 2513237098 | 2513671765 | 260 |
| 222 | iso_pu_bacteria | 2513237102 | 2513704840 | 260 |
| 223 | iso_pu_bacteria | 2513237104 | 2513721868 | 260 |
| 224 | iso_pu_bacteria | 2513237137 | 2513863837 | 260 |
| 225 | iso_pu_bacteria | 2513237139 | 2513879323 | 260 |
| 226 | iso_pu_bacteria | 2513237141 | 2513895151 | 260 |
| 227 | iso_pu_bacteria | 2513237145 | 2513922933 | 260 |
| 228 | iso_pu_bacteria | 2513237161 | 2514016857 | 260 |
| 229 | iso_pu_bacteria | 2515154112 | 2515630146 | 260 |
| 230 | iso_pu_bacteria | 2517093001 | 2517107939 | 260 |
| 231 | iso_pu_bacteria | 2517572143 | 2517889164 | 260 |
| 232 | iso_pu_bacteria | 2524023205 | 2524442002 | 260 |
| 233 | iso_pu_bacteria | 2524023210 | 2524470148 | 260 |
| 234 | iso_pu_bacteria | 2524023228 | 2524536584 | 260 |
| 235 | iso_pu_bacteria | 2528768022 | 2528851848 | 260 |
| 236 | iso_pu_bacteria | 2602042107 | 2603858153 | 260 |
| 237 | iso_pu_bacteria | 2617270735 | 2617353667 | 260 |
| 238 | iso_pu_bacteria | 2643221550 | 2643774234 | 260 |
| 239 | iso_pu_bacteria | 2643221564 | 2643837574 | 260 |
| 240 | iso_pu_bacteria | 2643221651 | 2644290124 | 260 |
| 241 | iso_pu_bacteria | 2667528175 | 2671121554 | 260 |
| 242 | iso_pu_bacteria | 2721755755 | 2723841927 | 260 |
| 243 | iso_pu_bacteria | 2728368998 | 2728753675 | 260 |
| 244 | iso_pu_bacteria | 2744054633 | 2745082380 | 260 |
| 245 | iso_pu_bacteria | 2791355196 | 2793065670 | 260 |
| 246 | iso_pu_bacteria | 2791355197 | 2793072590 | 260 |
| 247 | iso_pu_bacteria | 2791355199 | 2793079143 | 260 |
| 248 | iso_pu_bacteria | 2802429603 | 2805921530 | 260 |
| 249 | iso_pu_bacteria | 2816332527 | 2818239073 | 260 |
| 250 | iso_pu_bacteria | 2824600985 | 2824603006 | 260 |
| 251 | iso_pu_bacteria | 2824609381 | 2824615476 | 260 |
| 252 | iso_pu_bacteria | 2824617872 | 2824623926 | 260 |
| 253 | iso_pu_bacteria | 2824626560 | 2824632595 | 260 |
| 254 | iso_pu_bacteria | 2824635225 | 2824639451 | 260 |
| 255 | iso_pu_bacteria | 2824644064 | 2824649449 | 260 |
| 256 | iso_pu_bacteria | 2824653114 | 2824660315 | 260 |
| 257 | iso_pu_bacteria | 2824661429 | 2824668578 | 260 |
| 258 | iso_pu_bacteria | 2824671348 | 2824675357 | 260 |
| 259 | iso_pu_bacteria | 2824679649 | 2824684682 | 260 |
| 260 | iso_pu_bacteria | 2824687955 | 2824691575 | 260 |
| 261 | iso_pu_bacteria | 2824696289 | 2824700510 | 260 |
| 262 | iso_pu_bacteria | 2824714736 | 2824719331 | 260 |
| 263 | iso_pu_bacteria | 2824723954 | 2824727963 | 260 |
| 264 | iso_pu_bacteria | 2824773399 | 2824777439 | 260 |
| 265 | iso_pu_bacteria | 2838122688 | 2838130205 | 260 |
| 266 | iso_pu_bacteria | 2841941048 | 2841947882 | 260 |
| 267 | iso_pu_bacteria | 2841949485 | 2841956941 | 260 |
| 268 | iso_pu_bacteria | 2841957949 | 2841965070 | 260 |
| 269 | iso_pu_bacteria | 2841966195 | 2841972708 | 260 |
| 270 | iso_pu_bacteria | 2841974524 | 2841977440 | 260 |
| 271 | iso_pu_bacteria | 2841983080 | 2841990662 | 260 |
| 272 | iso_pu_bacteria | 2842038055 | 2842041290 | 260 |
| 273 | iso_pu_bacteria | 2842045827 | 2842049332 | 260 |
| 274 | iso_pu_bacteria | 2847939898 | 2847942462 | 260 |
| 275 | iso_pu_bacteria | 2849076700 | 2849083326 | 260 |
| 276 | iso_pu_bacteria | 2856356410 | 2856358727 | 260 |
| 277 | iso_pu_bacteria | 2857509624 | 2857516484 | 260 |
| 278 | iso_pu_bacteria | 2857524615 | 2857527542 | 260 |
| 279 | iso_pu_bacteria | 2871488783 | 2871491346 | 260 |
| 280 | iso_pu_bacteria | 2874590934 | 2874592633 | 260 |
| 281 | iso_pu_bacteria | 2874604998 | 2874610474 | 260 |
| 282 | iso_pu_bacteria | 2874612657 | 2874619071 | 260 |
| 283 | iso_pu_bacteria | 2874620515 | 2874623034 | 260 |
| 284 | iso_pu_bacteria | 2874628541 | 2874636837 | 260 |
| 285 | iso_pu_bacteria | 2874645413 | 2874647457 | 260 |
| 286 | iso_pu_bacteria | 2876761206 | 2876763727 | 260 |
| 287 | iso_pu_bacteria | 2876771140 | 2876772757 | 260 |
| 288 | iso_pu_bacteria | 2876808645 | 2876817427 | 260 |
| 289 | iso_pu_bacteria | 2876818435 | 2876820090 | 260 |
| 290 | iso_pu_bacteria | 2878753008 | 2878757781 | 260 |
| 291 | iso_pu_bacteria | 2879074833 | 2879076595 | 260 |
| 292 | iso_pu_bacteria | 2879099564 | 2879106786 | 260 |
| 293 | iso_pu_bacteria | 2879110137 | 2879115116 | 260 |
| 294 | iso_pu_bacteria | 2879127579 | 2879129228 | 260 |
| 295 | iso_pu_bacteria | 2879142872 | 2879144867 | 260 |
| 296 | iso_pu_bacteria | 2881845957 | 2881849792 | 260 |
| 297 | iso_pu_bacteria | 2882912400 | 2882915246 | 260 |
| 298 | iso_pu_bacteria | 2885318864 | 2885320484 | 260 |
| 299 | iso_pu_bacteria | 2885350715 | 2885351730 | 260 |
| 300 | iso_pu_bacteria | 2885366525 | 2885368600 | 260 |
| 301 | iso_pu_bacteria | 2885374607 | 2885376102 | 260 |
| 302 | iso_pu_bacteria | 2885383462 | 2885390206 | 260 |
| 303 | iso_pu_bacteria | 2885409591 | 2885417691 | 260 |
| 304 | iso_pu_bacteria | 2888378607 | 2888379274 | 260 |
| 305 | iso_pu_bacteria | 2888388044 | 2888390393 | 260 |
| 306 | iso_pu_bacteria | 2888419890 | 2888419959 | 260 |
| 307 | iso_pu_bacteria | 2889033259 | 2889035153 | 260 |
| 308 | iso_pu_bacteria | 2903492973 | 2903506456 | 260 |
| 309 | iso_pu_bacteria | 2903768456 | 2903775311 | 260 |
| 310 | iso_pu_bacteria | 2904666416 | 2904666654 | 260 |
| 311 | iso_pu_bacteria | 2904690495 | 2904690892 | 260 |
| 312 | iso_pu_bacteria | 2904699407 | 2904708979 | 260 |
| 313 | iso_pu_bacteria | 2906610324 | 2906613445 | 260 |
| 314 | iso_pu_bacteria | 2906626472 | 2906629105 | 260 |
| 315 | iso_pu_bacteria | 2906635258 | 2906636159 | 260 |
| 316 | iso_pu_bacteria | 2906660503 | 2906668478 | 260 |
| 317 | iso_pu_bacteria | 2908739725 | 2908747772 | 260 |
| 318 | iso_pu_bacteria | 2908756301 | 2908756948 | 260 |
| 319 | iso_pu_bacteria | 2922361189 | 2922363415 | 260 |
| 320 | iso_pu_bacteria | 2922368715 | 2922369044 | 260 |
| 321 | iso_pu_bacteria | 2922386360 | 2922388762 | 260 |
| 322 | iso_pu_bacteria | 2922393267 | 2922394703 | 260 |
| 323 | iso_pu_bacteria | 2922425934 | 2922433882 | 260 |
| 324 | iso_pu_bacteria | 2924784321 | 2924785722 | 260 |
| 325 | iso_pu_bacteria | 2929615660 | 2929618913 | 260 |
| 326 | iso_pu_bacteria | 2929624759 | 2929630990 | 260 |
| 327 | iso_pu_bacteria | 2932784394 | 2932788959 | 260 |
| 328 | iso_pu_bacteria | 2932794094 | 2932799992 | 260 |
| 329 | iso_pu_bacteria | 2932801729 | 2932809003 | 260 |
| 330 | iso_pu_bacteria | 2932809354 | 2932814397 | 260 |
| 331 | iso_pu_bacteria | 2932818245 | 2932820523 | 260 |
| 332 | iso_pu_bacteria | 2932828146 | 2932834562 | 260 |
| 333 | iso_pu_bacteria | 2933577622 | 2933580377 | 260 |
| 334 | iso_pu_bacteria | 2935608549 | 2935614617 | 260 |
| 335 | iso_pu_bacteria | 2935616580 | 2935624426 | 260 |
| 336 | iso_pu_bacteria | 2935630451 | 2935634911 | 260 |
| 337 | iso_pu_bacteria | 2935638405 | 2935645934 | 260 |
| 338 | iso_pu_bacteria | 2935648319 | 2935654779 | 260 |
| 339 | iso_pu_bacteria | 2935656913 | 2935663659 | 260 |
| 340 | iso_pu_bacteria | 2935665750 | 2935674477 | 260 |
| 341 | iso_pu_bacteria | 2935675223 | 2935682678 | 260 |
| 342 | iso_pu_bacteria | 2935684952 | 2935686711 | 260 |
| 343 | iso_pu_bacteria | 2935694250 | 2935701613 | 260 |
| 344 | iso_pu_bacteria | 2935703347 | 2935710411 | 260 |
| 345 | iso_pu_bacteria | 2935713505 | 2935716399 | 260 |
| 346 | iso_pu_bacteria | 2935722832 | 2935723476 | 260 |
| 347 | iso_pu_bacteria | 2935732158 | 2935735032 | 260 |
| 348 | iso_pu_bacteria | 2935741537 | 2935744177 | 260 |
| 349 | iso_pu_bacteria | 2935750917 | 2935752677 | 260 |
| 350 | iso_pu_bacteria | 2935760218 | 2935764895 | 260 |
| 351 | iso_pu_bacteria | 2935769743 | 2935774183 | 260 |
| 352 | iso_pu_bacteria | 2935777560 | 2935782360 | 260 |
| 353 | iso_pu_bacteria | 2935785616 | 2935789101 | 260 |
| 354 | iso_pu_bacteria | 2935793552 | 2935796851 | 260 |
| 355 | iso_pu_bacteria | 2935801545 | 2935806065 | 260 |
| 356 | iso_pu_bacteria | 2935810662 | 2935816875 | 260 |
| 357 | iso_pu_bacteria | 2935819856 | 2935826351 | 260 |
| 358 | iso_pu_bacteria | 2935827899 | 2935835165 | 260 |
| 359 | iso_pu_bacteria | 2935837841 | 2935841454 | 260 |
| 360 | iso_pu_bacteria | 2935847175 | 2935853838 | 260 |
| 361 | iso_pu_bacteria | 2935855204 | 2935863145 | 260 |
| 362 | iso_pu_bacteria | 2935864058 | 2935873098 | 260 |
| 363 | iso_pu_bacteria | 2935873716 | 2935880147 | 260 |
| 364 | iso_pu_bacteria | 2935883170 | 2935888204 | 260 |
| 365 | iso_pu_bacteria | 2935908558 | 2935915385 | 260 |
| 366 | iso_pu_bacteria | 2935916978 | 2935925139 | 260 |
| 367 | iso_pu_bacteria | 2935926038 | 2935933280 | 260 |
| 368 | iso_pu_bacteria | 2935934488 | 2935941372 | 260 |
| 369 | iso_pu_bacteria | 2935942939 | 2935949569 | 260 |
| 370 | iso_pu_bacteria | 2935951376 | 2935958256 | 260 |
| 371 | iso_pu_bacteria | 2935959822 | 2935966503 | 260 |
| 372 | iso_pu_bacteria | 2935967501 | 2935974844 | 260 |
| 373 | iso_pu_bacteria | 2935975950 | 2935983105 | 260 |
| 374 | iso_pu_bacteria | 2935984226 | 2935985269 | 260 |
| 375 | iso_pu_bacteria | 2935992306 | 2936000851 | 260 |
| 376 | iso_pu_bacteria | 2936002035 | 2936010352 | 260 |
| 377 | iso_pu_bacteria | 2936011229 | 2936017815 | 260 |
| 378 | iso_pu_bacteria | 2936019824 | 2936026318 | 260 |
| 379 | iso_pu_bacteria | 2936028420 | 2936035065 | 260 |
| 380 | iso_pu_bacteria | 2936037263 | 2936043866 | 260 |
| 381 | iso_pu_bacteria | 2936046547 | 2936053178 | 260 |
| 382 | iso_pu_bacteria | 2936055302 | 2936056969 | 260 |
| 383 | iso_pu_bacteria | 2940556831 | 2940558590 | 260 |
| 384 | iso_pu_bacteria | 2941507105 | 2941514301 | 260 |
| 385 | iso_pu_bacteria | 2941515067 | 2941522262 | 260 |
| 386 | iso_pu_bacteria | 2941523033 | 2941530133 | 260 |
| 387 | iso_pu_bacteria | 2941531003 | 2941537991 | 260 |
| 388 | iso_pu_bacteria | 2941538514 | 2941543680 | 260 |
| 389 | iso_pu_bacteria | 2961170736 | 2961174324 | 260 |
| 390 | iso_pu_bacteria | 2967996073 | 2968000271 | 260 |
| 391 | iso_pu_bacteria | 2968003550 | 2968005457 | 260 |
| 392 | iso_pu_bacteria | 2970503327 | 2970506911 | 260 |
| 393 | iso_pu_bacteria | 2977821940 | 2977822313 | 260 |
| 394 | iso_pu_bacteria | 2977828996 | 2977833297 | 260 |
| 395 | iso_pu_bacteria | 2979808191 | 2979812106 | 260 |
| 396 | iso_pu_bacteria | 3005474847 | 3005475397 | 260 |
| 397 | iso_pu_bacteria | 3005506211 | 3005511502 | 260 |
| 398 | iso_pu_bacteria | 8004374579 | 8004379292 | 260 |
| 399 | iso_pu_bacteria | 8006926726 | 8006932662 | 260 |
| 400 | iso_pu_bacteria | 8006933436 | 8006935887 | 260 |
| 401 | iso_pu_bacteria | 8006964411 | 8006969375 | 260 |
| 402 | iso_pu_bacteria | 8006973647 | 8006975996 | 260 |
| 403 | iso_pu_bacteria | 8006984368 | 8006988420 | 260 |
| 404 | iso_pu_bacteria | 8006994254 | 8007000668 | 260 |
| 405 | iso_pu_bacteria | 8016511872 | 8016517846 | 260 |
| 406 | iso_pu_bacteria | 8016530956 | 8016539498 | 260 |
| 407 | iso_pu_bacteria | 8016539877 | 8016543787 | 260 |
| 408 | iso_pu_bacteria | 8016548790 | 8016549508 | 260 |
| 409 | iso_pu_bacteria | 8016557553 | 8016557930 | 260 |
| 410 | iso_pu_bacteria | 8016566248 | 8016569187 | 260 |
| 411 | iso_pu_bacteria | 8016575299 | 8016581828 | 260 |
| 412 | iso_pu_bacteria | 8016583857 | 8016586025 | 260 |
| 413 | iso_pu_bacteria | 8016595262 | 8016595950 | 260 |
| 414 | iso_pu_bacteria | 8016603502 | 8016606820 | 260 |
| 415 | iso_pu_bacteria | 8016613128 | 8016618727 | 260 |
| 416 | iso_pu_bacteria | 8016622563 | 8016622804 | 260 |
| 417 | iso_pu_bacteria | 8016630954 | 8016635309 | 260 |
| 418 | iso_pu_bacteria | 8017057580 | 8017058787 | 260 |
| 419 | iso_pu_bacteria | 8019530166 | 8019530777 | 260 |
| 420 | iso_pu_bacteria | 8019538911 | 8019540807 | 260 |
| 421 | iso_pu_bacteria | 8019547302 | 8019549807 | 260 |
| 422 | iso_pu_bacteria | 8019565922 | 8019572868 | 260 |
| 423 | iso_pu_bacteria | 8019576017 | 8019576865 | 260 |
| 424 | iso_pu_bacteria | 8019586578 | 8019594922 | 260 |
| 425 | iso_pu_bacteria | 8019608314 | 8019611689 | 260 |
| 426 | iso_pu_bacteria | 8019619141 | 8019623283 | 260 |
| 427 | iso_pu_bacteria | 8019648815 | 8019652080 | 260 |
| 428 | iso_pu_bacteria | 8019659431 | 8019666650 | 260 |
| 429 | iso_pu_bacteria | 8019687851 | 8019695934 | 260 |
| 430 | iso_pu_bacteria | 8055742211 | 8055742762 | 260 |
| 431 | iso_pu_bacteria | 8056673599 | 8056678561 | 260 |
| 432 | iso_pu_bacteria | 8056681323 | 8056689385 | 260 |
| 433 | iso_pu_bacteria | 8056689827 | 8056691919 | 260 |
| 434 | iso_pu_bacteria | 8056967851 | 8056975740 | 260 |
| 435 | 3300050493 | nmdc:mga0k408_2838_c1 | nmdc:mga0k408_2838_c1_6059_6850 | 261 |
| 436 | iso_pu_bacteria | 2509276018 | 2509371163 | 261 |
| 437 | iso_pu_bacteria | 2510065059 | 2510313748 | 261 |
| 438 | iso_pu_bacteria | 2512875024 | 2512958935 | 261 |
| 439 | iso_pu_bacteria | 2513237090 | 2513610911 | 261 |
| 440 | iso_pu_bacteria | 2513237164 | 2514038217 | 261 |
| 441 | iso_pu_bacteria | 2599185301 | 2599938379 | 261 |
| 442 | iso_pu_bacteria | 2643221551 | 2643775272 | 261 |
| 443 | iso_pu_bacteria | 2643221555 | 2643793718 | 261 |
| 444 | iso_pu_bacteria | 2643221595 | 2643985807 | 261 |
| 445 | iso_pu_bacteria | 2643221627 | 2644158421 | 261 |
| 446 | iso_pu_bacteria | 2687453392 | 2688598806 | 261 |
| 447 | iso_pu_bacteria | 2693429783 | 2694629880 | 261 |
| 448 | iso_pu_bacteria | 2693429784 | 2694636247 | 261 |
| 449 | iso_pu_bacteria | 2738543024 | 2739308167 | 261 |
| 450 | iso_pu_bacteria | 2756170246 | 2756675665 | 261 |
| 451 | iso_pu_bacteria | 2844002411 | 2844006169 | 261 |
| 452 | iso_pu_bacteria | 2856328259 | 2856331466 | 261 |
| 453 | iso_pu_bacteria | 2856334872 | 2856339052 | 261 |
| 454 | iso_pu_bacteria | 2856364286 | 2856370489 | 261 |
| 455 | iso_pu_bacteria | 2857349434 | 2857350723 | 261 |
| 456 | iso_pu_bacteria | 2869249662 | 2869250867 | 261 |
| 457 | iso_pu_bacteria | 2869264136 | 2869266681 | 261 |
| 458 | iso_pu_bacteria | 2869271264 | 2869272126 | 261 |
| 459 | iso_pu_bacteria | 2869285874 | 2869291784 | 261 |
| 460 | iso_pu_bacteria | 2871429161 | 2871434993 | 261 |
| 461 | iso_pu_bacteria | 2871451962 | 2871459116 | 261 |
| 462 | iso_pu_bacteria | 2871459585 | 2871466482 | 261 |
| 463 | iso_pu_bacteria | 2871466892 | 2871468154 | 261 |
| 464 | iso_pu_bacteria | 2874131515 | 2874134713 | 261 |
| 465 | iso_pu_bacteria | 2874146452 | 2874149384 | 261 |
| 466 | iso_pu_bacteria | 2874155637 | 2874157647 | 261 |
| 467 | iso_pu_bacteria | 2874162495 | 2874166224 | 261 |
| 468 | iso_pu_bacteria | 2876369609 | 2876370574 | 261 |
| 469 | iso_pu_bacteria | 2876392853 | 2876394586 | 261 |
| 470 | iso_pu_bacteria | 2876399893 | 2876406013 | 261 |
| 471 | iso_pu_bacteria | 2876413966 | 2876415850 | 261 |
| 472 | iso_pu_bacteria | 2878745973 | 2878752128 | 261 |
| 473 | iso_pu_bacteria | 2881147464 | 2881151883 | 261 |
| 474 | iso_pu_bacteria | 2882632389 | 2882635639 | 261 |
| 475 | iso_pu_bacteria | 2885305155 | 2885309786 | 261 |
| 476 | iso_pu_bacteria | 2885312484 | 2885317609 | 261 |
| 477 | iso_pu_bacteria | 2885326080 | 2885328975 | 261 |
| 478 | iso_pu_bacteria | 2888350351 | 2888356122 | 261 |
| 479 | iso_pu_bacteria | 2889010040 | 2889011053 | 261 |
| 480 | iso_pu_bacteria | 2889016732 | 2889017255 | 261 |
| 481 | iso_pu_bacteria | 2903492973 | 2903493314 | 261 |
| 482 | iso_pu_bacteria | 2904659560 | 2904661220 | 261 |
| 483 | iso_pu_bacteria | 2906308376 | 2906314522 | 261 |
| 484 | iso_pu_bacteria | 2906321335 | 2906327690 | 261 |
| 485 | iso_pu_bacteria | 2906370794 | 2906371497 | 261 |
| 486 | iso_pu_bacteria | 2906378014 | 2906382786 | 261 |
| 487 | iso_pu_bacteria | 2906393657 | 2906400934 | 261 |
| 488 | iso_pu_bacteria | 2906408224 | 2906412095 | 261 |
| 489 | iso_pu_bacteria | 2922130491 | 2922131230 | 261 |
| 490 | iso_pu_bacteria | 2922151315 | 2922154650 | 261 |
| 491 | iso_pu_bacteria | 2922172374 | 2922177473 | 261 |
| 492 | iso_pu_bacteria | 2922178524 | 2922181790 | 261 |
| 493 | iso_pu_bacteria | 2924733363 | 2924739348 | 261 |
| 494 | iso_pu_bacteria | 2924748358 | 2924748516 | 261 |
| 495 | iso_pu_bacteria | 2937813078 | 2937816175 | 261 |
| 496 | iso_pu_bacteria | 2937843397 | 2937844813 | 261 |
| 497 | iso_pu_bacteria | 2958041894 | 2958043496 | 261 |
| 498 | iso_pu_bacteria | 2958100919 | 2958104993 | 261 |
| 499 | iso_pu_bacteria | 2958122699 | 2958129632 | 261 |
| 500 | iso_pu_bacteria | 2958130278 | 2958136182 | 261 |
| 501 | iso_pu_bacteria | 2958137437 | 2958139483 | 261 |
| 502 | iso_pu_bacteria | 2958158011 | 2958163021 | 261 |
| 503 | iso_pu_bacteria | 2958172287 | 2958175287 | 261 |
| 504 | iso_pu_bacteria | 2958179912 | 2958185650 | 261 |
| 505 | iso_pu_bacteria | 2961077736 | 2961084027 | 261 |
| 506 | iso_pu_bacteria | 2961114664 | 2961116371 | 261 |
| 507 | iso_pu_bacteria | 2961136820 | 2961144642 | 261 |
| 508 | iso_pu_bacteria | 2965025482 | 2965026525 | 261 |
| 509 | iso_pu_bacteria | 2965032056 | 2965035273 | 261 |
| 510 | iso_pu_bacteria | 2965040258 | 2965040422 | 261 |
| 511 | iso_pu_bacteria | 2965047637 | 2965055185 | 261 |
| 512 | iso_pu_bacteria | 2965089291 | 2965095342 | 261 |
| 513 | iso_pu_bacteria | 2965102966 | 2965107099 | 261 |
| 514 | iso_pu_bacteria | 2965110997 | 2965114528 | 261 |
| 515 | iso_pu_bacteria | 2965119406 | 2965122089 | 261 |
| 516 | iso_pu_bacteria | 2968110612 | 2968112277 | 261 |
| 517 | iso_pu_bacteria | 2968117919 | 2968121041 | 261 |
| 518 | iso_pu_bacteria | 2970489779 | 2970495709 | 261 |
| 519 | iso_pu_bacteria | 2970547951 | 2970554700 | 261 |
| 520 | iso_pu_bacteria | 2977843712 | 2977846411 | 261 |
| 521 | iso_pu_bacteria | 2977872689 | 2977875146 | 261 |
| 522 | iso_pu_bacteria | 2977915119 | 2977917266 | 261 |
| 523 | iso_pu_bacteria | 2977935797 | 2977940420 | 261 |
| 524 | iso_pu_bacteria | 2977942078 | 2977947582 | 261 |
| 525 | iso_pu_bacteria | 2977950692 | 2977955203 | 261 |
| 526 | iso_pu_bacteria | 2977957713 | 2977961716 | 261 |
| 527 | iso_pu_bacteria | 2977971508 | 2977974288 | 261 |
| 528 | iso_pu_bacteria | 2979710463 | 2979710486 | 261 |
| 529 | iso_pu_bacteria | 2979793036 | 2979793836 | 261 |
| 530 | iso_pu_bacteria | 2987636660 | 2987637907 | 261 |
| 531 | iso_pu_bacteria | 2987645492 | 2987646798 | 261 |
| 532 | iso_pu_bacteria | 2987673487 | 2987674549 | 261 |
| 533 | iso_pu_bacteria | 3000135777 | 3000140230 | 261 |
| 534 | iso_pu_bacteria | 3004167301 | 3004169300 | 261 |
| 535 | iso_pu_bacteria | 3004195979 | 3004197588 | 261 |
| 536 | iso_pu_bacteria | 3004203850 | 3004205771 | 261 |
| 537 | iso_pu_bacteria | 3004239961 | 3004243965 | 261 |
| 538 | iso_pu_bacteria | 3004268573 | 3004268903 | 261 |
| 539 | iso_pu_bacteria | 649633066 | 649873324 | 261 |
| 540 | iso_pu_bacteria | 8002285264 | 8002288716 | 261 |
| 541 | iso_pu_bacteria | 8004300914 | 8004301861 | 261 |
| 542 | iso_pu_bacteria | 8004387939 | 8004394490 | 261 |
| 543 | iso_pu_bacteria | 8004640170 | 8004640452 | 261 |
| 544 | iso_pu_bacteria | 8004695233 | 8004696030 | 261 |
| 545 | iso_pu_bacteria | 8004714634 | 8004720783 | 261 |
| 546 | 3300005434 | Ga0070709_10050531 | Ga0070709_100505312 | 262 |
| 547 | 3300005435 | Ga0070714_100259577 | Ga0070714_1002595771 | 262 |
| 548 | 3300005436 | Ga0070713_100094497 | Ga0070713_1000944972 | 262 |
| 549 | 3300005437 | Ga0070710_10128812 | Ga0070710_101288122 | 262 |
| 550 | 3300005439 | Ga0070711_100000566 | Ga0070711_1000005667 | 262 |
| 551 | 3300006163 | Ga0070715_10056483 | Ga0070715_100564833 | 262 |
| 552 | 3300006175 | Ga0070712_100004751 | Ga0070712_1000047515 | 262 |
| 553 | 3300025928 | Ga0207700_10242341 | Ga0207700_102423412 | 262 |
| 554 | 3300025939 | Ga0207665_10008178 | Ga0207665_100081783 | 262 |
| 555 | 3300030521 | Ga0307511_10024436 | Ga0307511_100244365 | 262 |
| 556 | 3300031507 | Ga0307509_10018509 | Ga0307509_100185096 | 262 |
| 557 | 3300031730 | Ga0307516_10005650 | Ga0307516_100056508 | 262 |
| 558 | 3300039453 | Ga0436362_0990892 | Ga0436362_0990892_68_874 | 262 |
| 559 | 3300046506 | Ga0495583_0020315 | Ga0495583_0020315_476_1270 | 262 |
| 560 | 3300046507 | Ga0495606_0001032 | Ga0495606_0001032_3240_4034 | 262 |
| 561 | 3300046524 | Ga0495648_0005545 | Ga0495648_0005545_6745_7539 | 262 |
| 562 | 3300046660 | Ga0495625_0168405 | Ga0495625_0168405_286_1080 | 262 |
| 563 | 3300046694 | Ga0495649_0072661 | Ga0495649_0072661_261_1055 | 262 |
| 564 | 3300049460 | Ga0495682_0019787 | Ga0495682_0019787_1203_1997 | 262 |
| 565 | 3300049568 | Ga0501031_0055697 | Ga0501031_0055697_1505_2299 | 262 |
| 566 | 3300049571 | Ga0501034_0072553 | Ga0501034_0072553_2166_2960 | 262 |
| 567 | 3300049571 | Ga0501034_0181193 | Ga0501034_0181193_617_1411 | 262 |
| 568 | 3300049572 | Ga0501036_0099029 | Ga0501036_0099029_1074_1868 | 262 |
| 569 | 3300049573 | Ga0501037_0080211 | Ga0501037_0080211_82_876 | 262 |
| 570 | 3300049574 | Ga0501038_0102772 | Ga0501038_0102772_608_1402 | 262 |
| 571 | 3300049574 | Ga0501038_0189131 | Ga0501038_0189131_716_1510 | 262 |
| 572 | 3300049575 | Ga0501039_0220437 | Ga0501039_0220437_532_1326 | 262 |
| 573 | 3300049579 | Ga0501043_0176682 | Ga0501043_0176682_281_1075 | 262 |
| 574 | 3300049581 | Ga0501047_0311940 | Ga0501047_0311940_504_1298 | 262 |
| 575 | 3300049586 | Ga0501070_0096744 | Ga0501070_0096744_1336_2130 | 262 |
| 576 | 3300053178 | Ga0500637_0170473 | Ga0500637_0170473_252_1046 | 262 |
| 577 | 3300003203 | JGI25406J46586_10000887 | JGI25406J46586_100008875 | 263 |
| 578 | 3300005344 | Ga0070661_100162468 | Ga0070661_1001624683 | 263 |
| 579 | 3300005458 | Ga0070681_10037882 | Ga0070681_100378824 | 263 |
| 580 | 3300005563 | Ga0068855_100000022 | Ga0068855_100000022174 | 263 |
| 581 | 3300005616 | Ga0068852_100008561 | Ga0068852_1000085617 | 263 |
| 582 | 3300005616 | Ga0068852_100081448 | Ga0068852_1000814483 | 263 |
| 583 | 3300005985 | Ga0081539_10000879 | Ga0081539_1000087936 | 263 |
| 584 | 3300006038 | Ga0075365_10035818 | Ga0075365_100358182 | 263 |
| 585 | 3300006051 | Ga0075364_10042860 | Ga0075364_100428602 | 263 |
| 586 | 3300006175 | Ga0070712_100000244 | Ga0070712_10000024427 | 263 |
| 587 | 3300006178 | Ga0075367_10060079 | Ga0075367_100600793 | 263 |
| 588 | 3300009093 | Ga0105240_10000479 | Ga0105240_1000047934 | 263 |
| 589 | 3300009093 | Ga0105240_10655677 | Ga0105240_106556772 | 263 |
| 590 | 3300009101 | Ga0105247_10006862 | Ga0105247_100068627 | 263 |
| 591 | 3300010375 | Ga0105239_10000773 | Ga0105239_1000077324 | 263 |
| 592 | 3300013105 | Ga0157369_10041713 | Ga0157369_100417134 | 263 |
| 593 | 3300013297 | Ga0157378_10243106 | Ga0157378_102431062 | 263 |
| 594 | 3300025913 | Ga0207695_10000018 | Ga0207695_10000018675 | 263 |
| 595 | 3300025915 | Ga0207693_10000135 | Ga0207693_1000013561 | 263 |
| 596 | 3300025924 | Ga0207694_10000005 | Ga0207694_10000005125 | 263 |
| 597 | 3300025949 | Ga0207667_10000061 | Ga0207667_10000061171 | 263 |
| 598 | 3300026023 | Ga0207677_10311058 | Ga0207677_103110581 | 263 |
| 599 | 3300026142 | Ga0207698_10003421 | Ga0207698_100034219 | 263 |
| 600 | 3300031250 | Ga0265331_10018105 | Ga0265331_100181052 | 263 |
| 601 | 3300031344 | Ga0265316_10126412 | Ga0265316_101264123 | 263 |
| 602 | 3300031711 | Ga0265314_10038992 | Ga0265314_100389922 | 263 |
| 603 | 3300031911 | Ga0307412_10540795 | Ga0307412_105407951 | 263 |
| 604 | 3300039437 | Ga0436365_1773510 | Ga0436365_1773510_4514_5311 | 263 |
| 605 | 3300046455 | Ga0495603_0015122 | Ga0495603_0015122_3695_4492 | 263 |
| 606 | 3300046507 | Ga0495606_0089044 | Ga0495606_0089044_916_1713 | 263 |
| 607 | 3300046516 | Ga0495628_0255532 | Ga0495628_0255532_316_1116 | 263 |
| 608 | 3300046529 | Ga0495652_0216541 | Ga0495652_0216541_469_1269 | 263 |
| 609 | 3300046543 | Ga0495645_0137973 | Ga0495645_0137973_29_829 | 263 |
| 610 | 3300049460 | Ga0495682_0003694 | Ga0495682_0003694_949_1749 | 263 |
| 611 | 3300049742 | Ga0501080_0011414 | Ga0501080_0011414_1260_2060 | 263 |
| 612 | 3300050492 | nmdc:mga0yw44_121517_c1 | nmdc:mga0yw44_121517_c1_568_1365 | 263 |
| 613 | 3300050513 | nmdc:mga0rr50_7973_c1 | nmdc:mga0rr50_7973_c1_3619_4419 | 263 |
| 614 | 3300053119 | Ga0500595_016306 | Ga0500595_016306_182_979 | 263 |
| 615 | 3300053133 | Ga0500655_004197 | Ga0500655_004197_360_1160 | 263 |
| 616 | 3300003215 | JGI25153J46596_10001684 | JGI25153J46596_100016842 | 264 |
| 617 | 3300003215 | JGI25153J46596_10002416 | JGI25153J46596_100024167 | 264 |
| 618 | 3300003215 | JGI25153J46596_10004047 | JGI25153J46596_100040472 | 264 |
| 619 | 3300003215 | JGI25153J46596_10050192 | JGI25153J46596_100501922 | 264 |
| 620 | 3300003354 | JGI25160J50197_1005514 | JGI25160J50197_10055144 | 264 |
| 621 | 3300003752 | Ga0055539_1001740 | Ga0055539_10017402 | 264 |
| 622 | 3300003794 | Ga0055531_10012840 | Ga0055531_100128403 | 264 |
| 623 | 3300004625 | Ga0055543_1001860 | Ga0055543_10018606 | 264 |
| 624 | 3300005262 | Ga0065165_1001256 | Ga0065165_10012564 | 264 |
| 625 | 3300005262 | Ga0065165_1005779 | Ga0065165_10057792 | 264 |
| 626 | 3300005327 | Ga0070658_10103957 | Ga0070658_101039572 | 264 |
| 627 | 3300005327 | Ga0070658_10373856 | Ga0070658_103738562 | 264 |
| 628 | 3300005328 | Ga0070676_10038287 | Ga0070676_100382872 | 264 |
| 629 | 3300005329 | Ga0070683_100006785 | Ga0070683_1000067857 | 264 |
| 630 | 3300005329 | Ga0070683_100063089 | Ga0070683_1000630892 | 264 |
| 631 | 3300005330 | Ga0070690_100139173 | Ga0070690_1001391731 | 264 |
| 632 | 3300005331 | Ga0070670_100113110 | Ga0070670_1001131102 | 264 |
| 633 | 3300005331 | Ga0070670_100448063 | Ga0070670_1004480632 | 264 |
| 634 | 3300005333 | Ga0070677_10161434 | Ga0070677_101614341 | 264 |
| 635 | 3300005334 | Ga0068869_100101482 | Ga0068869_1001014822 | 264 |
| 636 | 3300005334 | Ga0068869_100270717 | Ga0068869_1002707171 | 264 |
| 637 | 3300005334 | Ga0068869_100548301 | Ga0068869_1005483011 | 264 |
| 638 | 3300005334 | Ga0068869_100659490 | Ga0068869_1006594901 | 264 |
| 639 | 3300005335 | Ga0070666_10210657 | Ga0070666_102106572 | 264 |
| 640 | 3300005336 | Ga0070680_100020920 | Ga0070680_1000209204 | 264 |
| 641 | 3300005336 | Ga0070680_100176113 | Ga0070680_1001761132 | 264 |
| 642 | 3300005336 | Ga0070680_100232420 | Ga0070680_1002324202 | 264 |
| 643 | 3300005337 | Ga0070682_100076346 | Ga0070682_1000763462 | 264 |
| 644 | 3300005337 | Ga0070682_100220559 | Ga0070682_1002205592 | 264 |
| 645 | 3300005338 | Ga0068868_100020206 | Ga0068868_1000202062 | 264 |
| 646 | 3300005338 | Ga0068868_100038556 | Ga0068868_1000385562 | 264 |
| 647 | 3300005339 | Ga0070660_100025110 | Ga0070660_1000251102 | 264 |
| 648 | 3300005344 | Ga0070661_100004410 | Ga0070661_1000044104 | 264 |
| 649 | 3300005344 | Ga0070661_100057292 | Ga0070661_1000572922 | 264 |
| 650 | 3300005347 | Ga0070668_100016899 | Ga0070668_1000168992 | 264 |
| 651 | 3300005347 | Ga0070668_100035262 | Ga0070668_1000352623 | 264 |
| 652 | 3300005347 | Ga0070668_100039201 | Ga0070668_1000392012 | 264 |
| 653 | 3300005347 | Ga0070668_100049264 | Ga0070668_1000492642 | 264 |
| 654 | 3300005347 | Ga0070668_100166549 | Ga0070668_1001665492 | 264 |
| 655 | 3300005354 | Ga0070675_100630142 | Ga0070675_1006301421 | 264 |
| 656 | 3300005355 | Ga0070671_100205637 | Ga0070671_1002056372 | 264 |
| 657 | 3300005366 | Ga0070659_100040136 | Ga0070659_1000401362 | 264 |
| 658 | 3300005366 | Ga0070659_100073417 | Ga0070659_1000734173 | 264 |
| 659 | 3300005367 | Ga0070667_100203864 | Ga0070667_1002038642 | 264 |
| 660 | 3300005367 | Ga0070667_100206712 | Ga0070667_1002067122 | 264 |
| 661 | 3300005434 | Ga0070709_10001864 | Ga0070709_100018641 | 264 |
| 662 | 3300005434 | Ga0070709_10025801 | Ga0070709_100258012 | 264 |
| 663 | 3300005434 | Ga0070709_10255161 | Ga0070709_102551612 | 264 |
| 664 | 3300005435 | Ga0070714_100001530 | Ga0070714_1000015307 | 264 |
| 665 | 3300005435 | Ga0070714_100106301 | Ga0070714_1001063013 | 264 |
| 666 | 3300005436 | Ga0070713_100010561 | Ga0070713_1000105612 | 264 |
| 667 | 3300005436 | Ga0070713_100375905 | Ga0070713_1003759052 | 264 |
| 668 | 3300005436 | Ga0070713_100543274 | Ga0070713_1005432741 | 264 |
| 669 | 3300005437 | Ga0070710_10001292 | Ga0070710_100012925 | 264 |
| 670 | 3300005437 | Ga0070710_10074620 | Ga0070710_100746202 | 264 |
| 671 | 3300005437 | Ga0070710_10177177 | Ga0070710_101771771 | 264 |
| 672 | 3300005438 | Ga0070701_10129409 | Ga0070701_101294091 | 264 |
| 673 | 3300005439 | Ga0070711_100011045 | Ga0070711_1000110455 | 264 |
| 674 | 3300005439 | Ga0070711_100017968 | Ga0070711_1000179683 | 264 |
| 675 | 3300005439 | Ga0070711_100072221 | Ga0070711_1000722213 | 264 |
| 676 | 3300005439 | Ga0070711_100474838 | Ga0070711_1004748381 | 264 |
| 677 | 3300005441 | Ga0070700_100377799 | Ga0070700_1003777992 | 264 |
| 678 | 3300005444 | Ga0070694_100090188 | Ga0070694_1000901882 | 264 |
| 679 | 3300005455 | Ga0070663_100028641 | Ga0070663_1000286412 | 264 |
| 680 | 3300005455 | Ga0070663_100053700 | Ga0070663_1000537002 | 264 |
| 681 | 3300005455 | Ga0070663_100064496 | Ga0070663_1000644963 | 264 |
| 682 | 3300005455 | Ga0070663_100116012 | Ga0070663_1001160122 | 264 |
| 683 | 3300005455 | Ga0070663_100174049 | Ga0070663_1001740492 | 264 |
| 684 | 3300005455 | Ga0070663_100201513 | Ga0070663_1002015132 | 264 |
| 685 | 3300005456 | Ga0070678_100194755 | Ga0070678_1001947552 | 264 |
| 686 | 3300005456 | Ga0070678_100535655 | Ga0070678_1005356552 | 264 |
| 687 | 3300005456 | Ga0070678_100657486 | Ga0070678_1006574861 | 264 |
| 688 | 3300005457 | Ga0070662_100314515 | Ga0070662_1003145151 | 264 |
| 689 | 3300005457 | Ga0070662_100519827 | Ga0070662_1005198271 | 264 |
| 690 | 3300005458 | Ga0070681_10025960 | Ga0070681_100259603 | 264 |
| 691 | 3300005458 | Ga0070681_10067612 | Ga0070681_100676122 | 264 |
| 692 | 3300005458 | Ga0070681_10110722 | Ga0070681_101107222 | 264 |
| 693 | 3300005459 | Ga0068867_100337474 | Ga0068867_1003374741 | 264 |
| 694 | 3300005468 | Ga0070707_100410737 | Ga0070707_1004107372 | 264 |
| 695 | 3300005471 | Ga0070698_100451188 | Ga0070698_1004511882 | 264 |
| 696 | 3300005530 | Ga0070679_100088998 | Ga0070679_1000889982 | 264 |
| 697 | 3300005535 | Ga0070684_100043666 | Ga0070684_1000436662 | 264 |
| 698 | 3300005535 | Ga0070684_100073039 | Ga0070684_1000730393 | 264 |
| 699 | 3300005535 | Ga0070684_100159351 | Ga0070684_1001593512 | 264 |
| 700 | 3300005539 | Ga0068853_100025481 | Ga0068853_1000254812 | 264 |
| 701 | 3300005539 | Ga0068853_100145661 | Ga0068853_1001456612 | 264 |
| 702 | 3300005539 | Ga0068853_100234307 | Ga0068853_1002343072 | 264 |
| 703 | 3300005539 | Ga0068853_100415666 | Ga0068853_1004156662 | 264 |
| 704 | 3300005539 | Ga0068853_100468896 | Ga0068853_1004688961 | 264 |
| 705 | 3300005544 | Ga0070686_100209330 | Ga0070686_1002093302 | 264 |
| 706 | 3300005545 | Ga0070695_100326559 | Ga0070695_1003265591 | 264 |
| 707 | 3300005548 | Ga0070665_100017685 | Ga0070665_1000176855 | 264 |
| 708 | 3300005548 | Ga0070665_100060033 | Ga0070665_1000600333 | 264 |
| 709 | 3300005548 | Ga0070665_100069146 | Ga0070665_1000691462 | 264 |
| 710 | 3300005548 | Ga0070665_100093763 | Ga0070665_1000937632 | 264 |
| 711 | 3300005548 | Ga0070665_100108386 | Ga0070665_1001083862 | 264 |
| 712 | 3300005548 | Ga0070665_100371142 | Ga0070665_1003711421 | 264 |
| 713 | 3300005548 | Ga0070665_101015425 | Ga0070665_1010154251 | 264 |
| 714 | 3300005563 | Ga0068855_100076020 | Ga0068855_1000760204 | 264 |
| 715 | 3300005563 | Ga0068855_100265765 | Ga0068855_1002657652 | 264 |
| 716 | 3300005564 | Ga0070664_100147623 | Ga0070664_1001476232 | 264 |
| 717 | 3300005577 | Ga0068857_100136152 | Ga0068857_1001361522 | 264 |
| 718 | 3300005577 | Ga0068857_100449258 | Ga0068857_1004492581 | 264 |
| 719 | 3300005578 | Ga0068854_100256004 | Ga0068854_1002560041 | 264 |
| 720 | 3300005578 | Ga0068854_100346474 | Ga0068854_1003464742 | 264 |
| 721 | 3300005614 | Ga0068856_100001018 | Ga0068856_1000010183 | 264 |
| 722 | 3300005614 | Ga0068856_100040360 | Ga0068856_1000403602 | 264 |
| 723 | 3300005614 | Ga0068856_100089449 | Ga0068856_1000894493 | 264 |
| 724 | 3300005614 | Ga0068856_100825474 | Ga0068856_1008254741 | 264 |
| 725 | 3300005615 | Ga0070702_100068032 | Ga0070702_1000680322 | 264 |
| 726 | 3300005615 | Ga0070702_100102440 | Ga0070702_1001024402 | 264 |
| 727 | 3300005617 | Ga0068859_100177742 | Ga0068859_1001777422 | 264 |
| 728 | 3300005617 | Ga0068859_100311569 | Ga0068859_1003115692 | 264 |
| 729 | 3300005618 | Ga0068864_100148009 | Ga0068864_1001480092 | 264 |
| 730 | 3300005618 | Ga0068864_100638465 | Ga0068864_1006384651 | 264 |
| 731 | 3300005718 | Ga0068866_10161301 | Ga0068866_101613012 | 264 |
| 732 | 3300005719 | Ga0068861_100164249 | Ga0068861_1001642492 | 264 |
| 733 | 3300005719 | Ga0068861_100178058 | Ga0068861_1001780582 | 264 |
| 734 | 3300005719 | Ga0068861_100344242 | Ga0068861_1003442422 | 264 |
| 735 | 3300005834 | Ga0068851_10017811 | Ga0068851_100178112 | 264 |
| 736 | 3300005834 | Ga0068851_10086532 | Ga0068851_100865322 | 264 |
| 737 | 3300005840 | Ga0068870_10114426 | Ga0068870_101144261 | 264 |
| 738 | 3300005841 | Ga0068863_100213781 | Ga0068863_1002137812 | 264 |
| 739 | 3300005841 | Ga0068863_100223032 | Ga0068863_1002230322 | 264 |
| 740 | 3300005842 | Ga0068858_100201435 | Ga0068858_1002014352 | 264 |
| 741 | 3300005842 | Ga0068858_100316992 | Ga0068858_1003169922 | 264 |
| 742 | 3300005842 | Ga0068858_100443978 | Ga0068858_1004439782 | 264 |
| 743 | 3300005842 | Ga0068858_100681473 | Ga0068858_1006814731 | 264 |
| 744 | 3300005843 | Ga0068860_100141656 | Ga0068860_1001416562 | 264 |
| 745 | 3300005843 | Ga0068860_100251682 | Ga0068860_1002516821 | 264 |
| 746 | 3300005843 | Ga0068860_100296194 | Ga0068860_1002961942 | 264 |
| 747 | 3300005843 | Ga0068860_100432860 | Ga0068860_1004328601 | 264 |
| 748 | 3300005844 | Ga0068862_100080359 | Ga0068862_1000803592 | 264 |
| 749 | 3300005844 | Ga0068862_100252887 | Ga0068862_1002528872 | 264 |
| 750 | 3300005937 | Ga0081455_10003561 | Ga0081455_1000356113 | 264 |
| 751 | 3300005981 | Ga0081538_10055588 | Ga0081538_100555882 | 264 |
| 752 | 3300005983 | Ga0081540_1005331 | Ga0081540_10053316 | 264 |
| 753 | 3300005983 | Ga0081540_1013508 | Ga0081540_10135081 | 264 |
| 754 | 3300005983 | Ga0081540_1014693 | Ga0081540_10146932 | 264 |
| 755 | 3300005983 | Ga0081540_1019069 | Ga0081540_10190692 | 264 |
| 756 | 3300005983 | Ga0081540_1028921 | Ga0081540_10289212 | 264 |
| 757 | 3300005983 | Ga0081540_1032545 | Ga0081540_10325452 | 264 |
| 758 | 3300005983 | Ga0081540_1056129 | Ga0081540_10561292 | 264 |
| 759 | 3300005983 | Ga0081540_1070922 | Ga0081540_10709222 | 264 |
| 760 | 3300005985 | Ga0081539_10026237 | Ga0081539_100262372 | 264 |
| 761 | 3300005985 | Ga0081539_10057638 | Ga0081539_100576382 | 264 |
| 762 | 3300005985 | Ga0081539_10064672 | Ga0081539_100646722 | 264 |
| 763 | 3300006028 | Ga0070717_10006670 | Ga0070717_100066706 | 264 |
| 764 | 3300006028 | Ga0070717_10027722 | Ga0070717_100277222 | 264 |
| 765 | 3300006028 | Ga0070717_10110440 | Ga0070717_101104402 | 264 |
| 766 | 3300006028 | Ga0070717_10244962 | Ga0070717_102449621 | 264 |
| 767 | 3300006028 | Ga0070717_10273074 | Ga0070717_102730742 | 264 |
| 768 | 3300006028 | Ga0070717_10587822 | Ga0070717_105878221 | 264 |
| 769 | 3300006038 | Ga0075365_10025909 | Ga0075365_100259092 | 264 |
| 770 | 3300006038 | Ga0075365_10077522 | Ga0075365_100775222 | 264 |
| 771 | 3300006038 | Ga0075365_10089110 | Ga0075365_100891102 | 264 |
| 772 | 3300006038 | Ga0075365_10172366 | Ga0075365_101723662 | 264 |
| 773 | 3300006038 | Ga0075365_10178126 | Ga0075365_101781262 | 264 |
| 774 | 3300006038 | Ga0075365_10194265 | Ga0075365_101942652 | 264 |
| 775 | 3300006038 | Ga0075365_10267683 | Ga0075365_102676832 | 264 |
| 776 | 3300006038 | Ga0075365_10298190 | Ga0075365_102981901 | 264 |
| 777 | 3300006042 | Ga0075368_10051186 | Ga0075368_100511862 | 264 |
| 778 | 3300006048 | Ga0075363_100041314 | Ga0075363_1000413142 | 264 |
| 779 | 3300006048 | Ga0075363_100102939 | Ga0075363_1001029392 | 264 |
| 780 | 3300006051 | Ga0075364_10076031 | Ga0075364_100760312 | 264 |
| 781 | 3300006051 | Ga0075364_10122346 | Ga0075364_101223462 | 264 |
| 782 | 3300006051 | Ga0075364_10167290 | Ga0075364_101672903 | 264 |
| 783 | 3300006051 | Ga0075364_10243882 | Ga0075364_102438822 | 264 |
| 784 | 3300006163 | Ga0070715_10000692 | Ga0070715_100006925 | 264 |
| 785 | 3300006163 | Ga0070715_10070033 | Ga0070715_100700332 | 264 |
| 786 | 3300006173 | Ga0070716_100047440 | Ga0070716_1000474401 | 264 |
| 787 | 3300006175 | Ga0070712_100002905 | Ga0070712_1000029054 | 264 |
| 788 | 3300006177 | Ga0075362_10052402 | Ga0075362_100524022 | 264 |
| 789 | 3300006178 | Ga0075367_10024247 | Ga0075367_100242472 | 264 |
| 790 | 3300006178 | Ga0075367_10073144 | Ga0075367_100731442 | 264 |
| 791 | 3300006178 | Ga0075367_10078112 | Ga0075367_100781122 | 264 |
| 792 | 3300006178 | Ga0075367_10107392 | Ga0075367_101073922 | 264 |
| 793 | 3300006178 | Ga0075367_10207318 | Ga0075367_102073181 | 264 |
| 794 | 3300006186 | Ga0075369_10044746 | Ga0075369_100447462 | 264 |
| 795 | 3300006195 | Ga0075366_10103637 | Ga0075366_101036372 | 264 |
| 796 | 3300006195 | Ga0075366_10117966 | Ga0075366_101179661 | 264 |
| 797 | 3300006195 | Ga0075366_10244598 | Ga0075366_102445981 | 264 |
| 798 | 3300006237 | Ga0097621_100203993 | Ga0097621_1002039932 | 264 |
| 799 | 3300006237 | Ga0097621_100276226 | Ga0097621_1002762262 | 264 |
| 800 | 3300006237 | Ga0097621_100401247 | Ga0097621_1004012471 | 264 |
| 801 | 3300006353 | Ga0075370_10075364 | Ga0075370_100753641 | 264 |
| 802 | 3300006358 | Ga0068871_100033813 | Ga0068871_1000338133 | 264 |
| 803 | 3300006358 | Ga0068871_100154445 | Ga0068871_1001544452 | 264 |
| 804 | 3300006847 | Ga0075431_100355593 | Ga0075431_1003555931 | 264 |
| 805 | 3300006871 | Ga0075434_100015658 | Ga0075434_1000156582 | 264 |
| 806 | 3300006881 | Ga0068865_100170632 | Ga0068865_1001706322 | 264 |
| 807 | 3300006881 | Ga0068865_100417125 | Ga0068865_1004171252 | 264 |
| 808 | 3300006914 | Ga0075436_100152439 | Ga0075436_1001524392 | 264 |
| 809 | 3300006931 | Ga0097620_100177750 | Ga0097620_1001777501 | 264 |
| 810 | 3300006931 | Ga0097620_100311572 | Ga0097620_1003115722 | 264 |
| 811 | 3300006943 | Ga0099822_1024801 | Ga0099822_10248012 | 264 |
| 812 | 3300007076 | Ga0075435_100193617 | Ga0075435_1001936172 | 264 |
| 813 | 3300007265 | Ga0099794_10028369 | Ga0099794_100283692 | 264 |
| 814 | 3300007265 | Ga0099794_10089968 | Ga0099794_100899682 | 264 |
| 815 | 3300007265 | Ga0099794_10092687 | Ga0099794_100926872 | 264 |
| 816 | 3300007788 | Ga0099795_10034742 | Ga0099795_100347422 | 264 |
| 817 | 3300007788 | Ga0099795_10039452 | Ga0099795_100394522 | 264 |
| 818 | 3300009092 | Ga0105250_10143620 | Ga0105250_101436201 | 264 |
| 819 | 3300009093 | Ga0105240_10152375 | Ga0105240_101523752 | 264 |
| 820 | 3300009093 | Ga0105240_10669412 | Ga0105240_106694121 | 264 |
| 821 | 3300009094 | Ga0111539_10119914 | Ga0111539_101199142 | 264 |
| 822 | 3300009094 | Ga0111539_10403435 | Ga0111539_104034352 | 264 |
| 823 | 3300009098 | Ga0105245_10027097 | Ga0105245_100270973 | 264 |
| 824 | 3300009098 | Ga0105245_10158408 | Ga0105245_101584081 | 264 |
| 825 | 3300009098 | Ga0105245_10362223 | Ga0105245_103622232 | 264 |
| 826 | 3300009101 | Ga0105247_10056060 | Ga0105247_100560602 | 264 |
| 827 | 3300009101 | Ga0105247_10099147 | Ga0105247_100991472 | 264 |
| 828 | 3300009101 | Ga0105247_10209355 | Ga0105247_102093552 | 264 |
| 829 | 3300009101 | Ga0105247_10229794 | Ga0105247_102297942 | 264 |
| 830 | 3300009101 | Ga0105247_10259585 | Ga0105247_102595851 | 264 |
| 831 | 3300009147 | Ga0114129_10653701 | Ga0114129_106537012 | 264 |
| 832 | 3300009148 | Ga0105243_10071509 | Ga0105243_100715093 | 264 |
| 833 | 3300009148 | Ga0105243_10221113 | Ga0105243_102211132 | 264 |
| 834 | 3300009174 | Ga0105241_10050885 | Ga0105241_100508852 | 264 |
| 835 | 3300009174 | Ga0105241_10085698 | Ga0105241_100856982 | 264 |
| 836 | 3300009174 | Ga0105241_10456516 | Ga0105241_104565161 | 264 |
| 837 | 3300009176 | Ga0105242_10138748 | Ga0105242_101387482 | 264 |
| 838 | 3300009177 | Ga0105248_10046836 | Ga0105248_100468366 | 264 |
| 839 | 3300009177 | Ga0105248_10057103 | Ga0105248_100571033 | 264 |
| 840 | 3300009177 | Ga0105248_10133843 | Ga0105248_101338431 | 264 |
| 841 | 3300009177 | Ga0105248_10433820 | Ga0105248_104338202 | 264 |
| 842 | 3300009545 | Ga0105237_10068946 | Ga0105237_100689463 | 264 |
| 843 | 3300009545 | Ga0105237_10138669 | Ga0105237_101386692 | 264 |
| 844 | 3300009545 | Ga0105237_10212444 | Ga0105237_102124442 | 264 |
| 845 | 3300009545 | Ga0105237_10342503 | Ga0105237_103425032 | 264 |
| 846 | 3300009551 | Ga0105238_10003574 | Ga0105238_1000357413 | 264 |
| 847 | 3300009551 | Ga0105238_10078604 | Ga0105238_100786043 | 264 |
| 848 | 3300009551 | Ga0105238_10079172 | Ga0105238_100791723 | 264 |
| 849 | 3300009551 | Ga0105238_10173018 | Ga0105238_101730182 | 264 |
| 850 | 3300009551 | Ga0105238_10469780 | Ga0105238_104697802 | 264 |
| 851 | 3300009551 | Ga0105238_10604499 | Ga0105238_106044992 | 264 |
| 852 | 3300009553 | Ga0105249_10369740 | Ga0105249_103697402 | 264 |
| 853 | 3300010159 | Ga0099796_10039618 | Ga0099796_100396182 | 264 |
| 854 | 3300010159 | Ga0099796_10041721 | Ga0099796_100417212 | 264 |
| 855 | 3300010375 | Ga0105239_10073781 | Ga0105239_100737812 | 264 |
| 856 | 3300010375 | Ga0105239_10107432 | Ga0105239_101074322 | 264 |
| 857 | 3300010375 | Ga0105239_10131733 | Ga0105239_101317332 | 264 |
| 858 | 3300010375 | Ga0105239_10150962 | Ga0105239_101509622 | 264 |
| 859 | 3300010375 | Ga0105239_10250822 | Ga0105239_102508222 | 264 |
| 860 | 3300011119 | Ga0105246_10023203 | Ga0105246_100232032 | 264 |
| 861 | 3300011119 | Ga0105246_10459867 | Ga0105246_104598671 | 264 |
| 862 | 3300011119 | Ga0105246_10547430 | Ga0105246_105474301 | 264 |
| 863 | 3300013104 | Ga0157370_10073863 | Ga0157370_100738633 | 264 |
| 864 | 3300013104 | Ga0157370_10166258 | Ga0157370_101662582 | 264 |
| 865 | 3300013104 | Ga0157370_10377581 | Ga0157370_103775812 | 264 |
| 866 | 3300013105 | Ga0157369_10037979 | Ga0157369_100379796 | 264 |
| 867 | 3300013105 | Ga0157369_10049861 | Ga0157369_100498612 | 264 |
| 868 | 3300013297 | Ga0157378_10014732 | Ga0157378_100147326 | 264 |
| 869 | 3300013297 | Ga0157378_10733818 | Ga0157378_107338181 | 264 |
| 870 | 3300013297 | Ga0157378_10883591 | Ga0157378_108835912 | 264 |
| 871 | 3300013306 | Ga0163162_10207638 | Ga0163162_102076382 | 264 |
| 872 | 3300013307 | Ga0157372_10523485 | Ga0157372_105234852 | 264 |
| 873 | 3300013307 | Ga0157372_10657929 | Ga0157372_106579292 | 264 |
| 874 | 3300013308 | Ga0157375_10049447 | Ga0157375_100494473 | 264 |
| 875 | 3300013308 | Ga0157375_10455632 | Ga0157375_104556321 | 264 |
| 876 | 3300014325 | Ga0163163_10062000 | Ga0163163_100620003 | 264 |
| 877 | 3300014325 | Ga0163163_10110182 | Ga0163163_101101822 | 264 |
| 878 | 3300014325 | Ga0163163_10260852 | Ga0163163_102608522 | 264 |
| 879 | 3300014325 | Ga0163163_10477607 | Ga0163163_104776071 | 264 |
| 880 | 3300014325 | Ga0163163_10507350 | Ga0163163_105073501 | 264 |
| 881 | 3300014325 | Ga0163163_10540552 | Ga0163163_105405522 | 264 |
| 882 | 3300014325 | Ga0163163_10625360 | Ga0163163_106253601 | 264 |
| 883 | 3300014326 | Ga0157380_10073085 | Ga0157380_100730851 | 264 |
| 884 | 3300014326 | Ga0157380_10134433 | Ga0157380_101344332 | 264 |
| 885 | 3300014326 | Ga0157380_10523710 | Ga0157380_105237102 | 264 |
| 886 | 3300014968 | Ga0157379_10094448 | Ga0157379_100944483 | 264 |
| 887 | 3300014968 | Ga0157379_10102294 | Ga0157379_101022942 | 264 |
| 888 | 3300014969 | Ga0157376_10103182 | Ga0157376_101031822 | 264 |
| 889 | 3300014969 | Ga0157376_10128319 | Ga0157376_101283192 | 264 |
| 890 | 3300014969 | Ga0157376_10175821 | Ga0157376_101758212 | 264 |
| 891 | 3300014969 | Ga0157376_10671345 | Ga0157376_106713451 | 264 |
| 892 | 3300014969 | Ga0157376_10671697 | Ga0157376_106716971 | 264 |
| 893 | 3300020078 | Ga0206352_10327112 | Ga0206352_103271122 | 264 |
| 894 | 3300020082 | Ga0206353_10360498 | Ga0206353_103604982 | 264 |
| 895 | 3300021358 | Ga0213873_10048796 | Ga0213873_100487961 | 264 |
| 896 | 3300021361 | Ga0213872_10035151 | Ga0213872_100351512 | 264 |
| 897 | 3300021384 | Ga0213876_10000379 | Ga0213876_1000037940 | 264 |
| 898 | 3300021384 | Ga0213876_10027975 | Ga0213876_100279752 | 264 |
| 899 | 3300021384 | Ga0213876_10060856 | Ga0213876_100608562 | 264 |
| 900 | 3300021388 | Ga0213875_10058079 | Ga0213875_100580792 | 264 |
| 901 | 3300021441 | Ga0213871_10012844 | Ga0213871_100128442 | 264 |
| 902 | 3300022467 | Ga0224712_10068820 | Ga0224712_100688202 | 264 |
| 903 | 3300025230 | Ga0209563_100900 | Ga0209563_1009002 | 264 |
| 904 | 3300025253 | Ga0209677_100589 | Ga0209677_1005897 | 264 |
| 905 | 3300025253 | Ga0209677_100686 | Ga0209677_1006864 | 264 |
| 906 | 3300025254 | Ga0209148_1000192 | Ga0209148_100019283 | 264 |
| 907 | 3300025261 | Ga0209233_1030385 | Ga0209233_10303851 | 264 |
| 908 | 3300025272 | Ga0209455_1000892 | Ga0209455_10008924 | 264 |
| 909 | 3300025272 | Ga0209455_1008942 | Ga0209455_10089424 | 264 |
| 910 | 3300025297 | Ga0209758_1000030 | Ga0209758_100003096 | 264 |
| 911 | 3300025297 | Ga0209758_1000963 | Ga0209758_10009632 | 264 |
| 912 | 3300025297 | Ga0209758_1001374 | Ga0209758_100137420 | 264 |
| 913 | 3300025297 | Ga0209758_1002971 | Ga0209758_100297112 | 264 |
| 914 | 3300025297 | Ga0209758_1006840 | Ga0209758_10068407 | 264 |
| 915 | 3300025297 | Ga0209758_1056005 | Ga0209758_10560051 | 264 |
| 916 | 3300025299 | Ga0209256_1007102 | Ga0209256_10071022 | 264 |
| 917 | 3300025302 | Ga0207426_1002230 | Ga0207426_100223014 | 264 |
| 918 | 3300025302 | Ga0207426_1045987 | Ga0207426_10459871 | 264 |
| 919 | 3300025302 | Ga0207426_1049336 | Ga0207426_10493362 | 264 |
| 920 | 3300025303 | Ga0209051_1040948 | Ga0209051_10409482 | 264 |
| 921 | 3300025304 | Ga0209257_1000778 | Ga0209257_10007782 | 264 |
| 922 | 3300025321 | Ga0207656_10249198 | Ga0207656_102491981 | 264 |
| 923 | 3300025898 | Ga0207692_10001095 | Ga0207692_1000109510 | 264 |
| 924 | 3300025898 | Ga0207692_10001486 | Ga0207692_100014868 | 264 |
| 925 | 3300025898 | Ga0207692_10019848 | Ga0207692_100198482 | 264 |
| 926 | 3300025898 | Ga0207692_10083894 | Ga0207692_100838942 | 264 |
| 927 | 3300025898 | Ga0207692_10150991 | Ga0207692_101509912 | 264 |
| 928 | 3300025900 | Ga0207710_10031359 | Ga0207710_100313592 | 264 |
| 929 | 3300025900 | Ga0207710_10049449 | Ga0207710_100494492 | 264 |
| 930 | 3300025900 | Ga0207710_10056106 | Ga0207710_100561062 | 264 |
| 931 | 3300025903 | Ga0207680_10159343 | Ga0207680_101593432 | 264 |
| 932 | 3300025905 | Ga0207685_10006479 | Ga0207685_100064792 | 264 |
| 933 | 3300025906 | Ga0207699_10003048 | Ga0207699_100030485 | 264 |
| 934 | 3300025906 | Ga0207699_10024107 | Ga0207699_100241072 | 264 |
| 935 | 3300025906 | Ga0207699_10082251 | Ga0207699_100822512 | 264 |
| 936 | 3300025906 | Ga0207699_10101524 | Ga0207699_101015241 | 264 |
| 937 | 3300025908 | Ga0207643_10174427 | Ga0207643_101744271 | 264 |
| 938 | 3300025908 | Ga0207643_10269159 | Ga0207643_102691592 | 264 |
| 939 | 3300025909 | Ga0207705_10046628 | Ga0207705_100466282 | 264 |
| 940 | 3300025910 | Ga0207684_10262757 | Ga0207684_102627572 | 264 |
| 941 | 3300025911 | Ga0207654_10047597 | Ga0207654_100475972 | 264 |
| 942 | 3300025911 | Ga0207654_10182504 | Ga0207654_101825042 | 264 |
| 943 | 3300025912 | Ga0207707_10327035 | Ga0207707_103270352 | 264 |
| 944 | 3300025914 | Ga0207671_10126097 | Ga0207671_101260972 | 264 |
| 945 | 3300025915 | Ga0207693_10002846 | Ga0207693_1000284610 | 264 |
| 946 | 3300025915 | Ga0207693_10002989 | Ga0207693_100029894 | 264 |
| 947 | 3300025915 | Ga0207693_10054373 | Ga0207693_100543732 | 264 |
| 948 | 3300025915 | Ga0207693_10328824 | Ga0207693_103288241 | 264 |
| 949 | 3300025916 | Ga0207663_10030130 | Ga0207663_100301302 | 264 |
| 950 | 3300025916 | Ga0207663_10108560 | Ga0207663_101085602 | 264 |
| 951 | 3300025917 | Ga0207660_10016173 | Ga0207660_100161733 | 264 |
| 952 | 3300025917 | Ga0207660_10128437 | Ga0207660_101284372 | 264 |
| 953 | 3300025919 | Ga0207657_10003421 | Ga0207657_100034213 | 264 |
| 954 | 3300025919 | Ga0207657_10033247 | Ga0207657_100332472 | 264 |
| 955 | 3300025920 | Ga0207649_10078949 | Ga0207649_100789492 | 264 |
| 956 | 3300025921 | Ga0207652_10016392 | Ga0207652_100163925 | 264 |
| 957 | 3300025921 | Ga0207652_10049462 | Ga0207652_100494621 | 264 |
| 958 | 3300025921 | Ga0207652_10246762 | Ga0207652_102467622 | 264 |
| 959 | 3300025921 | Ga0207652_10496463 | Ga0207652_104964631 | 264 |
| 960 | 3300025922 | Ga0207646_10186796 | Ga0207646_101867962 | 264 |
| 961 | 3300025923 | Ga0207681_10352857 | Ga0207681_103528571 | 264 |
| 962 | 3300025923 | Ga0207681_10379656 | Ga0207681_103796562 | 264 |
| 963 | 3300025923 | Ga0207681_10500556 | Ga0207681_105005562 | 264 |
| 964 | 3300025924 | Ga0207694_10015922 | Ga0207694_100159223 | 264 |
| 965 | 3300025924 | Ga0207694_10219180 | Ga0207694_102191802 | 264 |
| 966 | 3300025924 | Ga0207694_10373878 | Ga0207694_103738781 | 264 |
| 967 | 3300025925 | Ga0207650_10429883 | Ga0207650_104298831 | 264 |
| 968 | 3300025926 | Ga0207659_10552773 | Ga0207659_105527731 | 264 |
| 969 | 3300025927 | Ga0207687_10015988 | Ga0207687_100159882 | 264 |
| 970 | 3300025927 | Ga0207687_10053389 | Ga0207687_100533892 | 264 |
| 971 | 3300025927 | Ga0207687_10240022 | Ga0207687_102400222 | 264 |
| 972 | 3300025928 | Ga0207700_10037283 | Ga0207700_100372833 | 264 |
| 973 | 3300025928 | Ga0207700_10050229 | Ga0207700_100502294 | 264 |
| 974 | 3300025928 | Ga0207700_10165803 | Ga0207700_101658032 | 264 |
| 975 | 3300025929 | Ga0207664_10014503 | Ga0207664_100145032 | 264 |
| 976 | 3300025929 | Ga0207664_10143538 | Ga0207664_101435382 | 264 |
| 977 | 3300025932 | Ga0207690_10477970 | Ga0207690_104779701 | 264 |
| 978 | 3300025933 | Ga0207706_10040481 | Ga0207706_100404811 | 264 |
| 979 | 3300025933 | Ga0207706_10152726 | Ga0207706_101527262 | 264 |
| 980 | 3300025933 | Ga0207706_10155994 | Ga0207706_101559942 | 264 |
| 981 | 3300025934 | Ga0207686_10045445 | Ga0207686_100454452 | 264 |
| 982 | 3300025935 | Ga0207709_10043282 | Ga0207709_100432823 | 264 |
| 983 | 3300025937 | Ga0207669_10006847 | Ga0207669_100068474 | 264 |
| 984 | 3300025937 | Ga0207669_10116476 | Ga0207669_101164762 | 264 |
| 985 | 3300025938 | Ga0207704_10248610 | Ga0207704_102486101 | 264 |
| 986 | 3300025938 | Ga0207704_10348784 | Ga0207704_103487842 | 264 |
| 987 | 3300025939 | Ga0207665_10001253 | Ga0207665_100012536 | 264 |
| 988 | 3300025939 | Ga0207665_10013855 | Ga0207665_100138552 | 264 |
| 989 | 3300025939 | Ga0207665_10069404 | Ga0207665_100694041 | 264 |
| 990 | 3300025939 | Ga0207665_10111687 | Ga0207665_101116871 | 264 |
| 991 | 3300025939 | Ga0207665_10121463 | Ga0207665_101214632 | 264 |
| 992 | 3300025939 | Ga0207665_10139468 | Ga0207665_101394682 | 264 |
| 993 | 3300025939 | Ga0207665_10532829 | Ga0207665_105328292 | 264 |
| 994 | 3300025940 | Ga0207691_10207495 | Ga0207691_102074952 | 264 |
| 995 | 3300025941 | Ga0207711_10049144 | Ga0207711_100491442 | 264 |
| 996 | 3300025941 | Ga0207711_10254340 | Ga0207711_102543401 | 264 |
| 997 | 3300025941 | Ga0207711_10439987 | Ga0207711_104399872 | 264 |
| 998 | 3300025942 | Ga0207689_10204450 | Ga0207689_102044502 | 264 |
| 999 | 3300025942 | Ga0207689_10649328 | Ga0207689_106493281 | 264 |
| 1000 | 3300025944 | Ga0207661_10001342 | Ga0207661_100013423 | 264 |
| 1001 | 3300025949 | Ga0207667_10023451 | Ga0207667_100234515 | 264 |
| 1002 | 3300025949 | Ga0207667_10296839 | Ga0207667_102968392 | 264 |
| 1003 | 3300025949 | Ga0207667_10720176 | Ga0207667_107201761 | 264 |
| 1004 | 3300025960 | Ga0207651_10180529 | Ga0207651_101805292 | 264 |
| 1005 | 3300025960 | Ga0207651_10472116 | Ga0207651_104721161 | 264 |
| 1006 | 3300025961 | Ga0207712_10625430 | Ga0207712_106254302 | 264 |
| 1007 | 3300025972 | Ga0207668_10004124 | Ga0207668_100041247 | 264 |
| 1008 | 3300025972 | Ga0207668_10123496 | Ga0207668_101234962 | 264 |
| 1009 | 3300025972 | Ga0207668_10212140 | Ga0207668_102121402 | 264 |
| 1010 | 3300025972 | Ga0207668_10228602 | Ga0207668_102286022 | 264 |
| 1011 | 3300025981 | Ga0207640_10123629 | Ga0207640_101236292 | 264 |
| 1012 | 3300026023 | Ga0207677_10022538 | Ga0207677_100225383 | 264 |
| 1013 | 3300026023 | Ga0207677_10066679 | Ga0207677_100666792 | 264 |
| 1014 | 3300026035 | Ga0207703_10276266 | Ga0207703_102762662 | 264 |
| 1015 | 3300026041 | Ga0207639_10001314 | Ga0207639_100013141 | 264 |
| 1016 | 3300026041 | Ga0207639_10128686 | Ga0207639_101286862 | 264 |
| 1017 | 3300026041 | Ga0207639_10215547 | Ga0207639_102155472 | 264 |
| 1018 | 3300026041 | Ga0207639_10309103 | Ga0207639_103091032 | 264 |
| 1019 | 3300026067 | Ga0207678_10049702 | Ga0207678_100497022 | 264 |
| 1020 | 3300026067 | Ga0207678_10050540 | Ga0207678_100505401 | 264 |
| 1021 | 3300026067 | Ga0207678_10056281 | Ga0207678_100562812 | 264 |
| 1022 | 3300026067 | Ga0207678_10107910 | Ga0207678_101079102 | 264 |
| 1023 | 3300026067 | Ga0207678_10151225 | Ga0207678_101512252 | 264 |
| 1024 | 3300026067 | Ga0207678_10161436 | Ga0207678_101614362 | 264 |
| 1025 | 3300026067 | Ga0207678_10178825 | Ga0207678_101788252 | 264 |
| 1026 | 3300026067 | Ga0207678_10269903 | Ga0207678_102699032 | 264 |
| 1027 | 3300026075 | Ga0207708_10302338 | Ga0207708_103023382 | 264 |
| 1028 | 3300026078 | Ga0207702_10000589 | Ga0207702_1000058924 | 264 |
| 1029 | 3300026078 | Ga0207702_10561532 | Ga0207702_105615322 | 264 |
| 1030 | 3300026078 | Ga0207702_10596651 | Ga0207702_105966511 | 264 |
| 1031 | 3300026078 | Ga0207702_10696890 | Ga0207702_106968901 | 264 |
| 1032 | 3300026088 | Ga0207641_10115883 | Ga0207641_101158832 | 264 |
| 1033 | 3300026088 | Ga0207641_10494314 | Ga0207641_104943142 | 264 |
| 1034 | 3300026089 | Ga0207648_10115297 | Ga0207648_101152972 | 264 |
| 1035 | 3300026095 | Ga0207676_10092749 | Ga0207676_100927492 | 264 |
| 1036 | 3300026095 | Ga0207676_10366987 | Ga0207676_103669872 | 264 |
| 1037 | 3300026116 | Ga0207674_10005581 | Ga0207674_100055813 | 264 |
| 1038 | 3300026116 | Ga0207674_10434216 | Ga0207674_104342162 | 264 |
| 1039 | 3300026118 | Ga0207675_100011675 | Ga0207675_1000116755 | 264 |
| 1040 | 3300026118 | Ga0207675_100258163 | Ga0207675_1002581632 | 264 |
| 1041 | 3300026121 | Ga0207683_10069852 | Ga0207683_100698523 | 264 |
| 1042 | 3300026121 | Ga0207683_10087590 | Ga0207683_100875902 | 264 |
| 1043 | 3300026121 | Ga0207683_10216350 | Ga0207683_102163502 | 264 |
| 1044 | 3300026121 | Ga0207683_10237500 | Ga0207683_102375002 | 264 |
| 1045 | 3300026142 | Ga0207698_10250937 | Ga0207698_102509372 | 264 |
| 1046 | 3300027357 | Ga0209589_1000017 | Ga0209589_10000172 | 264 |
| 1047 | 3300027361 | Ga0209489_100018 | Ga0209489_1000182 | 264 |
| 1048 | 3300027363 | Ga0209700_100028 | Ga0209700_1000282 | 264 |
| 1049 | 3300027671 | Ga0209588_1064418 | Ga0209588_10644181 | 264 |
| 1050 | 3300027907 | Ga0207428_10057863 | Ga0207428_100578632 | 264 |
| 1051 | 3300028379 | Ga0268266_10003301 | Ga0268266_1000330114 | 264 |
| 1052 | 3300028379 | Ga0268266_10004550 | Ga0268266_100045502 | 264 |
| 1053 | 3300028379 | Ga0268266_10009757 | Ga0268266_100097572 | 264 |
| 1054 | 3300028379 | Ga0268266_10039193 | Ga0268266_100391934 | 264 |
| 1055 | 3300028379 | Ga0268266_10047642 | Ga0268266_100476422 | 264 |
| 1056 | 3300028379 | Ga0268266_10569525 | Ga0268266_105695251 | 264 |
| 1057 | 3300028380 | Ga0268265_10068111 | Ga0268265_100681112 | 264 |
| 1058 | 3300028380 | Ga0268265_10233380 | Ga0268265_102333802 | 264 |
| 1059 | 3300028381 | Ga0268264_10146383 | Ga0268264_101463832 | 264 |
| 1060 | 3300028381 | Ga0268264_10223930 | Ga0268264_102239301 | 264 |
| 1061 | 3300028381 | Ga0268264_10444787 | Ga0268264_104447871 | 264 |
| 1062 | 3300028558 | Ga0265326_10024038 | Ga0265326_100240381 | 264 |
| 1063 | 3300028563 | Ga0265319_1001409 | Ga0265319_100140913 | 264 |
| 1064 | 3300028573 | Ga0265334_10001624 | Ga0265334_100016248 | 264 |
| 1065 | 3300028577 | Ga0265318_10006240 | Ga0265318_100062402 | 264 |
| 1066 | 3300028653 | Ga0265323_10000684 | Ga0265323_1000068410 | 264 |
| 1067 | 3300028666 | Ga0265336_10000459 | Ga0265336_1000045913 | 264 |
| 1068 | 3300028786 | Ga0307517_10002574 | Ga0307517_100025747 | 264 |
| 1069 | 3300028794 | Ga0307515_10027983 | Ga0307515_100279833 | 264 |
| 1070 | 3300028794 | Ga0307515_10101962 | Ga0307515_101019622 | 264 |
| 1071 | 3300028794 | Ga0307515_10318185 | Ga0307515_103181852 | 264 |
| 1072 | 3300028794 | Ga0307515_10319947 | Ga0307515_103199472 | 264 |
| 1073 | 3300028800 | Ga0265338_10002741 | Ga0265338_1000274110 | 264 |
| 1074 | 3300029957 | Ga0265324_10002054 | Ga0265324_100020547 | 264 |
| 1075 | 3300031235 | Ga0265330_10003717 | Ga0265330_100037175 | 264 |
| 1076 | 3300031235 | Ga0265330_10005196 | Ga0265330_100051963 | 264 |
| 1077 | 3300031235 | Ga0265330_10080725 | Ga0265330_100807252 | 264 |
| 1078 | 3300031238 | Ga0265332_10026658 | Ga0265332_100266582 | 264 |
| 1079 | 3300031239 | Ga0265328_10077962 | Ga0265328_100779621 | 264 |
| 1080 | 3300031241 | Ga0265325_10004205 | Ga0265325_100042056 | 264 |
| 1081 | 3300031250 | Ga0265331_10000113 | Ga0265331_1000011369 | 264 |
| 1082 | 3300031344 | Ga0265316_10389572 | Ga0265316_103895721 | 264 |
| 1083 | 3300031456 | Ga0307513_10129649 | Ga0307513_101296492 | 264 |
| 1084 | 3300031456 | Ga0307513_10157467 | Ga0307513_101574672 | 264 |
| 1085 | 3300031507 | Ga0307509_10165598 | Ga0307509_101655981 | 264 |
| 1086 | 3300031616 | Ga0307508_10020956 | Ga0307508_100209564 | 264 |
| 1087 | 3300031616 | Ga0307508_10104174 | Ga0307508_101041741 | 264 |
| 1088 | 3300031711 | Ga0265314_10007930 | Ga0265314_1000793011 | 264 |
| 1089 | 3300031711 | Ga0265314_10167255 | Ga0265314_101672552 | 264 |
| 1090 | 3300031712 | Ga0265342_10021922 | Ga0265342_100219222 | 264 |
| 1091 | 3300031712 | Ga0265342_10037780 | Ga0265342_100377801 | 264 |
| 1092 | 3300031730 | Ga0307516_10204685 | Ga0307516_102046852 | 264 |
| 1093 | 3300031731 | Ga0307405_10215055 | Ga0307405_102150551 | 264 |
| 1094 | 3300031901 | Ga0307406_10422755 | Ga0307406_104227551 | 264 |
| 1095 | 3300031911 | Ga0307412_10242146 | Ga0307412_102421462 | 264 |
| 1096 | 3300031911 | Ga0307412_10256728 | Ga0307412_102567282 | 264 |
| 1097 | 3300031995 | Ga0307409_100019096 | Ga0307409_1000190963 | 264 |
| 1098 | 3300032002 | Ga0307416_100525870 | Ga0307416_1005258702 | 264 |
| 1099 | 3300032002 | Ga0307416_100801905 | Ga0307416_1008019051 | 264 |
| 1100 | 3300032002 | Ga0307416_100992969 | Ga0307416_1009929691 | 264 |
| 1101 | 3300032005 | Ga0307411_10353908 | Ga0307411_103539081 | 264 |
| 1102 | 3300032126 | Ga0307415_100035272 | Ga0307415_1000352723 | 264 |
| 1103 | 3300033179 | Ga0307507_10131484 | Ga0307507_101314842 | 264 |
| 1104 | 3300033179 | Ga0307507_10286597 | Ga0307507_102865971 | 264 |
| 1105 | 3300033180 | Ga0307510_10002191 | Ga0307510_1000219115 | 264 |
| 1106 | 3300033180 | Ga0307510_10005503 | Ga0307510_1000550310 | 264 |
| 1107 | 3300033180 | Ga0307510_10014423 | Ga0307510_100144235 | 264 |
| 1108 | 3300033180 | Ga0307510_10205698 | Ga0307510_102056982 | 264 |
| 1109 | 3300035086 | Ga0373934_0002927 | Ga0373934_0002927_4504_5304 | 264 |
| 1110 | 3300035111 | Ga0373923_0001517 | Ga0373923_0001517_5714_6514 | 264 |
| 1111 | 3300035112 | Ga0373932_0043812 | Ga0373932_0043812_461_1261 | 264 |
| 1112 | 3300035113 | Ga0373936_0003688 | Ga0373936_0003688_4158_4958 | 264 |
| 1113 | 3300035116 | Ga0373945_0026797 | Ga0373945_0026797_516_1316 | 264 |
| 1114 | 3300035116 | Ga0373945_0090801 | Ga0373945_0090801_54_854 | 264 |
| 1115 | 3300035117 | Ga0373953_0002334 | Ga0373953_0002334_902_1702 | 264 |
| 1116 | 3300035117 | Ga0373953_0020514 | Ga0373953_0020514_1627_2427 | 264 |
| 1117 | 3300035117 | Ga0373953_0064608 | Ga0373953_0064608_317_1120 | 264 |
| 1118 | 3300035118 | Ga0373954_0000308 | Ga0373954_0000308_5601_6401 | 264 |
| 1119 | 3300035118 | Ga0373954_0081215 | Ga0373954_0081215_218_1021 | 264 |
| 1120 | 3300035118 | Ga0373954_0188012 | Ga0373954_0188012_133_933 | 264 |
| 1121 | 3300035119 | Ga0373956_0007091 | Ga0373956_0007091_763_1563 | 264 |
| 1122 | 3300035119 | Ga0373956_0024134 | Ga0373956_0024134_919_1719 | 264 |
| 1123 | 3300035120 | Ga0373957_0035099 | Ga0373957_0035099_281_1081 | 264 |
| 1124 | 3300035120 | Ga0373957_0084416 | Ga0373957_0084416_315_1115 | 264 |
| 1125 | 3300035120 | Ga0373957_0099505 | Ga0373957_0099505_180_980 | 264 |
| 1126 | 3300035170 | Ga0373943_0064203 | Ga0373943_0064203_67_867 | 264 |
| 1127 | 3300035172 | Ga0373955_0000479 | Ga0373955_0000479_6691_7491 | 264 |
| 1128 | 3300035172 | Ga0373955_0013850 | Ga0373955_0013850_1363_2166 | 264 |
| 1129 | 3300035172 | Ga0373955_0031548 | Ga0373955_0031548_964_1764 | 264 |
| 1130 | 3300035172 | Ga0373955_0037818 | Ga0373955_0037818_381_1181 | 264 |
| 1131 | 3300035241 | Ga0373961_0040437 | Ga0373961_0040437_326_1126 | 264 |
| 1132 | 3300035410 | Ga0373924_0001372 | Ga0373924_0001372_481_1281 | 264 |
| 1133 | 3300035410 | Ga0373924_0003769 | Ga0373924_0003769_4011_4811 | 264 |
| 1134 | 3300035691 | Ga0373931_0004987 | Ga0373931_0004987_1183_1983 | 264 |
| 1135 | 3300035691 | Ga0373931_0019791 | Ga0373931_0019791_2181_2981 | 264 |
| 1136 | 3300035692 | Ga0373935_0000119 | Ga0373935_0000119_16767_17567 | 264 |
| 1137 | 3300035695 | Ga0373927_0000965 | Ga0373927_0000965_3395_4195 | 264 |
| 1138 | 3300035695 | Ga0373927_0004272 | Ga0373927_0004272_9021_9821 | 264 |
| 1139 | 3300035695 | Ga0373927_0015399 | Ga0373927_0015399_1409_2209 | 264 |
| 1140 | 3300035695 | Ga0373927_0023855 | Ga0373927_0023855_955_1755 | 264 |
| 1141 | 3300035695 | Ga0373927_0059057 | Ga0373927_0059057_1510_2310 | 264 |
| 1142 | 3300035724 | Ga0373933_0001108 | Ga0373933_0001108_4681_5481 | 264 |
| 1143 | 3300035724 | Ga0373933_0001668 | Ga0373933_0001668_11116_11916 | 264 |
| 1144 | 3300035724 | Ga0373933_0100519 | Ga0373933_0100519_270_1070 | 264 |
| 1145 | 3300035725 | Ga0373947_0001785 | Ga0373947_0001785_786_1586 | 264 |
| 1146 | 3300036401 | Ga0373937_0005638 | Ga0373937_0005638_6197_6997 | 264 |
| 1147 | 3300036401 | Ga0373937_0006200 | Ga0373937_0006200_8383_9186 | 264 |
| 1148 | 3300036401 | Ga0373937_0125029 | Ga0373937_0125029_472_1272 | 264 |
| 1149 | 3300036401 | Ga0373937_0192146 | Ga0373937_0192146_330_1130 | 264 |
| 1150 | 3300036401 | Ga0373937_0735686 | Ga0373937_0735686_17_817 | 264 |
| 1151 | 3300037068 | Ga0373925_0022704 | Ga0373925_0022704_581_1381 | 264 |
| 1152 | 3300037068 | Ga0373925_0151490 | Ga0373925_0151490_402_1202 | 264 |
| 1153 | 3300037068 | Ga0373925_0467483 | Ga0373925_0467483_107_907 | 264 |
| 1154 | 3300037312 | Ga0395899_0134752 | Ga0395899_0134752_233_1033 | 264 |
| 1155 | 3300037418 | Ga0395900_0000787 | Ga0395900_0000787_29465_30265 | 264 |
| 1156 | 3300037418 | Ga0395900_0092771 | Ga0395900_0092771_2234_3034 | 264 |
| 1157 | 3300037418 | Ga0395900_0217539 | Ga0395900_0217539_1035_1835 | 264 |
| 1158 | 3300037466 | Ga0395898_0009257 | Ga0395898_0009257_6513_7313 | 264 |
| 1159 | 3300037466 | Ga0395898_0022662 | Ga0395898_0022662_1123_1920 | 264 |
| 1160 | 3300037466 | Ga0395898_0083383 | Ga0395898_0083383_173_973 | 264 |
| 1161 | 3300037466 | Ga0395898_0277124 | Ga0395898_0277124_505_1305 | 264 |
| 1162 | 3300037471 | Ga0395905_0003015 | Ga0395905_0003015_2206_3006 | 264 |
| 1163 | 3300037471 | Ga0395905_0205532 | Ga0395905_0205532_948_1748 | 264 |
| 1164 | 3300037853 | Ga0436364_1247840 | Ga0436364_1247840_559_1359 | 264 |
| 1165 | 3300038443 | Ga0395901_0449065 | Ga0395901_0449065_337_1137 | 264 |
| 1166 | 3300038443 | Ga0395901_0629020 | Ga0395901_0629020_68_868 | 264 |
| 1167 | 3300039437 | Ga0436365_0121548 | Ga0436365_0121548_265_1065 | 264 |
| 1168 | 3300039437 | Ga0436365_0542778 | Ga0436365_0542778_297_1097 | 264 |
| 1169 | 3300039437 | Ga0436365_0736791 | Ga0436365_0736791_50_850 | 264 |
| 1170 | 3300039437 | Ga0436365_0770725 | Ga0436365_0770725_441_1241 | 264 |
| 1171 | 3300039437 | Ga0436365_1093355 | Ga0436365_1093355_809_1609 | 264 |
| 1172 | 3300039437 | Ga0436365_1141460 | Ga0436365_1141460_739_1539 | 264 |
| 1173 | 3300039437 | Ga0436365_1196036 | Ga0436365_1196036_48480_49286 | 264 |
| 1174 | 3300039437 | Ga0436365_1212928 | Ga0436365_1212928_1147_1947 | 264 |
| 1175 | 3300039438 | Ga0436360_0502011 | Ga0436360_0502011_253_1053 | 264 |
| 1176 | 3300039438 | Ga0436360_0799468 | Ga0436360_0799468_287_1087 | 264 |
| 1177 | 3300039438 | Ga0436360_0876230 | Ga0436360_0876230_1040_1840 | 264 |
| 1178 | 3300039438 | Ga0436360_1176238 | Ga0436360_1176238_441_1241 | 264 |
| 1179 | 3300039447 | Ga0436361_0601086 | Ga0436361_0601086_976_1776 | 264 |
| 1180 | 3300039447 | Ga0436361_0628280 | Ga0436361_0628280_892_1692 | 264 |
| 1181 | 3300039450 | Ga0436363_0333985 | Ga0436363_0333985_82_882 | 264 |
| 1182 | 3300039450 | Ga0436363_1379096 | Ga0436363_1379096_178_978 | 264 |
| 1183 | 3300039450 | Ga0436363_1460349 | Ga0436363_1460349_8686_9486 | 264 |
| 1184 | 3300039453 | Ga0436362_0510213 | Ga0436362_0510213_42_842 | 264 |
| 1185 | 3300041413 | Ga0439465_0048330 | Ga0439465_0048330_530_1330 | 264 |
| 1186 | 3300041452 | Ga0451793_0670052 | Ga0451793_0670052_370_1170 | 264 |
| 1187 | 3300041460 | Ga0451802_0602542 | Ga0451802_0602542_217_1017 | 264 |
| 1188 | 3300042157 | Ga0439458_0063069 | Ga0439458_0063069_116_916 | 264 |
| 1189 | 3300044656 | Ga0466969_0035525 | Ga0466969_0035525_851_1651 | 264 |
| 1190 | 3300044658 | Ga0466972_0085742 | Ga0466972_0085742_663_1463 | 264 |
| 1191 | 3300044683 | Ga0466965_0023487 | Ga0466965_0023487_1021_1821 | 264 |
| 1192 | 3300044684 | Ga0466966_0005407 | Ga0466966_0005407_5154_5954 | 264 |
| 1193 | 3300044693 | Ga0466961_0000446 | Ga0466961_0000446_12211_13011 | 264 |
| 1194 | 3300044693 | Ga0466961_0078250 | Ga0466961_0078250_1193_1993 | 264 |
| 1195 | 3300044706 | Ga0466964_0077869 | Ga0466964_0077869_450_1250 | 264 |
| 1196 | 3300044706 | Ga0466964_0242953 | Ga0466964_0242953_64_864 | 264 |
| 1197 | 3300044735 | Ga0466968_0015129 | Ga0466968_0015129_969_1769 | 264 |
| 1198 | 3300044901 | Ga0466960_0087155 | Ga0466960_0087155_709_1509 | 264 |
| 1199 | 3300045049 | Ga0466959_0015178 | Ga0466959_0015178_3611_4411 | 264 |
| 1200 | 3300045049 | Ga0466959_0049485 | Ga0466959_0049485_1556_2356 | 264 |
| 1201 | 3300045976 | Ga0466967_0018622 | Ga0466967_0018622_2916_3716 | 264 |
| 1202 | 3300046452 | Ga0495617_067131 | Ga0495617_067131_211_1011 | 264 |
| 1203 | 3300046454 | Ga0495592_0001710 | Ga0495592_0001710_3670_4470 | 264 |
| 1204 | 3300046454 | Ga0495592_0010188 | Ga0495592_0010188_2256_3056 | 264 |
| 1205 | 3300046454 | Ga0495592_0194101 | Ga0495592_0194101_343_1143 | 264 |
| 1206 | 3300046454 | Ga0495592_0273579 | Ga0495592_0273579_196_996 | 264 |
| 1207 | 3300046455 | Ga0495603_0001895 | Ga0495603_0001895_805_1605 | 264 |
| 1208 | 3300046455 | Ga0495603_0029402 | Ga0495603_0029402_1022_1822 | 264 |
| 1209 | 3300046455 | Ga0495603_0077918 | Ga0495603_0077918_203_1003 | 264 |
| 1210 | 3300046455 | Ga0495603_0101825 | Ga0495603_0101825_154_954 | 264 |
| 1211 | 3300046455 | Ga0495603_0106449 | Ga0495603_0106449_823_1623 | 264 |
| 1212 | 3300046457 | Ga0495590_0058882 | Ga0495590_0058882_261_1061 | 264 |
| 1213 | 3300046459 | Ga0495629_0000348 | Ga0495629_0000348_27310_28110 | 264 |
| 1214 | 3300046459 | Ga0495629_0000353 | Ga0495629_0000353_12732_13532 | 264 |
| 1215 | 3300046459 | Ga0495629_0083140 | Ga0495629_0083140_108_908 | 264 |
| 1216 | 3300046459 | Ga0495629_0100825 | Ga0495629_0100825_326_1126 | 264 |
| 1217 | 3300046459 | Ga0495629_0150241 | Ga0495629_0150241_800_1600 | 264 |
| 1218 | 3300046460 | Ga0495638_0008632 | Ga0495638_0008632_4438_5238 | 264 |
| 1219 | 3300046460 | Ga0495638_0011137 | Ga0495638_0011137_377_1177 | 264 |
| 1220 | 3300046460 | Ga0495638_0015142 | Ga0495638_0015142_2497_3297 | 264 |
| 1221 | 3300046460 | Ga0495638_0215063 | Ga0495638_0215063_56_856 | 264 |
| 1222 | 3300046461 | Ga0495641_0000972 | Ga0495641_0000972_6239_7039 | 264 |
| 1223 | 3300046462 | Ga0495651_0005720 | Ga0495651_0005720_1848_2648 | 264 |
| 1224 | 3300046462 | Ga0495651_0009935 | Ga0495651_0009935_800_1600 | 264 |
| 1225 | 3300046462 | Ga0495651_0023259 | Ga0495651_0023259_3781_4581 | 264 |
| 1226 | 3300046462 | Ga0495651_0027908 | Ga0495651_0027908_2325_3125 | 264 |
| 1227 | 3300046462 | Ga0495651_0080407 | Ga0495651_0080407_902_1702 | 264 |
| 1228 | 3300046462 | Ga0495651_0125451 | Ga0495651_0125451_135_935 | 264 |
| 1229 | 3300046463 | Ga0495653_0007405 | Ga0495653_0007405_243_1043 | 264 |
| 1230 | 3300046463 | Ga0495653_0074094 | Ga0495653_0074094_1482_2282 | 264 |
| 1231 | 3300046463 | Ga0495653_0149706 | Ga0495653_0149706_60_860 | 264 |
| 1232 | 3300046471 | Ga0495650_0018520 | Ga0495650_0018520_1063_1863 | 264 |
| 1233 | 3300046471 | Ga0495650_0040687 | Ga0495650_0040687_658_1458 | 264 |
| 1234 | 3300046472 | Ga0495580_0001291 | Ga0495580_0001291_596_1396 | 264 |
| 1235 | 3300046472 | Ga0495580_0108232 | Ga0495580_0108232_208_1008 | 264 |
| 1236 | 3300046472 | Ga0495580_0158865 | Ga0495580_0158865_751_1551 | 264 |
| 1237 | 3300046473 | Ga0495582_0000444 | Ga0495582_0000444_11841_12641 | 264 |
| 1238 | 3300046475 | Ga0495639_0000177 | Ga0495639_0000177_25561_26361 | 264 |
| 1239 | 3300046475 | Ga0495639_0023674 | Ga0495639_0023674_476_1276 | 264 |
| 1240 | 3300046476 | Ga0495662_0001662 | Ga0495662_0001662_9897_10697 | 264 |
| 1241 | 3300046477 | Ga0495664_0108480 | Ga0495664_0108480_96_896 | 264 |
| 1242 | 3300046492 | Ga0495585_0055573 | Ga0495585_0055573_491_1291 | 264 |
| 1243 | 3300046492 | Ga0495585_0243050 | Ga0495585_0243050_73_873 | 264 |
| 1244 | 3300046499 | Ga0495594_0000079 | Ga0495594_0000079_12150_12950 | 264 |
| 1245 | 3300046507 | Ga0495606_0008637 | Ga0495606_0008637_7138_7938 | 264 |
| 1246 | 3300046507 | Ga0495606_0057292 | Ga0495606_0057292_1031_1831 | 264 |
| 1247 | 3300046507 | Ga0495606_0077676 | Ga0495606_0077676_711_1511 | 264 |
| 1248 | 3300046507 | Ga0495606_0085779 | Ga0495606_0085779_103_903 | 264 |
| 1249 | 3300046511 | Ga0495608_0000368 | Ga0495608_0000368_25066_25866 | 264 |
| 1250 | 3300046511 | Ga0495608_0018906 | Ga0495608_0018906_1074_1874 | 264 |
| 1251 | 3300046511 | Ga0495608_0145895 | Ga0495608_0145895_212_1012 | 264 |
| 1252 | 3300046512 | Ga0495610_0049526 | Ga0495610_0049526_965_1765 | 264 |
| 1253 | 3300046513 | Ga0495616_0088347 | Ga0495616_0088347_41_841 | 264 |
| 1254 | 3300046513 | Ga0495616_0095689 | Ga0495616_0095689_87_887 | 264 |
| 1255 | 3300046513 | Ga0495616_0113313 | Ga0495616_0113313_424_1224 | 264 |
| 1256 | 3300046514 | Ga0495618_0009426 | Ga0495618_0009426_3852_4652 | 264 |
| 1257 | 3300046514 | Ga0495618_0017517 | Ga0495618_0017517_408_1208 | 264 |
| 1258 | 3300046514 | Ga0495618_0240556 | Ga0495618_0240556_112_912 | 264 |
| 1259 | 3300046515 | Ga0495620_0094294 | Ga0495620_0094294_294_1094 | 264 |
| 1260 | 3300046516 | Ga0495628_0062818 | Ga0495628_0062818_36_836 | 264 |
| 1261 | 3300046516 | Ga0495628_0072261 | Ga0495628_0072261_1583_2383 | 264 |
| 1262 | 3300046516 | Ga0495628_0129420 | Ga0495628_0129420_490_1290 | 264 |
| 1263 | 3300046516 | Ga0495628_0203187 | Ga0495628_0203187_61_861 | 264 |
| 1264 | 3300046516 | Ga0495628_0225212 | Ga0495628_0225212_488_1288 | 264 |
| 1265 | 3300046517 | Ga0495630_0011873 | Ga0495630_0011873_2112_2912 | 264 |
| 1266 | 3300046517 | Ga0495630_0370520 | Ga0495630_0370520_38_838 | 264 |
| 1267 | 3300046519 | Ga0495632_0076839 | Ga0495632_0076839_303_1103 | 264 |
| 1268 | 3300046519 | Ga0495632_0133454 | Ga0495632_0133454_152_952 | 264 |
| 1269 | 3300046520 | Ga0495637_0081861 | Ga0495637_0081861_219_1019 | 264 |
| 1270 | 3300046520 | Ga0495637_0093763 | Ga0495637_0093763_144_944 | 264 |
| 1271 | 3300046520 | Ga0495637_0102108 | Ga0495637_0102108_183_983 | 264 |
| 1272 | 3300046522 | Ga0495643_0071487 | Ga0495643_0071487_349_1149 | 264 |
| 1273 | 3300046522 | Ga0495643_0159415 | Ga0495643_0159415_169_969 | 264 |
| 1274 | 3300046524 | Ga0495648_0001441 | Ga0495648_0001441_4230_5030 | 264 |
| 1275 | 3300046524 | Ga0495648_0050416 | Ga0495648_0050416_1599_2399 | 264 |
| 1276 | 3300046524 | Ga0495648_0074623 | Ga0495648_0074623_140_940 | 264 |
| 1277 | 3300046524 | Ga0495648_0093296 | Ga0495648_0093296_145_945 | 264 |
| 1278 | 3300046526 | Ga0495666_0112566 | Ga0495666_0112566_251_1051 | 264 |
| 1279 | 3300046529 | Ga0495652_0003538 | Ga0495652_0003538_7702_8502 | 264 |
| 1280 | 3300046529 | Ga0495652_0044979 | Ga0495652_0044979_2125_2925 | 264 |
| 1281 | 3300046529 | Ga0495652_0056577 | Ga0495652_0056577_159_959 | 264 |
| 1282 | 3300046529 | Ga0495652_0302334 | Ga0495652_0302334_247_1047 | 264 |
| 1283 | 3300046529 | Ga0495652_0303133 | Ga0495652_0303133_305_1105 | 264 |
| 1284 | 3300046530 | Ga0495654_0032691 | Ga0495654_0032691_771_1571 | 264 |
| 1285 | 3300046530 | Ga0495654_0046918 | Ga0495654_0046918_615_1415 | 264 |
| 1286 | 3300046531 | Ga0495665_0000570 | Ga0495665_0000570_442_1242 | 264 |
| 1287 | 3300046533 | Ga0495640_0000938 | Ga0495640_0000938_19498_20298 | 264 |
| 1288 | 3300046533 | Ga0495640_0008034 | Ga0495640_0008034_4611_5411 | 264 |
| 1289 | 3300046533 | Ga0495640_0029702 | Ga0495640_0029702_2983_3783 | 264 |
| 1290 | 3300046535 | Ga0495586_0265305 | Ga0495586_0265305_97_897 | 264 |
| 1291 | 3300046536 | Ga0495587_0004424 | Ga0495587_0004424_464_1264 | 264 |
| 1292 | 3300046537 | Ga0495598_0001754 | Ga0495598_0001754_935_1735 | 264 |
| 1293 | 3300046543 | Ga0495645_0231641 | Ga0495645_0231641_29_829 | 264 |
| 1294 | 3300046543 | Ga0495645_0380495 | Ga0495645_0380495_72_872 | 264 |
| 1295 | 3300046557 | Ga0495622_0000888 | Ga0495622_0000888_12255_13055 | 264 |
| 1296 | 3300046557 | Ga0495622_0013293 | Ga0495622_0013293_1553_2353 | 264 |
| 1297 | 3300046557 | Ga0495622_0071534 | Ga0495622_0071534_260_1060 | 264 |
| 1298 | 3300046558 | Ga0495633_0083705 | Ga0495633_0083705_636_1436 | 264 |
| 1299 | 3300046558 | Ga0495633_0105571 | Ga0495633_0105571_401_1201 | 264 |
| 1300 | 3300046559 | Ga0495667_0007023 | Ga0495667_0007023_3351_4151 | 264 |
| 1301 | 3300046559 | Ga0495667_0315678 | Ga0495667_0315678_105_905 | 264 |
| 1302 | 3300046615 | Ga0495656_0001212 | Ga0495656_0001212_858_1658 | 264 |
| 1303 | 3300046615 | Ga0495656_0045656 | Ga0495656_0045656_935_1735 | 264 |
| 1304 | 3300046616 | Ga0495668_0113544 | Ga0495668_0113544_530_1330 | 264 |
| 1305 | 3300046616 | Ga0495668_0174264 | Ga0495668_0174264_304_1104 | 264 |
| 1306 | 3300046616 | Ga0495668_0182158 | Ga0495668_0182158_169_969 | 264 |
| 1307 | 3300046616 | Ga0495668_0192483 | Ga0495668_0192483_262_1062 | 264 |
| 1308 | 3300046616 | Ga0495668_0215629 | Ga0495668_0215629_81_881 | 264 |
| 1309 | 3300046642 | Ga0495634_0000334 | Ga0495634_0000334_18082_18882 | 264 |
| 1310 | 3300046642 | Ga0495634_0004641 | Ga0495634_0004641_8588_9388 | 264 |
| 1311 | 3300046642 | Ga0495634_0102275 | Ga0495634_0102275_612_1412 | 264 |
| 1312 | 3300046660 | Ga0495625_0045332 | Ga0495625_0045332_111_911 | 264 |
| 1313 | 3300046660 | Ga0495625_0101996 | Ga0495625_0101996_740_1540 | 264 |
| 1314 | 3300046660 | Ga0495625_0119561 | Ga0495625_0119561_873_1673 | 264 |
| 1315 | 3300046660 | Ga0495625_0231017 | Ga0495625_0231017_83_883 | 264 |
| 1316 | 3300046660 | Ga0495625_0317373 | Ga0495625_0317373_102_902 | 264 |
| 1317 | 3300046663 | Ga0495635_0000372 | Ga0495635_0000372_21983_22783 | 264 |
| 1318 | 3300046663 | Ga0495635_0004370 | Ga0495635_0004370_1278_2078 | 264 |
| 1319 | 3300046664 | Ga0495659_0007020 | Ga0495659_0007020_789_1589 | 264 |
| 1320 | 3300046664 | Ga0495659_0023775 | Ga0495659_0023775_273_1073 | 264 |
| 1321 | 3300046665 | Ga0495661_0045906 | Ga0495661_0045906_1164_1964 | 264 |
| 1322 | 3300046665 | Ga0495661_0184630 | Ga0495661_0184630_27_827 | 264 |
| 1323 | 3300046674 | Ga0495588_0038425 | Ga0495588_0038425_1092_1892 | 264 |
| 1324 | 3300046674 | Ga0495588_0046186 | Ga0495588_0046186_316_1116 | 264 |
| 1325 | 3300046674 | Ga0495588_0191832 | Ga0495588_0191832_207_1007 | 264 |
| 1326 | 3300046675 | Ga0495657_0006148 | Ga0495657_0006148_4146_4946 | 264 |
| 1327 | 3300046675 | Ga0495657_0010390 | Ga0495657_0010390_1393_2193 | 264 |
| 1328 | 3300046675 | Ga0495657_0044452 | Ga0495657_0044452_294_1094 | 264 |
| 1329 | 3300046675 | Ga0495657_0177171 | Ga0495657_0177171_449_1249 | 264 |
| 1330 | 3300046678 | Ga0495599_0018187 | Ga0495599_0018187_1103_1903 | 264 |
| 1331 | 3300046678 | Ga0495599_0114109 | Ga0495599_0114109_419_1219 | 264 |
| 1332 | 3300046679 | Ga0495623_0009665 | Ga0495623_0009665_995_1795 | 264 |
| 1333 | 3300046680 | Ga0495646_0003761 | Ga0495646_0003761_3009_3809 | 264 |
| 1334 | 3300046680 | Ga0495646_0020785 | Ga0495646_0020785_1223_2023 | 264 |
| 1335 | 3300046681 | Ga0495647_0000312 | Ga0495647_0000312_805_1605 | 264 |
| 1336 | 3300046683 | Ga0495658_0000416 | Ga0495658_0000416_1445_2245 | 264 |
| 1337 | 3300046684 | Ga0495669_0042244 | Ga0495669_0042244_246_1046 | 264 |
| 1338 | 3300046689 | Ga0495613_0010249 | Ga0495613_0010249_2127_2927 | 264 |
| 1339 | 3300046689 | Ga0495613_0013379 | Ga0495613_0013379_1741_2541 | 264 |
| 1340 | 3300046690 | Ga0495624_0003210 | Ga0495624_0003210_1606_2406 | 264 |
| 1341 | 3300046690 | Ga0495624_0117312 | Ga0495624_0117312_253_1053 | 264 |
| 1342 | 3300046690 | Ga0495624_0160495 | Ga0495624_0160495_289_1089 | 264 |
| 1343 | 3300046691 | Ga0495670_0126710 | Ga0495670_0126710_391_1191 | 264 |
| 1344 | 3300046692 | Ga0495671_0061788 | Ga0495671_0061788_284_1084 | 264 |
| 1345 | 3300046694 | Ga0495649_0071092 | Ga0495649_0071092_409_1209 | 264 |
| 1346 | 3300046794 | Ga0495589_0049818 | Ga0495589_0049818_814_1614 | 264 |
| 1347 | 3300046794 | Ga0495589_0055679 | Ga0495589_0055679_705_1505 | 264 |
| 1348 | 3300046794 | Ga0495589_0069750 | Ga0495589_0069750_458_1258 | 264 |
| 1349 | 3300046794 | Ga0495589_0091870 | Ga0495589_0091870_103_903 | 264 |
| 1350 | 3300046809 | Ga0495600_0001217 | Ga0495600_0001217_7573_8373 | 264 |
| 1351 | 3300046809 | Ga0495600_0008584 | Ga0495600_0008584_4171_4971 | 264 |
| 1352 | 3300046809 | Ga0495600_0051602 | Ga0495600_0051602_1129_1929 | 264 |
| 1353 | 3300046809 | Ga0495600_0116656 | Ga0495600_0116656_96_896 | 264 |
| 1354 | 3300046810 | Ga0495660_0049733 | Ga0495660_0049733_337_1137 | 264 |
| 1355 | 3300046810 | Ga0495660_0095371 | Ga0495660_0095371_150_950 | 264 |
| 1356 | 3300047315 | Ga0495581_0000426 | Ga0495581_0000426_7975_8775 | 264 |
| 1357 | 3300047315 | Ga0495581_0090963 | Ga0495581_0090963_472_1272 | 264 |
| 1358 | 3300047317 | Ga0495604_0010461 | Ga0495604_0010461_3865_4665 | 264 |
| 1359 | 3300047317 | Ga0495604_0012415 | Ga0495604_0012415_1976_2776 | 264 |
| 1360 | 3300047317 | Ga0495604_0189193 | Ga0495604_0189193_560_1360 | 264 |
| 1361 | 3300047318 | Ga0495636_0087362 | Ga0495636_0087362_471_1271 | 264 |
| 1362 | 3300047319 | Ga0495674_0000533 | Ga0495674_0000533_17143_17943 | 264 |
| 1363 | 3300047319 | Ga0495674_0019041 | Ga0495674_0019041_111_911 | 264 |
| 1364 | 3300047320 | Ga0495672_0089178 | Ga0495672_0089178_390_1190 | 264 |
| 1365 | 3300047321 | Ga0495676_0056269 | Ga0495676_0056269_1184_1984 | 264 |
| 1366 | 3300047321 | Ga0495676_0073567 | Ga0495676_0073567_1115_1915 | 264 |
| 1367 | 3300047321 | Ga0495676_0195066 | Ga0495676_0195066_78_878 | 264 |
| 1368 | 3300047322 | Ga0495680_0007925 | Ga0495680_0007925_3655_4455 | 264 |
| 1369 | 3300047322 | Ga0495680_0176521 | Ga0495680_0176521_421_1221 | 264 |
| 1370 | 3300047444 | Ga0495675_0003518 | Ga0495675_0003518_3601_4401 | 264 |
| 1371 | 3300047446 | Ga0495679_037220 | Ga0495679_037220_11_811 | 264 |
| 1372 | 3300047447 | Ga0495685_027462 | Ga0495685_027462_872_1672 | 264 |
| 1373 | 3300047469 | Ga0495673_0019403 | Ga0495673_0019403_946_1746 | 264 |
| 1374 | 3300047469 | Ga0495673_0123858 | Ga0495673_0123858_181_981 | 264 |
| 1375 | 3300047469 | Ga0495673_0137047 | Ga0495673_0137047_24_824 | 264 |
| 1376 | 3300047471 | Ga0495684_0001014 | Ga0495684_0001014_11496_12296 | 264 |
| 1377 | 3300047471 | Ga0495684_0057861 | Ga0495684_0057861_620_1420 | 264 |
| 1378 | 3300047472 | Ga0495686_0028879 | Ga0495686_0028879_261_1061 | 264 |
| 1379 | 3300047472 | Ga0495686_0091427 | Ga0495686_0091427_121_921 | 264 |
| 1380 | 3300047472 | Ga0495686_0198465 | Ga0495686_0198465_61_861 | 264 |
| 1381 | 3300047472 | Ga0495686_0205040 | Ga0495686_0205040_205_1005 | 264 |
| 1382 | 3300047673 | Ga0495593_0023687 | Ga0495593_0023687_805_1605 | 264 |
| 1383 | 3300047673 | Ga0495593_0031577 | Ga0495593_0031577_637_1437 | 264 |
| 1384 | 3300047673 | Ga0495593_0038062 | Ga0495593_0038062_1708_2508 | 264 |
| 1385 | 3300047673 | Ga0495593_0156747 | Ga0495593_0156747_223_1023 | 264 |
| 1386 | 3300048088 | Ga0495602_0005816 | Ga0495602_0005816_5669_6469 | 264 |
| 1387 | 3300048088 | Ga0495602_0226127 | Ga0495602_0226127_181_981 | 264 |
| 1388 | 3300048089 | Ga0495614_0094922 | Ga0495614_0094922_153_953 | 264 |
| 1389 | 3300048091 | Ga0495626_0017165 | Ga0495626_0017165_1275_2075 | 264 |
| 1390 | 3300048903 | Ga0496100_0045272 | Ga0496100_0045272_1856_2656 | 264 |
| 1391 | 3300048903 | Ga0496100_0176930 | Ga0496100_0176930_117_917 | 264 |
| 1392 | 3300048903 | Ga0496100_0211300 | Ga0496100_0211300_431_1231 | 264 |
| 1393 | 3300048903 | Ga0496100_0222780 | Ga0496100_0222780_523_1323 | 264 |
| 1394 | 3300048903 | Ga0496100_0292123 | Ga0496100_0292123_57_857 | 264 |
| 1395 | 3300048904 | Ga0496101_0003771 | Ga0496101_0003771_1569_2369 | 264 |
| 1396 | 3300048904 | Ga0496101_0037613 | Ga0496101_0037613_1341_2141 | 264 |
| 1397 | 3300048904 | Ga0496101_0162728 | Ga0496101_0162728_22_822 | 264 |
| 1398 | 3300048904 | Ga0496101_0193428 | Ga0496101_0193428_205_1005 | 264 |
| 1399 | 3300048904 | Ga0496101_0312036 | Ga0496101_0312036_408_1208 | 264 |
| 1400 | 3300048904 | Ga0496101_0445982 | Ga0496101_0445982_50_850 | 264 |
| 1401 | 3300048904 | Ga0496101_0501068 | Ga0496101_0501068_105_905 | 264 |
| 1402 | 3300048905 | Ga0496102_0005218 | Ga0496102_0005218_5406_6206 | 264 |
| 1403 | 3300048905 | Ga0496102_0076419 | Ga0496102_0076419_376_1176 | 264 |
| 1404 | 3300048905 | Ga0496102_0137316 | Ga0496102_0137316_481_1281 | 264 |
| 1405 | 3300048905 | Ga0496102_0434489 | Ga0496102_0434489_420_1220 | 264 |
| 1406 | 3300048905 | Ga0496102_0474123 | Ga0496102_0474123_329_1129 | 264 |
| 1407 | 3300048905 | Ga0496102_0630675 | Ga0496102_0630675_40_840 | 264 |
| 1408 | 3300048906 | Ga0496103_0010723 | Ga0496103_0010723_4577_5377 | 264 |
| 1409 | 3300048906 | Ga0496103_0069056 | Ga0496103_0069056_496_1296 | 264 |
| 1410 | 3300048907 | Ga0496104_0016231 | Ga0496104_0016231_2621_3421 | 264 |
| 1411 | 3300048907 | Ga0496104_0022194 | Ga0496104_0022194_28_828 | 264 |
| 1412 | 3300048907 | Ga0496104_0098594 | Ga0496104_0098594_106_906 | 264 |
| 1413 | 3300048907 | Ga0496104_0403460 | Ga0496104_0403460_194_994 | 264 |
| 1414 | 3300048908 | Ga0496105_0009741 | Ga0496105_0009741_1246_2046 | 264 |
| 1415 | 3300048908 | Ga0496105_0019070 | Ga0496105_0019070_3342_4142 | 264 |
| 1416 | 3300048908 | Ga0496105_0029405 | Ga0496105_0029405_260_1060 | 264 |
| 1417 | 3300048908 | Ga0496105_0060520 | Ga0496105_0060520_536_1336 | 264 |
| 1418 | 3300048908 | Ga0496105_0476983 | Ga0496105_0476983_141_941 | 264 |
| 1419 | 3300048909 | Ga0496106_0029624 | Ga0496106_0029624_2358_3158 | 264 |
| 1420 | 3300048909 | Ga0496106_0039923 | Ga0496106_0039923_543_1343 | 264 |
| 1421 | 3300048909 | Ga0496106_0117779 | Ga0496106_0117779_286_1086 | 264 |
| 1422 | 3300048909 | Ga0496106_0217351 | Ga0496106_0217351_307_1107 | 264 |
| 1423 | 3300048910 | Ga0496107_0003550 | Ga0496107_0003550_6074_6874 | 264 |
| 1424 | 3300048910 | Ga0496107_0035584 | Ga0496107_0035584_1322_2122 | 264 |
| 1425 | 3300048910 | Ga0496107_0201826 | Ga0496107_0201826_275_1075 | 264 |
| 1426 | 3300048910 | Ga0496107_0390940 | Ga0496107_0390940_29_829 | 264 |
| 1427 | 3300048911 | Ga0496108_0002351 | Ga0496108_0002351_12635_13435 | 264 |
| 1428 | 3300048911 | Ga0496108_0022679 | Ga0496108_0022679_1713_2513 | 264 |
| 1429 | 3300048911 | Ga0496108_0183373 | Ga0496108_0183373_407_1207 | 264 |
| 1430 | 3300048912 | Ga0496109_0002582 | Ga0496109_0002582_3483_4283 | 264 |
| 1431 | 3300048912 | Ga0496109_0011126 | Ga0496109_0011126_4352_5152 | 264 |
| 1432 | 3300048912 | Ga0496109_0093698 | Ga0496109_0093698_1526_2326 | 264 |
| 1433 | 3300048912 | Ga0496109_0479465 | Ga0496109_0479465_26_826 | 264 |
| 1434 | 3300048912 | Ga0496109_0703062 | Ga0496109_0703062_19_819 | 264 |
| 1435 | 3300048913 | Ga0496110_0007857 | Ga0496110_0007857_3342_4142 | 264 |
| 1436 | 3300048913 | Ga0496110_0068203 | Ga0496110_0068203_2105_2905 | 264 |
| 1437 | 3300048913 | Ga0496110_0163439 | Ga0496110_0163439_59_859 | 264 |
| 1438 | 3300048913 | Ga0496110_0222916 | Ga0496110_0222916_146_946 | 264 |
| 1439 | 3300048913 | Ga0496110_0277699 | Ga0496110_0277699_632_1432 | 264 |
| 1440 | 3300048913 | Ga0496110_0410559 | Ga0496110_0410559_424_1224 | 264 |
| 1441 | 3300048913 | Ga0496110_0516382 | Ga0496110_0516382_241_1041 | 264 |
| 1442 | 3300048914 | Ga0496111_0091112 | Ga0496111_0091112_34_834 | 264 |
| 1443 | 3300048914 | Ga0496111_0158134 | Ga0496111_0158134_531_1331 | 264 |
| 1444 | 3300048914 | Ga0496111_0249749 | Ga0496111_0249749_349_1149 | 264 |
| 1445 | 3300048915 | Ga0496112_0008401 | Ga0496112_0008401_305_1105 | 264 |
| 1446 | 3300048915 | Ga0496112_0036493 | Ga0496112_0036493_706_1506 | 264 |
| 1447 | 3300048915 | Ga0496112_0056475 | Ga0496112_0056475_2257_3057 | 264 |
| 1448 | 3300048915 | Ga0496112_0158316 | Ga0496112_0158316_672_1472 | 264 |
| 1449 | 3300048915 | Ga0496112_0188637 | Ga0496112_0188637_819_1619 | 264 |
| 1450 | 3300048915 | Ga0496112_0590938 | Ga0496112_0590938_185_985 | 264 |
| 1451 | 3300048916 | Ga0496113_0006395 | Ga0496113_0006395_1635_2435 | 264 |
| 1452 | 3300048916 | Ga0496113_0012289 | Ga0496113_0012289_34_834 | 264 |
| 1453 | 3300048916 | Ga0496113_0228856 | Ga0496113_0228856_566_1366 | 264 |
| 1454 | 3300048916 | Ga0496113_0254832 | Ga0496113_0254832_336_1136 | 264 |
| 1455 | 3300048916 | Ga0496113_0403519 | Ga0496113_0403519_233_1033 | 264 |
| 1456 | 3300048916 | Ga0496113_0605397 | Ga0496113_0605397_14_814 | 264 |
| 1457 | 3300048917 | Ga0496114_0030213 | Ga0496114_0030213_1492_2292 | 264 |
| 1458 | 3300048917 | Ga0496114_0075310 | Ga0496114_0075310_1473_2273 | 264 |
| 1459 | 3300048917 | Ga0496114_0080809 | Ga0496114_0080809_1536_2336 | 264 |
| 1460 | 3300048917 | Ga0496114_0310384 | Ga0496114_0310384_74_874 | 264 |
| 1461 | 3300048917 | Ga0496114_0631560 | Ga0496114_0631560_87_887 | 264 |
| 1462 | 3300048917 | Ga0496114_0634809 | Ga0496114_0634809_121_921 | 264 |
| 1463 | 3300048918 | Ga0496115_0002700 | Ga0496115_0002700_5068_5868 | 264 |
| 1464 | 3300048918 | Ga0496115_0006372 | Ga0496115_0006372_1457_2257 | 264 |
| 1465 | 3300048918 | Ga0496115_0060457 | Ga0496115_0060457_1605_2405 | 264 |
| 1466 | 3300048918 | Ga0496115_0095775 | Ga0496115_0095775_761_1561 | 264 |
| 1467 | 3300048918 | Ga0496115_0132409 | Ga0496115_0132409_896_1696 | 264 |
| 1468 | 3300048918 | Ga0496115_0178984 | Ga0496115_0178984_630_1430 | 264 |
| 1469 | 3300048918 | Ga0496115_0209551 | Ga0496115_0209551_798_1598 | 264 |
| 1470 | 3300048918 | Ga0496115_0238443 | Ga0496115_0238443_448_1248 | 264 |
| 1471 | 3300048918 | Ga0496115_0574503 | Ga0496115_0574503_62_862 | 264 |
| 1472 | 3300048919 | Ga0496116_0059189 | Ga0496116_0059189_1292_2092 | 264 |
| 1473 | 3300048919 | Ga0496116_0226840 | Ga0496116_0226840_79_879 | 264 |
| 1474 | 3300048920 | Ga0496117_0067197 | Ga0496117_0067197_1551_2351 | 264 |
| 1475 | 3300048920 | Ga0496117_0134776 | Ga0496117_0134776_270_1070 | 264 |
| 1476 | 3300048920 | Ga0496117_0226708 | Ga0496117_0226708_188_988 | 264 |
| 1477 | 3300048921 | Ga0496118_0042278 | Ga0496118_0042278_899_1699 | 264 |
| 1478 | 3300048921 | Ga0496118_0093947 | Ga0496118_0093947_1229_2029 | 264 |
| 1479 | 3300048921 | Ga0496118_0136708 | Ga0496118_0136708_285_1085 | 264 |
| 1480 | 3300048921 | Ga0496118_0168951 | Ga0496118_0168951_508_1308 | 264 |
| 1481 | 3300048921 | Ga0496118_0252008 | Ga0496118_0252008_64_864 | 264 |
| 1482 | 3300048922 | Ga0496119_0064740 | Ga0496119_0064740_12_812 | 264 |
| 1483 | 3300048922 | Ga0496119_0064916 | Ga0496119_0064916_1261_2061 | 264 |
| 1484 | 3300048922 | Ga0496119_0074470 | Ga0496119_0074470_175_975 | 264 |
| 1485 | 3300048923 | Ga0496120_0113877 | Ga0496120_0113877_166_966 | 264 |
| 1486 | 3300048923 | Ga0496120_0149659 | Ga0496120_0149659_167_967 | 264 |
| 1487 | 3300048923 | Ga0496120_0218679 | Ga0496120_0218679_53_853 | 264 |
| 1488 | 3300048924 | Ga0496121_0006526 | Ga0496121_0006526_126_926 | 264 |
| 1489 | 3300048924 | Ga0496121_0017298 | Ga0496121_0017298_1364_2164 | 264 |
| 1490 | 3300048924 | Ga0496121_0020252 | Ga0496121_0020252_3248_4048 | 264 |
| 1491 | 3300048924 | Ga0496121_0024943 | Ga0496121_0024943_64_864 | 264 |
| 1492 | 3300048924 | Ga0496121_0026087 | Ga0496121_0026087_2853_3653 | 264 |
| 1493 | 3300048924 | Ga0496121_0054436 | Ga0496121_0054436_162_962 | 264 |
| 1494 | 3300048924 | Ga0496121_0069583 | Ga0496121_0069583_420_1220 | 264 |
| 1495 | 3300048924 | Ga0496121_0074527 | Ga0496121_0074527_567_1367 | 264 |
| 1496 | 3300048924 | Ga0496121_0125803 | Ga0496121_0125803_890_1690 | 264 |
| 1497 | 3300048924 | Ga0496121_0234124 | Ga0496121_0234124_305_1105 | 264 |
| 1498 | 3300048925 | Ga0496122_0051864 | Ga0496122_0051864_859_1659 | 264 |
| 1499 | 3300048926 | Ga0496123_0016690 | Ga0496123_0016690_1832_2632 | 264 |
| 1500 | 3300048926 | Ga0496123_0156129 | Ga0496123_0156129_85_885 | 264 |
| 1501 | 3300048927 | Ga0496124_0140856 | Ga0496124_0140856_29_829 | 264 |
| 1502 | 3300048927 | Ga0496124_0143720 | Ga0496124_0143720_766_1566 | 264 |
| 1503 | 3300048927 | Ga0496124_0234720 | Ga0496124_0234720_355_1155 | 264 |
| 1504 | 3300048927 | Ga0496124_0373275 | Ga0496124_0373275_169_969 | 264 |
| 1505 | 3300048928 | Ga0496125_0000420 | Ga0496125_0000420_51539_52339 | 264 |
| 1506 | 3300048928 | Ga0496125_0001161 | Ga0496125_0001161_12418_13218 | 264 |
| 1507 | 3300048928 | Ga0496125_0005151 | Ga0496125_0005151_9642_10442 | 264 |
| 1508 | 3300048928 | Ga0496125_0037965 | Ga0496125_0037965_1721_2521 | 264 |
| 1509 | 3300048928 | Ga0496125_0051090 | Ga0496125_0051090_27_827 | 264 |
| 1510 | 3300048928 | Ga0496125_0056665 | Ga0496125_0056665_40_840 | 264 |
| 1511 | 3300048928 | Ga0496125_0177519 | Ga0496125_0177519_21_821 | 264 |
| 1512 | 3300048928 | Ga0496125_0253585 | Ga0496125_0253585_215_1015 | 264 |
| 1513 | 3300048929 | Ga0496126_0003575 | Ga0496126_0003575_8193_8993 | 264 |
| 1514 | 3300048929 | Ga0496126_0007151 | Ga0496126_0007151_698_1498 | 264 |
| 1515 | 3300048929 | Ga0496126_0017087 | Ga0496126_0017087_6226_7026 | 264 |
| 1516 | 3300048929 | Ga0496126_0036374 | Ga0496126_0036374_3515_4315 | 264 |
| 1517 | 3300048929 | Ga0496126_0037272 | Ga0496126_0037272_2538_3338 | 264 |
| 1518 | 3300048929 | Ga0496126_0048345 | Ga0496126_0048345_700_1500 | 264 |
| 1519 | 3300048929 | Ga0496126_0099199 | Ga0496126_0099199_232_1032 | 264 |
| 1520 | 3300048929 | Ga0496126_0143226 | Ga0496126_0143226_106_906 | 264 |
| 1521 | 3300048929 | Ga0496126_0147360 | Ga0496126_0147360_192_992 | 264 |
| 1522 | 3300048929 | Ga0496126_0155251 | Ga0496126_0155251_938_1738 | 264 |
| 1523 | 3300048929 | Ga0496126_0205744 | Ga0496126_0205744_516_1316 | 264 |
| 1524 | 3300048929 | Ga0496126_0206431 | Ga0496126_0206431_571_1374 | 264 |
| 1525 | 3300048929 | Ga0496126_0287714 | Ga0496126_0287714_508_1308 | 264 |
| 1526 | 3300048929 | Ga0496126_0317197 | Ga0496126_0317197_377_1177 | 264 |
| 1527 | 3300048929 | Ga0496126_0327722 | Ga0496126_0327722_18_818 | 264 |
| 1528 | 3300048929 | Ga0496126_0533885 | Ga0496126_0533885_103_903 | 264 |
| 1529 | 3300049460 | Ga0495682_0025931 | Ga0495682_0025931_873_1673 | 264 |
| 1530 | 3300049568 | Ga0501031_0002387 | Ga0501031_0002387_7054_7854 | 264 |
| 1531 | 3300049568 | Ga0501031_0002483 | Ga0501031_0002483_6103_6909 | 264 |
| 1532 | 3300049568 | Ga0501031_0257568 | Ga0501031_0257568_248_1048 | 264 |
| 1533 | 3300049569 | Ga0501032_0000227 | Ga0501032_0000227_16547_17347 | 264 |
| 1534 | 3300049569 | Ga0501032_0000318 | Ga0501032_0000318_17233_18039 | 264 |
| 1535 | 3300049570 | Ga0501033_0000443 | Ga0501033_0000443_11011_11817 | 264 |
| 1536 | 3300049570 | Ga0501033_0004766 | Ga0501033_0004766_724_1524 | 264 |
| 1537 | 3300049570 | Ga0501033_0008200 | Ga0501033_0008200_2472_3272 | 264 |
| 1538 | 3300049570 | Ga0501033_0361659 | Ga0501033_0361659_156_956 | 264 |
| 1539 | 3300049571 | Ga0501034_0000061 | Ga0501034_0000061_34033_34839 | 264 |
| 1540 | 3300049571 | Ga0501034_0000100 | Ga0501034_0000100_18483_19283 | 264 |
| 1541 | 3300049571 | Ga0501034_0028765 | Ga0501034_0028765_2044_2844 | 264 |
| 1542 | 3300049571 | Ga0501034_0068429 | Ga0501034_0068429_212_1012 | 264 |
| 1543 | 3300049571 | Ga0501034_0180456 | Ga0501034_0180456_278_1078 | 264 |
| 1544 | 3300049572 | Ga0501036_0000010 | Ga0501036_0000010_66588_67388 | 264 |
| 1545 | 3300049572 | Ga0501036_0000387 | Ga0501036_0000387_7573_8379 | 264 |
| 1546 | 3300049572 | Ga0501036_0175906 | Ga0501036_0175906_887_1687 | 264 |
| 1547 | 3300049572 | Ga0501036_0282657 | Ga0501036_0282657_339_1139 | 264 |
| 1548 | 3300049572 | Ga0501036_0321690 | Ga0501036_0321690_475_1275 | 264 |
| 1549 | 3300049573 | Ga0501037_0000104 | Ga0501037_0000104_56690_57496 | 264 |
| 1550 | 3300049573 | Ga0501037_0000183 | Ga0501037_0000183_43916_44716 | 264 |
| 1551 | 3300049573 | Ga0501037_0005109 | Ga0501037_0005109_266_1072 | 264 |
| 1552 | 3300049573 | Ga0501037_0064315 | Ga0501037_0064315_465_1265 | 264 |
| 1553 | 3300049573 | Ga0501037_0088726 | Ga0501037_0088726_27_827 | 264 |
| 1554 | 3300049573 | Ga0501037_0145197 | Ga0501037_0145197_158_958 | 264 |
| 1555 | 3300049573 | Ga0501037_0387866 | Ga0501037_0387866_25_825 | 264 |
| 1556 | 3300049574 | Ga0501038_0000054 | Ga0501038_0000054_50352_51152 | 264 |
| 1557 | 3300049574 | Ga0501038_0000340 | Ga0501038_0000340_37678_38484 | 264 |
| 1558 | 3300049574 | Ga0501038_0009130 | Ga0501038_0009130_3489_4289 | 264 |
| 1559 | 3300049574 | Ga0501038_0029904 | Ga0501038_0029904_2703_3503 | 264 |
| 1560 | 3300049574 | Ga0501038_0068147 | Ga0501038_0068147_184_984 | 264 |
| 1561 | 3300049574 | Ga0501038_0093188 | Ga0501038_0093188_256_1056 | 264 |
| 1562 | 3300049575 | Ga0501039_0000110 | Ga0501039_0000110_20014_20814 | 264 |
| 1563 | 3300049575 | Ga0501039_0000536 | Ga0501039_0000536_22177_22983 | 264 |
| 1564 | 3300049575 | Ga0501039_0034134 | Ga0501039_0034134_3060_3860 | 264 |
| 1565 | 3300049575 | Ga0501039_0319562 | Ga0501039_0319562_91_891 | 264 |
| 1566 | 3300049576 | Ga0501040_0016098 | Ga0501040_0016098_3426_4226 | 264 |
| 1567 | 3300049577 | Ga0501041_0106141 | Ga0501041_0106141_499_1299 | 264 |
| 1568 | 3300049578 | Ga0501042_0029189 | Ga0501042_0029189_3067_3867 | 264 |
| 1569 | 3300049579 | Ga0501043_0000106 | Ga0501043_0000106_73873_74673 | 264 |
| 1570 | 3300049579 | Ga0501043_0000161 | Ga0501043_0000161_14615_15421 | 264 |
| 1571 | 3300049579 | Ga0501043_0015830 | Ga0501043_0015830_3143_3943 | 264 |
| 1572 | 3300049579 | Ga0501043_0038102 | Ga0501043_0038102_208_1008 | 264 |
| 1573 | 3300049579 | Ga0501043_0119062 | Ga0501043_0119062_735_1535 | 264 |
| 1574 | 3300049579 | Ga0501043_0209758 | Ga0501043_0209758_638_1438 | 264 |
| 1575 | 3300049580 | Ga0501046_0001107 | Ga0501046_0001107_12292_13098 | 264 |
| 1576 | 3300049580 | Ga0501046_0005134 | Ga0501046_0005134_6119_6919 | 264 |
| 1577 | 3300049580 | Ga0501046_0012683 | Ga0501046_0012683_5315_6115 | 264 |
| 1578 | 3300049580 | Ga0501046_0122368 | Ga0501046_0122368_115_915 | 264 |
| 1579 | 3300049581 | Ga0501047_0000122 | Ga0501047_0000122_27800_28606 | 264 |
| 1580 | 3300049581 | Ga0501047_0000702 | Ga0501047_0000702_172_972 | 264 |
| 1581 | 3300049581 | Ga0501047_0032928 | Ga0501047_0032928_2163_2963 | 264 |
| 1582 | 3300049581 | Ga0501047_0051165 | Ga0501047_0051165_2782_3582 | 264 |
| 1583 | 3300049581 | Ga0501047_0085334 | Ga0501047_0085334_1953_2753 | 264 |
| 1584 | 3300049581 | Ga0501047_0137596 | Ga0501047_0137596_1378_2178 | 264 |
| 1585 | 3300049581 | Ga0501047_0367503 | Ga0501047_0367503_381_1181 | 264 |
| 1586 | 3300049582 | Ga0501048_0000060 | Ga0501048_0000060_46651_47457 | 264 |
| 1587 | 3300049582 | Ga0501048_0000456 | Ga0501048_0000456_11883_12683 | 264 |
| 1588 | 3300049582 | Ga0501048_0031383 | Ga0501048_0031383_3001_3801 | 264 |
| 1589 | 3300049583 | Ga0501067_0001976 | Ga0501067_0001976_2159_2965 | 264 |
| 1590 | 3300049583 | Ga0501067_0004998 | Ga0501067_0004998_4574_5374 | 264 |
| 1591 | 3300049583 | Ga0501067_0028386 | Ga0501067_0028386_184_984 | 264 |
| 1592 | 3300049583 | Ga0501067_0104145 | Ga0501067_0104145_326_1126 | 264 |
| 1593 | 3300049583 | Ga0501067_0114284 | Ga0501067_0114284_296_1090 | 264 |
| 1594 | 3300049584 | Ga0501068_0000737 | Ga0501068_0000737_9162_9968 | 264 |
| 1595 | 3300049584 | Ga0501068_0000938 | Ga0501068_0000938_8986_9786 | 264 |
| 1596 | 3300049584 | Ga0501068_0018828 | Ga0501068_0018828_2809_3609 | 264 |
| 1597 | 3300049584 | Ga0501068_0067026 | Ga0501068_0067026_59_859 | 264 |
| 1598 | 3300049584 | Ga0501068_0261206 | Ga0501068_0261206_39_839 | 264 |
| 1599 | 3300049585 | Ga0501069_0000315 | Ga0501069_0000315_8065_8865 | 264 |
| 1600 | 3300049585 | Ga0501069_0003284 | Ga0501069_0003284_2310_3116 | 264 |
| 1601 | 3300049585 | Ga0501069_0211785 | Ga0501069_0211785_283_1083 | 264 |
| 1602 | 3300049586 | Ga0501070_0000659 | Ga0501070_0000659_296_1102 | 264 |
| 1603 | 3300049586 | Ga0501070_0007760 | Ga0501070_0007760_5845_6645 | 264 |
| 1604 | 3300049586 | Ga0501070_0063684 | Ga0501070_0063684_1048_1848 | 264 |
| 1605 | 3300049586 | Ga0501070_0243976 | Ga0501070_0243976_562_1368 | 264 |
| 1606 | 3300049586 | Ga0501070_0269532 | Ga0501070_0269532_263_1063 | 264 |
| 1607 | 3300049586 | Ga0501070_0379270 | Ga0501070_0379270_202_1002 | 264 |
| 1608 | 3300049587 | Ga0501071_0045800 | Ga0501071_0045800_1524_2330 | 264 |
| 1609 | 3300049587 | Ga0501071_0115738 | Ga0501071_0115738_532_1332 | 264 |
| 1610 | 3300049588 | Ga0501072_0000606 | Ga0501072_0000606_22259_23065 | 264 |
| 1611 | 3300049588 | Ga0501072_0001167 | Ga0501072_0001167_7129_7929 | 264 |
| 1612 | 3300049588 | Ga0501072_0047895 | Ga0501072_0047895_1515_2315 | 264 |
| 1613 | 3300049589 | Ga0501073_0000014 | Ga0501073_0000014_10715_11521 | 264 |
| 1614 | 3300049589 | Ga0501073_0000238 | Ga0501073_0000238_16348_17148 | 264 |
| 1615 | 3300049589 | Ga0501073_0029113 | Ga0501073_0029113_2893_3693 | 264 |
| 1616 | 3300049590 | Ga0501074_0000259 | Ga0501074_0000259_23642_24442 | 264 |
| 1617 | 3300049590 | Ga0501074_0000995 | Ga0501074_0000995_10432_11238 | 264 |
| 1618 | 3300049590 | Ga0501074_0021196 | Ga0501074_0021196_2983_3783 | 264 |
| 1619 | 3300049590 | Ga0501074_0154843 | Ga0501074_0154843_558_1358 | 264 |
| 1620 | 3300049591 | Ga0501075_0153982 | Ga0501075_0153982_601_1404 | 264 |
| 1621 | 3300049592 | Ga0501076_0301602 | Ga0501076_0301602_351_1157 | 264 |
| 1622 | 3300049593 | Ga0501077_0096296 | Ga0501077_0096296_1008_1811 | 264 |
| 1623 | 3300049741 | Ga0501079_0014230 | Ga0501079_0014230_2190_2990 | 264 |
| 1624 | 3300049742 | Ga0501080_0002287 | Ga0501080_0002287_5854_6654 | 264 |
| 1625 | 3300049742 | Ga0501080_0007524 | Ga0501080_0007524_296_1102 | 264 |
| 1626 | 3300049742 | Ga0501080_0018024 | Ga0501080_0018024_5554_6354 | 264 |
| 1627 | 3300049742 | Ga0501080_0118121 | Ga0501080_0118121_1482_2282 | 264 |
| 1628 | 3300049742 | Ga0501080_0474771 | Ga0501080_0474771_246_1046 | 264 |
| 1629 | 3300049744 | Ga0501083_0000550 | Ga0501083_0000550_9232_10032 | 264 |
| 1630 | 3300049744 | Ga0501083_0010171 | Ga0501083_0010171_3638_4444 | 264 |
| 1631 | 3300049744 | Ga0501083_0013449 | Ga0501083_0013449_1493_2293 | 264 |
| 1632 | 3300049822 | Ga0501035_0000099 | Ga0501035_0000099_12292_13098 | 264 |
| 1633 | 3300049822 | Ga0501035_0000146 | Ga0501035_0000146_6425_7225 | 264 |
| 1634 | 3300049822 | Ga0501035_0070990 | Ga0501035_0070990_401_1201 | 264 |
| 1635 | 3300049822 | Ga0501035_0102938 | Ga0501035_0102938_1076_1876 | 264 |
| 1636 | 3300049822 | Ga0501035_0123306 | Ga0501035_0123306_301_1101 | 264 |
| 1637 | 3300049822 | Ga0501035_0168274 | Ga0501035_0168274_260_1060 | 264 |
| 1638 | 3300049823 | Ga0501044_0000195 | Ga0501044_0000195_63546_64352 | 264 |
| 1639 | 3300049823 | Ga0501044_0002385 | Ga0501044_0002385_5708_6508 | 264 |
| 1640 | 3300049823 | Ga0501044_0030160 | Ga0501044_0030160_4046_4846 | 264 |
| 1641 | 3300049823 | Ga0501044_0035811 | Ga0501044_0035811_1584_2384 | 264 |
| 1642 | 3300049823 | Ga0501044_0039805 | Ga0501044_0039805_66_866 | 264 |
| 1643 | 3300049823 | Ga0501044_0101805 | Ga0501044_0101805_1024_1824 | 264 |
| 1644 | 3300049823 | Ga0501044_0218231 | Ga0501044_0218231_887_1687 | 264 |
| 1645 | 3300049823 | Ga0501044_0270193 | Ga0501044_0270193_61_861 | 264 |
| 1646 | 3300049823 | Ga0501044_0385295 | Ga0501044_0385295_383_1183 | 264 |
| 1647 | 3300049823 | Ga0501044_0431210 | Ga0501044_0431210_186_986 | 264 |
| 1648 | 3300049824 | Ga0501045_0004135 | Ga0501045_0004135_2966_3766 | 264 |
| 1649 | 3300049824 | Ga0501045_0024453 | Ga0501045_0024453_672_1478 | 264 |
| 1650 | 3300049824 | Ga0501045_0070605 | Ga0501045_0070605_16_816 | 264 |
| 1651 | 3300050489 | nmdc:mga03683_37109_c1 | nmdc:mga03683_37109_c1_549_1349 | 264 |
| 1652 | 3300050490 | nmdc:mga03n38_1385_c1 | nmdc:mga03n38_1385_c1_5697_6497 | 264 |
| 1653 | 3300050490 | nmdc:mga03n38_140458_c1 | nmdc:mga03n38_140458_c1_396_1196 | 264 |
| 1654 | 3300050490 | nmdc:mga03n38_148281_c1 | nmdc:mga03n38_148281_c1_306_1130 | 264 |
| 1655 | 3300050490 | nmdc:mga03n38_5383_c1 | nmdc:mga03n38_5383_c1_2120_2920 | 264 |
| 1656 | 3300050491 | nmdc:mga00v17_47537_c1 | nmdc:mga00v17_47537_c1_658_1458 | 264 |
| 1657 | 3300050491 | nmdc:mga00v17_85061_c1 | nmdc:mga00v17_85061_c1_741_1541 | 264 |
| 1658 | 3300050492 | nmdc:mga0yw44_32623_c1 | nmdc:mga0yw44_32623_c1_1117_1917 | 264 |
| 1659 | 3300050492 | nmdc:mga0yw44_41024_c1 | nmdc:mga0yw44_41024_c1_1290_2090 | 264 |
| 1660 | 3300050492 | nmdc:mga0yw44_85309_c1 | nmdc:mga0yw44_85309_c1_619_1419 | 264 |
| 1661 | 3300050492 | nmdc:mga0yw44_98070_c1 | nmdc:mga0yw44_98070_c1_782_1582 | 264 |
| 1662 | 3300050493 | nmdc:mga0k408_44704_c1 | nmdc:mga0k408_44704_c1_377_1177 | 264 |
| 1663 | 3300050493 | nmdc:mga0k408_45315_c1 | nmdc:mga0k408_45315_c1_918_1718 | 264 |
| 1664 | 3300050494 | nmdc:mga06z11_33686_c1 | nmdc:mga06z11_33686_c1_339_1139 | 264 |
| 1665 | 3300050494 | nmdc:mga06z11_85306_c1 | nmdc:mga06z11_85306_c1_28_828 | 264 |
| 1666 | 3300050496 | nmdc:mga07m45_269756_c1 | nmdc:mga07m45_269756_c1_51_851 | 264 |
| 1667 | 3300050507 | nmdc:mga05p37_225116_c1 | nmdc:mga05p37_225116_c1_990_1790 | 264 |
| 1668 | 3300050507 | nmdc:mga05p37_458612_c1 | nmdc:mga05p37_458612_c1_648_1448 | 264 |
| 1669 | 3300050511 | nmdc:mga08y16_336950_c1 | nmdc:mga08y16_336950_c1_496_1296 | 264 |
| 1670 | 3300050514 | nmdc:mga08x19_100320_c1 | nmdc:mga08x19_100320_c1_168_968 | 264 |
| 1671 | 3300050516 | nmdc:mga0sz30_90125_c1 | nmdc:mga0sz30_90125_c1_407_1207 | 264 |
| 1672 | 3300053077 | Ga0495601_0026087 | Ga0495601_0026087_916_1716 | 264 |
| 1673 | 3300053077 | Ga0495601_0031353 | Ga0495601_0031353_1402_2202 | 264 |
| 1674 | 3300053077 | Ga0495601_0068831 | Ga0495601_0068831_78_878 | 264 |
| 1675 | 3300053077 | Ga0495601_0304869 | Ga0495601_0304869_38_841 | 264 |
| 1676 | 3300053078 | Ga0495612_0022777 | Ga0495612_0022777_1201_2001 | 264 |
| 1677 | 3300053084 | Ga0495595_0026287 | Ga0495595_0026287_1453_2253 | 264 |
| 1678 | 3300053084 | Ga0495595_0060653 | Ga0495595_0060653_94_894 | 264 |
| 1679 | 3300053085 | Ga0495619_0005683 | Ga0495619_0005683_4115_4915 | 264 |
| 1680 | 3300053085 | Ga0495619_0144025 | Ga0495619_0144025_341_1141 | 264 |
| 1681 | 3300053086 | Ga0500578_0190699 | Ga0500578_0190699_322_1122 | 264 |
| 1682 | 3300053087 | Ga0500643_000270 | Ga0500643_000270_5165_5965 | 264 |
| 1683 | 3300053089 | Ga0500581_088318 | Ga0500581_088318_112_912 | 264 |
| 1684 | 3300053091 | Ga0500647_0082492 | Ga0500647_0082492_552_1352 | 264 |
| 1685 | 3300053093 | Ga0500651_0022302 | Ga0500651_0022302_3138_3938 | 264 |
| 1686 | 3300053093 | Ga0500651_0165963 | Ga0500651_0165963_398_1198 | 264 |
| 1687 | 3300053094 | Ga0500566_0000022 | Ga0500566_0000022_39397_40197 | 264 |
| 1688 | 3300053094 | Ga0500566_0005084 | Ga0500566_0005084_1454_2254 | 264 |
| 1689 | 3300053094 | Ga0500566_0052562 | Ga0500566_0052562_773_1573 | 264 |
| 1690 | 3300053095 | Ga0500640_000259 | Ga0500640_000259_10670_11470 | 264 |
| 1691 | 3300053096 | Ga0500641_0002387 | Ga0500641_0002387_4566_5366 | 264 |
| 1692 | 3300053096 | Ga0500641_0002665 | Ga0500641_0002665_4514_5314 | 264 |
| 1693 | 3300053096 | Ga0500641_0073297 | Ga0500641_0073297_142_942 | 264 |
| 1694 | 3300053098 | Ga0500650_0014048 | Ga0500650_0014048_857_1657 | 264 |
| 1695 | 3300053102 | Ga0500554_002353 | Ga0500554_002353_193_993 | 264 |
| 1696 | 3300053102 | Ga0500554_009543 | Ga0500554_009543_196_996 | 264 |
| 1697 | 3300053103 | Ga0500555_002818 | Ga0500555_002818_140_940 | 264 |
| 1698 | 3300053104 | Ga0500556_0000306 | Ga0500556_0000306_25195_25995 | 264 |
| 1699 | 3300053104 | Ga0500556_0021119 | Ga0500556_0021119_1264_2064 | 264 |
| 1700 | 3300053104 | Ga0500556_0075336 | Ga0500556_0075336_81_881 | 264 |
| 1701 | 3300053104 | Ga0500556_0127573 | Ga0500556_0127573_92_892 | 264 |
| 1702 | 3300053105 | Ga0500557_000026 | Ga0500557_000026_37263_38063 | 264 |
| 1703 | 3300053108 | Ga0500562_012247 | Ga0500562_012247_21_821 | 264 |
| 1704 | 3300053108 | Ga0500562_014270 | Ga0500562_014270_772_1572 | 264 |
| 1705 | 3300053109 | Ga0500569_022839 | Ga0500569_022839_839_1639 | 264 |
| 1706 | 3300053109 | Ga0500569_079789 | Ga0500569_079789_51_851 | 264 |
| 1707 | 3300053111 | Ga0500572_001109 | Ga0500572_001109_5450_6250 | 264 |
| 1708 | 3300053117 | Ga0500593_000814 | Ga0500593_000814_4361_5197 | 264 |
| 1709 | 3300053119 | Ga0500595_000095 | Ga0500595_000095_1340_2140 | 264 |
| 1710 | 3300053119 | Ga0500595_023108 | Ga0500595_023108_795_1595 | 264 |
| 1711 | 3300053119 | Ga0500595_023330 | Ga0500595_023330_37_837 | 264 |
| 1712 | 3300053122 | Ga0500608_008047 | Ga0500608_008047_330_1130 | 264 |
| 1713 | 3300053130 | Ga0500642_0000091 | Ga0500642_0000091_5278_6078 | 264 |
| 1714 | 3300053131 | Ga0500652_000454 | Ga0500652_000454_11913_12713 | 264 |
| 1715 | 3300053131 | Ga0500652_029820 | Ga0500652_029820_156_956 | 264 |
| 1716 | 3300053131 | Ga0500652_089386 | Ga0500652_089386_305_1105 | 264 |
| 1717 | 3300053134 | Ga0500658_0142942 | Ga0500658_0142942_131_931 | 264 |
| 1718 | 3300053136 | Ga0500559_0000219 | Ga0500559_0000219_31315_32115 | 264 |
| 1719 | 3300053136 | Ga0500559_0002476 | Ga0500559_0002476_1489_2289 | 264 |
| 1720 | 3300053139 | Ga0500568_0011063 | Ga0500568_0011063_2666_3466 | 264 |
| 1721 | 3300053139 | Ga0500568_0028272 | Ga0500568_0028272_180_980 | 264 |
| 1722 | 3300053139 | Ga0500568_0058922 | Ga0500568_0058922_168_968 | 264 |
| 1723 | 3300053148 | Ga0500590_147655 | Ga0500590_147655_188_988 | 264 |
| 1724 | 3300053150 | Ga0500603_000192 | Ga0500603_000192_3033_3833 | 264 |
| 1725 | 3300053150 | Ga0500603_000199 | Ga0500603_000199_4251_5051 | 264 |
| 1726 | 3300053150 | Ga0500603_010461 | Ga0500603_010461_949_1749 | 264 |
| 1727 | 3300053151 | Ga0500604_0000841 | Ga0500604_0000841_356_1156 | 264 |
| 1728 | 3300053151 | Ga0500604_0009783 | Ga0500604_0009783_1222_2022 | 264 |
| 1729 | 3300053151 | Ga0500604_0130095 | Ga0500604_0130095_24_824 | 264 |
| 1730 | 3300053153 | Ga0500616_0000046 | Ga0500616_0000046_26162_26962 | 264 |
| 1731 | 3300053153 | Ga0500616_0003195 | Ga0500616_0003195_8829_9629 | 264 |
| 1732 | 3300053153 | Ga0500616_0021691 | Ga0500616_0021691_2017_2817 | 264 |
| 1733 | 3300053156 | Ga0500622_0006911 | Ga0500622_0006911_2318_3118 | 264 |
| 1734 | 3300053156 | Ga0500622_0029083 | Ga0500622_0029083_271_1071 | 264 |
| 1735 | 3300053159 | Ga0500630_010421 | Ga0500630_010421_2507_3307 | 264 |
| 1736 | 3300053160 | Ga0500633_0011023 | Ga0500633_0011023_1327_2127 | 264 |
| 1737 | 3300053162 | Ga0500638_003343 | Ga0500638_003343_4670_5470 | 264 |
| 1738 | 3300053162 | Ga0500638_175585 | Ga0500638_175585_108_908 | 264 |
| 1739 | 3300053163 | Ga0500639_032910 | Ga0500639_032910_1333_2133 | 264 |
| 1740 | 3300053177 | Ga0500636_0018270 | Ga0500636_0018270_1060_1860 | 264 |
| 1741 | 3300053177 | Ga0500636_0056864 | Ga0500636_0056864_1235_2035 | 264 |
| 1742 | 3300053178 | Ga0500637_0047175 | Ga0500637_0047175_930_1730 | 264 |
| 1743 | 3300053178 | Ga0500637_0112124 | Ga0500637_0112124_17_817 | 264 |
| 1744 | 3300053178 | Ga0500637_0209872 | Ga0500637_0209872_14_814 | 264 |
| 1745 | 3300053730 | Ga0500645_013732 | Ga0500645_013732_1658_2458 | 264 |
| 1746 | 3300053730 | Ga0500645_038402 | Ga0500645_038402_279_1079 | 264 |
| 1747 | 3300053735 | Ga0500596_001884 | Ga0500596_001884_1155_1955 | 264 |
| 1748 | 3300053737 | Ga0500601_000223 | Ga0500601_000223_53_853 | 264 |
| 1749 | 3300053737 | Ga0500601_005136 | Ga0500601_005136_39_839 | 264 |
| 1750 | 3300054114 | Ga0501084_0001641 | Ga0501084_0001641_6667_7473 | 264 |
| 1751 | 3300054114 | Ga0501084_0008167 | Ga0501084_0008167_4947_5747 | 264 |
| 1752 | 3300054114 | Ga0501084_0081306 | Ga0501084_0081306_1416_2216 | 264 |
| 1753 | 3300055283 | Ga0500661_007090 | Ga0500661_007090_1129_1929 | 264 |
| 1754 | 3300060353 | Ga0501082_0003572 | Ga0501082_0003572_6761_7561 | 264 |
| 1755 | 3300060353 | Ga0501082_0062470 | Ga0501082_0062470_2209_3015 | 264 |
| 1756 | 3300060353 | Ga0501082_0150757 | Ga0501082_0150757_193_993 | 264 |
| 1757 | 3300001989 | JGI24739J22299_10063256 | JGI24739J22299_100632561 | 265 |
| 1758 | 3300003762 | Ga0055542_1001266 | Ga0055542_10012669 | 265 |
| 1759 | 3300005339 | Ga0070660_100125849 | Ga0070660_1001258492 | 265 |
| 1760 | 3300005356 | Ga0070674_100070086 | Ga0070674_1000700861 | 265 |
| 1761 | 3300006038 | Ga0075365_10028965 | Ga0075365_100289654 | 265 |
| 1762 | 3300006042 | Ga0075368_10018477 | Ga0075368_100184772 | 265 |
| 1763 | 3300006177 | Ga0075362_10043999 | Ga0075362_100439993 | 265 |
| 1764 | 3300025907 | Ga0207645_10307664 | Ga0207645_103076641 | 265 |
| 1765 | 3300026041 | Ga0207639_10815690 | Ga0207639_108156901 | 265 |
| 1766 | 3300026118 | Ga0207675_100909768 | Ga0207675_1009097681 | 265 |
| 1767 | 3300027866 | Ga0209813_10036988 | Ga0209813_100369882 | 265 |
| 1768 | 3300031911 | Ga0307412_10417345 | Ga0307412_104173451 | 265 |
| 1769 | 3300032002 | Ga0307416_100404467 | Ga0307416_1004044672 | 265 |
| 1770 | 3300037418 | Ga0395900_0032409 | Ga0395900_0032409_1898_2695 | 265 |
| 1771 | 3300037418 | Ga0395900_0267352 | Ga0395900_0267352_554_1351 | 265 |
| 1772 | 3300037466 | Ga0395898_0510652 | Ga0395898_0510652_265_1062 | 265 |
| 1773 | 3300038443 | Ga0395901_0681709 | Ga0395901_0681709_59_856 | 265 |
| 1774 | 3300046460 | Ga0495638_0215336 | Ga0495638_0215336_181_978 | 265 |
| 1775 | 3300046522 | Ga0495643_0086141 | Ga0495643_0086141_413_1210 | 265 |
| 1776 | 3300048929 | Ga0496126_0190877 | Ga0496126_0190877_510_1307 | 265 |
| 1777 | 3300049568 | Ga0501031_0027736 | Ga0501031_0027736_2166_2963 | 265 |
| 1778 | 3300049569 | Ga0501032_0000009 | Ga0501032_0000009_128667_129464 | 265 |
| 1779 | 3300049570 | Ga0501033_0000019 | Ga0501033_0000019_98644_99441 | 265 |
| 1780 | 3300049570 | Ga0501033_0504559 | Ga0501033_0504559_20_820 | 265 |
| 1781 | 3300049571 | Ga0501034_0000044 | Ga0501034_0000044_128667_129464 | 265 |
| 1782 | 3300049571 | Ga0501034_0253526 | Ga0501034_0253526_543_1343 | 265 |
| 1783 | 3300049572 | Ga0501036_0000008 | Ga0501036_0000008_128667_129464 | 265 |
| 1784 | 3300049573 | Ga0501037_0000055 | Ga0501037_0000055_65630_66427 | 265 |
| 1785 | 3300049574 | Ga0501038_0000006 | Ga0501038_0000006_128667_129464 | 265 |
| 1786 | 3300049575 | Ga0501039_0000014 | Ga0501039_0000014_98644_99441 | 265 |
| 1787 | 3300049576 | Ga0501040_0034810 | Ga0501040_0034810_549_1346 | 265 |
| 1788 | 3300049579 | Ga0501043_0001366 | Ga0501043_0001366_2173_2970 | 265 |
| 1789 | 3300049581 | Ga0501047_0001105 | Ga0501047_0001105_10836_11633 | 265 |
| 1790 | 3300049586 | Ga0501070_0212993 | Ga0501070_0212993_111_908 | 265 |
| 1791 | 3300049822 | Ga0501035_0000096 | Ga0501035_0000096_44181_44978 | 265 |
| 1792 | 3300049823 | Ga0501044_0000017 | Ga0501044_0000017_98644_99441 | 265 |
| 1793 | 3300050489 | nmdc:mga03683_61382_c1 | nmdc:mga03683_61382_c1_601_1398 | 265 |
| 1794 | 3300050490 | nmdc:mga03n38_98787_c1 | nmdc:mga03n38_98787_c1_244_1041 | 265 |
| 1795 | 3300050495 | nmdc:mga04h51_40454_c1 | nmdc:mga04h51_40454_c1_31_828 | 265 |
| 1796 | 3300053079 | Ga0500610_0066195 | Ga0500610_0066195_1059_1856 | 265 |
| 1797 | 3300053104 | Ga0500556_0000097 | Ga0500556_0000097_76850_77662 | 265 |
| 1798 | 3300053151 | Ga0500604_0004109 | Ga0500604_0004109_2887_3684 | 265 |
| 1799 | 3300053155 | Ga0500620_000290 | Ga0500620_000290_8143_8940 | 265 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1zxi-assembly1.cif.gz_F | reconstituted co dehydrogenase from oligotropha carboxidovorans | 0.9013 | 3 | 261 |
| 1zxi-assembly1.cif.gz_F | reconstituted co dehydrogenase from oligotropha carboxidovorans | 0.8852 | 3 | 261 |
| 1ffv-assembly1.cif.gz_F | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava | 0.8816 | 3 | 261 |
| 1n5w-assembly1.cif.gz_C | crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form | 0.867 | 3 | 261 |
| 7dqx-assembly1.cif.gz_B | crystal structure of xanthine dehydrogenase family protein | 0.8667 | 3 | 261 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6Y7N2_57_165_3.30.465.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9521 | 63 | 163 | 3.30.465.10 |
| 1t3qF02 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9461 | 54 | 166 | 3.30.465.10 |
| 1ffvC03 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9389 | 56 | 163 | 3.30.465.10 |
| af_Q46800_56_173_3.30.465.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9294 | 55 | 164 | 3.30.465.10 |
| af_P64557_52_156_3.30.465.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9017 | 55 | 163 | 3.30.465.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A527DEU0-F1-model_v4 | Carbon monoxide dehydrogenase | 0.9968 | 132 | 263 |
|
| AF-A0A3S1U3F1-F1-model_v4 | deleted | 0.995 | 145 | 263 |
|
| AF-A0A529ZII5-F1-model_v4 | Carbon monoxide dehydrogenase | 0.9909 | 186 | 263 |
|
| AF-A0A2S6TG65-F1-model_v4 | FAD-binding PCMH-type domain-containing protein | 0.9899 | 56 | 260 |
GO:0016491
GO:0071949 |
| AF-A0A659UIX0-F1-model_v4 | Carbon monoxide dehydrogenase | 0.9807 | 63 | 164 |
GO:0016491
GO:0071949 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar