F495673

General Info

Members Datasets Scaffolds Average Seq Length
1779 680 1233 408

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0052392|Ga0466959_0052392_1350_2846
Length 498
Sequence MVRVASQRARRKPVSPSLGCRGPIRLGGRSSAKPNPLFVSLHQPQLAGCNNRFAPPNNAKLASACAACETWRKQNGQNKTKREKTMPALKRRLISIAVLAAAXXLAASGAEAQKKYDPGASDTEIKIGNIMPYSGPASSYGVIGLTEKAYFDMINDQGGINGRKVKFITYDDGYSPPKAIEQARKLVESDEVLFIFQSLGTPSNSAIQKYMNAKKVPQLFVATGATKWGDPKNFPWTMGWQPNYQSEGRIYGKYILEHFPDAKIAVFWQNDDAGKDQVKGLRDGLGDKADKMIIADKSYEVSDPSIDSQIVALRDSGADTFFSWAAPKGSAQAIRKVGEIGWKPRFFLANVSTSVAGVLKPAGLENAKGIISSAYLKDPTDPAWKDDAGIKAWRAFMDKYYPEGDKLNSNNVYGYAVAQTMVQVLKQCGDDLTRENIMKQAASLKDFSSEVMLPGIKINTSPDDFFPIEQMQLMKFDGEAWHLFGDVITGEVGHETTH

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
8 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
9 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
10 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
11 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
12 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
13 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
14 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
15 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
16 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
17 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
18 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
19 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
20 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
21 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
22 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
23 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
24 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
25 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
26 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
27 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
28 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
29 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
30 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
31 2791355199
32 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
33 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
34 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
35 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
36 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
37 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
38 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
39 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
40 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
41 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
42 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
43 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
44 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
45 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
46 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
47 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
48 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
49 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
50 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
51 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
52 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
53 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
54 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
55 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
56 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
57 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
58 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
59 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
60 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
61 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
62 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
63 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
64 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
65 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
66 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
67 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
68 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
69 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
70 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
71 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
72 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
73 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
74 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
75 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
76 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
77 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
78 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
79 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
80 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
81 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
82 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
83 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
84 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
85 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
86 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
87 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
88 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
89 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
90 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
91 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
92 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
93 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
94 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
95 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
96 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
97 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
98 2904699407
99 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
100 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
101 2906610324
102 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
103 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
104 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
105 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
106 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
107 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
108 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
109 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
110 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
111 2922368715
112 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
113 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
114 2922425934
115 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
116 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
117 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
118 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
119 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
120 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
121 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
122 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
123 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
124 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
125 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
126 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
127 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
128 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
129 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
130 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
131 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
132 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
133 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
134 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
135 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
136 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
137 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
138 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
139 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
140 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
141 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
142 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
143 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
144 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
145 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
146 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
147 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
148 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
149 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
150 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
151 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
152 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
153 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
154 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
155 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
156 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
157 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
158 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
159 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
160 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
161 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
162 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
163 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
164 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
165 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
166 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
167 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
168 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
169 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
170 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
171 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
172 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
173 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
174 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
175 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
176 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
177 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
178 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
179 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
180 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
181 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
182 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
183 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
184 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
185 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
186 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
187 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
188 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
189 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
190 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
191 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
193 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
194 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
195 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
196 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
197 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
198 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
199 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
200 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
201 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
202 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
203 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
204 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
205 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
206 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
207 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
208 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
209 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
210 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
211 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
212 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
213 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
214 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
215 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
216 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
217 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
218 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
219 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
220 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
221 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
222 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
223 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
224 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
225 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
226 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
227 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
228 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
229 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
230 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
231 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
232 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
233 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
234 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
235 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
236 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
237 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
238 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
239 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
240 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
241 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
242 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
243 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
244 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
245 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
246 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
247 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
248 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
249 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
250 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
251 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
252 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
253 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
254 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
255 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
256 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
257 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
258 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
259 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
260 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
261 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
262 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
263 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
264 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
265 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
266 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
267 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
268 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
269 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
270 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
271 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
272 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
273 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
274 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
275 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
276 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
277 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
278 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
279 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
280 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
281 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
282 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
283 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
284 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
285 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
286 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
287 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
288 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
289 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
290 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
291 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
292 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
293 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
294 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
295 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
296 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
297 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
298 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
299 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
301 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
302 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
303 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
304 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
305 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
306 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
307 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
308 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
309 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
310 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
311 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
312 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
313 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
314 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
315 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
371 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
372 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
373 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
376 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
377 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
381 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
382 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
383 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
384 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
385 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
386 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
387 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
388 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
389 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
390 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
391 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
392 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
393 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
394 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
395 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
396 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
397 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
398 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
399 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
400 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
401 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
402 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
403 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
404 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
405 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
406 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
407 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
408 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
409 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
410 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
411 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
412 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
413 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
414 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
415 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
416 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
417 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
418 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
419 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
420 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
421 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
422 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
423 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
424 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
425 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
426 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
427 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
428 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
429 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
430 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
431 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
432 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
433 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
434 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
435 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
436 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
437 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
438 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
439 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
440 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
441 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
442 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
443 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
444 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
445 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
446 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
447 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
448 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
449 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
450 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
451 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
452 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
453 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
454 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
455 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
456 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
457 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
458 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
459 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
460 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
461 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
462 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
463 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
464 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
465 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
466 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
467 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
468 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
469 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
470 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
471 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
472 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
473 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
474 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
475 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
476 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
477 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
478 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
479 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
480 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
481 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
482 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
483 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
484 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
485 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
486 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
487 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
488 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
489 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
490 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
491 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
492 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
493 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
494 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
495 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
496 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
497 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
498 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
499 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
500 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
501 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
502 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
503 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
504 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
505 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
506 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
507 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
508 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
509 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
510 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
511 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
512 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
513 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
514 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
515 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
516 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
517 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
518 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
519 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
520 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
521 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
522 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
523 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
524 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
525 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
526 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
527 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
528 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
529 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
530 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
531 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
532 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
533 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
534 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
535 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
536 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
537 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
538 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
539 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
540 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
541 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
542 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
543 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
544 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
545 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
546 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
547 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
548 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
549 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
550 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
551 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
552 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
553 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
554 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
555 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
556 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
557 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
558 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
559 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
560 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
561 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
562 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
563 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
564 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
565 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
566 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
567 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
568 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
569 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
570 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
571 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
572 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
573 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
574 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
575 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
576 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
577 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
578 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
579 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
580 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
581 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
582 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
583 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
584 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
585 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
586 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
587 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
588 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
589 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
590 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
591 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
592 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
593 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
594 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
595 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
596 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
597 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
598 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
599 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
600 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
601 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
602 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
603 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
604 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
605 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
606 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
607 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
608 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
609 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
610 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
611 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
612 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
613 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
614 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
615 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
616 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
617 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
618 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
619 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
620 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
621 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
622 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
623 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
624 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
625 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
626 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
627 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
628 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
629 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
630 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
631 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
632 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
633 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
634 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
635 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
636 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
637 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
638 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
639 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
640 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
641 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
642 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
643 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
644 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
645 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
646 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
647 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
648 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
649 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
650 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
651 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
652 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
653 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
654 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
655 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
656 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
657 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
658 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
659 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
660 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
661 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
662 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
663 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
664 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
665 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
666 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
667 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
668 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
669 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
670 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
671 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
672 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
673 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
674 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
675 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
676 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
677 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
678 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
679 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
680 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.93
Metatranscriptomes 0.62
Isolates 18.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.5
Nodule 13.43
Rhizoplane 5.06
Rhizosphere 59.75
Stem 0
Stem Tuber 0
Unclassified 12.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1005163 3300000549 Bacteria 1666
2 LJQas_1007993 3300000549 Bacteria 1295
3 JGI25406J46586_10000081 3300003203 Bacteria 43450
4 JGI25406J46586_10005250 3300003203 Bacteria 6010
5 JGI25406J46586_10008729 3300003203 Bacteria 4567
6 JGI25406J46586_10010371 3300003203 Bacteria 4136
7 JGI25153J46596_10000946 3300003215 Bacteria 17627
8 JGI25153J46596_10001097 3300003215 Bacteria 16465
9 JGI25153J46596_10006710 3300003215 Bacteria 5781
10 JGI25153J46596_10015079 3300003215 Bacteria 3171
11 JGI25404J52841_10000269 3300003659 Bacteria 6604
12 JGI25404J52841_10001487 3300003659 Bacteria 4136
13 JGI25404J52841_10007004 3300003659 Bacteria 2372
14 JGI25405J52794_10012251 3300003911 Bacteria 1649
15 Ga0058861_11933975 3300004800 Bacteria 1277
16 Ga0065165_1002365 3300005262 Bacteria 16315
17 Ga0070658_10015568 3300005327 Bacteria 6082
18 Ga0070658_10033545 3300005327 Bacteria 4131
19 Ga0070683_100006494 3300005329 Bacteria 9820
20 Ga0070683_100088981 3300005329 Bacteria 2897
21 Ga0070683_100138095 3300005329 Bacteria 2309
22 Ga0070683_100282663 3300005329 Bacteria 1578
23 Ga0068869_100029096 3300005334 Bacteria 3867
24 Ga0068869_100039424 3300005334 Bacteria 3372
25 Ga0070666_10080750 3300005335 Bacteria 2223
26 Ga0070680_100001453 3300005336 Bacteria 17175
27 Ga0070680_100008461 3300005336 Bacteria 7879
28 Ga0070680_100009025 3300005336 Bacteria 7646
29 Ga0070680_100020597 3300005336 Bacteria 5236
30 Ga0070680_100023945 3300005336 Bacteria 4874
31 Ga0070680_100124543 3300005336 Bacteria 2153
32 Ga0070680_100211331 3300005336 Bacteria 1637
33 Ga0070680_100261936 3300005336 Bacteria 1463
34 Ga0070682_100050250 3300005337 Bacteria 2602
35 Ga0070682_100163042 3300005337 Bacteria 1542
36 Ga0068868_100147843 3300005338 Bacteria 1933
37 Ga0070660_100012369 3300005339 Bacteria 6092
38 Ga0070660_100016156 3300005339 Bacteria 5411
39 Ga0070691_10058906 3300005341 Bacteria 1845
40 Ga0070661_100042475 3300005344 Bacteria 3318
41 Ga0070661_100072768 3300005344 Bacteria 2530
42 Ga0070668_100013950 3300005347 Bacteria 6008
43 Ga0070668_100133195 3300005347 Bacteria 1996
44 Ga0070668_100185248 3300005347 Bacteria 1702
45 Ga0070671_100010559 3300005355 Bacteria 7415
46 Ga0070671_100046849 3300005355 Bacteria 3596
47 Ga0070674_100008705 3300005356 Bacteria 6053
48 Ga0070688_100047848 3300005365 Bacteria 2655
49 Ga0070659_100107317 3300005366 Bacteria 2251
50 Ga0070659_100158179 3300005366 Bacteria 1852
51 Ga0070709_10001137 3300005434 Bacteria 14661
52 Ga0070709_10025182 3300005434 Bacteria 3513
53 Ga0070709_10040088 3300005434 Bacteria 2877
54 Ga0070709_10059854 3300005434 Bacteria 2419
55 Ga0070709_10129692 3300005434 Bacteria 1720
56 Ga0070714_100007296 3300005435 Bacteria 8595
57 Ga0070714_100018594 3300005435 Bacteria 5648
58 Ga0070714_100064176 3300005435 Bacteria 3160
59 Ga0070714_100154815 3300005435 Bacteria 2068
60 Ga0070714_100160787 3300005435 Bacteria 2032
61 Ga0070714_100319290 3300005435 Bacteria 1452
62 Ga0070713_100004722 3300005436 Bacteria 9209
63 Ga0070713_100011248 3300005436 Bacteria 6509
64 Ga0070713_100038019 3300005436 Bacteria 3896
65 Ga0070713_100049823 3300005436 Bacteria 3457
66 Ga0070713_100145904 3300005436 Bacteria 2101
67 Ga0070713_100168114 3300005436 Bacteria 1962
68 Ga0070713_100189284 3300005436 Bacteria 1854
69 Ga0070710_10001311 3300005437 Bacteria 11760
70 Ga0070710_10015995 3300005437 Bacteria 3808
71 Ga0070710_10028352 3300005437 Bacteria 2994
72 Ga0070711_100006268 3300005439 Bacteria 7166
73 Ga0070711_100007928 3300005439 Bacteria 6476
74 Ga0070711_100010485 3300005439 Bacteria 5738
75 Ga0070711_100020416 3300005439 Bacteria 4269
76 Ga0070711_100025037 3300005439 Bacteria 3900
77 Ga0070711_100031873 3300005439 Bacteria 3502
78 Ga0070711_100037198 3300005439 Bacteria 3264
79 Ga0070711_100191343 3300005439 Bacteria 1573
80 Ga0070700_100071112 3300005441 Bacteria 2220
81 Ga0070663_100004678 3300005455 Bacteria 8070
82 Ga0070663_100012907 3300005455 Bacteria 5303
83 Ga0070663_100017721 3300005455 Bacteria 4654
84 Ga0070663_100040232 3300005455 Bacteria 3271
85 Ga0070663_100044931 3300005455 Bacteria 3118
86 Ga0070663_100076612 3300005455 Bacteria 2446
87 Ga0070678_100016331 3300005456 Bacteria 4747
88 Ga0070678_100121784 3300005456 Bacteria 2058
89 Ga0070662_100065903 3300005457 Bacteria 2656
90 Ga0070662_100080615 3300005457 Bacteria 2423
91 Ga0070681_10000334 3300005458 Bacteria 38316
92 Ga0070681_10006811 3300005458 Bacteria 11120
93 Ga0070681_10007089 3300005458 Bacteria 10914
94 Ga0070681_10033074 3300005458 Bacteria 5191
95 Ga0070681_10036430 3300005458 Bacteria 4940
96 Ga0070681_10049053 3300005458 Bacteria 4217
97 Ga0070681_10057183 3300005458 Bacteria 3880
98 Ga0070681_10085897 3300005458 Bacteria 3099
99 Ga0070681_10089143 3300005458 Bacteria 3036
100 Ga0070681_10227118 3300005458 Bacteria 1781
101 Ga0070706_100085005 3300005467 Bacteria 2932
102 Ga0070707_100090716 3300005468 Bacteria 2958
103 Ga0070698_100071439 3300005471 Bacteria 3481
104 Ga0070699_100016664 3300005518 Bacteria 6307
105 Ga0070679_100005911 3300005530 Bacteria 11370
106 Ga0070679_100014819 3300005530 Bacteria 7490
107 Ga0070679_100042235 3300005530 Bacteria 4540
108 Ga0070679_100213723 3300005530 Bacteria 1891
109 Ga0070679_100251754 3300005530 Bacteria 1722
110 Ga0070684_100007203 3300005535 Bacteria 8643
111 Ga0070684_100034954 3300005535 Bacteria 4299
112 Ga0070684_100056336 3300005535 Bacteria 3430
113 Ga0070684_100192082 3300005535 Bacteria 1858
114 Ga0070697_100002686 3300005536 Bacteria 13689
115 Ga0070697_100128235 3300005536 Bacteria 2126
116 Ga0068853_100014772 3300005539 Bacteria 6408
117 Ga0068853_100023239 3300005539 Bacteria 5187
118 Ga0068853_100044215 3300005539 Bacteria 3812
119 Ga0068853_100044472 3300005539 Bacteria 3802
120 Ga0068853_100078359 3300005539 Bacteria 2888
121 Ga0068853_100094862 3300005539 Bacteria 2630
122 Ga0068853_100202940 3300005539 Bacteria 1805
123 Ga0068853_100213461 3300005539 Bacteria 1760
124 Ga0070672_100060534 3300005543 Bacteria 2981
125 Ga0070695_100004100 3300005545 Bacteria 8516
126 Ga0070695_100141411 3300005545 Bacteria 1669
127 Ga0070696_100102446 3300005546 Bacteria 2053
128 Ga0070693_100036628 3300005547 Bacteria 2729
129 Ga0070693_100069677 3300005547 Bacteria 2067
130 Ga0070665_100026819 3300005548 Bacteria 5804
131 Ga0070665_100047689 3300005548 Bacteria 4299
132 Ga0070665_100059932 3300005548 Bacteria 3815
133 Ga0070665_100151430 3300005548 Bacteria 2322
134 Ga0070665_100200140 3300005548 Bacteria 1998
135 Ga0070665_100232941 3300005548 Bacteria 1842
136 Ga0070665_100308563 3300005548 Bacteria 1586
137 Ga0070704_100145858 3300005549 Bacteria 1854
138 Ga0068855_100010185 3300005563 Bacteria 11331
139 Ga0068855_100016594 3300005563 Bacteria 8856
140 Ga0068855_100065209 3300005563 Bacteria 4246
141 Ga0068855_100093726 3300005563 Bacteria 3463
142 Ga0068855_100188478 3300005563 Bacteria 2328
143 Ga0068855_100279671 3300005563 Bacteria 1854
144 Ga0068855_100281991 3300005563 Bacteria 1844
145 Ga0068855_100324296 3300005563 Bacteria 1701
146 Ga0070664_100036128 3300005564 Bacteria 4150
147 Ga0068857_100006806 3300005577 Bacteria 9841
148 Ga0068854_100188544 3300005578 Bacteria 1615
149 Ga0068854_100218555 3300005578 Bacteria 1506
150 Ga0068856_100000137 3300005614 Bacteria 73762
151 Ga0068856_100105225 3300005614 Bacteria 2816
152 Ga0068856_100333703 3300005614 Bacteria 1534
153 Ga0070702_100065769 3300005615 Bacteria 2124
154 Ga0068852_100015965 3300005616 Bacteria 5845
155 Ga0068852_100020420 3300005616 Bacteria 5268
156 Ga0068852_100028224 3300005616 Bacteria 4588
157 Ga0068852_100212311 3300005616 Bacteria 1837
158 Ga0068859_100115759 3300005617 Bacteria 2745
159 Ga0068859_100448322 3300005617 Bacteria 1386
160 Ga0068864_100034489 3300005618 Bacteria 4305
161 Ga0068864_100056367 3300005618 Bacteria 3395
162 Ga0068861_100199288 3300005719 Bacteria 1679
163 Ga0068851_10020979 3300005834 Bacteria 3169
164 Ga0068858_100057565 3300005842 Bacteria 3592
165 Ga0068858_100099558 3300005842 Bacteria 2710
166 Ga0068860_100004689 3300005843 Bacteria 13947
167 Ga0068860_100005520 3300005843 Bacteria 12804
168 Ga0068862_100088228 3300005844 Bacteria 2698
169 Ga0068862_100105231 3300005844 Bacteria 2473
170 Ga0068862_100126218 3300005844 Bacteria 2259
171 Ga0068862_100131689 3300005844 Bacteria 2212
172 Ga0068862_100282963 3300005844 Bacteria 1520
173 Ga0081455_10000763 3300005937 Bacteria 41769
174 Ga0081455_10003860 3300005937 Bacteria 17086
175 Ga0081455_10004479 3300005937 Bacteria 15634
176 Ga0081455_10006164 3300005937 Bacteria 12931
177 Ga0081455_10006808 3300005937 Bacteria 12185
178 Ga0081455_10010534 3300005937 Bacteria 9369
179 Ga0081455_10017893 3300005937 Bacteria 6773
180 Ga0081455_10037055 3300005937 Bacteria 4335
181 Ga0081455_10037166 3300005937 Bacteria 4328
182 Ga0081455_10063174 3300005937 Bacteria 3108
183 Ga0081455_10078440 3300005937 Bacteria 2714
184 Ga0081540_1001487 3300005983 Bacteria 20239
185 Ga0081540_1002682 3300005983 Bacteria 14479
186 Ga0081540_1003332 3300005983 Bacteria 12739
187 Ga0081540_1003389 3300005983 Bacteria 12636
188 Ga0081540_1003768 3300005983 Bacteria 11873
189 Ga0081540_1004916 3300005983 Bacteria 10063
190 Ga0081540_1006034 3300005983 Bacteria 8913
191 Ga0081540_1006810 3300005983 Bacteria 8257
192 Ga0081540_1010678 3300005983 Bacteria 6194
193 Ga0081540_1011165 3300005983 Bacteria 6028
194 Ga0081540_1012123 3300005983 Bacteria 5701
195 Ga0081540_1013542 3300005983 Bacteria 5295
196 Ga0081540_1013655 3300005983 Bacteria 5266
197 Ga0081540_1026650 3300005983 Bacteria 3292
198 Ga0081540_1028625 3300005983 Bacteria 3124
199 Ga0081540_1028785 3300005983 Bacteria 3110
200 Ga0081540_1032911 3300005983 Bacteria 2822
201 Ga0081540_1036933 3300005983 Bacteria 2597
202 Ga0081540_1043566 3300005983 Bacteria 2300
203 Ga0081540_1045754 3300005983 Bacteria 2218
204 Ga0081540_1045808 3300005983 Bacteria 2216
205 Ga0081539_10000157 3300005985 Bacteria 158278
206 Ga0081539_10000461 3300005985 Bacteria 86158
207 Ga0081539_10000498 3300005985 Bacteria 82216
208 Ga0081539_10006394 3300005985 Bacteria 11332
209 Ga0081539_10010685 3300005985 Bacteria 7401
210 Ga0081539_10027357 3300005985 Bacteria 3614
211 Ga0081539_10031508 3300005985 Bacteria 3266
212 Ga0081539_10044031 3300005985 Bacteria 2580
213 Ga0081539_10078330 3300005985 Bacteria 1745
214 Ga0070717_10001987 3300006028 Bacteria 14301
215 Ga0070717_10012926 3300006028 Bacteria 6377
216 Ga0070717_10017205 3300006028 Bacteria 5619
217 Ga0070717_10018197 3300006028 Bacteria 5483
218 Ga0070717_10285649 3300006028 Bacteria 1464
219 Ga0075365_10036401 3300006038 Bacteria 3188
220 Ga0075365_10086729 3300006038 Bacteria 2127
221 Ga0075365_10095798 3300006038 Bacteria 2027
222 Ga0075368_10024474 3300006042 Bacteria 2313
223 Ga0075368_10028024 3300006042 Bacteria 2175
224 Ga0075363_100060782 3300006048 Bacteria 2035
225 Ga0075363_100123093 3300006048 Bacteria 1450
226 Ga0075364_10035769 3300006051 Bacteria 3210
227 Ga0075364_10038215 3300006051 Bacteria 3110
228 Ga0075364_10071813 3300006051 Bacteria 2280
229 Ga0075364_10133529 3300006051 Bacteria 1667
230 Ga0075364_10187394 3300006051 Bacteria 1401
231 Ga0070715_10022143 3300006163 Bacteria 2474
232 Ga0070716_100016735 3300006173 Bacteria 3789
233 Ga0070716_100071765 3300006173 Bacteria 2036
234 Ga0070712_100005053 3300006175 Bacteria 8169
235 Ga0070712_100012567 3300006175 Bacteria 5384
236 Ga0070712_100020530 3300006175 Bacteria 4323
237 Ga0070712_100127313 3300006175 Bacteria 1926
238 Ga0075362_10006528 3300006177 Bacteria 4355
239 Ga0075367_10036930 3300006178 Bacteria 2836
240 Ga0075367_10037202 3300006178 Bacteria 2827
241 Ga0075367_10063200 3300006178 Bacteria 2213
242 Ga0075369_10002161 3300006186 Bacteria 6949
243 Ga0075369_10043684 3300006186 Bacteria 1924
244 Ga0097621_100026198 3300006237 Bacteria 4571
245 Ga0097621_100290353 3300006237 Bacteria 1442
246 Ga0075370_10056246 3300006353 Bacteria 2236
247 Ga0075370_10124613 3300006353 Bacteria 1501
248 Ga0068871_100053850 3300006358 Bacteria 3263
249 Ga0075434_100026575 3300006871 Bacteria 5672
250 Ga0075434_100059277 3300006871 Bacteria 3805
251 Ga0075436_100000818 3300006914 Bacteria 20692
252 Ga0075436_100200315 3300006914 Bacteria 1414
253 Ga0097620_100115762 3300006931 Bacteria 2745
254 Ga0097620_100448327 3300006931 Bacteria 1386
255 Ga0099824_1022298 3300006942 Bacteria 4205
256 Ga0099822_1000541 3300006943 Bacteria 35996
257 Ga0075435_100211501 3300007076 Bacteria 1646
258 Ga0075435_100289587 3300007076 Bacteria 1399
259 Ga0099794_10001086 3300007265 Bacteria 9307
260 Ga0099794_10041225 3300007265 Bacteria 2198
261 Ga0099794_10044158 3300007265 Bacteria 2129
262 Ga0099795_10031241 3300007788 Bacteria 1832
263 Ga0099795_10034527 3300007788 Bacteria 1762
264 Ga0105240_10003976 3300009093 Bacteria 22811
265 Ga0105240_10004565 3300009093 Bacteria 21001
266 Ga0105240_10005539 3300009093 Bacteria 18804
267 Ga0105240_10018312 3300009093 Bacteria 9413
268 Ga0105240_10063527 3300009093 Bacteria 4593
269 Ga0105240_10065154 3300009093 Bacteria 4524
270 Ga0105240_10067861 3300009093 Bacteria 4419
271 Ga0105240_10092667 3300009093 Bacteria 3689
272 Ga0105240_10101428 3300009093 Bacteria 3500
273 Ga0111539_10100579 3300009094 Bacteria 3395
274 Ga0105245_10137830 3300009098 Bacteria 2295
275 Ga0105247_10016302 3300009101 Bacteria 4451
276 Ga0105247_10072239 3300009101 Bacteria 2159
277 Ga0105243_10083696 3300009148 Bacteria 2611
278 Ga0105241_10047810 3300009174 Bacteria 3254
279 Ga0105241_10133754 3300009174 Bacteria 2011
280 Ga0105242_10035665 3300009176 Bacteria 3988
281 Ga0105248_10052124 3300009177 Bacteria 4592
282 Ga0105248_10295530 3300009177 Bacteria 1824
283 Ga0105237_10008293 3300009545 Bacteria 11279
284 Ga0105237_10012769 3300009545 Bacteria 8834
285 Ga0105237_10028530 3300009545 Bacteria 5683
286 Ga0105237_10034905 3300009545 Bacteria 5090
287 Ga0105237_10062821 3300009545 Bacteria 3713
288 Ga0105237_10091803 3300009545 Bacteria 3026
289 Ga0105237_10108190 3300009545 Bacteria 2772
290 Ga0105238_10001848 3300009551 Bacteria 21222
291 Ga0105238_10008924 3300009551 Bacteria 10035
292 Ga0105238_10069691 3300009551 Bacteria 3517
293 Ga0105238_10126795 3300009551 Bacteria 2531
294 Ga0105238_10147307 3300009551 Bacteria 2330
295 Ga0105238_10174752 3300009551 Bacteria 2124
296 Ga0105249_10030655 3300009553 Bacteria 4863
297 Ga0099796_10015701 3300010159 Bacteria 2219
298 Ga0099796_10025862 3300010159 Bacteria 1858
299 Ga0099796_10034029 3300010159 Bacteria 1681
300 Ga0099796_10047678 3300010159 Bacteria 1475
301 Ga0105239_10002860 3300010375 Bacteria 21608
302 Ga0105239_10005709 3300010375 Bacteria 14530
303 Ga0105239_10023763 3300010375 Bacteria 6749
304 Ga0105239_10025364 3300010375 Bacteria 6527
305 Ga0105239_10074969 3300010375 Bacteria 3720
306 Ga0105239_10079453 3300010375 Bacteria 3610
307 Ga0105239_10225081 3300010375 Bacteria 2104
308 Ga0105239_10244105 3300010375 Bacteria 2016
309 Ga0105246_10021293 3300011119 Bacteria 4171
310 Ga0157371_10008618 3300013102 Bacteria 8099
311 Ga0157370_10009093 3300013104 Bacteria 10655
312 Ga0157370_10077342 3300013104 Bacteria 3135
313 Ga0157370_10080805 3300013104 Bacteria 3061
314 Ga0157370_10113934 3300013104 Bacteria 2526
315 Ga0157369_10005973 3300013105 Bacteria 14139
316 Ga0157369_10006548 3300013105 Bacteria 13480
317 Ga0157369_10012428 3300013105 Bacteria 9664
318 Ga0157374_10043720 3300013296 Bacteria 4139
319 Ga0157374_10081460 3300013296 Bacteria 3072
320 Ga0157374_10236546 3300013296 Bacteria 1795
321 Ga0157378_10242799 3300013297 Bacteria 1721
322 Ga0157378_10287767 3300013297 Bacteria 1586
323 Ga0163162_10039795 3300013306 Bacteria 4698
324 Ga0163162_10054876 3300013306 Bacteria 4009
325 Ga0163162_10083787 3300013306 Bacteria 3263
326 Ga0163162_10105789 3300013306 Bacteria 2908
327 Ga0157372_10139778 3300013307 Bacteria 2789
328 Ga0157372_10169325 3300013307 Bacteria 2527
329 Ga0157372_10300846 3300013307 Bacteria 1866
330 Ga0157372_10323711 3300013307 Bacteria 1795
331 Ga0157375_10062338 3300013308 Bacteria 3705
332 Ga0157375_10075145 3300013308 Bacteria 3403
333 Ga0157375_10283338 3300013308 Bacteria 1820
334 Ga0163163_10032096 3300014325 Bacteria 5073
335 Ga0163163_10032957 3300014325 Bacteria 5007
336 Ga0163163_10035053 3300014325 Bacteria 4865
337 Ga0163163_10043559 3300014325 Bacteria 4400
338 Ga0163163_10055746 3300014325 Bacteria 3906
339 Ga0157380_10104142 3300014326 Bacteria 2369
340 Ga0182008_10000392 3300014497 Bacteria 33955
341 Ga0157379_10181050 3300014968 Bacteria 1904
342 Ga0157379_10206082 3300014968 Bacteria 1779
343 Ga0157376_10075664 3300014969 Bacteria 2874
344 Ga0157376_10101065 3300014969 Bacteria 2519
345 Ga0157376_10284137 3300014969 Bacteria 1559
346 Ga0206356_11666168 3300020070 Bacteria 2767
347 Ga0154015_1059841 3300020610 Bacteria 1907
348 Ga0214544_1000011 3300021320 Bacteria 262952
349 Ga0214542_1000009 3300021321 Bacteria 262861
350 Ga0214545_1000007 3300021324 Bacteria 262984
351 Ga0214543_1000020 3300021327 Bacteria 262861
352 Ga0213874_10016822 3300021377 Bacteria 1954
353 Ga0213876_10000505 3300021384 Bacteria 30368
354 Ga0213876_10003691 3300021384 Bacteria 8687
355 Ga0213876_10005094 3300021384 Bacteria 7245
356 Ga0213875_10006397 3300021388 Bacteria 6189
357 Ga0213871_10005083 3300021441 Bacteria 2687
358 Ga0209148_1000300 3300025254 Bacteria 71458
359 Ga0209233_1008056 3300025261 Bacteria 3290
360 Ga0209233_1009149 3300025261 Bacteria 3027
361 Ga0209233_1017786 3300025261 Bacteria 1928
362 Ga0209455_1002020 3300025272 Bacteria 8284
363 Ga0209455_1018117 3300025272 Bacteria 1455
364 Ga0209564_1002404 3300025295 Bacteria 14939
365 Ga0209758_1001864 3300025297 Bacteria 23116
366 Ga0209758_1004355 3300025297 Bacteria 11860
367 Ga0209758_1005849 3300025297 Bacteria 9184
368 Ga0209758_1036184 3300025297 Bacteria 1932
369 Ga0209758_1056617 3300025297 Bacteria 1323
370 Ga0207426_1003391 3300025302 Bacteria 8727
371 Ga0209257_1003528 3300025304 Bacteria 13303
372 Ga0207697_10054805 3300025315 Bacteria 1653
373 Ga0207656_10002790 3300025321 Bacteria 5934
374 Ga0207692_10000103 3300025898 Bacteria 24933
375 Ga0207692_10042096 3300025898 Bacteria 2265
376 Ga0207710_10041804 3300025900 Bacteria 2034
377 Ga0207688_10045802 3300025901 Bacteria 2440
378 Ga0207680_10209214 3300025903 Bacteria 1333
379 Ga0207647_10053435 3300025904 Bacteria 2489
380 Ga0207647_10060038 3300025904 Bacteria 2325
381 Ga0207647_10086530 3300025904 Bacteria 1873
382 Ga0207685_10008782 3300025905 Bacteria 2900
383 Ga0207699_10003630 3300025906 Bacteria 7376
384 Ga0207699_10019947 3300025906 Bacteria 3585
385 Ga0207699_10036754 3300025906 Bacteria 2794
386 Ga0207699_10059907 3300025906 Bacteria 2283
387 Ga0207699_10168253 3300025906 Bacteria 1464
388 Ga0207645_10097546 3300025907 Bacteria 1894
389 Ga0207643_10047938 3300025908 Bacteria 2419
390 Ga0207643_10121257 3300025908 Bacteria 1549
391 Ga0207705_10036015 3300025909 Bacteria 3542
392 Ga0207705_10090067 3300025909 Bacteria 2245
393 Ga0207684_10072801 3300025910 Bacteria 2918
394 Ga0207654_10033436 3300025911 Bacteria 2851
395 Ga0207654_10042159 3300025911 Bacteria 2581
396 Ga0207654_10152138 3300025911 Bacteria 1486
397 Ga0207707_10000134 3300025912 Bacteria 77031
398 Ga0207707_10000143 3300025912 Bacteria 74226
399 Ga0207707_10000613 3300025912 Bacteria 35676
400 Ga0207707_10006061 3300025912 Bacteria 10577
401 Ga0207707_10009454 3300025912 Bacteria 8452
402 Ga0207707_10030486 3300025912 Bacteria 4718
403 Ga0207707_10031981 3300025912 Bacteria 4606
404 Ga0207707_10075781 3300025912 Bacteria 2936
405 Ga0207707_10088754 3300025912 Bacteria 2701
406 Ga0207707_10101835 3300025912 Bacteria 2510
407 Ga0207695_10000006 3300025913 Bacteria 1135309
408 Ga0207695_10000478 3300025913 Bacteria 86076
409 Ga0207695_10009613 3300025913 Bacteria 11939
410 Ga0207695_10051447 3300025913 Bacteria 4326
411 Ga0207695_10081064 3300025913 Bacteria 3285
412 Ga0207695_10084884 3300025913 Bacteria 3196
413 Ga0207695_10166308 3300025913 Bacteria 2134
414 Ga0207695_10170178 3300025913 Bacteria 2104
415 Ga0207695_10215991 3300025913 Bacteria 1827
416 Ga0207671_10005733 3300025914 Bacteria 11323
417 Ga0207671_10008011 3300025914 Bacteria 9044
418 Ga0207671_10034723 3300025914 Bacteria 3746
419 Ga0207671_10053909 3300025914 Bacteria 2980
420 Ga0207671_10131498 3300025914 Bacteria 1921
421 Ga0207671_10144607 3300025914 Bacteria 1834
422 Ga0207671_10156990 3300025914 Bacteria 1760
423 Ga0207671_10166660 3300025914 Bacteria 1709
424 Ga0207693_10001154 3300025915 Bacteria 23558
425 Ga0207693_10012236 3300025915 Bacteria 6934
426 Ga0207693_10024298 3300025915 Bacteria 4811
427 Ga0207693_10033293 3300025915 Bacteria 4067
428 Ga0207693_10033987 3300025915 Bacteria 4023
429 Ga0207693_10156289 3300025915 Bacteria 1794
430 Ga0207663_10000733 3300025916 Bacteria 14676
431 Ga0207663_10008134 3300025916 Bacteria 5467
432 Ga0207663_10010912 3300025916 Bacteria 4854
433 Ga0207663_10025363 3300025916 Bacteria 3426
434 Ga0207663_10038827 3300025916 Bacteria 2881
435 Ga0207663_10088076 3300025916 Bacteria 2052
436 Ga0207663_10098560 3300025916 Bacteria 1957
437 Ga0207663_10160246 3300025916 Bacteria 1587
438 Ga0207660_10001451 3300025917 Bacteria 15916
439 Ga0207660_10047050 3300025917 Bacteria 3048
440 Ga0207660_10047550 3300025917 Bacteria 3034
441 Ga0207660_10050275 3300025917 Bacteria 2959
442 Ga0207657_10003960 3300025919 Bacteria 15723
443 Ga0207657_10220505 3300025919 Bacteria 1520
444 Ga0207649_10097219 3300025920 Bacteria 1941
445 Ga0207649_10116415 3300025920 Bacteria 1795
446 Ga0207652_10008026 3300025921 Bacteria 8473
447 Ga0207652_10018163 3300025921 Bacteria 5764
448 Ga0207652_10024167 3300025921 Bacteria 5040
449 Ga0207652_10045026 3300025921 Bacteria 3761
450 Ga0207652_10101709 3300025921 Bacteria 2539
451 Ga0207652_10133098 3300025921 Bacteria 2219
452 Ga0207652_10200726 3300025921 Bacteria 1795
453 Ga0207646_10208713 3300025922 Bacteria 1764
454 Ga0207681_10148127 3300025923 Bacteria 1756
455 Ga0207694_10003812 3300025924 Bacteria 11930
456 Ga0207694_10027026 3300025924 Bacteria 4369
457 Ga0207694_10031956 3300025924 Bacteria 4025
458 Ga0207694_10057603 3300025924 Bacteria 3021
459 Ga0207694_10065559 3300025924 Bacteria 2832
460 Ga0207694_10105856 3300025924 Bacteria 2234
461 Ga0207694_10150279 3300025924 Bacteria 1876
462 Ga0207694_10157351 3300025924 Bacteria 1834
463 Ga0207687_10083602 3300025927 Bacteria 2312
464 Ga0207687_10103997 3300025927 Bacteria 2095
465 Ga0207687_10198813 3300025927 Bacteria 1565
466 Ga0207700_10007251 3300025928 Bacteria 6763
467 Ga0207700_10011456 3300025928 Bacteria 5654
468 Ga0207700_10018146 3300025928 Bacteria 4719
469 Ga0207700_10032512 3300025928 Bacteria 3722
470 Ga0207700_10051229 3300025928 Bacteria 3080
471 Ga0207700_10086597 3300025928 Bacteria 2462
472 Ga0207700_10124231 3300025928 Bacteria 2097
473 Ga0207700_10137409 3300025928 Bacteria 2004
474 Ga0207664_10002058 3300025929 Bacteria 13252
475 Ga0207664_10020618 3300025929 Bacteria 4889
476 Ga0207664_10069689 3300025929 Bacteria 2828
477 Ga0207664_10091034 3300025929 Bacteria 2500
478 Ga0207664_10119384 3300025929 Bacteria 2204
479 Ga0207664_10119603 3300025929 Bacteria 2203
480 Ga0207664_10254938 3300025929 Bacteria 1532
481 Ga0207644_10262906 3300025931 Bacteria 1380
482 Ga0207690_10144557 3300025932 Bacteria 1757
483 Ga0207690_10168683 3300025932 Bacteria 1638
484 Ga0207706_10079123 3300025933 Bacteria 2891
485 Ga0207706_10123207 3300025933 Bacteria 2281
486 Ga0207686_10021011 3300025934 Bacteria 3739
487 Ga0207686_10038551 3300025934 Bacteria 2893
488 Ga0207686_10088955 3300025934 Bacteria 2034
489 Ga0207709_10013431 3300025935 Bacteria 4520
490 Ga0207669_10007810 3300025937 Bacteria 4979
491 Ga0207669_10023026 3300025937 Bacteria 3319
492 Ga0207665_10000583 3300025939 Bacteria 24575
493 Ga0207665_10009461 3300025939 Bacteria 6397
494 Ga0207665_10022575 3300025939 Bacteria 4140
495 Ga0207665_10036263 3300025939 Bacteria 3279
496 Ga0207665_10112506 3300025939 Bacteria 1914
497 Ga0207691_10110214 3300025940 Bacteria 2448
498 Ga0207691_10198719 3300025940 Bacteria 1746
499 Ga0207711_10109671 3300025941 Bacteria 2453
500 Ga0207711_10158388 3300025941 Bacteria 2048
501 Ga0207689_10047565 3300025942 Bacteria 3540
502 Ga0207661_10000712 3300025944 Bacteria 21611
503 Ga0207661_10034780 3300025944 Bacteria 3922
504 Ga0207661_10084514 3300025944 Bacteria 2629
505 Ga0207679_10046998 3300025945 Bacteria 3133
506 Ga0207679_10096446 3300025945 Bacteria 2301
507 Ga0207667_10010781 3300025949 Bacteria 10662
508 Ga0207667_10053139 3300025949 Bacteria 4263
509 Ga0207667_10092184 3300025949 Bacteria 3129
510 Ga0207667_10092869 3300025949 Bacteria 3117
511 Ga0207667_10160725 3300025949 Bacteria 2311
512 Ga0207667_10232507 3300025949 Bacteria 1887
513 Ga0207667_10255953 3300025949 Bacteria 1791
514 Ga0207667_10373801 3300025949 Bacteria 1452
515 Ga0207667_10412598 3300025949 Bacteria 1374
516 Ga0207712_10000950 3300025961 Bacteria 20896
517 Ga0207712_10010623 3300025961 Bacteria 5845
518 Ga0207712_10167183 3300025961 Bacteria 1715
519 Ga0207668_10015871 3300025972 Bacteria 4689
520 Ga0207668_10017035 3300025972 Bacteria 4546
521 Ga0207668_10079551 3300025972 Bacteria 2371
522 Ga0207640_10061183 3300025981 Bacteria 2493
523 Ga0207677_10082277 3300026023 Bacteria 2313
524 Ga0207703_10061236 3300026035 Bacteria 3081
525 Ga0207703_10113230 3300026035 Bacteria 2318
526 Ga0207639_10003617 3300026041 Bacteria 10381
527 Ga0207639_10107050 3300026041 Bacteria 2270
528 Ga0207639_10130063 3300026041 Bacteria 2083
529 Ga0207639_10135005 3300026041 Bacteria 2048
530 Ga0207678_10015490 3300026067 Bacteria 6703
531 Ga0207678_10022914 3300026067 Bacteria 5465
532 Ga0207678_10062479 3300026067 Bacteria 3201
533 Ga0207702_10000063 3300026078 Bacteria 123034
534 Ga0207702_10106126 3300026078 Bacteria 2489
535 Ga0207676_10044978 3300026095 Bacteria 3408
536 Ga0207676_10136967 3300026095 Bacteria 2090
537 Ga0207676_10155984 3300026095 Bacteria 1972
538 Ga0207674_10008108 3300026116 Bacteria 12178
539 Ga0207674_10115851 3300026116 Bacteria 2651
540 Ga0207674_10119893 3300026116 Bacteria 2599
541 Ga0207675_100156505 3300026118 Bacteria 2172
542 Ga0207675_100223657 3300026118 Bacteria 1814
543 Ga0207675_100241317 3300026118 Bacteria 1746
544 Ga0207683_10038696 3300026121 Bacteria 4159
545 Ga0207683_10064951 3300026121 Bacteria 3217
546 Ga0207683_10108364 3300026121 Bacteria 2485
547 Ga0207698_10015927 3300026142 Bacteria 5055
548 Ga0207698_10019849 3300026142 Bacteria 4612
549 Ga0207698_10023138 3300026142 Bacteria 4335
550 Ga0209589_1000015 3300027357 Bacteria 225913
551 Ga0209489_100015 3300027361 Bacteria 225913
552 Ga0209700_100025 3300027363 Bacteria 225913
553 Ga0209179_1000328 3300027512 Bacteria 4610
554 Ga0209179_1015250 3300027512 Bacteria 1424
555 Ga0209588_1000429 3300027671 Bacteria 10867
556 Ga0209588_1010370 3300027671 Bacteria 2801
557 Ga0209588_1013802 3300027671 Bacteria 2468
558 Ga0209588_1019049 3300027671 Bacteria 2140
559 Ga0209813_10015342 3300027866 Bacteria 2074
560 Ga0207428_10083135 3300027907 Bacteria 2498
561 Ga0268266_10001575 3300028379 Bacteria 26658
562 Ga0268266_10006809 3300028379 Bacteria 10409
563 Ga0268266_10039943 3300028379 Bacteria 3998
564 Ga0268266_10100363 3300028379 Bacteria 2550
565 Ga0268266_10102141 3300028379 Bacteria 2529
566 Ga0268266_10116805 3300028379 Bacteria 2370
567 Ga0268265_10015236 3300028380 Bacteria 5256
568 Ga0268265_10039380 3300028380 Bacteria 3484
569 Ga0268265_10080597 3300028380 Bacteria 2567
570 Ga0268265_10236998 3300028380 Bacteria 1607
571 Ga0268265_10253940 3300028380 Bacteria 1559
572 Ga0268265_10330426 3300028380 Bacteria 1384
573 Ga0268264_10000042 3300028381 Bacteria 372069
574 Ga0268264_10006148 3300028381 Bacteria 10139
575 Ga0268264_10081087 3300028381 Bacteria 2772
576 Ga0268264_10096441 3300028381 Bacteria 2561
577 Ga0307517_10000063 3300028786 Bacteria 144304
578 Ga0307517_10139977 3300028786 Bacteria 1703
579 Ga0307515_10168249 3300028794 Bacteria 2199
580 Ga0307515_10238789 3300028794 Bacteria 1593
581 Ga0307511_10131697 3300030521 Bacteria 1504
582 Ga0265332_10009080 3300031238 Bacteria 4445
583 Ga0265332_10022779 3300031238 Bacteria 2764
584 Ga0265325_10005166 3300031241 Bacteria 8118
585 Ga0265325_10043968 3300031241 Bacteria 2328
586 Ga0265329_10006285 3300031242 Bacteria 4721
587 Ga0265340_10011932 3300031247 Bacteria 4601
588 Ga0265340_10036924 3300031247 Bacteria 2420
589 Ga0265339_10007149 3300031249 Bacteria 7246
590 Ga0265316_10038893 3300031344 Bacteria 3826
591 Ga0265316_10194290 3300031344 Bacteria 1506
592 Ga0307509_10101201 3300031507 Bacteria 2917
593 Ga0307509_10128400 3300031507 Bacteria 2496
594 Ga0307509_10142988 3300031507 Bacteria 2323
595 Ga0307509_10219851 3300031507 Bacteria 1714
596 Ga0307408_100080965 3300031548 Bacteria 2427
597 Ga0265313_10073786 3300031595 Bacteria 1565
598 Ga0265313_10081048 3300031595 Bacteria 1474
599 Ga0307508_10000012 3300031616 Bacteria 243167
600 Ga0307508_10032756 3300031616 Bacteria 4693
601 Ga0307508_10047062 3300031616 Bacteria 3849
602 Ga0307508_10064434 3300031616 Bacteria 3231
603 Ga0307508_10180778 3300031616 Bacteria 1711
604 Ga0265314_10004155 3300031711 Bacteria 13618
605 Ga0265314_10005577 3300031711 Bacteria 11318
606 Ga0265314_10089496 3300031711 Bacteria 2008
607 Ga0265342_10014580 3300031712 Bacteria 5213
608 Ga0265342_10024906 3300031712 Bacteria 3770
609 Ga0265342_10140040 3300031712 Bacteria 1350
610 Ga0307516_10012044 3300031730 Bacteria 9348
611 Ga0307516_10012378 3300031730 Bacteria 9201
612 Ga0307516_10019648 3300031730 Bacteria 6993
613 Ga0307516_10035778 3300031730 Bacteria 4978
614 Ga0307516_10046028 3300031730 Bacteria 4306
615 Ga0307516_10047340 3300031730 Bacteria 4237
616 Ga0307516_10120986 3300031730 Bacteria 2408
617 Ga0307516_10161149 3300031730 Bacteria 1993
618 Ga0307516_10206215 3300031730 Bacteria 1682
619 Ga0307405_10019087 3300031731 Bacteria 3799
620 Ga0307406_10023316 3300031901 Bacteria 3681
621 Ga0307406_10083725 3300031901 Bacteria 2128
622 Ga0307409_100030528 3300031995 Bacteria 3873
623 Ga0307416_100203114 3300032002 Bacteria 1882
624 Ga0307415_100017008 3300032126 Bacteria 4351
625 Ga0307507_10075010 3300033179 Bacteria 3029
626 Ga0307510_10017326 3300033180 Bacteria 8499
627 Ga0307510_10018417 3300033180 Bacteria 8219
628 Ga0307510_10032591 3300033180 Bacteria 5868
629 Ga0307510_10212388 3300033180 Bacteria 1456
630 Ga0315911_1000037 3300033442 Bacteria 62198
631 Ga0373930_0002922 3300034816 Bacteria 2688
632 Ga0373934_0006683 3300035086 Bacteria 4285
633 Ga0373934_0083126 3300035086 Bacteria 1287
634 Ga0373940_0018951 3300035088 Bacteria 1733
635 Ga0373923_0015450 3300035111 Bacteria 2883
636 Ga0373936_0008794 3300035113 Bacteria 3805
637 Ga0373936_0063298 3300035113 Bacteria 1514
638 Ga0373936_0080528 3300035113 Bacteria 1355
639 Ga0373941_0028125 3300035115 Bacteria 1648
640 Ga0373945_0045658 3300035116 Bacteria 1596
641 Ga0373945_0054002 3300035116 Bacteria 1485
642 Ga0373945_0062970 3300035116 Bacteria 1388
643 Ga0373954_0000194 3300035118 Bacteria 21982
644 Ga0373956_0005615 3300035119 Bacteria 5015
645 Ga0373956_0013338 3300035119 Bacteria 3418
646 Ga0373957_0000558 3300035120 Bacteria 9469
647 Ga0373943_0049732 3300035170 Bacteria 2058
648 Ga0373946_0007120 3300035171 Bacteria 4084
649 Ga0373955_0000198 3300035172 Bacteria 24944
650 Ga0373955_0002265 3300035172 Bacteria 8358
651 Ga0373955_0017979 3300035172 Bacteria 3507
652 Ga0373924_0003352 3300035410 Bacteria 5503
653 Ga0373931_0003286 3300035691 Bacteria 7238
654 Ga0373931_0012362 3300035691 Bacteria 4135
655 Ga0373931_0168121 3300035691 Bacteria 1290
656 Ga0373935_0001270 3300035692 Bacteria 13910
657 Ga0373935_0008496 3300035692 Bacteria 6145
658 Ga0373935_0069665 3300035692 Bacteria 2266
659 Ga0373927_0000137 3300035695 Bacteria 56546
660 Ga0373927_0006695 3300035695 Bacteria 7840
661 Ga0373927_0006894 3300035695 Bacteria 7721
662 Ga0373927_0018690 3300035695 Bacteria 4549
663 Ga0373927_0034270 3300035695 Bacteria 3303
664 Ga0373927_0111666 3300035695 Bacteria 1781
665 Ga0373927_0147212 3300035695 Bacteria 1542
666 Ga0373927_0149025 3300035695 Bacteria 1532
667 Ga0373933_0000274 3300035724 Bacteria 33544
668 Ga0373933_0000961 3300035724 Bacteria 17558
669 Ga0373933_0111256 3300035724 Bacteria 1709
670 Ga0373947_0006199 3300035725 Bacteria 6955
671 Ga0373947_0008600 3300035725 Bacteria 5876
672 Ga0373947_0020673 3300035725 Bacteria 3802
673 Ga0373947_0097414 3300035725 Bacteria 1843
674 Ga0373937_0007705 3300036401 Bacteria 9334
675 Ga0373937_0029297 3300036401 Bacteria 4985
676 Ga0373937_0142464 3300036401 Bacteria 2243
677 Ga0373925_0002159 3300037068 Bacteria 16068
678 Ga0373925_0002405 3300037068 Bacteria 15008
679 Ga0373925_0036912 3300037068 Bacteria 3606
680 Ga0373925_0062697 3300037068 Bacteria 2796
681 Ga0373925_0116306 3300037068 Bacteria 2071
682 Ga0373925_0119252 3300037068 Bacteria 2047
683 Ga0373925_0141996 3300037068 Bacteria 1880
684 Ga0395899_0048061 3300037312 Bacteria 3176
685 Ga0395900_0002675 3300037418 Bacteria 19472
686 Ga0395900_0025734 3300037418 Bacteria 6023
687 Ga0395900_0044162 3300037418 Bacteria 4593
688 Ga0395900_0258630 3300037418 Bacteria 1739
689 Ga0395900_0299778 3300037418 Bacteria 1594
690 Ga0395898_0005085 3300037466 Bacteria 14256
691 Ga0395898_0012432 3300037466 Bacteria 8802
692 Ga0395898_0027242 3300037466 Bacteria 5739
693 Ga0395898_0035217 3300037466 Bacteria 4981
694 Ga0395898_0035859 3300037466 Bacteria 4929
695 Ga0395898_0189480 3300037466 Bacteria 1965
696 Ga0395905_0003852 3300037471 Bacteria 15817
697 Ga0395905_0128435 3300037471 Bacteria 2384
698 Ga0436364_0259789 3300037853 Bacteria 1721
699 Ga0395901_0076603 3300038443 Bacteria 3490
700 Ga0395901_0230677 3300038443 Bacteria 1933
701 Ga0395901_0385649 3300038443 Bacteria 1441
702 Ga0436365_0007077 3300039437 Bacteria 42426
703 Ga0436365_0021793 3300039437 Bacteria 95854
704 Ga0436365_0235812 3300039437 Bacteria 2474
705 Ga0436365_0400047 3300039437 Bacteria 2876
706 Ga0436365_0692786 3300039437 Bacteria 7173
707 Ga0436365_0831557 3300039437 Bacteria 3119
708 Ga0436365_0998035 3300039437 Bacteria 2324
709 Ga0436365_1161315 3300039437 Bacteria 24405
710 Ga0436365_1604062 3300039437 Bacteria 1873
711 Ga0436361_0885563 3300039447 Bacteria 3392
712 Ga0436363_0045132 3300039450 Bacteria 7877
713 Ga0436363_0080678 3300039450 Bacteria 9391
714 Ga0436363_0141292 3300039450 Bacteria 1535
715 Ga0436363_0573174 3300039450 Bacteria 7292
716 Ga0436363_0765119 3300039450 Bacteria 2056
717 Ga0436362_0354125 3300039453 Bacteria 2181
718 Ga0436362_0719825 3300039453 Bacteria 1698
719 Ga0436362_0768037 3300039453 Bacteria 10173
720 Ga0451853_3488916 3300041512 Bacteria 1751
721 Ga0451577_0003923 3300042876 Bacteria 16072
722 Ga0466969_0086058 3300044656 Bacteria 1494
723 Ga0466972_0025330 3300044658 Bacteria 2941
724 Ga0466965_0003985 3300044683 Bacteria 6545
725 Ga0466966_0003609 3300044684 Bacteria 10208
726 Ga0466966_0081685 3300044684 Bacteria 2012
727 Ga0466961_0000138 3300044693 Bacteria 48960
728 Ga0466963_0145831 3300044694 Bacteria 1642
729 Ga0466964_0046285 3300044706 Bacteria 1773
730 Ga0466964_0068426 3300044706 Bacteria 1495
731 Ga0466957_0116698 3300044842 Bacteria 1698
732 Ga0466959_0004441 3300045049 Bacteria 9392
733 Ga0466959_0052392 3300045049 Bacteria 2989
734 Ga0466959_0052438 3300045049 Bacteria 2987
735 Ga0466959_0081443 3300045049 Bacteria 2333
736 Ga0466967_0041536 3300045976 Bacteria 3966
737 Ga0466967_0186608 3300045976 Bacteria 1958
738 Ga0495592_0000339 3300046454 Bacteria 38389
739 Ga0495603_0000277 3300046455 Bacteria 27280
740 Ga0495603_0000534 3300046455 Bacteria 21119
741 Ga0495603_0003382 3300046455 Bacteria 9500
742 Ga0495603_0014464 3300046455 Bacteria 4773
743 Ga0495603_0018302 3300046455 Bacteria 4239
744 Ga0495603_0026289 3300046455 Bacteria 3517
745 Ga0495603_0037274 3300046455 Bacteria 2917
746 Ga0495603_0038296 3300046455 Bacteria 2876
747 Ga0495603_0051828 3300046455 Bacteria 2437
748 Ga0495603_0101766 3300046455 Bacteria 1677
749 Ga0495629_0000029 3300046459 Bacteria 127000
750 Ga0495629_0000176 3300046459 Bacteria 56922
751 Ga0495629_0000429 3300046459 Bacteria 35053
752 Ga0495629_0002796 3300046459 Bacteria 13308
753 Ga0495629_0003050 3300046459 Bacteria 12734
754 Ga0495638_0021438 3300046460 Bacteria 4258
755 Ga0495638_0046195 3300046460 Bacteria 2736
756 Ga0495641_0001504 3300046461 Bacteria 19881
757 Ga0495651_0002298 3300046462 Bacteria 14746
758 Ga0495651_0004273 3300046462 Bacteria 10957
759 Ga0495651_0017929 3300046462 Bacteria 5483
760 Ga0495651_0073584 3300046462 Bacteria 2593
761 Ga0495651_0081956 3300046462 Bacteria 2435
762 Ga0495653_0002916 3300046463 Bacteria 13678
763 Ga0495580_0000705 3300046472 Bacteria 28569
764 Ga0495580_0002724 3300046472 Bacteria 15264
765 Ga0495582_0000024 3300046473 Bacteria 82444
766 Ga0495582_0000482 3300046473 Bacteria 21808
767 Ga0495639_0000135 3300046475 Bacteria 38122
768 Ga0495639_0003253 3300046475 Bacteria 7055
769 Ga0495639_0027851 3300046475 Bacteria 2502
770 Ga0495639_0051011 3300046475 Bacteria 1880
771 Ga0495662_0000348 3300046476 Bacteria 20253
772 Ga0495662_0006898 3300046476 Bacteria 5642
773 Ga0495664_0009632 3300046477 Bacteria 5408
774 Ga0495584_0081540 3300046491 Bacteria 1628
775 Ga0495585_0028375 3300046492 Bacteria 3192
776 Ga0495585_0058078 3300046492 Bacteria 2134
777 Ga0495594_0000822 3300046499 Bacteria 16021
778 Ga0495594_0000896 3300046499 Bacteria 15411
779 Ga0495594_0015786 3300046499 Bacteria 3971
780 Ga0495606_0007982 3300046507 Bacteria 9312
781 Ga0495606_0088355 3300046507 Bacteria 1911
782 Ga0495608_0002299 3300046511 Bacteria 13791
783 Ga0495608_0040372 3300046511 Bacteria 3126
784 Ga0495610_0052998 3300046512 Bacteria 1967
785 Ga0495620_0059474 3300046515 Bacteria 1597
786 Ga0495628_0012669 3300046516 Bacteria 7103
787 Ga0495630_0002890 3300046517 Bacteria 11941
788 Ga0495630_0007650 3300046517 Bacteria 7726
789 Ga0495630_0018001 3300046517 Bacteria 5185
790 Ga0495631_0026373 3300046518 Bacteria 2670
791 Ga0495632_0045243 3300046519 Bacteria 2193
792 Ga0495632_0071044 3300046519 Bacteria 1673
793 Ga0495643_0032765 3300046522 Bacteria 2882
794 Ga0495643_0081888 3300046522 Bacteria 1678
795 Ga0495643_0093321 3300046522 Bacteria 1550
796 Ga0495644_0029270 3300046523 Bacteria 2082
797 Ga0495644_0049000 3300046523 Bacteria 1586
798 Ga0495648_0000310 3300046524 Bacteria 53884
799 Ga0495648_0036359 3300046524 Bacteria 3179
800 Ga0495648_0141218 3300046524 Bacteria 1267
801 Ga0495666_0006119 3300046526 Bacteria 6055
802 Ga0495666_0035372 3300046526 Bacteria 2435
803 Ga0495652_0004769 3300046529 Bacteria 12904
804 Ga0495652_0007414 3300046529 Bacteria 10113
805 Ga0495652_0014055 3300046529 Bacteria 7192
806 Ga0495652_0120850 3300046529 Bacteria 2089
807 Ga0495665_0000178 3300046531 Bacteria 32333
808 Ga0495640_0000881 3300046533 Bacteria 23059
809 Ga0495640_0001533 3300046533 Bacteria 18200
810 Ga0495640_0003708 3300046533 Bacteria 12271
811 Ga0495640_0009567 3300046533 Bacteria 7539
812 Ga0495587_0024155 3300046536 Bacteria 3728
813 Ga0495587_0048963 3300046536 Bacteria 2502
814 Ga0495598_0008960 3300046537 Bacteria 2347
815 Ga0495621_0026467 3300046539 Bacteria 1957
816 Ga0495645_0021151 3300046543 Bacteria 4702
817 Ga0495645_0027395 3300046543 Bacteria 4141
818 Ga0495645_0030073 3300046543 Bacteria 3956
819 Ga0495645_0038077 3300046543 Bacteria 3507
820 Ga0495622_0002012 3300046557 Bacteria 9942
821 Ga0495622_0029441 3300046557 Bacteria 2565
822 Ga0495633_0033632 3300046558 Bacteria 2471
823 Ga0495633_0077414 3300046558 Bacteria 1549
824 Ga0495667_0003330 3300046559 Bacteria 10755
825 Ga0495667_0019949 3300046559 Bacteria 4521
826 Ga0495667_0042815 3300046559 Bacteria 3002
827 Ga0495656_0016207 3300046615 Bacteria 2825
828 Ga0495656_0044436 3300046615 Bacteria 1870
829 Ga0495656_0079875 3300046615 Bacteria 1473
830 Ga0495668_0106999 3300046616 Bacteria 1529
831 Ga0495634_0001222 3300046642 Bacteria 23699
832 Ga0495634_0007096 3300046642 Bacteria 8449
833 Ga0495634_0013730 3300046642 Bacteria 5849
834 Ga0495611_0020338 3300046648 Bacteria 2856
835 Ga0495625_0051694 3300046660 Bacteria 2945
836 Ga0495625_0063911 3300046660 Bacteria 2598
837 Ga0495625_0125482 3300046660 Bacteria 1743
838 Ga0495635_0000276 3300046663 Bacteria 32999
839 Ga0495635_0000910 3300046663 Bacteria 19409
840 Ga0495635_0004181 3300046663 Bacteria 10017
841 Ga0495635_0010291 3300046663 Bacteria 6541
842 Ga0495635_0056377 3300046663 Bacteria 2705
843 Ga0495635_0105069 3300046663 Bacteria 1930
844 Ga0495659_0010257 3300046664 Bacteria 3001
845 Ga0495661_0047854 3300046665 Bacteria 2601
846 Ga0495661_0076552 3300046665 Bacteria 1941
847 Ga0495588_0001458 3300046674 Bacteria 10150
848 Ga0495588_0002893 3300046674 Bacteria 7400
849 Ga0495588_0003152 3300046674 Bacteria 7138
850 Ga0495588_0038561 3300046674 Bacteria 2431
851 Ga0495588_0064420 3300046674 Bacteria 1901
852 Ga0495588_0100718 3300046674 Bacteria 1518
853 Ga0495657_0023707 3300046675 Bacteria 4382
854 Ga0495599_0000440 3300046678 Bacteria 23669
855 Ga0495599_0046152 3300046678 Bacteria 2732
856 Ga0495599_0093308 3300046678 Bacteria 1878
857 Ga0495623_0004965 3300046679 Bacteria 8727
858 Ga0495623_0110117 3300046679 Bacteria 1670
859 Ga0495646_0023165 3300046680 Bacteria 3910
860 Ga0495646_0041961 3300046680 Bacteria 2809
861 Ga0495646_0084297 3300046680 Bacteria 1845
862 Ga0495647_0013024 3300046681 Bacteria 2873
863 Ga0495658_0001504 3300046683 Bacteria 12223
864 Ga0495658_0002247 3300046683 Bacteria 9767
865 Ga0495669_0006663 3300046684 Bacteria 4831
866 Ga0495669_0066376 3300046684 Bacteria 1639
867 Ga0495669_0081610 3300046684 Bacteria 1484
868 Ga0495613_0006457 3300046689 Bacteria 8768
869 Ga0495613_0022922 3300046689 Bacteria 4653
870 Ga0495613_0068130 3300046689 Bacteria 2596
871 Ga0495624_0000788 3300046690 Bacteria 24985
872 Ga0495624_0002246 3300046690 Bacteria 14726
873 Ga0495670_0023077 3300046691 Bacteria 3072
874 Ga0495670_0025540 3300046691 Bacteria 2922
875 Ga0495671_0033510 3300046692 Bacteria 2616
876 Ga0495649_0117149 3300046694 Bacteria 1410
877 Ga0495589_0093490 3300046794 Bacteria 1460
878 Ga0495589_0099229 3300046794 Bacteria 1410
879 Ga0495600_0000314 3300046809 Bacteria 25635
880 Ga0495600_0002595 3300046809 Bacteria 10414
881 Ga0495600_0036413 3300046809 Bacteria 3198
882 Ga0495581_0000004 3300047315 Bacteria 84424
883 Ga0495581_0019748 3300047315 Bacteria 3912
884 Ga0495604_0013152 3300047317 Bacteria 6589
885 Ga0495604_0048462 3300047317 Bacteria 3304
886 Ga0495674_0000375 3300047319 Bacteria 39876
887 Ga0495674_0001728 3300047319 Bacteria 21443
888 Ga0495674_0008604 3300047319 Bacteria 9712
889 Ga0495674_0015846 3300047319 Bacteria 7037
890 Ga0495674_0052817 3300047319 Bacteria 3574
891 Ga0495672_0054257 3300047320 Bacteria 2344
892 Ga0495672_0063717 3300047320 Bacteria 2114
893 Ga0495672_0064751 3300047320 Bacteria 2091
894 Ga0495676_0021097 3300047321 Bacteria 5701
895 Ga0495676_0038068 3300047321 Bacteria 3998
896 Ga0495676_0075107 3300047321 Bacteria 2586
897 Ga0495676_0106787 3300047321 Bacteria 2062
898 Ga0495676_0165714 3300047321 Bacteria 1559
899 Ga0495680_0036592 3300047322 Bacteria 3939
900 Ga0495675_0000801 3300047444 Bacteria 19376
901 Ga0495675_0029478 3300047444 Bacteria 3500
902 Ga0495684_0000023 3300047471 Bacteria 133626
903 Ga0495684_0002197 3300047471 Bacteria 15622
904 Ga0495684_0004302 3300047471 Bacteria 11119
905 Ga0495686_0036135 3300047472 Bacteria 3171
906 Ga0495686_0138420 3300047472 Bacteria 1438
907 Ga0495593_0000197 3300047673 Bacteria 31593
908 Ga0495593_0000198 3300047673 Bacteria 31587
909 Ga0495593_0000375 3300047673 Bacteria 24653
910 Ga0495602_0014005 3300048088 Bacteria 8161
911 Ga0495602_0069253 3300048088 Bacteria 3025
912 Ga0495614_0010788 3300048089 Bacteria 4024
913 Ga0495626_0097759 3300048091 Bacteria 1283
914 Ga0496100_0021374 3300048903 Bacteria 3895
915 Ga0496100_0072559 3300048903 Bacteria 2301
916 Ga0496100_0121646 3300048903 Bacteria 1827
917 Ga0496101_0001342 3300048904 Bacteria 14755
918 Ga0496101_0095520 3300048904 Bacteria 2217
919 Ga0496102_0013166 3300048905 Bacteria 7157
920 Ga0496102_0045476 3300048905 Bacteria 3986
921 Ga0496102_0057579 3300048905 Bacteria 3549
922 Ga0496102_0153797 3300048905 Bacteria 2162
923 Ga0496102_0192459 3300048905 Bacteria 1922
924 Ga0496103_0135393 3300048906 Bacteria 1574
925 Ga0496103_0139975 3300048906 Bacteria 1547
926 Ga0496104_0002918 3300048907 Bacteria 14731
927 Ga0496104_0008089 3300048907 Bacteria 9330
928 Ga0496104_0016010 3300048907 Bacteria 6808
929 Ga0496104_0031079 3300048907 Bacteria 4964
930 Ga0496104_0325824 3300048907 Bacteria 1449
931 Ga0496105_0009438 3300048908 Bacteria 7631
932 Ga0496105_0017461 3300048908 Bacteria 5755
933 Ga0496105_0020063 3300048908 Bacteria 5395
934 Ga0496105_0046941 3300048908 Bacteria 3564
935 Ga0496105_0110437 3300048908 Bacteria 2270
936 Ga0496105_0211533 3300048908 Bacteria 1581
937 Ga0496106_0002085 3300048909 Bacteria 14990
938 Ga0496106_0023922 3300048909 Bacteria 4539
939 Ga0496106_0091700 3300048909 Bacteria 2346
940 Ga0496106_0148930 3300048909 Bacteria 1845
941 Ga0496107_0001626 3300048910 Bacteria 14005
942 Ga0496107_0018609 3300048910 Bacteria 4892
943 Ga0496107_0061908 3300048910 Bacteria 2710
944 Ga0496108_0006756 3300048911 Bacteria 9286
945 Ga0496108_0016739 3300048911 Bacteria 5989
946 Ga0496108_0030999 3300048911 Bacteria 4433
947 Ga0496108_0041212 3300048911 Bacteria 3853
948 Ga0496108_0054292 3300048911 Bacteria 3362
949 Ga0496109_0018280 3300048912 Bacteria 6156
950 Ga0496109_0027858 3300048912 Bacteria 5049
951 Ga0496109_0045892 3300048912 Bacteria 3967
952 Ga0496109_0049885 3300048912 Bacteria 3812
953 Ga0496109_0079526 3300048912 Bacteria 3021
954 Ga0496110_0015096 3300048913 Bacteria 6423
955 Ga0496110_0027689 3300048913 Bacteria 4860
956 Ga0496110_0042322 3300048913 Bacteria 3976
957 Ga0496110_0050850 3300048913 Bacteria 3640
958 Ga0496110_0139486 3300048913 Bacteria 2191
959 Ga0496110_0213101 3300048913 Bacteria 1756
960 Ga0496110_0221792 3300048913 Bacteria 1719
961 Ga0496110_0228153 3300048913 Bacteria 1693
962 Ga0496110_0281867 3300048913 Bacteria 1513
963 Ga0496110_0288673 3300048913 Bacteria 1494
964 Ga0496111_0011412 3300048914 Bacteria 5982
965 Ga0496111_0071828 3300048914 Bacteria 2519
966 Ga0496111_0136763 3300048914 Bacteria 1815
967 Ga0496112_0000090 3300048915 Bacteria 59721
968 Ga0496112_0035408 3300048915 Bacteria 4863
969 Ga0496112_0049960 3300048915 Bacteria 4100
970 Ga0496112_0081198 3300048915 Bacteria 3206
971 Ga0496112_0092931 3300048915 Bacteria 2986
972 Ga0496112_0173896 3300048915 Bacteria 2119
973 Ga0496113_0012523 3300048916 Bacteria 5704
974 Ga0496113_0062856 3300048916 Bacteria 2804
975 Ga0496114_0018948 3300048917 Bacteria 5574
976 Ga0496114_0105825 3300048917 Bacteria 2407
977 Ga0496114_0228744 3300048917 Bacteria 1633
978 Ga0496115_0001562 3300048918 Bacteria 16472
979 Ga0496115_0037790 3300048918 Bacteria 3827
980 Ga0496115_0045771 3300048918 Bacteria 3494
981 Ga0496115_0057162 3300048918 Bacteria 3137
982 Ga0496115_0158149 3300048918 Bacteria 1872
983 Ga0496115_0228715 3300048918 Bacteria 1534
984 Ga0496116_0021698 3300048919 Bacteria 4833
985 Ga0496117_0104235 3300048920 Bacteria 1785
986 Ga0496118_0021357 3300048921 Bacteria 5700
987 Ga0496118_0066672 3300048921 Bacteria 2626
988 Ga0496118_0133200 3300048921 Bacteria 1591
989 Ga0496119_0013658 3300048922 Bacteria 6444
990 Ga0496119_0033943 3300048922 Bacteria 3371
991 Ga0496119_0087076 3300048922 Bacteria 1783
992 Ga0496120_0044928 3300048923 Bacteria 2563
993 Ga0496120_0088073 3300048923 Bacteria 1665
994 Ga0496121_0007690 3300048924 Bacteria 12941
995 Ga0496121_0011755 3300048924 Bacteria 9657
996 Ga0496121_0014151 3300048924 Bacteria 8498
997 Ga0496121_0015099 3300048924 Bacteria 8124
998 Ga0496121_0016341 3300048924 Bacteria 7669
999 Ga0496121_0042114 3300048924 Bacteria 3979
1000 Ga0496121_0044377 3300048924 Bacteria 3835
1001 Ga0496121_0076036 3300048924 Bacteria 2679
1002 Ga0496121_0077391 3300048924 Bacteria 2649
1003 Ga0496121_0088415 3300048924 Bacteria 2429
1004 Ga0496121_0090364 3300048924 Bacteria 2394
1005 Ga0496121_0092776 3300048924 Bacteria 2353
1006 Ga0496121_0097939 3300048924 Bacteria 2271
1007 Ga0496121_0098775 3300048924 Bacteria 2258
1008 Ga0496121_0108513 3300048924 Bacteria 2123
1009 Ga0496121_0121590 3300048924 Bacteria 1971
1010 Ga0496122_0105991 3300048925 Bacteria 1862
1011 Ga0496123_0105932 3300048926 Bacteria 1621
1012 Ga0496123_0117135 3300048926 Bacteria 1507
1013 Ga0496125_0000664 3300048928 Bacteria 57244
1014 Ga0496125_0004086 3300048928 Bacteria 17078
1015 Ga0496125_0027901 3300048928 Bacteria 5107
1016 Ga0496125_0049142 3300048928 Bacteria 3508
1017 Ga0496126_0005839 3300048929 Bacteria 13910
1018 Ga0496126_0012671 3300048929 Bacteria 8627
1019 Ga0496126_0016304 3300048929 Bacteria 7433
1020 Ga0496126_0026887 3300048929 Bacteria 5508
1021 Ga0496126_0030015 3300048929 Bacteria 5158
1022 Ga0496126_0047107 3300048929 Bacteria 3948
1023 Ga0496126_0047740 3300048929 Bacteria 3918
1024 Ga0496126_0050615 3300048929 Bacteria 3784
1025 Ga0496126_0056346 3300048929 Bacteria 3553
1026 Ga0496126_0058113 3300048929 Bacteria 3487
1027 Ga0496126_0074424 3300048929 Bacteria 3016
1028 Ga0496126_0167490 3300048929 Bacteria 1874
1029 Ga0496126_0192572 3300048929 Bacteria 1726
1030 Ga0496126_0211892 3300048929 Bacteria 1631
1031 Ga0496126_0218222 3300048929 Bacteria 1603
1032 Ga0496126_0280886 3300048929 Bacteria 1379
1033 Ga0495678_047442 3300049459 Bacteria 1682
1034 Ga0501031_0001791 3300049568 Bacteria 13478
1035 Ga0501031_0048412 3300049568 Bacteria 2770
1036 Ga0501032_0000073 3300049569 Bacteria 85584
1037 Ga0501032_0022837 3300049569 Bacteria 4333
1038 Ga0501032_0058259 3300049569 Bacteria 2593
1039 Ga0501032_0128537 3300049569 Bacteria 1672
1040 Ga0501033_0000136 3300049570 Bacteria 70952
1041 Ga0501033_0084302 3300049570 Bacteria 2329
1042 Ga0501033_0245070 3300049570 Bacteria 1271
1043 Ga0501034_0000251 3300049571 Bacteria 99406
1044 Ga0501036_0000036 3300049572 Bacteria 87244
1045 Ga0501036_0051369 3300049572 Bacteria 3490
1046 Ga0501037_0001715 3300049573 Bacteria 15897
1047 Ga0501038_0000428 3300049574 Bacteria 36623
1048 Ga0501038_0031834 3300049574 Bacteria 4658
1049 Ga0501039_0000273 3300049575 Bacteria 37431
1050 Ga0501039_0085782 3300049575 Bacteria 2452
1051 Ga0501042_0015037 3300049578 Bacteria 5293
1052 Ga0501043_0000165 3300049579 Bacteria 59980
1053 Ga0501043_0002500 3300049579 Bacteria 15543
1054 Ga0501046_0001143 3300049580 Bacteria 25820
1055 Ga0501046_0043332 3300049580 Bacteria 3583
1056 Ga0501046_0047803 3300049580 Bacteria 3391
1057 Ga0501046_0230349 3300049580 Bacteria 1369
1058 Ga0501047_0000340 3300049581 Bacteria 53278
1059 Ga0501047_0096309 3300049581 Bacteria 2838
1060 Ga0501047_0161095 3300049581 Bacteria 2115
1061 Ga0501047_0250276 3300049581 Bacteria 1620
1062 Ga0501048_0004991 3300049582 Bacteria 10119
1063 Ga0501067_0005805 3300049583 Bacteria 6851
1064 Ga0501067_0026256 3300049583 Bacteria 3227
1065 Ga0501067_0027971 3300049583 Bacteria 3125
1066 Ga0501068_0000255 3300049584 Bacteria 26229
1067 Ga0501068_0041667 3300049584 Bacteria 2760
1068 Ga0501069_0008241 3300049585 Bacteria 5471
1069 Ga0501070_0007747 3300049586 Bacteria 9102
1070 Ga0501070_0010122 3300049586 Bacteria 7983
1071 Ga0501070_0025402 3300049586 Bacteria 4969
1072 Ga0501070_0025521 3300049586 Bacteria 4957
1073 Ga0501071_0012098 3300049587 Bacteria 5836
1074 Ga0501071_0122894 3300049587 Bacteria 1925
1075 Ga0501072_0001213 3300049588 Bacteria 19257
1076 Ga0501073_0000037 3300049589 Bacteria 87345
1077 Ga0501074_0000133 3300049590 Bacteria 38342
1078 Ga0501074_0107539 3300049590 Bacteria 1997
1079 Ga0501074_0154938 3300049590 Bacteria 1637
1080 Ga0501076_0171998 3300049592 Bacteria 1766
1081 Ga0501079_0001057 3300049741 Bacteria 19118
1082 Ga0501080_0000054 3300049742 Bacteria 74316
1083 Ga0501080_0028463 3300049742 Bacteria 5198
1084 Ga0501080_0133973 3300049742 Bacteria 2293
1085 Ga0501080_0192598 3300049742 Bacteria 1873
1086 Ga0501083_0003724 3300049744 Bacteria 10711
1087 Ga0501035_0000142 3300049822 Bacteria 87561
1088 Ga0501035_0062851 3300049822 Bacteria 3303
1089 Ga0501035_0125053 3300049822 Bacteria 2245
1090 Ga0501035_0203574 3300049822 Bacteria 1696
1091 Ga0501044_0000414 3300049823 Bacteria 52784
1092 Ga0501044_0044082 3300049823 Bacteria 4632
1093 Ga0501044_0085260 3300049823 Bacteria 3192
1094 Ga0501044_0086417 3300049823 Bacteria 3168
1095 Ga0501045_0057653 3300049824 Bacteria 2842
1096 nmdc:mga03683_2888_c1 3300050489 Bacteria 5419
1097 nmdc:mga03n38_66642_c1 3300050490 Bacteria 1654
1098 nmdc:mga03n38_67070_c1 3300050490 Bacteria 1650
1099 nmdc:mga03n38_7090_c1 3300050490 Bacteria 3942
1100 nmdc:mga00v17_15058_c1 3300050491 Bacteria 4334
1101 nmdc:mga00v17_164365_c1 3300050491 Bacteria 1430
1102 nmdc:mga0yw44_58334_c1 3300050492 Bacteria 2358
1103 nmdc:mga06z11_20446_c1 3300050494 Bacteria 3060
1104 nmdc:mga06z11_87279_c1 3300050494 Bacteria 1687
1105 nmdc:mga04h51_10207_c1 3300050495 Bacteria 2573
1106 nmdc:mga04h51_33113_c1 3300050495 Bacteria 1643
1107 nmdc:mga07m45_137248_c1 3300050496 Bacteria 1416
1108 nmdc:mga07m45_137785_c1 3300050496 Bacteria 1413
1109 nmdc:mga07m45_21802_c1 3300050496 Bacteria 3492
1110 nmdc:mga07m45_32395_c1 3300050496 Bacteria 2899
1111 nmdc:mga07m45_38907_c1 3300050496 Bacteria 2656
1112 nmdc:mga07m45_53965_c1 3300050496 Bacteria 2272
1113 nmdc:mga05p37_161286_c1 3300050507 Bacteria 2738
1114 nmdc:mga08y16_138194_c1 3300050511 Bacteria 2533
1115 nmdc:mga08y16_139147_c1 3300050511 Bacteria 2524
1116 nmdc:mga08y16_259817_c1 3300050511 Bacteria 1793
1117 nmdc:mga0n895_24565_c1 3300050512 Bacteria 5681
1118 nmdc:mga0rr50_7098_c1 3300050513 Bacteria 6879
1119 nmdc:mga08x19_21_c1 3300050514 Bacteria 302369
1120 nmdc:mga0sz30_25727_c1 3300050516 Bacteria 2408
1121 nmdc:mga0sz30_488_c1 3300050516 Bacteria 11210
1122 nmdc:mga0sz30_49347_c1 3300050516 Bacteria 1783
1123 Ga0495601_0028223 3300053077 Bacteria 3475
1124 Ga0495601_0081577 3300053077 Bacteria 2076
1125 Ga0495601_0101022 3300053077 Bacteria 1863
1126 Ga0495601_0179164 3300053077 Bacteria 1386
1127 Ga0495601_0200594 3300053077 Bacteria 1304
1128 Ga0495612_0012023 3300053078 Bacteria 3488
1129 Ga0500635_0003136 3300053080 Bacteria 4132
1130 Ga0500635_0003603 3300053080 Bacteria 3915
1131 Ga0500635_0009758 3300053080 Bacteria 2674
1132 Ga0500635_0042830 3300053080 Bacteria 1520
1133 Ga0495595_0003578 3300053084 Bacteria 6170
1134 Ga0495619_0000111 3300053085 Bacteria 61304
1135 Ga0495619_0001183 3300053085 Bacteria 17177
1136 Ga0495619_0016178 3300053085 Bacteria 4722
1137 Ga0495619_0026281 3300053085 Bacteria 3744
1138 Ga0500578_0086293 3300053086 Bacteria 1994
1139 Ga0500581_045915 3300053089 Bacteria 2232
1140 Ga0500647_0033749 3300053091 Bacteria 2442
1141 Ga0500651_0011222 3300053093 Bacteria 5397
1142 Ga0500651_0046722 3300053093 Bacteria 2723
1143 Ga0500651_0181137 3300053093 Bacteria 1251
1144 Ga0500566_0000223 3300053094 Bacteria 30380
1145 Ga0500566_0000352 3300053094 Bacteria 24987
1146 Ga0500566_0000445 3300053094 Bacteria 23074
1147 Ga0500566_0000872 3300053094 Bacteria 17220
1148 Ga0500566_0006638 3300053094 Bacteria 6852
1149 Ga0500566_0042561 3300053094 Bacteria 2620
1150 Ga0500640_002695 3300053095 Bacteria 5944
1151 Ga0500650_0001140 3300053098 Bacteria 7721
1152 Ga0500554_003648 3300053102 Bacteria 3171
1153 Ga0500556_0000003 3300053104 Bacteria 679379
1154 Ga0500556_0000029 3300053104 Bacteria 165326
1155 Ga0500562_013354 3300053108 Bacteria 2096
1156 Ga0500569_021182 3300053109 Bacteria 1715
1157 Ga0500572_000236 3300053111 Bacteria 19616
1158 Ga0500572_000389 3300053111 Bacteria 15536
1159 Ga0500572_000848 3300053111 Bacteria 9536
1160 Ga0500591_044989 3300053115 Bacteria 2088
1161 Ga0500592_001392 3300053116 Bacteria 3910
1162 Ga0500595_001519 3300053119 Bacteria 12326
1163 Ga0500595_002014 3300053119 Bacteria 10407
1164 Ga0500595_002289 3300053119 Bacteria 9610
1165 Ga0500595_003149 3300053119 Bacteria 7818
1166 Ga0500595_004865 3300053119 Bacteria 5945
1167 Ga0500595_006850 3300053119 Bacteria 4795
1168 Ga0500595_046074 3300053119 Bacteria 1373
1169 Ga0500608_000713 3300053122 Bacteria 12184
1170 Ga0500618_026238 3300053125 Bacteria 1392
1171 Ga0500642_0000015 3300053130 Bacteria 181424
1172 Ga0500642_0000329 3300053130 Bacteria 16416
1173 Ga0500652_001212 3300053131 Bacteria 8224
1174 Ga0500652_016900 3300053131 Bacteria 2664
1175 Ga0500658_0068983 3300053134 Bacteria 1487
1176 Ga0500559_0000105 3300053136 Bacteria 65809
1177 Ga0500559_0000461 3300053136 Bacteria 28939
1178 Ga0500559_0001715 3300053136 Bacteria 12035
1179 Ga0500559_0002267 3300053136 Bacteria 10164
1180 Ga0500559_0072929 3300053136 Bacteria 1548
1181 Ga0500568_0001586 3300053139 Bacteria 14383
1182 Ga0500568_0005182 3300053139 Bacteria 6794
1183 Ga0500568_0020846 3300053139 Bacteria 2829
1184 Ga0500573_0027024 3300053140 Bacteria 3298
1185 Ga0500577_0000266 3300053142 Bacteria 13721
1186 Ga0500577_0012174 3300053142 Bacteria 2591
1187 Ga0500586_000403 3300053145 Bacteria 8635
1188 Ga0500590_061601 3300053148 Bacteria 1884
1189 Ga0500603_000178 3300053150 Bacteria 16265
1190 Ga0500603_000237 3300053150 Bacteria 14490
1191 Ga0500603_000303 3300053150 Bacteria 12925
1192 Ga0500603_013292 3300053150 Bacteria 1906
1193 Ga0500604_0002762 3300053151 Bacteria 4770
1194 Ga0500604_0043294 3300053151 Bacteria 1367
1195 Ga0500616_0000033 3300053153 Bacteria 398830
1196 Ga0500616_0000038 3300053153 Bacteria 386801
1197 Ga0500616_0001700 3300053153 Bacteria 20240
1198 Ga0500622_0017137 3300053156 Bacteria 3859
1199 Ga0500622_0020356 3300053156 Bacteria 3523
1200 Ga0500622_0024347 3300053156 Bacteria 3200
1201 Ga0500630_000468 3300053159 Bacteria 17761
1202 Ga0500630_001248 3300053159 Bacteria 11964
1203 Ga0500634_0061290 3300053161 Bacteria 1996
1204 Ga0500638_001847 3300053162 Bacteria 6994
1205 Ga0500638_053434 3300053162 Bacteria 1950
1206 Ga0500639_000031 3300053163 Bacteria 69938
1207 Ga0500636_0006971 3300053177 Bacteria 6514
1208 Ga0500636_0042809 3300053177 Bacteria 2675
1209 Ga0500636_0064297 3300053177 Bacteria 2137
1210 Ga0500636_0064793 3300053177 Bacteria 2128
1211 Ga0500637_0001085 3300053178 Bacteria 11197
1212 Ga0500637_0002841 3300053178 Bacteria 7801
1213 Ga0500637_0024766 3300053178 Bacteria 3290
1214 Ga0500637_0026684 3300053178 Bacteria 3184
1215 Ga0500637_0032567 3300053178 Bacteria 2907
1216 Ga0500637_0092833 3300053178 Bacteria 1749
1217 Ga0500645_005883 3300053730 Bacteria 4446
1218 Ga0500609_000386 3300053731 Bacteria 6515
1219 Ga0500552_002249 3300053733 Bacteria 1870
1220 Ga0500596_002483 3300053735 Bacteria 3635
1221 Ga0500596_009089 3300053735 Bacteria 1561
1222 Ga0501084_0006462 3300054114 Bacteria 9639
1223 Ga0500661_000349 3300055283 Bacteria 8436
1224 Ga0587077_001070 3300059493 Bacteria 2778
1225 Ga0587082_010826 3300059504 Bacteria 1324
1226 Ga0587083_0018533 3300059505 Bacteria 1260
1227 Ga0587062_000371 3300059639 Bacteria 3031
1228 Ga0587075_001170 3300059644 Bacteria 2460
1229 Ga0587075_008698 3300059644 Bacteria 1305
1230 Ga0587079_006083 3300059647 Bacteria 1741
1231 Ga0501082_0002719 3300060353 Bacteria 15447
1232 Ga0501082_0260104 3300060353 Bacteria 1510
1233 Ga0466962_0028097 3300061719 Bacteria 2696

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8016548790 8016553994 329
2 3300046684 Ga0495669_0066376 Ga0495669_0066376_589_1611 339
3 iso_pu_bacteria 8019629233 8019635574 339
4 3300050496 nmdc:mga07m45_38907_c1 nmdc:mga07m45_38907_c1_17_1048 343
5 iso_pu_bacteria 8016557553 8016561355 348
6 3300059505 Ga0587083_0018533 Ga0587083_0018533_31_1089 351
7 3300048914 Ga0496111_0136763 Ga0496111_0136763_373_1464 362
8 3300035086 Ga0373934_0083126 Ga0373934_0083126_11_1180 367
9 3300035111 Ga0373923_0015450 Ga0373923_0015450_935_2137 371
10 3300035119 Ga0373956_0013338 Ga0373956_0013338_1813_3015 371
11 3300035172 Ga0373955_0000198 Ga0373955_0000198_984_2186 371
12 3300035724 Ga0373933_0000274 Ga0373933_0000274_12_1214 371
13 3300046459 Ga0495629_0000176 Ga0495629_0000176_8301_9503 371
14 3300046462 Ga0495651_0002298 Ga0495651_0002298_13148_14350 371
15 3300046511 Ga0495608_0040372 Ga0495608_0040372_1597_2799 371
16 3300046529 Ga0495652_0004769 Ga0495652_0004769_5290_6492 371
17 3300046533 Ga0495640_0001533 Ga0495640_0001533_8266_9468 371
18 3300046536 Ga0495587_0048963 Ga0495587_0048963_191_1393 371
19 3300046543 Ga0495645_0027395 Ga0495645_0027395_2909_4111 371
20 3300046559 Ga0495667_0019949 Ga0495667_0019949_405_1607 371
21 3300046663 Ga0495635_0000276 Ga0495635_0000276_1618_2820 371
22 3300046809 Ga0495600_0000314 Ga0495600_0000314_387_1589 371
23 3300047317 Ga0495604_0048462 Ga0495604_0048462_394_1596 371
24 3300047444 Ga0495675_0029478 Ga0495675_0029478_1679_2881 371
25 3300047471 Ga0495684_0000023 Ga0495684_0000023_82324_83526 371
26 3300053085 Ga0495619_0000111 Ga0495619_0000111_29261_30463 371
27 3300031238 Ga0265332_10022779 Ga0265332_100227792 385
28 3300031730 Ga0307516_10046028 Ga0307516_100460282 387
29 3300005983 Ga0081540_1002682 Ga0081540_10026827 388
30 3300053085 Ga0495619_0026281 Ga0495619_0026281_162_1388 388
31 3300005937 Ga0081455_10004479 Ga0081455_100044798 389
32 3300053077 Ga0495601_0101022 Ga0495601_0101022_483_1790 389
33 iso_pu_bacteria 3005506211 3005507574 389
34 3300005458 Ga0070681_10089143 Ga0070681_100891432 390
35 3300006042 Ga0075368_10028024 Ga0075368_100280241 391
36 3300006051 Ga0075364_10133529 Ga0075364_101335291 391
37 3300006186 Ga0075369_10002161 Ga0075369_100021614 391
38 3300006186 Ga0075369_10043684 Ga0075369_100436841 391
39 3300010375 Ga0105239_10002860 Ga0105239_100028608 391
40 3300010375 Ga0105239_10005709 Ga0105239_1000570913 391
41 3300025304 Ga0209257_1003528 Ga0209257_10035289 391
42 3300025904 Ga0207647_10060038 Ga0207647_100600382 391
43 3300031249 Ga0265339_10007149 Ga0265339_100071492 391
44 3300031711 Ga0265314_10004155 Ga0265314_100041552 391
45 3300031712 Ga0265342_10024906 Ga0265342_100249062 391
46 3300037471 Ga0395905_0003852 Ga0395905_0003852_5875_7086 391
47 3300042876 Ga0451577_0003923 Ga0451577_0003923_1482_2687 391
48 3300048908 Ga0496105_0110437 Ga0496105_0110437_1079_2257 391
49 3300050491 nmdc:mga00v17_164365_c1 nmdc:mga00v17_164365_c1_88_1299 391
50 3300050516 nmdc:mga0sz30_488_c1 nmdc:mga0sz30_488_c1_1047_2258 391
51 3300050516 nmdc:mga0sz30_49347_c1 nmdc:mga0sz30_49347_c1_540_1751 391
52 3300053094 Ga0500566_0000352 Ga0500566_0000352_17035_18258 391
53 3300053095 Ga0500640_002695 Ga0500640_002695_1135_2358 391
54 3300053111 Ga0500572_000236 Ga0500572_000236_12795_14018 391
55 3300053115 Ga0500591_044989 Ga0500591_044989_667_1890 391
56 3300053150 Ga0500603_013292 Ga0500603_013292_251_1474 391
57 3300053159 Ga0500630_001248 Ga0500630_001248_3971_5194 391
58 3300003215 JGI25153J46596_10006710 JGI25153J46596_100067102 392
59 3300005546 Ga0070696_100102446 Ga0070696_1001024462 392
60 3300006028 Ga0070717_10018197 Ga0070717_100181976 392
61 3300025919 Ga0207657_10220505 Ga0207657_102205051 392
62 3300050496 nmdc:mga07m45_137785_c1 nmdc:mga07m45_137785_c1_112_1335 392
63 3300005983 Ga0081540_1006810 Ga0081540_10068108 393
64 3300010159 Ga0099796_10047678 Ga0099796_100476781 393
65 3300025923 Ga0207681_10148127 Ga0207681_101481272 393
66 3300049592 Ga0501076_0171998 Ga0501076_0171998_57_1268 393
67 3300005983 Ga0081540_1043566 Ga0081540_10435662 394
68 3300045049 Ga0466959_0052438 Ga0466959_0052438_460_1689 394
69 3300046455 Ga0495603_0014464 Ga0495603_0014464_17_1246 394
70 3300046492 Ga0495585_0028375 Ga0495585_0028375_332_1561 394
71 3300046539 Ga0495621_0026467 Ga0495621_0026467_267_1496 394
72 3300046615 Ga0495656_0016207 Ga0495656_0016207_157_1386 394
73 3300046674 Ga0495588_0002893 Ga0495588_0002893_4318_5547 394
74 3300048918 Ga0496115_0228715 Ga0496115_0228715_23_1384 394
75 3300049459 Ga0495678_047442 Ga0495678_047442_240_1445 394
76 3300061719 Ga0466962_0028097 Ga0466962_0028097_1122_2351 394
77 3300005356 Ga0070674_100008705 Ga0070674_1000087053 395
78 3300005434 Ga0070709_10001137 Ga0070709_100011375 395
79 3300005435 Ga0070714_100018594 Ga0070714_1000185944 395
80 3300005437 Ga0070710_10001311 Ga0070710_100013113 395
81 3300005439 Ga0070711_100006268 Ga0070711_1000062681 395
82 3300005439 Ga0070711_100007928 Ga0070711_1000079285 395
83 3300005539 Ga0068853_100213461 Ga0068853_1002134612 395
84 3300006175 Ga0070712_100005053 Ga0070712_1000050532 395
85 3300025905 Ga0207685_10008782 Ga0207685_100087823 395
86 3300025916 Ga0207663_10088076 Ga0207663_100880762 395
87 3300025937 Ga0207669_10023026 Ga0207669_100230261 395
88 3300026041 Ga0207639_10130063 Ga0207639_101300632 395
89 3300035170 Ga0373943_0049732 Ga0373943_0049732_423_1652 395
90 3300037068 Ga0373925_0141996 Ga0373925_0141996_523_1752 395
91 3300046455 Ga0495603_0037274 Ga0495603_0037274_1218_2423 395
92 3300046460 Ga0495638_0021438 Ga0495638_0021438_2468_3673 395
93 3300046507 Ga0495606_0088355 Ga0495606_0088355_648_1853 395
94 3300046512 Ga0495610_0052998 Ga0495610_0052998_720_1925 395
95 3300046515 Ga0495620_0059474 Ga0495620_0059474_232_1437 395
96 3300046522 Ga0495643_0093321 Ga0495643_0093321_157_1362 395
97 3300046558 Ga0495633_0077414 Ga0495633_0077414_31_1236 395
98 3300046616 Ga0495668_0106999 Ga0495668_0106999_38_1243 395
99 3300046674 Ga0495588_0100718 Ga0495588_0100718_220_1449 395
100 3300048919 Ga0496116_0021698 Ga0496116_0021698_2279_3484 395
101 3300048920 Ga0496117_0104235 Ga0496117_0104235_135_1340 395
102 3300048921 Ga0496118_0021357 Ga0496118_0021357_3642_4847 395
103 3300048922 Ga0496119_0087076 Ga0496119_0087076_370_1575 395
104 3300048923 Ga0496120_0044928 Ga0496120_0044928_913_2118 395
105 3300048923 Ga0496120_0088073 Ga0496120_0088073_306_1511 395
106 3300048924 Ga0496121_0044377 Ga0496121_0044377_1016_2221 395
107 3300048924 Ga0496121_0097939 Ga0496121_0097939_826_2031 395
108 3300048928 Ga0496125_0000664 Ga0496125_0000664_48427_49650 395
109 3300048928 Ga0496125_0004086 Ga0496125_0004086_9943_11148 395
110 3300048928 Ga0496125_0027901 Ga0496125_0027901_1385_2590 395
111 3300048929 Ga0496126_0050615 Ga0496126_0050615_1853_3076 395
112 3300049570 Ga0501033_0084302 Ga0501033_0084302_539_1768 395
113 3300049581 Ga0501047_0096309 Ga0501047_0096309_900_2129 395
114 3300049822 Ga0501035_0125053 Ga0501035_0125053_525_1754 395
115 3300050516 nmdc:mga0sz30_25727_c1 nmdc:mga0sz30_25727_c1_389_1594 395
116 3300053077 Ga0495601_0179164 Ga0495601_0179164_152_1375 395
117 3300053093 Ga0500651_0181137 Ga0500651_0181137_16_1221 395
118 3300053094 Ga0500566_0000445 Ga0500566_0000445_9334_10539 395
119 3300053104 Ga0500556_0000029 Ga0500556_0000029_150324_151529 395
120 3300053122 Ga0500608_000713 Ga0500608_000713_4561_5766 395
121 3300053130 Ga0500642_0000329 Ga0500642_0000329_1392_2597 395
122 3300053131 Ga0500652_016900 Ga0500652_016900_28_1233 395
123 3300053136 Ga0500559_0000105 Ga0500559_0000105_51875_53080 395
124 3300053139 Ga0500568_0001586 Ga0500568_0001586_4828_6033 395
125 3300053145 Ga0500586_000403 Ga0500586_000403_3345_4550 395
126 3300053151 Ga0500604_0002762 Ga0500604_0002762_2297_3502 395
127 3300053153 Ga0500616_0001700 Ga0500616_0001700_13863_15068 395
128 3300053156 Ga0500622_0024347 Ga0500622_0024347_855_2060 395
129 3300053178 Ga0500637_0092833 Ga0500637_0092833_63_1268 395
130 iso_pu_bacteria 2791355197 2793067021 395
131 iso_pu_bacteria 2857524615 2857525053 395
132 iso_pu_bacteria 2885374607 2885380984 395
133 iso_pu_bacteria 2893066018 2893069640 395
134 iso_pu_bacteria 2906610324 2906616830 395
135 iso_pu_bacteria 2919073203 2919078938 395
136 iso_pu_bacteria 2922425934 2922431107 395
137 iso_pu_bacteria 2935630451 2935636906 395
138 iso_pu_bacteria 2941507105 2941513638 395
139 iso_pu_bacteria 2941515067 2941521506 395
140 iso_pu_bacteria 2941523033 2941529260 395
141 iso_pu_bacteria 8019555841 8019565691 395
142 iso_pu_bacteria 8019565922 8019575782 395
143 3300005435 Ga0070714_100007296 Ga0070714_1000072965 396
144 3300005436 Ga0070713_100004722 Ga0070713_1000047228 396
145 3300005563 Ga0068855_100324296 Ga0068855_1003242962 396
146 3300005616 Ga0068852_100020420 Ga0068852_1000204202 396
147 3300006173 Ga0070716_100016735 Ga0070716_1000167353 396
148 3300025942 Ga0207689_10047565 Ga0207689_100475652 396
149 3300025945 Ga0207679_10096446 Ga0207679_100964461 396
150 3300026078 Ga0207702_10106126 Ga0207702_101061261 396
151 3300031344 Ga0265316_10038893 Ga0265316_100388932 396
152 3300035692 Ga0373935_0008496 Ga0373935_0008496_151_1353 396
153 3300035695 Ga0373927_0018690 Ga0373927_0018690_2673_3875 396
154 3300035725 Ga0373947_0097414 Ga0373947_0097414_278_1486 396
155 3300037068 Ga0373925_0119252 Ga0373925_0119252_826_2028 396
156 3300046519 Ga0495632_0045243 Ga0495632_0045243_194_1402 396
157 3300046524 Ga0495648_0141218 Ga0495648_0141218_40_1248 396
158 3300046526 Ga0495666_0006119 Ga0495666_0006119_2917_4161 396
159 3300046684 Ga0495669_0081610 Ga0495669_0081610_225_1433 396
160 3300047319 Ga0495674_0015846 Ga0495674_0015846_4262_5470 396
161 3300049570 Ga0501033_0245070 Ga0501033_0245070_53_1261 396
162 3300050489 nmdc:mga03683_2888_c1 nmdc:mga03683_2888_c1_1416_2627 396
163 3300050490 nmdc:mga03n38_67070_c1 nmdc:mga03n38_67070_c1_354_1565 396
164 3300053084 Ga0495595_0003578 Ga0495595_0003578_938_2146 396
165 3300053094 Ga0500566_0000223 Ga0500566_0000223_15201_16409 396
166 3300053094 Ga0500566_0042561 Ga0500566_0042561_1174_2376 396
167 3300053111 Ga0500572_000848 Ga0500572_000848_2452_3660 396
168 3300053119 Ga0500595_004865 Ga0500595_004865_2366_3574 396
169 3300053136 Ga0500559_0002267 Ga0500559_0002267_5261_6469 396
170 3300053148 Ga0500590_061601 Ga0500590_061601_634_1842 396
171 3300053150 Ga0500603_000237 Ga0500603_000237_9588_10796 396
172 3300053159 Ga0500630_000468 Ga0500630_000468_9655_10863 396
173 3300053163 Ga0500639_000031 Ga0500639_000031_65906_67114 396
174 3300053735 Ga0500596_002483 Ga0500596_002483_1698_2906 396
175 3300005457 Ga0070662_100065903 Ga0070662_1000659033 397
176 3300014497 Ga0182008_10000392 Ga0182008_1000039232 397
177 3300025912 Ga0207707_10075781 Ga0207707_100757812 397
178 3300025933 Ga0207706_10079123 Ga0207706_100791232 397
179 3300041512 Ga0451853_3488916 Ga0451853_3488916_236_1465 397
180 3300048915 Ga0496112_0049960 Ga0496112_0049960_2473_3687 397
181 3300049580 Ga0501046_0047803 Ga0501046_0047803_45_1289 397
182 iso_pu_bacteria 2508501128 2509151530 397
183 iso_pu_bacteria 2513237141 2513891618 397
184 iso_pu_bacteria 2906635258 2906643524 397
185 3300003659 JGI25404J52841_10007004 JGI25404J52841_100070041 398
186 3300005983 Ga0081540_1012123 Ga0081540_10121231 398
187 3300006028 Ga0070717_10017205 Ga0070717_100172053 398
188 3300006048 Ga0075363_100123093 Ga0075363_1001230932 398
189 3300006178 Ga0075367_10063200 Ga0075367_100632002 398
190 3300007265 Ga0099794_10001086 Ga0099794_100010864 398
191 3300025898 Ga0207692_10000103 Ga0207692_1000010318 398
192 3300025906 Ga0207699_10003630 Ga0207699_100036307 398
193 3300025906 Ga0207699_10059907 Ga0207699_100599072 398
194 3300025915 Ga0207693_10001154 Ga0207693_100011549 398
195 3300025916 Ga0207663_10000733 Ga0207663_1000073311 398
196 3300025916 Ga0207663_10038827 Ga0207663_100388272 398
197 3300025928 Ga0207700_10018146 Ga0207700_100181464 398
198 3300025929 Ga0207664_10002058 Ga0207664_100020585 398
199 3300025929 Ga0207664_10069689 Ga0207664_100696892 398
200 3300025939 Ga0207665_10000583 Ga0207665_1000058313 398
201 3300038443 Ga0395901_0076603 Ga0395901_0076603_1394_2608 398
202 3300046491 Ga0495584_0081540 Ga0495584_0081540_188_1402 398
203 3300046499 Ga0495594_0015786 Ga0495594_0015786_739_1953 398
204 3300046537 Ga0495598_0008960 Ga0495598_0008960_1089_2303 398
205 3300046665 Ga0495661_0076552 Ga0495661_0076552_604_1818 398
206 3300046691 Ga0495670_0023077 Ga0495670_0023077_43_1257 398
207 3300047321 Ga0495676_0075107 Ga0495676_0075107_13_1227 398
208 3300048924 Ga0496121_0092776 Ga0496121_0092776_372_1595 398
209 iso_pu_bacteria 2513237092 2513627454 398
210 iso_pu_bacteria 2513237098 2513676904 398
211 iso_pu_bacteria 2513237101 2513696299 398
212 iso_pu_bacteria 2513237137 2513857227 398
213 iso_pu_bacteria 2513237137 2513857228 398
214 iso_pu_bacteria 2517572143 2517888167 398
215 iso_pu_bacteria 2517572143 2517888168 398
216 iso_pu_bacteria 2524023210 2524468623 398
217 iso_pu_bacteria 2524023228 2524533346 398
218 iso_pu_bacteria 2667528175 2671119368 398
219 iso_pu_bacteria 2667528175 2671119369 398
220 iso_pu_bacteria 2721755755 2723842268 398
221 iso_pu_bacteria 2728368998 2728753418 398
222 iso_pu_bacteria 2728368998 2728753829 398
223 iso_pu_bacteria 2791355197 2793073452 398
224 iso_pu_bacteria 2791355199 2793077960 398
225 iso_pu_bacteria 2791355199 2793077961 398
226 iso_pu_bacteria 2824679649 2824684721 398
227 iso_pu_bacteria 2841957949 2841960586 398
228 iso_pu_bacteria 2874604998 2874610143 398
229 iso_pu_bacteria 2874612657 2874620240 398
230 iso_pu_bacteria 2876761206 2876765310 398
231 iso_pu_bacteria 2876808645 2876809362 398
232 iso_pu_bacteria 2879110137 2879113607 398
233 iso_pu_bacteria 2879110137 2879117011 398
234 iso_pu_bacteria 2885374607 2885380626 398
235 iso_pu_bacteria 2885374607 2885380627 398
236 iso_pu_bacteria 2885383462 2885390777 398
237 iso_pu_bacteria 2889033259 2889036390 398
238 iso_pu_bacteria 2903748898 2903752466 398
239 iso_pu_bacteria 2903748898 2903752467 398
240 iso_pu_bacteria 2903768456 2903772231 398
241 iso_pu_bacteria 2904690495 2904695745 398
242 iso_pu_bacteria 2904699407 2904710032 398
243 iso_pu_bacteria 2906610324 2906614470 398
244 iso_pu_bacteria 2906635258 2906643400 398
245 iso_pu_bacteria 2906635258 2906643401 398
246 iso_pu_bacteria 2906660503 2906666592 398
247 iso_pu_bacteria 2906660503 2906666593 398
248 iso_pu_bacteria 2908739725 2908746700 398
249 iso_pu_bacteria 2908756301 2908764261 398
250 iso_pu_bacteria 2922361189 2922365269 398
251 iso_pu_bacteria 2922361189 2922366733 398
252 iso_pu_bacteria 2922386360 2922389364 398
253 iso_pu_bacteria 2922393267 2922398523 398
254 iso_pu_bacteria 2922425934 2922426306 398
255 iso_pu_bacteria 2935630451 2935632689 398
256 iso_pu_bacteria 2941507105 2941508647 398
257 iso_pu_bacteria 2941515067 2941516477 398
258 iso_pu_bacteria 2941523033 2941524507 398
259 iso_pu_bacteria 3005474847 3005475672 398
260 iso_pu_bacteria 3005474847 3005475673 398
261 iso_pu_bacteria 8006926726 8006932267 398
262 iso_pu_bacteria 8006933436 8006937010 398
263 iso_pu_bacteria 8006964411 8006966326 398
264 iso_pu_bacteria 8006973647 8006976975 398
265 iso_pu_bacteria 8006984368 8006993144 398
266 iso_pu_bacteria 8006994254 8006996996 398
267 iso_pu_bacteria 8019565922 8019571742 398
268 iso_pu_bacteria 8056673599 8056678182 398
269 iso_pu_bacteria 8056681323 8056683426 398
270 iso_pu_bacteria 8056689827 8056692709 398
271 3300005985 Ga0081539_10044031 Ga0081539_100440312 399
272 3300006177 Ga0075362_10006528 Ga0075362_100065283 399
273 3300006914 Ga0075436_100200315 Ga0075436_1002003152 399
274 3300009101 Ga0105247_10072239 Ga0105247_100722392 399
275 3300009551 Ga0105238_10174752 Ga0105238_101747522 399
276 3300014968 Ga0157379_10206082 Ga0157379_102060822 399
277 3300025297 Ga0209758_1005849 Ga0209758_10058493 399
278 3300046455 Ga0495603_0018302 Ga0495603_0018302_2815_4032 399
279 3300046455 Ga0495603_0026289 Ga0495603_0026289_287_1504 399
280 3300046475 Ga0495639_0051011 Ga0495639_0051011_474_1691 399
281 3300046492 Ga0495585_0058078 Ga0495585_0058078_481_1698 399
282 3300046523 Ga0495644_0029270 Ga0495644_0029270_598_1815 399
283 3300046558 Ga0495633_0033632 Ga0495633_0033632_594_1811 399
284 3300046615 Ga0495656_0044436 Ga0495656_0044436_438_1655 399
285 3300046648 Ga0495611_0020338 Ga0495611_0020338_1614_2831 399
286 3300046660 Ga0495625_0063911 Ga0495625_0063911_243_1460 399
287 3300046665 Ga0495661_0047854 Ga0495661_0047854_844_2154 399
288 3300046674 Ga0495588_0001458 Ga0495588_0001458_8170_9387 399
289 3300046691 Ga0495670_0025540 Ga0495670_0025540_563_1780 399
290 3300047321 Ga0495676_0165714 Ga0495676_0165714_217_1434 399
291 3300048905 Ga0496102_0153797 Ga0496102_0153797_101_1318 399
292 3300048912 Ga0496109_0049885 Ga0496109_0049885_2443_3660 399
293 3300048914 Ga0496111_0071828 Ga0496111_0071828_675_1892 399
294 3300048921 Ga0496118_0066672 Ga0496118_0066672_600_1910 399
295 3300048924 Ga0496121_0016341 Ga0496121_0016341_1577_2887 399
296 3300048926 Ga0496123_0117135 Ga0496123_0117135_112_1422 399
297 3300048929 Ga0496126_0012671 Ga0496126_0012671_6906_8123 399
298 3300048929 Ga0496126_0074424 Ga0496126_0074424_760_2070 399
299 3300050495 nmdc:mga04h51_33113_c1 nmdc:mga04h51_33113_c1_391_1608 399
300 3300053080 Ga0500635_0009758 Ga0500635_0009758_52_1272 399
301 3300053089 Ga0500581_045915 Ga0500581_045915_841_2151 399
302 3300053093 Ga0500651_0046722 Ga0500651_0046722_1138_2355 399
303 3300053094 Ga0500566_0000872 Ga0500566_0000872_7181_8404 399
304 3300053104 Ga0500556_0000003 Ga0500556_0000003_391826_393136 399
305 3300053108 Ga0500562_013354 Ga0500562_013354_217_1527 399
306 3300053109 Ga0500569_021182 Ga0500569_021182_234_1544 399
307 3300053119 Ga0500595_002014 Ga0500595_002014_1077_2294 399
308 3300053130 Ga0500642_0000015 Ga0500642_0000015_121530_122753 399
309 3300053131 Ga0500652_001212 Ga0500652_001212_1248_2558 399
310 3300053134 Ga0500658_0068983 Ga0500658_0068983_147_1364 399
311 3300053136 Ga0500559_0000461 Ga0500559_0000461_11245_12468 399
312 3300053139 Ga0500568_0005182 Ga0500568_0005182_2515_3825 399
313 3300053142 Ga0500577_0012174 Ga0500577_0012174_109_1419 399
314 3300053150 Ga0500603_000178 Ga0500603_000178_14540_15760 399
315 3300053151 Ga0500604_0043294 Ga0500604_0043294_39_1349 399
316 3300053153 Ga0500616_0000033 Ga0500616_0000033_73256_74566 399
317 3300053156 Ga0500622_0017137 Ga0500622_0017137_2157_3467 399
318 3300053177 Ga0500636_0006971 Ga0500636_0006971_3799_5022 399
319 3300053178 Ga0500637_0001085 Ga0500637_0001085_4311_5531 399
320 3300053730 Ga0500645_005883 Ga0500645_005883_1360_2577 399
321 iso_pu_bacteria 2507262055 2507505912 399
322 iso_pu_bacteria 2508501009 2508540102 399
323 iso_pu_bacteria 2508501042 2508696172 399
324 iso_pu_bacteria 2513237092 2513627455 399
325 iso_pu_bacteria 2513237094 2513638341 399
326 iso_pu_bacteria 2513237096 2513656651 399
327 iso_pu_bacteria 2513237098 2513674285 399
328 iso_pu_bacteria 2513237104 2513715394 399
329 iso_pu_bacteria 2513237137 2513858559 399
330 iso_pu_bacteria 2513237139 2513877256 399
331 iso_pu_bacteria 2513237141 2513895206 399
332 iso_pu_bacteria 2513237145 2513917836 399
333 iso_pu_bacteria 2513237161 2514014631 399
334 iso_pu_bacteria 2515154112 2515631385 399
335 iso_pu_bacteria 2524023205 2524441174 399
336 iso_pu_bacteria 2524023205 2524442983 399
337 iso_pu_bacteria 2524023210 2524468624 399
338 iso_pu_bacteria 2524023228 2524533345 399
339 iso_pu_bacteria 2524023228 2524539359 399
340 iso_pu_bacteria 2528768022 2528855108 399
341 iso_pu_bacteria 2602042107 2603857222 399
342 iso_pu_bacteria 2602042107 2603860073 399
343 iso_pu_bacteria 2617270735 2617347792 399
344 iso_pu_bacteria 2617270741 2617374715 399
345 iso_pu_bacteria 2617270741 2617374716 399
346 iso_pu_bacteria 2667528175 2671117748 399
347 iso_pu_bacteria 2721755755 2723842269 399
348 iso_pu_bacteria 2728368998 2728752155 399
349 iso_pu_bacteria 2728368998 2728753828 399
350 iso_pu_bacteria 2744054633 2745081423 399
351 iso_pu_bacteria 2744054633 2745081927 399
352 iso_pu_bacteria 2791355196 2793061552 399
353 iso_pu_bacteria 2791355197 2793073453 399
354 iso_pu_bacteria 2802429603 2805916144 399
355 iso_pu_bacteria 2816332527 2818240883 399
356 iso_pu_bacteria 2824600985 2824603605 399
357 iso_pu_bacteria 2824600985 2824603606 399
358 iso_pu_bacteria 2824609381 2824610808 399
359 iso_pu_bacteria 2824609381 2824610809 399
360 iso_pu_bacteria 2824617872 2824623187 399
361 iso_pu_bacteria 2824626560 2824632215 399
362 iso_pu_bacteria 2824635225 2824642550 399
363 iso_pu_bacteria 2824644064 2824649852 399
364 iso_pu_bacteria 2824653114 2824660883 399
365 iso_pu_bacteria 2824653114 2824660884 399
366 iso_pu_bacteria 2824661429 2824667334 399
367 iso_pu_bacteria 2824671348 2824675069 399
368 iso_pu_bacteria 2824679649 2824684720 399
369 iso_pu_bacteria 2824687955 2824691804 399
370 iso_pu_bacteria 2824696289 2824703283 399
371 iso_pu_bacteria 2824704595 2824709942 399
372 iso_pu_bacteria 2824714736 2824721215 399
373 iso_pu_bacteria 2824723954 2824730474 399
374 iso_pu_bacteria 2824732956 2824737746 399
375 iso_pu_bacteria 2824732956 2824737747 399
376 iso_pu_bacteria 2824746037 2824750794 399
377 iso_pu_bacteria 2824746037 2824750795 399
378 iso_pu_bacteria 2824753945 2824762452 399
379 iso_pu_bacteria 2824763712 2824772172 399
380 iso_pu_bacteria 2824773399 2824775725 399
381 iso_pu_bacteria 2838122688 2838125101 399
382 iso_pu_bacteria 2841941048 2841945839 399
383 iso_pu_bacteria 2841949485 2841957737 399
384 iso_pu_bacteria 2841966195 2841973350 399
385 iso_pu_bacteria 2841974524 2841979486 399
386 iso_pu_bacteria 2841983080 2841989389 399
387 iso_pu_bacteria 2842038055 2842044380 399
388 iso_pu_bacteria 2842045827 2842051631 399
389 iso_pu_bacteria 2844315083 2844316240 399
390 iso_pu_bacteria 2844315083 2844316241 399
391 iso_pu_bacteria 2847930680 2847939448 399
392 iso_pu_bacteria 2847939898 2847941205 399
393 iso_pu_bacteria 2857509624 2857513329 399
394 iso_pu_bacteria 2857524615 2857525056 399
395 iso_pu_bacteria 2857524615 2857530889 399
396 iso_pu_bacteria 2874590934 2874596352 399
397 iso_pu_bacteria 2874604998 2874610142 399
398 iso_pu_bacteria 2874612657 2874620241 399
399 iso_pu_bacteria 2874628541 2874633326 399
400 iso_pu_bacteria 2874645413 2874650340 399
401 iso_pu_bacteria 2876761206 2876761635 399
402 iso_pu_bacteria 2876761206 2876761636 399
403 iso_pu_bacteria 2876771140 2876776817 399
404 iso_pu_bacteria 2876818435 2876824607 399
405 iso_pu_bacteria 2879074833 2879080954 399
406 iso_pu_bacteria 2879083081 2879091110 399
407 iso_pu_bacteria 2879099564 2879106666 399
408 iso_pu_bacteria 2879110137 2879117010 399
409 iso_pu_bacteria 2879127579 2879133800 399
410 iso_pu_bacteria 2879142872 2879143060 399
411 iso_pu_bacteria 2881364244 2881369616 399
412 iso_pu_bacteria 2885366525 2885367742 399
413 iso_pu_bacteria 2885366525 2885367743 399
414 iso_pu_bacteria 2885374607 2885381402 399
415 iso_pu_bacteria 2885383462 2885386437 399
416 iso_pu_bacteria 2885383462 2885387818 399
417 iso_pu_bacteria 2885409591 2885418287 399
418 iso_pu_bacteria 2888378607 2888387726 399
419 iso_pu_bacteria 2888388044 2888389945 399
420 iso_pu_bacteria 2888388044 2888389946 399
421 iso_pu_bacteria 2888419890 2888421156 399
422 iso_pu_bacteria 2888419890 2888421157 399
423 iso_pu_bacteria 2889033259 2889036391 399
424 iso_pu_bacteria 2893066018 2893066391 399
425 iso_pu_bacteria 2893066018 2893069643 399
426 iso_pu_bacteria 2903727486 2903728422 399
427 iso_pu_bacteria 2903727486 2903728423 399
428 iso_pu_bacteria 2903768456 2903772232 399
429 iso_pu_bacteria 2904666416 2904671528 399
430 iso_pu_bacteria 2904690495 2904696550 399
431 iso_pu_bacteria 2904699407 2904710033 399
432 iso_pu_bacteria 2904711408 2904719828 399
433 iso_pu_bacteria 2906602504 2906606564 399
434 iso_pu_bacteria 2906602504 2906606565 399
435 iso_pu_bacteria 2906610324 2906614471 399
436 iso_pu_bacteria 2906626472 2906631442 399
437 iso_pu_bacteria 2906635258 2906636779 399
438 iso_pu_bacteria 2906643746 2906650307 399
439 iso_pu_bacteria 2906643746 2906650308 399
440 iso_pu_bacteria 2906660503 2906661372 399
441 iso_pu_bacteria 2908775508 2908777198 399
442 iso_pu_bacteria 2908775508 2908777199 399
443 iso_pu_bacteria 2919073203 2919077898 399
444 iso_pu_bacteria 2919073203 2919078941 399
445 iso_pu_bacteria 2922361189 2922366732 399
446 iso_pu_bacteria 2922368715 2922377432 399
447 iso_pu_bacteria 2922386360 2922389365 399
448 iso_pu_bacteria 2922393267 2922398524 399
449 iso_pu_bacteria 2922425934 2922426307 399
450 iso_pu_bacteria 2922425934 2922429369 399
451 iso_pu_bacteria 2929615660 2929622222 399
452 iso_pu_bacteria 2929624759 2929630131 399
453 iso_pu_bacteria 2932784394 2932787938 399
454 iso_pu_bacteria 2932794094 2932799428 399
455 iso_pu_bacteria 2932801729 2932802173 399
456 iso_pu_bacteria 2932809354 2932813313 399
457 iso_pu_bacteria 2932818245 2932820010 399
458 iso_pu_bacteria 2932828146 2932832926 399
459 iso_pu_bacteria 2933577622 2933584164 399
460 iso_pu_bacteria 2935608549 2935614333 399
461 iso_pu_bacteria 2935616580 2935620411 399
462 iso_pu_bacteria 2935630451 2935632690 399
463 iso_pu_bacteria 2935630451 2935633746 399
464 iso_pu_bacteria 2935638405 2935640735 399
465 iso_pu_bacteria 2935648319 2935649363 399
466 iso_pu_bacteria 2935656913 2935657865 399
467 iso_pu_bacteria 2935665750 2935668927 399
468 iso_pu_bacteria 2935675223 2935681347 399
469 iso_pu_bacteria 2935684952 2935687236 399
470 iso_pu_bacteria 2935694250 2935696793 399
471 iso_pu_bacteria 2935703347 2935709115 399
472 iso_pu_bacteria 2935713505 2935716924 399
473 iso_pu_bacteria 2935722832 2935722951 399
474 iso_pu_bacteria 2935732158 2935734508 399
475 iso_pu_bacteria 2935741537 2935744701 399
476 iso_pu_bacteria 2935750917 2935753202 399
477 iso_pu_bacteria 2935760218 2935767606 399
478 iso_pu_bacteria 2935769743 2935770201 399
479 iso_pu_bacteria 2935777560 2935777769 399
480 iso_pu_bacteria 2935785616 2935786745 399
481 iso_pu_bacteria 2935793552 2935794799 399
482 iso_pu_bacteria 2935801545 2935804845 399
483 iso_pu_bacteria 2935810662 2935815994 399
484 iso_pu_bacteria 2935819856 2935826551 399
485 iso_pu_bacteria 2935827899 2935832242 399
486 iso_pu_bacteria 2935837841 2935840928 399
487 iso_pu_bacteria 2935847175 2935851155 399
488 iso_pu_bacteria 2935855204 2935859297 399
489 iso_pu_bacteria 2935864058 2935864481 399
490 iso_pu_bacteria 2935873716 2935875167 399
491 iso_pu_bacteria 2935883170 2935887329 399
492 iso_pu_bacteria 2935908558 2935913204 399
493 iso_pu_bacteria 2935916978 2935922626 399
494 iso_pu_bacteria 2935926038 2935930871 399
495 iso_pu_bacteria 2935934488 2935939795 399
496 iso_pu_bacteria 2935942939 2935946744 399
497 iso_pu_bacteria 2935951376 2935956055 399
498 iso_pu_bacteria 2935959822 2935964959 399
499 iso_pu_bacteria 2935967501 2935972848 399
500 iso_pu_bacteria 2935975950 2935978235 399
501 iso_pu_bacteria 2935984226 2935985639 399
502 iso_pu_bacteria 2935992306 2935995858 399
503 iso_pu_bacteria 2936002035 2936005769 399
504 iso_pu_bacteria 2936011229 2936012084 399
505 iso_pu_bacteria 2936019824 2936020835 399
506 iso_pu_bacteria 2936028420 2936029377 399
507 iso_pu_bacteria 2936037263 2936041897 399
508 iso_pu_bacteria 2936046547 2936048299 399
509 iso_pu_bacteria 2936055302 2936056590 399
510 iso_pu_bacteria 2940556831 2940559115 399
511 iso_pu_bacteria 2941507105 2941508646 399
512 iso_pu_bacteria 2941507105 2941510637 399
513 iso_pu_bacteria 2941515067 2941516476 399
514 iso_pu_bacteria 2941515067 2941517624 399
515 iso_pu_bacteria 2941523033 2941524508 399
516 iso_pu_bacteria 2941523033 2941525641 399
517 iso_pu_bacteria 2941531003 2941534598 399
518 iso_pu_bacteria 2941531003 2941534600 399
519 iso_pu_bacteria 2941538514 2941541810 399
520 iso_pu_bacteria 3005483717 3005491059 399
521 iso_pu_bacteria 3005483717 3005491060 399
522 iso_pu_bacteria 3005506211 3005510900 399
523 iso_pu_bacteria 3005587118 3005592183 399
524 iso_pu_bacteria 3005587118 3005592184 399
525 iso_pu_bacteria 3005594810 3005595852 399
526 iso_pu_bacteria 3005594810 3005595853 399
527 iso_pu_bacteria 3005710791 3005711800 399
528 iso_pu_bacteria 3005718088 3005719049 399
529 iso_pu_bacteria 3005718088 3005719051 399
530 iso_pu_bacteria 8006926726 8006932271 399
531 iso_pu_bacteria 8006933436 8006937011 399
532 iso_pu_bacteria 8006964411 8006966325 399
533 iso_pu_bacteria 8006973647 8006976976 399
534 iso_pu_bacteria 8006984368 8006993143 399
535 iso_pu_bacteria 8006994254 8006996995 399
536 iso_pu_bacteria 8016511872 8016517275 399
537 iso_pu_bacteria 8016530956 8016532044 399
538 iso_pu_bacteria 8016539877 8016545253 399
539 iso_pu_bacteria 8016548790 8016556836 399
540 iso_pu_bacteria 8016557553 8016565188 399
541 iso_pu_bacteria 8016566248 8016570331 399
542 iso_pu_bacteria 8016575299 8016582879 399
543 iso_pu_bacteria 8016583857 8016585415 399
544 iso_pu_bacteria 8016583857 8016585416 399
545 iso_pu_bacteria 8016595262 8016602832 399
546 iso_pu_bacteria 8016603502 8016605700 399
547 iso_pu_bacteria 8016630954 8016634900 399
548 iso_pu_bacteria 8017057580 8017059320 399
549 iso_pu_bacteria 8019530166 8019531860 399
550 iso_pu_bacteria 8019538911 8019539670 399
551 iso_pu_bacteria 8019547302 8019550981 399
552 iso_pu_bacteria 8019555841 8019561666 399
553 iso_pu_bacteria 8019565922 8019571741 399
554 iso_pu_bacteria 8019576017 8019576306 399
555 iso_pu_bacteria 8019586578 8019594180 399
556 iso_pu_bacteria 8019608314 8019611129 399
557 iso_pu_bacteria 8019619141 8019621978 399
558 iso_pu_bacteria 8019629233 8019631343 399
559 iso_pu_bacteria 8019638758 8019639275 399
560 iso_pu_bacteria 8019648815 8019651415 399
561 iso_pu_bacteria 8019659431 8019668146 399
562 iso_pu_bacteria 8019668869 8019677612 399
563 iso_pu_bacteria 8019687851 8019693313 399
564 iso_pu_bacteria 8055742211 8055743529 399
565 iso_pu_bacteria 8056673599 8056678181 399
566 iso_pu_bacteria 8056681323 8056683427 399
567 iso_pu_bacteria 8056967851 8056974178 399
568 3300005336 Ga0070680_100001453 Ga0070680_1000014531 400
569 3300005455 Ga0070663_100004678 Ga0070663_1000046782 400
570 3300005458 Ga0070681_10000334 Ga0070681_1000033425 400
571 3300005530 Ga0070679_100005911 Ga0070679_1000059118 400
572 3300005530 Ga0070679_100213723 Ga0070679_1002137232 400
573 3300005539 Ga0068853_100023239 Ga0068853_1000232392 400
574 3300005548 Ga0070665_100200140 Ga0070665_1002001402 400
575 3300006943 Ga0099822_1000541 Ga0099822_10005418 400
576 3300009093 Ga0105240_10004565 Ga0105240_100045652 400
577 3300009551 Ga0105238_10069691 Ga0105238_100696912 400
578 3300010375 Ga0105239_10244105 Ga0105239_102441052 400
579 3300025909 Ga0207705_10090067 Ga0207705_100900672 400
580 3300025912 Ga0207707_10000134 Ga0207707_1000013468 400
581 3300025912 Ga0207707_10031981 Ga0207707_100319812 400
582 3300025917 Ga0207660_10050275 Ga0207660_100502751 400
583 3300025920 Ga0207649_10097219 Ga0207649_100972192 400
584 3300025921 Ga0207652_10133098 Ga0207652_101330982 400
585 3300025949 Ga0207667_10092869 Ga0207667_100928692 400
586 3300025949 Ga0207667_10412598 Ga0207667_104125981 400
587 3300026041 Ga0207639_10107050 Ga0207639_101070502 400
588 3300026121 Ga0207683_10038696 Ga0207683_100386962 400
589 3300028379 Ga0268266_10100363 Ga0268266_101003632 400
590 3300031730 Ga0307516_10120986 Ga0307516_101209862 400
591 3300037312 Ga0395899_0048061 Ga0395899_0048061_295_1515 400
592 3300037418 Ga0395900_0002675 Ga0395900_0002675_4882_6102 400
593 3300037466 Ga0395898_0005085 Ga0395898_0005085_9644_10864 400
594 3300046522 Ga0495643_0032765 Ga0495643_0032765_619_1851 400
595 3300046543 Ga0495645_0021151 Ga0495645_0021151_1624_2850 400
596 3300046660 Ga0495625_0051694 Ga0495625_0051694_819_2051 400
597 3300048091 Ga0495626_0097759 Ga0495626_0097759_42_1268 400
598 3300048922 Ga0496119_0033943 Ga0496119_0033943_208_1461 400
599 3300048926 Ga0496123_0105932 Ga0496123_0105932_19_1239 400
600 3300049569 Ga0501032_0022837 Ga0501032_0022837_1034_2254 400
601 3300049823 Ga0501044_0086417 Ga0501044_0086417_813_2033 400
602 3300053094 Ga0500566_0000872 Ga0500566_0000872_2993_4213 400
603 3300053098 Ga0500650_0001140 Ga0500650_0001140_2632_3864 400
604 3300053104 Ga0500556_0000003 Ga0500556_0000003_387620_388852 400
605 3300053136 Ga0500559_0000461 Ga0500559_0000461_15436_16656 400
606 3300053139 Ga0500568_0020846 Ga0500568_0020846_132_1364 400
607 3300053153 Ga0500616_0000033 Ga0500616_0000033_77539_78771 400
608 3300053156 Ga0500622_0020356 Ga0500622_0020356_1532_2764 400
609 3300053161 Ga0500634_0061290 Ga0500634_0061290_380_1609 400
610 3300053177 Ga0500636_0042809 Ga0500636_0042809_16_1236 400
611 3300053178 Ga0500637_0032567 Ga0500637_0032567_1004_2224 400
612 iso_pu_bacteria 2508501128 2509151531 400
613 iso_pu_bacteria 2513237141 2513891619 400
614 3300003203 JGI25406J46586_10005250 JGI25406J46586_100052503 401
615 3300003203 JGI25406J46586_10008729 JGI25406J46586_100087294 401
616 3300003659 JGI25404J52841_10001487 JGI25404J52841_100014874 401
617 3300003911 JGI25405J52794_10012251 JGI25405J52794_100122511 401
618 3300005336 Ga0070680_100124543 Ga0070680_1001245432 401
619 3300005436 Ga0070713_100049823 Ga0070713_1000498231 401
620 3300005458 Ga0070681_10049053 Ga0070681_100490533 401
621 3300005536 Ga0070697_100002686 Ga0070697_1000026863 401
622 3300005545 Ga0070695_100004100 Ga0070695_1000041007 401
623 3300005545 Ga0070695_100141411 Ga0070695_1001414112 401
624 3300005548 Ga0070665_100308563 Ga0070665_1003085632 401
625 3300005937 Ga0081455_10000763 Ga0081455_1000076312 401
626 3300005937 Ga0081455_10003860 Ga0081455_1000386010 401
627 3300005937 Ga0081455_10017893 Ga0081455_100178937 401
628 3300005983 Ga0081540_1013655 Ga0081540_10136553 401
629 3300005983 Ga0081540_1026650 Ga0081540_10266502 401
630 3300005983 Ga0081540_1036933 Ga0081540_10369332 401
631 3300005985 Ga0081539_10000157 Ga0081539_1000015745 401
632 3300005985 Ga0081539_10000498 Ga0081539_1000049868 401
633 3300005985 Ga0081539_10031508 Ga0081539_100315083 401
634 3300006051 Ga0075364_10035769 Ga0075364_100357693 401
635 3300006914 Ga0075436_100000818 Ga0075436_1000008189 401
636 3300013102 Ga0157371_10008618 Ga0157371_100086187 401
637 3300013104 Ga0157370_10080805 Ga0157370_100808053 401
638 3300021384 Ga0213876_10000505 Ga0213876_1000050519 401
639 3300021384 Ga0213876_10005094 Ga0213876_100050942 401
640 3300021388 Ga0213875_10006397 Ga0213875_100063974 401
641 3300025906 Ga0207699_10019947 Ga0207699_100199471 401
642 3300025914 Ga0207671_10053909 Ga0207671_100539092 401
643 3300025924 Ga0207694_10027026 Ga0207694_100270262 401
644 3300025928 Ga0207700_10137409 Ga0207700_101374092 401
645 3300025929 Ga0207664_10020618 Ga0207664_100206183 401
646 3300025961 Ga0207712_10000950 Ga0207712_100009507 401
647 3300027671 Ga0209588_1013802 Ga0209588_10138024 401
648 3300031242 Ga0265329_10006285 Ga0265329_100062854 401
649 3300031247 Ga0265340_10036924 Ga0265340_100369242 401
650 3300031712 Ga0265342_10014580 Ga0265342_100145804 401
651 3300035113 Ga0373936_0008794 Ga0373936_0008794_1188_2408 401
652 3300035116 Ga0373945_0054002 Ga0373945_0054002_66_1289 401
653 3300037853 Ga0436364_0259789 Ga0436364_0259789_464_1693 401
654 3300039437 Ga0436365_0021793 Ga0436365_0021793_39678_40907 401
655 3300039437 Ga0436365_0235812 Ga0436365_0235812_1189_2412 401
656 3300039437 Ga0436365_0400047 Ga0436365_0400047_1416_2645 401
657 3300039437 Ga0436365_1161315 Ga0436365_1161315_22657_23886 401
658 3300039447 Ga0436361_0885563 Ga0436361_0885563_218_1438 401
659 3300039450 Ga0436363_0045132 Ga0436363_0045132_6442_7671 401
660 3300039450 Ga0436363_0080678 Ga0436363_0080678_5249_6478 401
661 3300039453 Ga0436362_0719825 Ga0436362_0719825_32_1261 401
662 3300039453 Ga0436362_0768037 Ga0436362_0768037_4446_5675 401
663 3300044656 Ga0466969_0086058 Ga0466969_0086058_227_1450 401
664 3300044684 Ga0466966_0081685 Ga0466966_0081685_652_1875 401
665 3300046455 Ga0495603_0101766 Ga0495603_0101766_388_1611 401
666 3300048915 Ga0496112_0049960 Ga0496112_0049960_1079_2302 401
667 3300048924 Ga0496121_0098775 Ga0496121_0098775_667_1902 401
668 3300049568 Ga0501031_0048412 Ga0501031_0048412_1345_2568 401
669 3300049569 Ga0501032_0000073 Ga0501032_0000073_74446_75669 401
670 3300049570 Ga0501033_0000136 Ga0501033_0000136_36471_37694 401
671 3300049571 Ga0501034_0000251 Ga0501034_0000251_55022_56245 401
672 3300049572 Ga0501036_0000036 Ga0501036_0000036_33269_34492 401
673 3300049573 Ga0501037_0001715 Ga0501037_0001715_13523_14746 401
674 3300049574 Ga0501038_0000428 Ga0501038_0000428_1804_3027 401
675 3300049575 Ga0501039_0000273 Ga0501039_0000273_28591_29814 401
676 3300049579 Ga0501043_0000165 Ga0501043_0000165_47498_48721 401
677 3300049580 Ga0501046_0001143 Ga0501046_0001143_11231_12454 401
678 3300049581 Ga0501047_0000340 Ga0501047_0000340_18793_20016 401
679 3300049583 Ga0501067_0027971 Ga0501067_0027971_1592_2815 401
680 3300049584 Ga0501068_0000255 Ga0501068_0000255_5883_7106 401
681 3300049586 Ga0501070_0007747 Ga0501070_0007747_4253_5476 401
682 3300049587 Ga0501071_0012098 Ga0501071_0012098_3257_4480 401
683 3300049589 Ga0501073_0000037 Ga0501073_0000037_52781_54004 401
684 3300049590 Ga0501074_0000133 Ga0501074_0000133_9827_11050 401
685 3300049741 Ga0501079_0001057 Ga0501079_0001057_14787_16010 401
686 3300049742 Ga0501080_0000054 Ga0501080_0000054_6744_7967 401
687 3300049744 Ga0501083_0003724 Ga0501083_0003724_2819_4042 401
688 3300049822 Ga0501035_0000142 Ga0501035_0000142_31317_32540 401
689 3300049823 Ga0501044_0000414 Ga0501044_0000414_31495_32718 401
690 3300050513 nmdc:mga0rr50_7098_c1 nmdc:mga0rr50_7098_c1_5216_6442 401
691 3300050514 nmdc:mga08x19_21_c1 nmdc:mga08x19_21_c1_62461_63687 401
692 3300053142 Ga0500577_0000266 Ga0500577_0000266_1498_2721 401
693 iso_pu_bacteria 2617270735 2617347794 401
694 iso_pu_bacteria 2841957949 2841960589 401
695 iso_pu_bacteria 3005506211 3005510902 401
696 iso_pu_bacteria 8016575299 8016582881 401
697 3300003203 JGI25406J46586_10010371 JGI25406J46586_100103713 402
698 3300003215 JGI25153J46596_10001097 JGI25153J46596_100010972 402
699 3300003215 JGI25153J46596_10015079 JGI25153J46596_100150792 402
700 3300005329 Ga0070683_100138095 Ga0070683_1001380952 402
701 3300005336 Ga0070680_100009025 Ga0070680_1000090253 402
702 3300005337 Ga0070682_100050250 Ga0070682_1000502502 402
703 3300005338 Ga0068868_100147843 Ga0068868_1001478432 402
704 3300005347 Ga0070668_100013950 Ga0070668_1000139504 402
705 3300005366 Ga0070659_100107317 Ga0070659_1001073172 402
706 3300005434 Ga0070709_10059854 Ga0070709_100598542 402
707 3300005455 Ga0070663_100040232 Ga0070663_1000402322 402
708 3300005458 Ga0070681_10007089 Ga0070681_100070895 402
709 3300005535 Ga0070684_100034954 Ga0070684_1000349543 402
710 3300005548 Ga0070665_100059932 Ga0070665_1000599322 402
711 3300005548 Ga0070665_100232941 Ga0070665_1002329412 402
712 3300005549 Ga0070704_100145858 Ga0070704_1001458582 402
713 3300005578 Ga0068854_100218555 Ga0068854_1002185551 402
714 3300005615 Ga0070702_100065769 Ga0070702_1000657692 402
715 3300005937 Ga0081455_10006164 Ga0081455_100061646 402
716 3300005937 Ga0081455_10006808 Ga0081455_100068085 402
717 3300005937 Ga0081455_10063174 Ga0081455_100631742 402
718 3300005983 Ga0081540_1003768 Ga0081540_10037683 402
719 3300005983 Ga0081540_1004916 Ga0081540_10049166 402
720 3300005983 Ga0081540_1006034 Ga0081540_10060343 402
721 3300005983 Ga0081540_1010678 Ga0081540_10106782 402
722 3300005983 Ga0081540_1011165 Ga0081540_10111654 402
723 3300005983 Ga0081540_1013542 Ga0081540_10135421 402
724 3300005983 Ga0081540_1028625 Ga0081540_10286252 402
725 3300005983 Ga0081540_1032911 Ga0081540_10329111 402
726 3300005985 Ga0081539_10006394 Ga0081539_100063949 402
727 3300005985 Ga0081539_10027357 Ga0081539_100273571 402
728 3300005985 Ga0081539_10078330 Ga0081539_100783302 402
729 3300006038 Ga0075365_10036401 Ga0075365_100364012 402
730 3300006038 Ga0075365_10086729 Ga0075365_100867292 402
731 3300006051 Ga0075364_10038215 Ga0075364_100382151 402
732 3300006353 Ga0075370_10124613 Ga0075370_101246131 402
733 3300006942 Ga0099824_1022298 Ga0099824_10222982 402
734 3300006943 Ga0099822_1000541 Ga0099822_100054111 402
735 3300009093 Ga0105240_10092667 Ga0105240_100926673 402
736 3300009094 Ga0111539_10100579 Ga0111539_101005792 402
737 3300009545 Ga0105237_10028530 Ga0105237_100285304 402
738 3300009551 Ga0105238_10126795 Ga0105238_101267953 402
739 3300009551 Ga0105238_10147307 Ga0105238_101473072 402
740 3300010159 Ga0099796_10025862 Ga0099796_100258622 402
741 3300010375 Ga0105239_10079453 Ga0105239_100794531 402
742 3300025297 Ga0209758_1036184 Ga0209758_10361841 402
743 3300025903 Ga0207680_10209214 Ga0207680_102092141 402
744 3300025904 Ga0207647_10086530 Ga0207647_100865302 402
745 3300025912 Ga0207707_10101835 Ga0207707_101018351 402
746 3300025914 Ga0207671_10034723 Ga0207671_100347234 402
747 3300025924 Ga0207694_10031956 Ga0207694_100319564 402
748 3300025924 Ga0207694_10105856 Ga0207694_101058562 402
749 3300025924 Ga0207694_10150279 Ga0207694_101502791 402
750 3300025927 Ga0207687_10198813 Ga0207687_101988131 402
751 3300025934 Ga0207686_10088955 Ga0207686_100889552 402
752 3300025935 Ga0207709_10013431 Ga0207709_100134314 402
753 3300025949 Ga0207667_10373801 Ga0207667_103738012 402
754 3300025961 Ga0207712_10010623 Ga0207712_100106235 402
755 3300025972 Ga0207668_10079551 Ga0207668_100795512 402
756 3300027357 Ga0209589_1000015 Ga0209589_1000015160 402
757 3300027361 Ga0209489_100015 Ga0209489_100015160 402
758 3300027363 Ga0209700_100025 Ga0209700_100025160 402
759 3300027512 Ga0209179_1015250 Ga0209179_10152502 402
760 3300027671 Ga0209588_1000429 Ga0209588_10004296 402
761 3300027671 Ga0209588_1010370 Ga0209588_10103702 402
762 3300027866 Ga0209813_10015342 Ga0209813_100153422 402
763 3300027907 Ga0207428_10083135 Ga0207428_100831352 402
764 3300028379 Ga0268266_10001575 Ga0268266_100015753 402
765 3300028379 Ga0268266_10006809 Ga0268266_100068096 402
766 3300028379 Ga0268266_10102141 Ga0268266_101021412 402
767 3300028380 Ga0268265_10015236 Ga0268265_100152362 402
768 3300028380 Ga0268265_10039380 Ga0268265_100393803 402
769 3300028381 Ga0268264_10081087 Ga0268264_100810872 402
770 3300028786 Ga0307517_10000063 Ga0307517_10000063126 402
771 3300028794 Ga0307515_10168249 Ga0307515_101682492 402
772 3300031241 Ga0265325_10005166 Ga0265325_100051666 402
773 3300031247 Ga0265340_10011932 Ga0265340_100119323 402
774 3300031249 Ga0265339_10007149 Ga0265339_100071491 402
775 3300031507 Ga0307509_10101201 Ga0307509_101012011 402
776 3300031507 Ga0307509_10219851 Ga0307509_102198512 402
777 3300031595 Ga0265313_10073786 Ga0265313_100737862 402
778 3300031616 Ga0307508_10032756 Ga0307508_100327564 402
779 3300031616 Ga0307508_10064434 Ga0307508_100644342 402
780 3300031712 Ga0265342_10140040 Ga0265342_101400401 402
781 3300031730 Ga0307516_10161149 Ga0307516_101611492 402
782 3300031901 Ga0307406_10023316 Ga0307406_100233161 402
783 3300032126 Ga0307415_100017008 Ga0307415_1000170083 402
784 3300033180 Ga0307510_10017326 Ga0307510_100173261 402
785 3300033180 Ga0307510_10018417 Ga0307510_100184175 402
786 3300033442 Ga0315911_1000037 Ga0315911_100003714 402
787 3300033442 Ga0315911_1000037 Ga0315911_100003715 402
788 3300035116 Ga0373945_0062970 Ga0373945_0062970_39_1265 402
789 3300035695 Ga0373927_0147212 Ga0373927_0147212_235_1467 402
790 3300037418 Ga0395900_0025734 Ga0395900_0025734_1984_3210 402
791 3300037466 Ga0395898_0027242 Ga0395898_0027242_2091_3317 402
792 3300037466 Ga0395898_0035859 Ga0395898_0035859_997_2223 402
793 3300037471 Ga0395905_0128435 Ga0395905_0128435_627_1853 402
794 3300038443 Ga0395901_0230677 Ga0395901_0230677_517_1743 402
795 3300039437 Ga0436365_0007077 Ga0436365_0007077_10532_11764 402
796 3300039437 Ga0436365_1604062 Ga0436365_1604062_332_1558 402
797 3300045049 Ga0466959_0081443 Ga0466959_0081443_777_2003 402
798 3300046455 Ga0495603_0026289 Ga0495603_0026289_1673_2899 402
799 3300046615 Ga0495656_0079875 Ga0495656_0079875_233_1459 402
800 3300046684 Ga0495669_0006663 Ga0495669_0006663_1049_2275 402
801 3300047319 Ga0495674_0052817 Ga0495674_0052817_2228_3454 402
802 3300047320 Ga0495672_0064751 Ga0495672_0064751_404_1630 402
803 3300048905 Ga0496102_0045476 Ga0496102_0045476_323_1549 402
804 3300048913 Ga0496110_0228153 Ga0496110_0228153_238_1464 402
805 3300048918 Ga0496115_0057162 Ga0496115_0057162_1562_2791 402
806 3300048924 Ga0496121_0011755 Ga0496121_0011755_5408_6634 402
807 3300048924 Ga0496121_0015099 Ga0496121_0015099_6228_7454 402
808 3300048924 Ga0496121_0088415 Ga0496121_0088415_917_2143 402
809 3300048924 Ga0496121_0090364 Ga0496121_0090364_1093_2319 402
810 3300048925 Ga0496122_0105991 Ga0496122_0105991_556_1782 402
811 3300048929 Ga0496126_0005839 Ga0496126_0005839_2764_3990 402
812 3300048929 Ga0496126_0030015 Ga0496126_0030015_109_1335 402
813 3300048929 Ga0496126_0058113 Ga0496126_0058113_317_1546 402
814 3300050490 nmdc:mga03n38_7090_c1 nmdc:mga03n38_7090_c1_889_2115 402
815 3300050491 nmdc:mga00v17_15058_c1 nmdc:mga00v17_15058_c1_151_1377 402
816 3300050492 nmdc:mga0yw44_58334_c1 nmdc:mga0yw44_58334_c1_651_1871 402
817 3300050494 nmdc:mga06z11_87279_c1 nmdc:mga06z11_87279_c1_312_1538 402
818 3300050495 nmdc:mga04h51_10207_c1 nmdc:mga04h51_10207_c1_793_2019 402
819 3300050496 nmdc:mga07m45_137248_c1 nmdc:mga07m45_137248_c1_154_1380 402
820 3300050511 nmdc:mga08y16_138194_c1 nmdc:mga08y16_138194_c1_598_1824 402
821 3300050511 nmdc:mga08y16_139147_c1 nmdc:mga08y16_139147_c1_292_1518 402
822 3300050511 nmdc:mga08y16_259817_c1 nmdc:mga08y16_259817_c1_394_1656 402
823 3300053119 Ga0500595_002289 Ga0500595_002289_7336_8556 402
824 3300053145 Ga0500586_000403 Ga0500586_000403_1972_3243 402
825 3300053153 Ga0500616_0000038 Ga0500616_0000038_292183_293409 402
826 3300059639 Ga0587062_000371 Ga0587062_000371_148_1374 402
827 3300059644 Ga0587075_001170 Ga0587075_001170_1064_2290 402
828 iso_pu_bacteria 2513237098 2513672240 402
829 iso_pu_bacteria 2903768456 2903772567 402
830 3300000549 LJQas_1007993 LJQas_10079931 403
831 3300003203 JGI25406J46586_10000081 JGI25406J46586_100000811 403
832 3300003203 JGI25406J46586_10000081 JGI25406J46586_100000812 403
833 3300003203 JGI25406J46586_10008729 JGI25406J46586_100087293 403
834 3300003215 JGI25153J46596_10000946 JGI25153J46596_1000094611 403
835 3300003215 JGI25153J46596_10006710 JGI25153J46596_100067104 403
836 3300003659 JGI25404J52841_10000269 JGI25404J52841_100002694 403
837 3300004800 Ga0058861_11933975 Ga0058861_119339751 403
838 3300005262 Ga0065165_1002365 Ga0065165_100236511 403
839 3300005327 Ga0070658_10015568 Ga0070658_100155683 403
840 3300005327 Ga0070658_10015568 Ga0070658_100155684 403
841 3300005327 Ga0070658_10015568 Ga0070658_100155685 403
842 3300005327 Ga0070658_10033545 Ga0070658_100335452 403
843 3300005329 Ga0070683_100006494 Ga0070683_1000064943 403
844 3300005329 Ga0070683_100006494 Ga0070683_1000064944 403
845 3300005329 Ga0070683_100006494 Ga0070683_1000064945 403
846 3300005329 Ga0070683_100088981 Ga0070683_1000889812 403
847 3300005329 Ga0070683_100282663 Ga0070683_1002826631 403
848 3300005334 Ga0068869_100029096 Ga0068869_1000290963 403
849 3300005334 Ga0068869_100039424 Ga0068869_1000394242 403
850 3300005335 Ga0070666_10080750 Ga0070666_100807501 403
851 3300005336 Ga0070680_100008461 Ga0070680_1000084612 403
852 3300005336 Ga0070680_100008461 Ga0070680_1000084613 403
853 3300005336 Ga0070680_100009025 Ga0070680_1000090252 403
854 3300005336 Ga0070680_100020597 Ga0070680_1000205972 403
855 3300005336 Ga0070680_100211331 Ga0070680_1002113311 403
856 3300005336 Ga0070680_100261936 Ga0070680_1002619361 403
857 3300005337 Ga0070682_100163042 Ga0070682_1001630421 403
858 3300005339 Ga0070660_100012369 Ga0070660_1000123692 403
859 3300005339 Ga0070660_100016156 Ga0070660_1000161565 403
860 3300005341 Ga0070691_10058906 Ga0070691_100589062 403
861 3300005344 Ga0070661_100042475 Ga0070661_1000424752 403
862 3300005344 Ga0070661_100072768 Ga0070661_1000727682 403
863 3300005347 Ga0070668_100013950 Ga0070668_1000139503 403
864 3300005347 Ga0070668_100133195 Ga0070668_1001331952 403
865 3300005347 Ga0070668_100185248 Ga0070668_1001852481 403
866 3300005355 Ga0070671_100010559 Ga0070671_1000105593 403
867 3300005355 Ga0070671_100046849 Ga0070671_1000468493 403
868 3300005365 Ga0070688_100047848 Ga0070688_1000478482 403
869 3300005366 Ga0070659_100158179 Ga0070659_1001581791 403
870 3300005434 Ga0070709_10001137 Ga0070709_100011374 403
871 3300005434 Ga0070709_10025182 Ga0070709_100251822 403
872 3300005434 Ga0070709_10040088 Ga0070709_100400882 403
873 3300005434 Ga0070709_10129692 Ga0070709_101296921 403
874 3300005435 Ga0070714_100064176 Ga0070714_1000641761 403
875 3300005435 Ga0070714_100319290 Ga0070714_1003192901 403
876 3300005436 Ga0070713_100011248 Ga0070713_1000112483 403
877 3300005436 Ga0070713_100038019 Ga0070713_1000380191 403
878 3300005436 Ga0070713_100145904 Ga0070713_1001459042 403
879 3300005436 Ga0070713_100168114 Ga0070713_1001681141 403
880 3300005436 Ga0070713_100189284 Ga0070713_1001892841 403
881 3300005437 Ga0070710_10015995 Ga0070710_100159952 403
882 3300005437 Ga0070710_10028352 Ga0070710_100283522 403
883 3300005439 Ga0070711_100010485 Ga0070711_1000104851 403
884 3300005439 Ga0070711_100010485 Ga0070711_1000104852 403
885 3300005439 Ga0070711_100020416 Ga0070711_1000204163 403
886 3300005439 Ga0070711_100031873 Ga0070711_1000318732 403
887 3300005439 Ga0070711_100037198 Ga0070711_1000371982 403
888 3300005439 Ga0070711_100191343 Ga0070711_1001913431 403
889 3300005441 Ga0070700_100071112 Ga0070700_1000711122 403
890 3300005455 Ga0070663_100012907 Ga0070663_1000129072 403
891 3300005455 Ga0070663_100017721 Ga0070663_1000177212 403
892 3300005455 Ga0070663_100044931 Ga0070663_1000449311 403
893 3300005455 Ga0070663_100076612 Ga0070663_1000766122 403
894 3300005456 Ga0070678_100016331 Ga0070678_1000163312 403
895 3300005456 Ga0070678_100121784 Ga0070678_1001217842 403
896 3300005457 Ga0070662_100080615 Ga0070662_1000806153 403
897 3300005458 Ga0070681_10006811 Ga0070681_100068114 403
898 3300005458 Ga0070681_10006811 Ga0070681_100068115 403
899 3300005458 Ga0070681_10007089 Ga0070681_100070897 403
900 3300005458 Ga0070681_10033074 Ga0070681_100330742 403
901 3300005458 Ga0070681_10085897 Ga0070681_100858972 403
902 3300005458 Ga0070681_10227118 Ga0070681_102271182 403
903 3300005467 Ga0070706_100085005 Ga0070706_1000850051 403
904 3300005467 Ga0070706_100085005 Ga0070706_1000850052 403
905 3300005468 Ga0070707_100090716 Ga0070707_1000907162 403
906 3300005471 Ga0070698_100071439 Ga0070698_1000714392 403
907 3300005518 Ga0070699_100016664 Ga0070699_1000166646 403
908 3300005530 Ga0070679_100014819 Ga0070679_1000148197 403
909 3300005530 Ga0070679_100251754 Ga0070679_1002517541 403
910 3300005535 Ga0070684_100007203 Ga0070684_1000072032 403
911 3300005535 Ga0070684_100007203 Ga0070684_1000072033 403
912 3300005535 Ga0070684_100034954 Ga0070684_1000349544 403
913 3300005535 Ga0070684_100056336 Ga0070684_1000563363 403
914 3300005535 Ga0070684_100192082 Ga0070684_1001920822 403
915 3300005536 Ga0070697_100128235 Ga0070697_1001282352 403
916 3300005539 Ga0068853_100014772 Ga0068853_1000147725 403
917 3300005539 Ga0068853_100044215 Ga0068853_1000442151 403
918 3300005539 Ga0068853_100044472 Ga0068853_1000444722 403
919 3300005539 Ga0068853_100078359 Ga0068853_1000783592 403
920 3300005539 Ga0068853_100094862 Ga0068853_1000948622 403
921 3300005539 Ga0068853_100202940 Ga0068853_1002029401 403
922 3300005543 Ga0070672_100060534 Ga0070672_1000605342 403
923 3300005547 Ga0070693_100036628 Ga0070693_1000366282 403
924 3300005547 Ga0070693_100069677 Ga0070693_1000696772 403
925 3300005548 Ga0070665_100026819 Ga0070665_1000268192 403
926 3300005548 Ga0070665_100047689 Ga0070665_1000476892 403
927 3300005548 Ga0070665_100151430 Ga0070665_1001514302 403
928 3300005563 Ga0068855_100010185 Ga0068855_1000101856 403
929 3300005563 Ga0068855_100010185 Ga0068855_1000101857 403
930 3300005563 Ga0068855_100010185 Ga0068855_1000101858 403
931 3300005563 Ga0068855_100065209 Ga0068855_1000652092 403
932 3300005563 Ga0068855_100065209 Ga0068855_1000652093 403
933 3300005563 Ga0068855_100093726 Ga0068855_1000937263 403
934 3300005563 Ga0068855_100188478 Ga0068855_1001884782 403
935 3300005564 Ga0070664_100036128 Ga0070664_1000361283 403
936 3300005564 Ga0070664_100036128 Ga0070664_1000361284 403
937 3300005577 Ga0068857_100006806 Ga0068857_1000068066 403
938 3300005577 Ga0068857_100006806 Ga0068857_1000068067 403
939 3300005578 Ga0068854_100188544 Ga0068854_1001885442 403
940 3300005614 Ga0068856_100000137 Ga0068856_10000013739 403
941 3300005614 Ga0068856_100000137 Ga0068856_10000013740 403
942 3300005614 Ga0068856_100105225 Ga0068856_1001052252 403
943 3300005614 Ga0068856_100333703 Ga0068856_1003337031 403
944 3300005616 Ga0068852_100015965 Ga0068852_1000159652 403
945 3300005616 Ga0068852_100028224 Ga0068852_1000282242 403
946 3300005616 Ga0068852_100028224 Ga0068852_1000282243 403
947 3300005616 Ga0068852_100212311 Ga0068852_1002123112 403
948 3300005617 Ga0068859_100115759 Ga0068859_1001157592 403
949 3300005618 Ga0068864_100034489 Ga0068864_1000344892 403
950 3300005618 Ga0068864_100056367 Ga0068864_1000563672 403
951 3300005719 Ga0068861_100199288 Ga0068861_1001992881 403
952 3300005834 Ga0068851_10020979 Ga0068851_100209792 403
953 3300005842 Ga0068858_100057565 Ga0068858_1000575651 403
954 3300005842 Ga0068858_100099558 Ga0068858_1000995582 403
955 3300005843 Ga0068860_100004689 Ga0068860_10000468910 403
956 3300005843 Ga0068860_100005520 Ga0068860_1000055207 403
957 3300005844 Ga0068862_100088228 Ga0068862_1000882282 403
958 3300005844 Ga0068862_100105231 Ga0068862_1001052312 403
959 3300005844 Ga0068862_100126218 Ga0068862_1001262182 403
960 3300005844 Ga0068862_100131689 Ga0068862_1001316892 403
961 3300005844 Ga0068862_100282963 Ga0068862_1002829632 403
962 3300005937 Ga0081455_10003860 Ga0081455_1000386011 403
963 3300005937 Ga0081455_10006164 Ga0081455_100061645 403
964 3300005937 Ga0081455_10010534 Ga0081455_1001053414 403
965 3300005937 Ga0081455_10037055 Ga0081455_100370553 403
966 3300005937 Ga0081455_10037166 Ga0081455_100371662 403
967 3300005937 Ga0081455_10078440 Ga0081455_100784402 403
968 3300005983 Ga0081540_1001487 Ga0081540_100148712 403
969 3300005983 Ga0081540_1003332 Ga0081540_10033323 403
970 3300005983 Ga0081540_1003389 Ga0081540_10033892 403
971 3300005983 Ga0081540_1003768 Ga0081540_10037684 403
972 3300005983 Ga0081540_1004916 Ga0081540_10049167 403
973 3300005983 Ga0081540_1006034 Ga0081540_10060344 403
974 3300005983 Ga0081540_1006810 Ga0081540_10068107 403
975 3300005983 Ga0081540_1011165 Ga0081540_10111653 403
976 3300005983 Ga0081540_1026650 Ga0081540_10266503 403
977 3300005983 Ga0081540_1028785 Ga0081540_10287853 403
978 3300005983 Ga0081540_1032911 Ga0081540_10329112 403
979 3300005983 Ga0081540_1045754 Ga0081540_10457542 403
980 3300005983 Ga0081540_1045808 Ga0081540_10458082 403
981 3300005985 Ga0081539_10000157 Ga0081539_1000015744 403
982 3300005985 Ga0081539_10000461 Ga0081539_1000046140 403
983 3300005985 Ga0081539_10000461 Ga0081539_1000046141 403
984 3300005985 Ga0081539_10010685 Ga0081539_100106857 403
985 3300006028 Ga0070717_10001987 Ga0070717_100019877 403
986 3300006028 Ga0070717_10012926 Ga0070717_100129265 403
987 3300006028 Ga0070717_10018197 Ga0070717_100181974 403
988 3300006028 Ga0070717_10285649 Ga0070717_102856492 403
989 3300006038 Ga0075365_10095798 Ga0075365_100957982 403
990 3300006042 Ga0075368_10024474 Ga0075368_100244742 403
991 3300006048 Ga0075363_100060782 Ga0075363_1000607821 403
992 3300006051 Ga0075364_10038215 Ga0075364_100382152 403
993 3300006051 Ga0075364_10071813 Ga0075364_100718131 403
994 3300006051 Ga0075364_10187394 Ga0075364_101873942 403
995 3300006163 Ga0070715_10022143 Ga0070715_100221432 403
996 3300006173 Ga0070716_100071765 Ga0070716_1000717652 403
997 3300006175 Ga0070712_100005053 Ga0070712_1000050533 403
998 3300006175 Ga0070712_100012567 Ga0070712_1000125673 403
999 3300006175 Ga0070712_100012567 Ga0070712_1000125674 403
1000 3300006175 Ga0070712_100020530 Ga0070712_1000205302 403
1001 3300006175 Ga0070712_100127313 Ga0070712_1001273132 403
1002 3300006178 Ga0075367_10036930 Ga0075367_100369302 403
1003 3300006178 Ga0075367_10037202 Ga0075367_100372021 403
1004 3300006237 Ga0097621_100026198 Ga0097621_1000261982 403
1005 3300006237 Ga0097621_100026198 Ga0097621_1000261983 403
1006 3300006237 Ga0097621_100290353 Ga0097621_1002903531 403
1007 3300006353 Ga0075370_10056246 Ga0075370_100562463 403
1008 3300006358 Ga0068871_100053850 Ga0068871_1000538502 403
1009 3300006358 Ga0068871_100053850 Ga0068871_1000538503 403
1010 3300006871 Ga0075434_100026575 Ga0075434_1000265752 403
1011 3300006871 Ga0075434_100059277 Ga0075434_1000592773 403
1012 3300006931 Ga0097620_100115762 Ga0097620_1001157622 403
1013 3300006942 Ga0099824_1022298 Ga0099824_10222983 403
1014 3300007076 Ga0075435_100211501 Ga0075435_1002115011 403
1015 3300007076 Ga0075435_100289587 Ga0075435_1002895871 403
1016 3300007265 Ga0099794_10001086 Ga0099794_100010862 403
1017 3300007265 Ga0099794_10001086 Ga0099794_100010863 403
1018 3300007265 Ga0099794_10044158 Ga0099794_100441581 403
1019 3300007788 Ga0099795_10031241 Ga0099795_100312412 403
1020 3300007788 Ga0099795_10034527 Ga0099795_100345271 403
1021 3300009093 Ga0105240_10003976 Ga0105240_1000397616 403
1022 3300009093 Ga0105240_10005539 Ga0105240_100055394 403
1023 3300009093 Ga0105240_10018312 Ga0105240_100183124 403
1024 3300009093 Ga0105240_10018312 Ga0105240_100183125 403
1025 3300009093 Ga0105240_10065154 Ga0105240_100651543 403
1026 3300009093 Ga0105240_10067861 Ga0105240_100678612 403
1027 3300009093 Ga0105240_10092667 Ga0105240_100926672 403
1028 3300009093 Ga0105240_10101428 Ga0105240_101014282 403
1029 3300009098 Ga0105245_10137830 Ga0105245_101378302 403
1030 3300009101 Ga0105247_10016302 Ga0105247_100163026 403
1031 3300009148 Ga0105243_10083696 Ga0105243_100836962 403
1032 3300009174 Ga0105241_10047810 Ga0105241_100478102 403
1033 3300009176 Ga0105242_10035665 Ga0105242_100356652 403
1034 3300009176 Ga0105242_10035665 Ga0105242_100356653 403
1035 3300009177 Ga0105248_10052124 Ga0105248_100521243 403
1036 3300009177 Ga0105248_10295530 Ga0105248_102955302 403
1037 3300009545 Ga0105237_10008293 Ga0105237_100082936 403
1038 3300009545 Ga0105237_10012769 Ga0105237_100127692 403
1039 3300009545 Ga0105237_10012769 Ga0105237_100127693 403
1040 3300009545 Ga0105237_10012769 Ga0105237_100127694 403
1041 3300009545 Ga0105237_10028530 Ga0105237_100285305 403
1042 3300009545 Ga0105237_10034905 Ga0105237_100349052 403
1043 3300009545 Ga0105237_10062821 Ga0105237_100628212 403
1044 3300009545 Ga0105237_10091803 Ga0105237_100918031 403
1045 3300009545 Ga0105237_10091803 Ga0105237_100918032 403
1046 3300009551 Ga0105238_10001848 Ga0105238_1000184810 403
1047 3300009551 Ga0105238_10001848 Ga0105238_100018489 403
1048 3300009551 Ga0105238_10069691 Ga0105238_100696913 403
1049 3300009553 Ga0105249_10030655 Ga0105249_100306554 403
1050 3300010159 Ga0099796_10015701 Ga0099796_100157011 403
1051 3300010159 Ga0099796_10034029 Ga0099796_100340291 403
1052 3300010375 Ga0105239_10023763 Ga0105239_100237635 403
1053 3300010375 Ga0105239_10023763 Ga0105239_100237636 403
1054 3300010375 Ga0105239_10025364 Ga0105239_100253642 403
1055 3300010375 Ga0105239_10025364 Ga0105239_100253643 403
1056 3300010375 Ga0105239_10025364 Ga0105239_100253644 403
1057 3300010375 Ga0105239_10074969 Ga0105239_100749693 403
1058 3300010375 Ga0105239_10225081 Ga0105239_102250811 403
1059 3300011119 Ga0105246_10021293 Ga0105246_100212933 403
1060 3300013102 Ga0157371_10008618 Ga0157371_100086188 403
1061 3300013104 Ga0157370_10077342 Ga0157370_100773422 403
1062 3300013104 Ga0157370_10113934 Ga0157370_101139342 403
1063 3300013105 Ga0157369_10005973 Ga0157369_100059733 403
1064 3300013105 Ga0157369_10005973 Ga0157369_100059734 403
1065 3300013105 Ga0157369_10005973 Ga0157369_100059735 403
1066 3300013105 Ga0157369_10006548 Ga0157369_1000654811 403
1067 3300013105 Ga0157369_10012428 Ga0157369_100124282 403
1068 3300013296 Ga0157374_10043720 Ga0157374_100437202 403
1069 3300013296 Ga0157374_10043720 Ga0157374_100437203 403
1070 3300013296 Ga0157374_10081460 Ga0157374_100814602 403
1071 3300013296 Ga0157374_10236546 Ga0157374_102365462 403
1072 3300013297 Ga0157378_10242799 Ga0157378_102427992 403
1073 3300013297 Ga0157378_10287767 Ga0157378_102877671 403
1074 3300013306 Ga0163162_10039795 Ga0163162_100397952 403
1075 3300013306 Ga0163162_10054876 Ga0163162_100548763 403
1076 3300013306 Ga0163162_10083787 Ga0163162_100837872 403
1077 3300013306 Ga0163162_10105789 Ga0163162_101057892 403
1078 3300013307 Ga0157372_10139778 Ga0157372_101397782 403
1079 3300013307 Ga0157372_10169325 Ga0157372_101693252 403
1080 3300013307 Ga0157372_10300846 Ga0157372_103008462 403
1081 3300013307 Ga0157372_10323711 Ga0157372_103237111 403
1082 3300013308 Ga0157375_10062338 Ga0157375_100623382 403
1083 3300013308 Ga0157375_10075145 Ga0157375_100751452 403
1084 3300013308 Ga0157375_10075145 Ga0157375_100751453 403
1085 3300013308 Ga0157375_10283338 Ga0157375_102833381 403
1086 3300014325 Ga0163163_10032096 Ga0163163_100320964 403
1087 3300014325 Ga0163163_10032957 Ga0163163_100329572 403
1088 3300014325 Ga0163163_10035053 Ga0163163_100350534 403
1089 3300014325 Ga0163163_10043559 Ga0163163_100435592 403
1090 3300014325 Ga0163163_10055746 Ga0163163_100557463 403
1091 3300014326 Ga0157380_10104142 Ga0157380_101041423 403
1092 3300014968 Ga0157379_10181050 Ga0157379_101810501 403
1093 3300014969 Ga0157376_10075664 Ga0157376_100756642 403
1094 3300014969 Ga0157376_10101065 Ga0157376_101010652 403
1095 3300014969 Ga0157376_10284137 Ga0157376_102841371 403
1096 3300020070 Ga0206356_11666168 Ga0206356_116661681 403
1097 3300020070 Ga0206356_11666168 Ga0206356_116661682 403
1098 3300020610 Ga0154015_1059841 Ga0154015_10598411 403
1099 3300021320 Ga0214544_1000011 Ga0214544_1000011101 403
1100 3300021321 Ga0214542_1000009 Ga0214542_1000009141 403
1101 3300021324 Ga0214545_1000007 Ga0214545_1000007101 403
1102 3300021327 Ga0214543_1000020 Ga0214543_1000020141 403
1103 3300021377 Ga0213874_10016822 Ga0213874_100168222 403
1104 3300025254 Ga0209148_1000300 Ga0209148_100030056 403
1105 3300025254 Ga0209148_1000300 Ga0209148_100030058 403
1106 3300025261 Ga0209233_1008056 Ga0209233_10080562 403
1107 3300025261 Ga0209233_1009149 Ga0209233_10091492 403
1108 3300025261 Ga0209233_1017786 Ga0209233_10177862 403
1109 3300025272 Ga0209455_1002020 Ga0209455_10020204 403
1110 3300025272 Ga0209455_1002020 Ga0209455_10020206 403
1111 3300025272 Ga0209455_1018117 Ga0209455_10181171 403
1112 3300025295 Ga0209564_1002404 Ga0209564_10024044 403
1113 3300025297 Ga0209758_1001864 Ga0209758_100186416 403
1114 3300025297 Ga0209758_1001864 Ga0209758_100186417 403
1115 3300025297 Ga0209758_1004355 Ga0209758_10043559 403
1116 3300025297 Ga0209758_1056617 Ga0209758_10566171 403
1117 3300025302 Ga0207426_1003391 Ga0207426_10033914 403
1118 3300025315 Ga0207697_10054805 Ga0207697_100548051 403
1119 3300025321 Ga0207656_10002790 Ga0207656_100027902 403
1120 3300025321 Ga0207656_10002790 Ga0207656_100027903 403
1121 3300025898 Ga0207692_10042096 Ga0207692_100420962 403
1122 3300025900 Ga0207710_10041804 Ga0207710_100418042 403
1123 3300025901 Ga0207688_10045802 Ga0207688_100458022 403
1124 3300025904 Ga0207647_10053435 Ga0207647_100534352 403
1125 3300025906 Ga0207699_10019947 Ga0207699_100199472 403
1126 3300025906 Ga0207699_10036754 Ga0207699_100367542 403
1127 3300025906 Ga0207699_10168253 Ga0207699_101682531 403
1128 3300025907 Ga0207645_10097546 Ga0207645_100975462 403
1129 3300025908 Ga0207643_10047938 Ga0207643_100479381 403
1130 3300025908 Ga0207643_10121257 Ga0207643_101212571 403
1131 3300025909 Ga0207705_10036015 Ga0207705_100360152 403
1132 3300025909 Ga0207705_10036015 Ga0207705_100360153 403
1133 3300025910 Ga0207684_10072801 Ga0207684_100728013 403
1134 3300025911 Ga0207654_10033436 Ga0207654_100334362 403
1135 3300025911 Ga0207654_10152138 Ga0207654_101521381 403
1136 3300025912 Ga0207707_10000143 Ga0207707_1000014311 403
1137 3300025912 Ga0207707_10000613 Ga0207707_1000061310 403
1138 3300025912 Ga0207707_10000613 Ga0207707_1000061311 403
1139 3300025912 Ga0207707_10000613 Ga0207707_100006139 403
1140 3300025912 Ga0207707_10009454 Ga0207707_100094542 403
1141 3300025912 Ga0207707_10030486 Ga0207707_100304862 403
1142 3300025912 Ga0207707_10030486 Ga0207707_100304863 403
1143 3300025912 Ga0207707_10088754 Ga0207707_100887542 403
1144 3300025913 Ga0207695_10000006 Ga0207695_10000006560 403
1145 3300025913 Ga0207695_10000478 Ga0207695_1000047867 403
1146 3300025913 Ga0207695_10009613 Ga0207695_1000961310 403
1147 3300025913 Ga0207695_10009613 Ga0207695_100096138 403
1148 3300025913 Ga0207695_10009613 Ga0207695_100096139 403
1149 3300025913 Ga0207695_10051447 Ga0207695_100514473 403
1150 3300025913 Ga0207695_10084884 Ga0207695_100848841 403
1151 3300025913 Ga0207695_10084884 Ga0207695_100848842 403
1152 3300025913 Ga0207695_10166308 Ga0207695_101663082 403
1153 3300025913 Ga0207695_10215991 Ga0207695_102159912 403
1154 3300025914 Ga0207671_10005733 Ga0207671_100057335 403
1155 3300025914 Ga0207671_10008011 Ga0207671_100080118 403
1156 3300025914 Ga0207671_10131498 Ga0207671_101314982 403
1157 3300025914 Ga0207671_10144607 Ga0207671_101446072 403
1158 3300025914 Ga0207671_10156990 Ga0207671_101569901 403
1159 3300025914 Ga0207671_10166660 Ga0207671_101666601 403
1160 3300025915 Ga0207693_10012236 Ga0207693_100122367 403
1161 3300025915 Ga0207693_10024298 Ga0207693_100242982 403
1162 3300025915 Ga0207693_10033293 Ga0207693_100332933 403
1163 3300025915 Ga0207693_10033987 Ga0207693_100339871 403
1164 3300025915 Ga0207693_10156289 Ga0207693_101562891 403
1165 3300025916 Ga0207663_10008134 Ga0207663_100081344 403
1166 3300025916 Ga0207663_10010912 Ga0207663_100109123 403
1167 3300025916 Ga0207663_10025363 Ga0207663_100253632 403
1168 3300025916 Ga0207663_10098560 Ga0207663_100985602 403
1169 3300025916 Ga0207663_10160246 Ga0207663_101602461 403
1170 3300025917 Ga0207660_10001451 Ga0207660_1000145110 403
1171 3300025917 Ga0207660_10001451 Ga0207660_100014518 403
1172 3300025917 Ga0207660_10001451 Ga0207660_100014519 403
1173 3300025917 Ga0207660_10047050 Ga0207660_100470502 403
1174 3300025917 Ga0207660_10047550 Ga0207660_100475502 403
1175 3300025919 Ga0207657_10003960 Ga0207657_100039606 403
1176 3300025919 Ga0207657_10003960 Ga0207657_100039607 403
1177 3300025919 Ga0207657_10003960 Ga0207657_100039608 403
1178 3300025920 Ga0207649_10116415 Ga0207649_101164151 403
1179 3300025921 Ga0207652_10008026 Ga0207652_100080263 403
1180 3300025921 Ga0207652_10008026 Ga0207652_100080265 403
1181 3300025921 Ga0207652_10024167 Ga0207652_100241672 403
1182 3300025921 Ga0207652_10045026 Ga0207652_100450262 403
1183 3300025921 Ga0207652_10101709 Ga0207652_101017092 403
1184 3300025921 Ga0207652_10200726 Ga0207652_102007262 403
1185 3300025922 Ga0207646_10208713 Ga0207646_102087132 403
1186 3300025924 Ga0207694_10003812 Ga0207694_100038123 403
1187 3300025924 Ga0207694_10003812 Ga0207694_100038124 403
1188 3300025924 Ga0207694_10003812 Ga0207694_100038125 403
1189 3300025924 Ga0207694_10027026 Ga0207694_100270263 403
1190 3300025924 Ga0207694_10057603 Ga0207694_100576032 403
1191 3300025924 Ga0207694_10157351 Ga0207694_101573511 403
1192 3300025927 Ga0207687_10083602 Ga0207687_100836022 403
1193 3300025927 Ga0207687_10103997 Ga0207687_101039971 403
1194 3300025928 Ga0207700_10007251 Ga0207700_100072514 403
1195 3300025928 Ga0207700_10011456 Ga0207700_100114562 403
1196 3300025928 Ga0207700_10011456 Ga0207700_100114563 403
1197 3300025928 Ga0207700_10032512 Ga0207700_100325123 403
1198 3300025928 Ga0207700_10051229 Ga0207700_100512291 403
1199 3300025928 Ga0207700_10086597 Ga0207700_100865972 403
1200 3300025928 Ga0207700_10124231 Ga0207700_101242313 403
1201 3300025929 Ga0207664_10091034 Ga0207664_100910341 403
1202 3300025929 Ga0207664_10119384 Ga0207664_101193842 403
1203 3300025929 Ga0207664_10119603 Ga0207664_101196032 403
1204 3300025929 Ga0207664_10254938 Ga0207664_102549381 403
1205 3300025931 Ga0207644_10262906 Ga0207644_102629061 403
1206 3300025932 Ga0207690_10144557 Ga0207690_101445571 403
1207 3300025932 Ga0207690_10168683 Ga0207690_101686832 403
1208 3300025933 Ga0207706_10123207 Ga0207706_101232072 403
1209 3300025934 Ga0207686_10021011 Ga0207686_100210112 403
1210 3300025934 Ga0207686_10021011 Ga0207686_100210113 403
1211 3300025934 Ga0207686_10038551 Ga0207686_100385512 403
1212 3300025935 Ga0207709_10013431 Ga0207709_100134313 403
1213 3300025937 Ga0207669_10007810 Ga0207669_100078106 403
1214 3300025939 Ga0207665_10009461 Ga0207665_100094613 403
1215 3300025939 Ga0207665_10022575 Ga0207665_100225752 403
1216 3300025939 Ga0207665_10112506 Ga0207665_101125062 403
1217 3300025940 Ga0207691_10110214 Ga0207691_101102142 403
1218 3300025940 Ga0207691_10198719 Ga0207691_101987191 403
1219 3300025941 Ga0207711_10109671 Ga0207711_101096712 403
1220 3300025941 Ga0207711_10158388 Ga0207711_101583882 403
1221 3300025944 Ga0207661_10000712 Ga0207661_1000071210 403
1222 3300025944 Ga0207661_10034780 Ga0207661_100347802 403
1223 3300025944 Ga0207661_10034780 Ga0207661_100347803 403
1224 3300025944 Ga0207661_10084514 Ga0207661_100845142 403
1225 3300025945 Ga0207679_10046998 Ga0207679_100469982 403
1226 3300025949 Ga0207667_10010781 Ga0207667_100107813 403
1227 3300025949 Ga0207667_10010781 Ga0207667_100107814 403
1228 3300025949 Ga0207667_10010781 Ga0207667_100107815 403
1229 3300025949 Ga0207667_10053139 Ga0207667_100531393 403
1230 3300025949 Ga0207667_10092184 Ga0207667_100921842 403
1231 3300025949 Ga0207667_10160725 Ga0207667_101607251 403
1232 3300025961 Ga0207712_10167183 Ga0207712_101671832 403
1233 3300025972 Ga0207668_10015871 Ga0207668_100158716 403
1234 3300025972 Ga0207668_10017035 Ga0207668_100170353 403
1235 3300025981 Ga0207640_10061183 Ga0207640_100611832 403
1236 3300026023 Ga0207677_10082277 Ga0207677_100822772 403
1237 3300026035 Ga0207703_10061236 Ga0207703_100612362 403
1238 3300026035 Ga0207703_10113230 Ga0207703_101132302 403
1239 3300026041 Ga0207639_10003617 Ga0207639_100036173 403
1240 3300026041 Ga0207639_10003617 Ga0207639_100036174 403
1241 3300026041 Ga0207639_10003617 Ga0207639_100036175 403
1242 3300026041 Ga0207639_10135005 Ga0207639_101350052 403
1243 3300026067 Ga0207678_10015490 Ga0207678_100154904 403
1244 3300026067 Ga0207678_10022914 Ga0207678_100229142 403
1245 3300026067 Ga0207678_10062479 Ga0207678_100624792 403
1246 3300026078 Ga0207702_10000063 Ga0207702_1000006336 403
1247 3300026078 Ga0207702_10000063 Ga0207702_1000006337 403
1248 3300026095 Ga0207676_10044978 Ga0207676_100449782 403
1249 3300026095 Ga0207676_10136967 Ga0207676_101369672 403
1250 3300026095 Ga0207676_10155984 Ga0207676_101559841 403
1251 3300026116 Ga0207674_10008108 Ga0207674_100081082 403
1252 3300026116 Ga0207674_10008108 Ga0207674_100081083 403
1253 3300026116 Ga0207674_10119893 Ga0207674_101198932 403
1254 3300026118 Ga0207675_100156505 Ga0207675_1001565052 403
1255 3300026118 Ga0207675_100223657 Ga0207675_1002236572 403
1256 3300026118 Ga0207675_100241317 Ga0207675_1002413171 403
1257 3300026121 Ga0207683_10064951 Ga0207683_100649513 403
1258 3300026121 Ga0207683_10108364 Ga0207683_101083642 403
1259 3300026142 Ga0207698_10015927 Ga0207698_100159271 403
1260 3300026142 Ga0207698_10015927 Ga0207698_100159272 403
1261 3300026142 Ga0207698_10015927 Ga0207698_100159273 403
1262 3300026142 Ga0207698_10019849 Ga0207698_100198492 403
1263 3300026142 Ga0207698_10023138 Ga0207698_100231383 403
1264 3300027357 Ga0209589_1000015 Ga0209589_1000015161 403
1265 3300027361 Ga0209489_100015 Ga0209489_100015161 403
1266 3300027363 Ga0209700_100025 Ga0209700_100025161 403
1267 3300027512 Ga0209179_1000328 Ga0209179_10003284 403
1268 3300027671 Ga0209588_1000429 Ga0209588_10004297 403
1269 3300027671 Ga0209588_1019049 Ga0209588_10190492 403
1270 3300028379 Ga0268266_10001575 Ga0268266_100015754 403
1271 3300028379 Ga0268266_10006809 Ga0268266_100068097 403
1272 3300028379 Ga0268266_10039943 Ga0268266_100399434 403
1273 3300028379 Ga0268266_10116805 Ga0268266_101168052 403
1274 3300028380 Ga0268265_10015236 Ga0268265_100152363 403
1275 3300028380 Ga0268265_10039380 Ga0268265_100393802 403
1276 3300028380 Ga0268265_10080597 Ga0268265_100805972 403
1277 3300028380 Ga0268265_10236998 Ga0268265_102369982 403
1278 3300028380 Ga0268265_10253940 Ga0268265_102539401 403
1279 3300028380 Ga0268265_10330426 Ga0268265_103304261 403
1280 3300028381 Ga0268264_10000042 Ga0268264_10000042227 403
1281 3300028381 Ga0268264_10006148 Ga0268264_100061482 403
1282 3300028381 Ga0268264_10096441 Ga0268264_100964412 403
1283 3300028786 Ga0307517_10139977 Ga0307517_101399771 403
1284 3300028794 Ga0307515_10238789 Ga0307515_102387891 403
1285 3300030521 Ga0307511_10131697 Ga0307511_101316971 403
1286 3300031238 Ga0265332_10009080 Ga0265332_100090801 403
1287 3300031238 Ga0265332_10009080 Ga0265332_100090802 403
1288 3300031241 Ga0265325_10043968 Ga0265325_100439681 403
1289 3300031344 Ga0265316_10194290 Ga0265316_101942901 403
1290 3300031507 Ga0307509_10101201 Ga0307509_101012012 403
1291 3300031507 Ga0307509_10128400 Ga0307509_101284002 403
1292 3300031548 Ga0307408_100080965 Ga0307408_1000809652 403
1293 3300031595 Ga0265313_10081048 Ga0265313_100810481 403
1294 3300031616 Ga0307508_10047062 Ga0307508_100470622 403
1295 3300031711 Ga0265314_10005577 Ga0265314_100055777 403
1296 3300031711 Ga0265314_10089496 Ga0265314_100894961 403
1297 3300031730 Ga0307516_10012044 Ga0307516_100120446 403
1298 3300031730 Ga0307516_10012044 Ga0307516_100120447 403
1299 3300031730 Ga0307516_10012378 Ga0307516_100123787 403
1300 3300031730 Ga0307516_10019648 Ga0307516_100196487 403
1301 3300031730 Ga0307516_10035778 Ga0307516_100357783 403
1302 3300031730 Ga0307516_10047340 Ga0307516_100473402 403
1303 3300031730 Ga0307516_10206215 Ga0307516_102062152 403
1304 3300031731 Ga0307405_10019087 Ga0307405_100190871 403
1305 3300031901 Ga0307406_10083725 Ga0307406_100837252 403
1306 3300031995 Ga0307409_100030528 Ga0307409_1000305283 403
1307 3300032002 Ga0307416_100203114 Ga0307416_1002031141 403
1308 3300033180 Ga0307510_10018417 Ga0307510_100184176 403
1309 3300033180 Ga0307510_10032591 Ga0307510_100325913 403
1310 3300033180 Ga0307510_10032591 Ga0307510_100325914 403
1311 3300033180 Ga0307510_10032591 Ga0307510_100325915 403
1312 3300033180 Ga0307510_10212388 Ga0307510_102123881 403
1313 3300034816 Ga0373930_0002922 Ga0373930_0002922_77_1306 403
1314 3300035086 Ga0373934_0006683 Ga0373934_0006683_1241_2470 403
1315 3300035088 Ga0373940_0018951 Ga0373940_0018951_101_1330 403
1316 3300035113 Ga0373936_0063298 Ga0373936_0063298_61_1290 403
1317 3300035113 Ga0373936_0080528 Ga0373936_0080528_97_1326 403
1318 3300035115 Ga0373941_0028125 Ga0373941_0028125_353_1582 403
1319 3300035116 Ga0373945_0045658 Ga0373945_0045658_276_1505 403
1320 3300035118 Ga0373954_0000194 Ga0373954_0000194_8047_9276 403
1321 3300035119 Ga0373956_0005615 Ga0373956_0005615_1052_2281 403
1322 3300035120 Ga0373957_0000558 Ga0373957_0000558_5417_6646 403
1323 3300035171 Ga0373946_0007120 Ga0373946_0007120_2438_3667 403
1324 3300035172 Ga0373955_0002265 Ga0373955_0002265_4096_5325 403
1325 3300035172 Ga0373955_0017979 Ga0373955_0017979_253_1482 403
1326 3300035410 Ga0373924_0003352 Ga0373924_0003352_1239_2468 403
1327 3300035691 Ga0373931_0003286 Ga0373931_0003286_49_1278 403
1328 3300035691 Ga0373931_0012362 Ga0373931_0012362_249_1478 403
1329 3300035691 Ga0373931_0168121 Ga0373931_0168121_33_1262 403
1330 3300035692 Ga0373935_0001270 Ga0373935_0001270_11751_12980 403
1331 3300035692 Ga0373935_0069665 Ga0373935_0069665_142_1371 403
1332 3300035695 Ga0373927_0000137 Ga0373927_0000137_13516_14820 403
1333 3300035695 Ga0373927_0006695 Ga0373927_0006695_379_1608 403
1334 3300035695 Ga0373927_0006894 Ga0373927_0006894_4549_5778 403
1335 3300035695 Ga0373927_0034270 Ga0373927_0034270_901_2130 403
1336 3300035695 Ga0373927_0111666 Ga0373927_0111666_280_1509 403
1337 3300035695 Ga0373927_0149025 Ga0373927_0149025_118_1347 403
1338 3300035724 Ga0373933_0000961 Ga0373933_0000961_5615_6844 403
1339 3300035724 Ga0373933_0111256 Ga0373933_0111256_46_1278 403
1340 3300035725 Ga0373947_0006199 Ga0373947_0006199_3217_4521 403
1341 3300035725 Ga0373947_0008600 Ga0373947_0008600_442_1671 403
1342 3300035725 Ga0373947_0020673 Ga0373947_0020673_438_1667 403
1343 3300036401 Ga0373937_0007705 Ga0373937_0007705_7766_8995 403
1344 3300036401 Ga0373937_0029297 Ga0373937_0029297_448_1677 403
1345 3300036401 Ga0373937_0142464 Ga0373937_0142464_864_2093 403
1346 3300037068 Ga0373925_0002159 Ga0373925_0002159_10712_12016 403
1347 3300037068 Ga0373925_0002405 Ga0373925_0002405_9738_10967 403
1348 3300037068 Ga0373925_0036912 Ga0373925_0036912_2261_3562 403
1349 3300037068 Ga0373925_0062697 Ga0373925_0062697_1551_2780 403
1350 3300037068 Ga0373925_0116306 Ga0373925_0116306_351_1580 403
1351 3300037418 Ga0395900_0025734 Ga0395900_0025734_3382_4611 403
1352 3300037418 Ga0395900_0044162 Ga0395900_0044162_2308_3537 403
1353 3300037418 Ga0395900_0044162 Ga0395900_0044162_913_2142 403
1354 3300037418 Ga0395900_0258630 Ga0395900_0258630_194_1423 403
1355 3300037466 Ga0395898_0012432 Ga0395898_0012432_5477_6706 403
1356 3300037466 Ga0395898_0012432 Ga0395898_0012432_6871_8100 403
1357 3300037466 Ga0395898_0027242 Ga0395898_0027242_3490_4719 403
1358 3300037466 Ga0395898_0035217 Ga0395898_0035217_2885_4114 403
1359 3300038443 Ga0395901_0385649 Ga0395901_0385649_24_1253 403
1360 3300039437 Ga0436365_0692786 Ga0436365_0692786_917_2140 403
1361 3300039437 Ga0436365_0831557 Ga0436365_0831557_1193_2422 403
1362 3300039437 Ga0436365_0998035 Ga0436365_0998035_189_1415 403
1363 3300039450 Ga0436363_0141292 Ga0436363_0141292_286_1518 403
1364 3300039450 Ga0436363_0573174 Ga0436363_0573174_5326_6555 403
1365 3300039450 Ga0436363_0765119 Ga0436363_0765119_50_1282 403
1366 3300044658 Ga0466972_0025330 Ga0466972_0025330_1481_2710 403
1367 3300044683 Ga0466965_0003985 Ga0466965_0003985_3673_4902 403
1368 3300044684 Ga0466966_0003609 Ga0466966_0003609_2348_3577 403
1369 3300044693 Ga0466961_0000138 Ga0466961_0000138_2932_4161 403
1370 3300044694 Ga0466963_0145831 Ga0466963_0145831_76_1305 403
1371 3300044706 Ga0466964_0046285 Ga0466964_0046285_128_1357 403
1372 3300044706 Ga0466964_0068426 Ga0466964_0068426_214_1443 403
1373 3300044842 Ga0466957_0116698 Ga0466957_0116698_444_1673 403
1374 3300045049 Ga0466959_0004441 Ga0466959_0004441_4493_5722 403
1375 3300045976 Ga0466967_0041536 Ga0466967_0041536_587_1816 403
1376 3300045976 Ga0466967_0186608 Ga0466967_0186608_84_1313 403
1377 3300046454 Ga0495592_0000339 Ga0495592_0000339_4245_5474 403
1378 3300046455 Ga0495603_0000277 Ga0495603_0000277_13161_14465 403
1379 3300046455 Ga0495603_0000534 Ga0495603_0000534_14577_15806 403
1380 3300046455 Ga0495603_0003382 Ga0495603_0003382_2556_3857 403
1381 3300046455 Ga0495603_0018302 Ga0495603_0018302_1418_2647 403
1382 3300046455 Ga0495603_0038296 Ga0495603_0038296_1079_2308 403
1383 3300046455 Ga0495603_0051828 Ga0495603_0051828_486_1715 403
1384 3300046459 Ga0495629_0000029 Ga0495629_0000029_13661_14965 403
1385 3300046459 Ga0495629_0000429 Ga0495629_0000429_11221_12450 403
1386 3300046459 Ga0495629_0002796 Ga0495629_0002796_9327_10556 403
1387 3300046459 Ga0495629_0003050 Ga0495629_0003050_8133_9362 403
1388 3300046460 Ga0495638_0046195 Ga0495638_0046195_1187_2416 403
1389 3300046461 Ga0495641_0001504 Ga0495641_0001504_13581_14885 403
1390 3300046462 Ga0495651_0004273 Ga0495651_0004273_8068_9297 403
1391 3300046462 Ga0495651_0017929 Ga0495651_0017929_131_1360 403
1392 3300046462 Ga0495651_0073584 Ga0495651_0073584_769_1998 403
1393 3300046462 Ga0495651_0081956 Ga0495651_0081956_121_1353 403
1394 3300046463 Ga0495653_0002916 Ga0495653_0002916_8068_9297 403
1395 3300046472 Ga0495580_0000705 Ga0495580_0000705_26454_27758 403
1396 3300046472 Ga0495580_0002724 Ga0495580_0002724_10714_11943 403
1397 3300046473 Ga0495582_0000024 Ga0495582_0000024_13639_14943 403
1398 3300046473 Ga0495582_0000482 Ga0495582_0000482_804_2033 403
1399 3300046475 Ga0495639_0000135 Ga0495639_0000135_30393_31697 403
1400 3300046475 Ga0495639_0003253 Ga0495639_0003253_804_2033 403
1401 3300046475 Ga0495639_0027851 Ga0495639_0027851_407_1636 403
1402 3300046476 Ga0495662_0000348 Ga0495662_0000348_34_1263 403
1403 3300046476 Ga0495662_0006898 Ga0495662_0006898_251_1480 403
1404 3300046477 Ga0495664_0009632 Ga0495664_0009632_255_1559 403
1405 3300046499 Ga0495594_0000822 Ga0495594_0000822_4535_5839 403
1406 3300046499 Ga0495594_0000896 Ga0495594_0000896_1839_3068 403
1407 3300046507 Ga0495606_0007982 Ga0495606_0007982_6970_8199 403
1408 3300046511 Ga0495608_0002299 Ga0495608_0002299_6689_7918 403
1409 3300046516 Ga0495628_0012669 Ga0495628_0012669_5837_7066 403
1410 3300046517 Ga0495630_0002890 Ga0495630_0002890_7908_9137 403
1411 3300046517 Ga0495630_0007650 Ga0495630_0007650_1375_2679 403
1412 3300046517 Ga0495630_0018001 Ga0495630_0018001_2198_3427 403
1413 3300046518 Ga0495631_0026373 Ga0495631_0026373_1115_2356 403
1414 3300046519 Ga0495632_0071044 Ga0495632_0071044_381_1610 403
1415 3300046522 Ga0495643_0081888 Ga0495643_0081888_397_1626 403
1416 3300046523 Ga0495644_0049000 Ga0495644_0049000_64_1293 403
1417 3300046524 Ga0495648_0000310 Ga0495648_0000310_2372_3601 403
1418 3300046524 Ga0495648_0036359 Ga0495648_0036359_672_1901 403
1419 3300046526 Ga0495666_0035372 Ga0495666_0035372_996_2225 403
1420 3300046529 Ga0495652_0007414 Ga0495652_0007414_7256_8485 403
1421 3300046529 Ga0495652_0014055 Ga0495652_0014055_505_1809 403
1422 3300046529 Ga0495652_0120850 Ga0495652_0120850_805_2034 403
1423 3300046531 Ga0495665_0000178 Ga0495665_0000178_13586_14890 403
1424 3300046533 Ga0495640_0000881 Ga0495640_0000881_10099_11328 403
1425 3300046533 Ga0495640_0003708 Ga0495640_0003708_5057_6361 403
1426 3300046533 Ga0495640_0009567 Ga0495640_0009567_2456_3685 403
1427 3300046536 Ga0495587_0024155 Ga0495587_0024155_1410_2639 403
1428 3300046543 Ga0495645_0030073 Ga0495645_0030073_1975_3204 403
1429 3300046543 Ga0495645_0038077 Ga0495645_0038077_1718_2947 403
1430 3300046557 Ga0495622_0002012 Ga0495622_0002012_5821_7050 403
1431 3300046557 Ga0495622_0029441 Ga0495622_0029441_366_1595 403
1432 3300046559 Ga0495667_0003330 Ga0495667_0003330_1243_2472 403
1433 3300046559 Ga0495667_0042815 Ga0495667_0042815_1498_2802 403
1434 3300046642 Ga0495634_0001222 Ga0495634_0001222_6464_7693 403
1435 3300046642 Ga0495634_0007096 Ga0495634_0007096_2916_4145 403
1436 3300046642 Ga0495634_0013730 Ga0495634_0013730_323_1627 403
1437 3300046648 Ga0495611_0020338 Ga0495611_0020338_215_1444 403
1438 3300046660 Ga0495625_0125482 Ga0495625_0125482_66_1295 403
1439 3300046663 Ga0495635_0000910 Ga0495635_0000910_10217_11446 403
1440 3300046663 Ga0495635_0004181 Ga0495635_0004181_7256_8485 403
1441 3300046663 Ga0495635_0010291 Ga0495635_0010291_412_1716 403
1442 3300046663 Ga0495635_0056377 Ga0495635_0056377_1325_2554 403
1443 3300046663 Ga0495635_0105069 Ga0495635_0105069_220_1449 403
1444 3300046664 Ga0495659_0010257 Ga0495659_0010257_679_1908 403
1445 3300046674 Ga0495588_0003152 Ga0495588_0003152_5284_6513 403
1446 3300046674 Ga0495588_0038561 Ga0495588_0038561_1150_2379 403
1447 3300046674 Ga0495588_0064420 Ga0495588_0064420_524_1753 403
1448 3300046675 Ga0495657_0023707 Ga0495657_0023707_1621_2850 403
1449 3300046678 Ga0495599_0000440 Ga0495599_0000440_4001_5230 403
1450 3300046678 Ga0495599_0046152 Ga0495599_0046152_885_2114 403
1451 3300046678 Ga0495599_0093308 Ga0495599_0093308_139_1368 403
1452 3300046679 Ga0495623_0004965 Ga0495623_0004965_1661_2890 403
1453 3300046679 Ga0495623_0110117 Ga0495623_0110117_185_1414 403
1454 3300046680 Ga0495646_0023165 Ga0495646_0023165_1695_2924 403
1455 3300046680 Ga0495646_0041961 Ga0495646_0041961_98_1327 403
1456 3300046680 Ga0495646_0084297 Ga0495646_0084297_92_1396 403
1457 3300046681 Ga0495647_0013024 Ga0495647_0013024_1533_2837 403
1458 3300046683 Ga0495658_0001504 Ga0495658_0001504_8639_9943 403
1459 3300046683 Ga0495658_0002247 Ga0495658_0002247_5115_6344 403
1460 3300046684 Ga0495669_0006663 Ga0495669_0006663_2432_3661 403
1461 3300046689 Ga0495613_0006457 Ga0495613_0006457_1122_2426 403
1462 3300046689 Ga0495613_0022922 Ga0495613_0022922_195_1424 403
1463 3300046689 Ga0495613_0068130 Ga0495613_0068130_1257_2486 403
1464 3300046690 Ga0495624_0000788 Ga0495624_0000788_10075_11379 403
1465 3300046690 Ga0495624_0002246 Ga0495624_0002246_10713_11942 403
1466 3300046691 Ga0495670_0023077 Ga0495670_0023077_1419_2648 403
1467 3300046692 Ga0495671_0033510 Ga0495671_0033510_27_1268 403
1468 3300046694 Ga0495649_0117149 Ga0495649_0117149_165_1394 403
1469 3300046794 Ga0495589_0099229 Ga0495589_0099229_62_1291 403
1470 3300046809 Ga0495600_0002595 Ga0495600_0002595_8068_9297 403
1471 3300046809 Ga0495600_0036413 Ga0495600_0036413_1014_2318 403
1472 3300047315 Ga0495581_0000004 Ga0495581_0000004_69068_70297 403
1473 3300047315 Ga0495581_0000004 Ga0495581_0000004_70476_71780 403
1474 3300047315 Ga0495581_0019748 Ga0495581_0019748_2434_3663 403
1475 3300047317 Ga0495604_0013152 Ga0495604_0013152_4118_5347 403
1476 3300047319 Ga0495674_0000375 Ga0495674_0000375_32688_33917 403
1477 3300047319 Ga0495674_0001728 Ga0495674_0001728_17153_18457 403
1478 3300047319 Ga0495674_0008604 Ga0495674_0008604_5393_6622 403
1479 3300047319 Ga0495674_0015846 Ga0495674_0015846_2821_4050 403
1480 3300047320 Ga0495672_0054257 Ga0495672_0054257_448_1677 403
1481 3300047320 Ga0495672_0063717 Ga0495672_0063717_357_1586 403
1482 3300047321 Ga0495676_0021097 Ga0495676_0021097_1512_2816 403
1483 3300047321 Ga0495676_0038068 Ga0495676_0038068_388_1617 403
1484 3300047321 Ga0495676_0106787 Ga0495676_0106787_705_2006 403
1485 3300047322 Ga0495680_0036592 Ga0495680_0036592_1090_2319 403
1486 3300047444 Ga0495675_0000801 Ga0495675_0000801_8068_9297 403
1487 3300047471 Ga0495684_0002197 Ga0495684_0002197_12733_13962 403
1488 3300047471 Ga0495684_0004302 Ga0495684_0004302_8718_9947 403
1489 3300047472 Ga0495686_0036135 Ga0495686_0036135_1614_2855 403
1490 3300047472 Ga0495686_0138420 Ga0495686_0138420_142_1371 403
1491 3300047673 Ga0495593_0000197 Ga0495593_0000197_10050_11279 403
1492 3300047673 Ga0495593_0000198 Ga0495593_0000198_30124_31428 403
1493 3300047673 Ga0495593_0000375 Ga0495593_0000375_3521_4750 403
1494 3300048088 Ga0495602_0014005 Ga0495602_0014005_1661_2890 403
1495 3300048088 Ga0495602_0069253 Ga0495602_0069253_33_1262 403
1496 3300048089 Ga0495614_0010788 Ga0495614_0010788_2756_3985 403
1497 3300048903 Ga0496100_0021374 Ga0496100_0021374_2629_3858 403
1498 3300048903 Ga0496100_0072559 Ga0496100_0072559_335_1564 403
1499 3300048903 Ga0496100_0121646 Ga0496100_0121646_401_1630 403
1500 3300048904 Ga0496101_0001342 Ga0496101_0001342_7109_8338 403
1501 3300048904 Ga0496101_0001342 Ga0496101_0001342_8520_9749 403
1502 3300048904 Ga0496101_0095520 Ga0496101_0095520_345_1574 403
1503 3300048905 Ga0496102_0013166 Ga0496102_0013166_1506_2735 403
1504 3300048905 Ga0496102_0013166 Ga0496102_0013166_2903_4132 403
1505 3300048905 Ga0496102_0057579 Ga0496102_0057579_2113_3342 403
1506 3300048905 Ga0496102_0057579 Ga0496102_0057579_702_1931 403
1507 3300048905 Ga0496102_0192459 Ga0496102_0192459_342_1571 403
1508 3300048906 Ga0496103_0135393 Ga0496103_0135393_165_1394 403
1509 3300048906 Ga0496103_0139975 Ga0496103_0139975_32_1261 403
1510 3300048907 Ga0496104_0002918 Ga0496104_0002918_7398_8627 403
1511 3300048907 Ga0496104_0008089 Ga0496104_0008089_3534_4763 403
1512 3300048907 Ga0496104_0008089 Ga0496104_0008089_4931_6160 403
1513 3300048907 Ga0496104_0016010 Ga0496104_0016010_3209_4441 403
1514 3300048907 Ga0496104_0031079 Ga0496104_0031079_2723_3952 403
1515 3300048907 Ga0496104_0325824 Ga0496104_0325824_82_1311 403
1516 3300048908 Ga0496105_0009438 Ga0496105_0009438_4666_5895 403
1517 3300048908 Ga0496105_0017461 Ga0496105_0017461_4072_5409 403
1518 3300048908 Ga0496105_0020063 Ga0496105_0020063_231_1460 403
1519 3300048908 Ga0496105_0046941 Ga0496105_0046941_2251_3480 403
1520 3300048908 Ga0496105_0211533 Ga0496105_0211533_180_1409 403
1521 3300048909 Ga0496106_0002085 Ga0496106_0002085_2154_3386 403
1522 3300048909 Ga0496106_0023922 Ga0496106_0023922_1682_2911 403
1523 3300048909 Ga0496106_0023922 Ga0496106_0023922_271_1500 403
1524 3300048909 Ga0496106_0091700 Ga0496106_0091700_882_2111 403
1525 3300048909 Ga0496106_0148930 Ga0496106_0148930_55_1284 403
1526 3300048910 Ga0496107_0001626 Ga0496107_0001626_5825_7054 403
1527 3300048910 Ga0496107_0001626 Ga0496107_0001626_7236_8465 403
1528 3300048910 Ga0496107_0018609 Ga0496107_0018609_309_1538 403
1529 3300048911 Ga0496108_0016739 Ga0496108_0016739_3847_5076 403
1530 3300048911 Ga0496108_0030999 Ga0496108_0030999_2615_3844 403
1531 3300048911 Ga0496108_0041212 Ga0496108_0041212_2509_3738 403
1532 3300048911 Ga0496108_0054292 Ga0496108_0054292_1074_2306 403
1533 3300048912 Ga0496109_0018280 Ga0496109_0018280_2297_3526 403
1534 3300048912 Ga0496109_0018280 Ga0496109_0018280_3708_4937 403
1535 3300048912 Ga0496109_0045892 Ga0496109_0045892_1254_2483 403
1536 3300048912 Ga0496109_0049885 Ga0496109_0049885_1045_2274 403
1537 3300048912 Ga0496109_0079526 Ga0496109_0079526_1664_2896 403
1538 3300048913 Ga0496110_0015096 Ga0496110_0015096_10_1242 403
1539 3300048913 Ga0496110_0027689 Ga0496110_0027689_1810_3039 403
1540 3300048913 Ga0496110_0027689 Ga0496110_0027689_3221_4450 403
1541 3300048913 Ga0496110_0042322 Ga0496110_0042322_145_1482 403
1542 3300048913 Ga0496110_0050850 Ga0496110_0050850_1494_2723 403
1543 3300048913 Ga0496110_0213101 Ga0496110_0213101_120_1349 403
1544 3300048913 Ga0496110_0221792 Ga0496110_0221792_255_1484 403
1545 3300048913 Ga0496110_0281867 Ga0496110_0281867_140_1369 403
1546 3300048913 Ga0496110_0288673 Ga0496110_0288673_166_1395 403
1547 3300048914 Ga0496111_0011412 Ga0496111_0011412_2969_4198 403
1548 3300048914 Ga0496111_0011412 Ga0496111_0011412_4380_5609 403
1549 3300048915 Ga0496112_0000090 Ga0496112_0000090_14591_15820 403
1550 3300048915 Ga0496112_0035408 Ga0496112_0035408_2261_3490 403
1551 3300048915 Ga0496112_0081198 Ga0496112_0081198_1554_2783 403
1552 3300048915 Ga0496112_0092931 Ga0496112_0092931_361_1590 403
1553 3300048915 Ga0496112_0173896 Ga0496112_0173896_699_1928 403
1554 3300048916 Ga0496113_0012523 Ga0496113_0012523_1891_3120 403
1555 3300048916 Ga0496113_0012523 Ga0496113_0012523_494_1723 403
1556 3300048917 Ga0496114_0018948 Ga0496114_0018948_1876_3105 403
1557 3300048917 Ga0496114_0018948 Ga0496114_0018948_3273_4502 403
1558 3300048917 Ga0496114_0105825 Ga0496114_0105825_287_1570 403
1559 3300048917 Ga0496114_0228744 Ga0496114_0228744_58_1287 403
1560 3300048918 Ga0496115_0001562 Ga0496115_0001562_2061_3290 403
1561 3300048918 Ga0496115_0001562 Ga0496115_0001562_3472_4701 403
1562 3300048918 Ga0496115_0037790 Ga0496115_0037790_809_2038 403
1563 3300048918 Ga0496115_0045771 Ga0496115_0045771_1268_2497 403
1564 3300048918 Ga0496115_0158149 Ga0496115_0158149_314_1543 403
1565 3300048921 Ga0496118_0133200 Ga0496118_0133200_168_1397 403
1566 3300048922 Ga0496119_0013658 Ga0496119_0013658_2593_3822 403
1567 3300048924 Ga0496121_0007690 Ga0496121_0007690_4792_6021 403
1568 3300048924 Ga0496121_0011755 Ga0496121_0011755_6795_8024 403
1569 3300048924 Ga0496121_0014151 Ga0496121_0014151_842_2071 403
1570 3300048924 Ga0496121_0042114 Ga0496121_0042114_1243_2472 403
1571 3300048924 Ga0496121_0108513 Ga0496121_0108513_835_2064 403
1572 3300048924 Ga0496121_0121590 Ga0496121_0121590_461_1690 403
1573 3300048928 Ga0496125_0049142 Ga0496125_0049142_468_1871 403
1574 3300048929 Ga0496126_0012671 Ga0496126_0012671_5509_6738 403
1575 3300048929 Ga0496126_0016304 Ga0496126_0016304_6141_7370 403
1576 3300048929 Ga0496126_0026887 Ga0496126_0026887_3545_4774 403
1577 3300048929 Ga0496126_0030015 Ga0496126_0030015_1501_2730 403
1578 3300048929 Ga0496126_0047740 Ga0496126_0047740_569_1798 403
1579 3300048929 Ga0496126_0056346 Ga0496126_0056346_536_1765 403
1580 3300048929 Ga0496126_0167490 Ga0496126_0167490_145_1374 403
1581 3300048929 Ga0496126_0192572 Ga0496126_0192572_130_1359 403
1582 3300048929 Ga0496126_0218222 Ga0496126_0218222_350_1579 403
1583 3300048929 Ga0496126_0280886 Ga0496126_0280886_25_1254 403
1584 3300049568 Ga0501031_0001791 Ga0501031_0001791_277_1506 403
1585 3300049569 Ga0501032_0000073 Ga0501032_0000073_75963_77192 403
1586 3300049569 Ga0501032_0000073 Ga0501032_0000073_77380_78609 403
1587 3300049570 Ga0501033_0000136 Ga0501033_0000136_37988_39217 403
1588 3300049570 Ga0501033_0000136 Ga0501033_0000136_39405_40634 403
1589 3300049571 Ga0501034_0000251 Ga0501034_0000251_56539_57768 403
1590 3300049571 Ga0501034_0000251 Ga0501034_0000251_57956_59185 403
1591 3300049572 Ga0501036_0000036 Ga0501036_0000036_30329_31558 403
1592 3300049572 Ga0501036_0000036 Ga0501036_0000036_31746_32975 403
1593 3300049572 Ga0501036_0051369 Ga0501036_0051369_1074_2303 403
1594 3300049573 Ga0501037_0001715 Ga0501037_0001715_10583_11812 403
1595 3300049573 Ga0501037_0001715 Ga0501037_0001715_12000_13229 403
1596 3300049574 Ga0501038_0000428 Ga0501038_0000428_3321_4550 403
1597 3300049574 Ga0501038_0000428 Ga0501038_0000428_4738_5967 403
1598 3300049574 Ga0501038_0031834 Ga0501038_0031834_3169_4398 403
1599 3300049575 Ga0501039_0000273 Ga0501039_0000273_25651_26880 403
1600 3300049575 Ga0501039_0000273 Ga0501039_0000273_27068_28297 403
1601 3300049575 Ga0501039_0085782 Ga0501039_0085782_785_2014 403
1602 3300049578 Ga0501042_0015037 Ga0501042_0015037_2762_3991 403
1603 3300049579 Ga0501043_0000165 Ga0501043_0000165_44558_45787 403
1604 3300049579 Ga0501043_0000165 Ga0501043_0000165_45975_47204 403
1605 3300049580 Ga0501046_0001143 Ga0501046_0001143_12748_13977 403
1606 3300049580 Ga0501046_0001143 Ga0501046_0001143_14165_15394 403
1607 3300049580 Ga0501046_0230349 Ga0501046_0230349_93_1322 403
1608 3300049581 Ga0501047_0000340 Ga0501047_0000340_20310_21539 403
1609 3300049581 Ga0501047_0000340 Ga0501047_0000340_21727_22956 403
1610 3300049581 Ga0501047_0161095 Ga0501047_0161095_601_1830 403
1611 3300049582 Ga0501048_0004991 Ga0501048_0004991_1448_2677 403
1612 3300049582 Ga0501048_0004991 Ga0501048_0004991_2865_4094 403
1613 3300049583 Ga0501067_0005805 Ga0501067_0005805_1388_2617 403
1614 3300049584 Ga0501068_0000255 Ga0501068_0000255_2943_4172 403
1615 3300049584 Ga0501068_0000255 Ga0501068_0000255_4360_5589 403
1616 3300049584 Ga0501068_0041667 Ga0501068_0041667_1023_2252 403
1617 3300049585 Ga0501069_0008241 Ga0501069_0008241_1461_2690 403
1618 3300049585 Ga0501069_0008241 Ga0501069_0008241_2878_4107 403
1619 3300049586 Ga0501070_0007747 Ga0501070_0007747_5770_6999 403
1620 3300049586 Ga0501070_0007747 Ga0501070_0007747_7187_8416 403
1621 3300049586 Ga0501070_0010122 Ga0501070_0010122_5233_6462 403
1622 3300049586 Ga0501070_0025402 Ga0501070_0025402_389_1618 403
1623 3300049586 Ga0501070_0025521 Ga0501070_0025521_1611_2840 403
1624 3300049586 Ga0501070_0025521 Ga0501070_0025521_179_1402 403
1625 3300049587 Ga0501071_0122894 Ga0501071_0122894_11_1240 403
1626 3300049588 Ga0501072_0001213 Ga0501072_0001213_8257_9486 403
1627 3300049588 Ga0501072_0001213 Ga0501072_0001213_9674_10903 403
1628 3300049589 Ga0501073_0000037 Ga0501073_0000037_54298_55527 403
1629 3300049589 Ga0501073_0000037 Ga0501073_0000037_55715_56944 403
1630 3300049590 Ga0501074_0000133 Ga0501074_0000133_6887_8116 403
1631 3300049590 Ga0501074_0000133 Ga0501074_0000133_8304_9533 403
1632 3300049590 Ga0501074_0107539 Ga0501074_0107539_283_1506 403
1633 3300049741 Ga0501079_0001057 Ga0501079_0001057_11847_13076 403
1634 3300049741 Ga0501079_0001057 Ga0501079_0001057_13264_14493 403
1635 3300049742 Ga0501080_0000054 Ga0501080_0000054_3804_5033 403
1636 3300049742 Ga0501080_0000054 Ga0501080_0000054_5221_6450 403
1637 3300049742 Ga0501080_0028463 Ga0501080_0028463_2302_3525 403
1638 3300049742 Ga0501080_0028463 Ga0501080_0028463_864_2093 403
1639 3300049742 Ga0501080_0192598 Ga0501080_0192598_70_1299 403
1640 3300049744 Ga0501083_0003724 Ga0501083_0003724_1296_2525 403
1641 3300049822 Ga0501035_0000142 Ga0501035_0000142_28377_29606 403
1642 3300049822 Ga0501035_0000142 Ga0501035_0000142_29794_31023 403
1643 3300049822 Ga0501035_0062851 Ga0501035_0062851_1916_3145 403
1644 3300049822 Ga0501035_0062851 Ga0501035_0062851_497_1726 403
1645 3300049823 Ga0501044_0000414 Ga0501044_0000414_28555_29784 403
1646 3300049823 Ga0501044_0000414 Ga0501044_0000414_29972_31201 403
1647 3300049823 Ga0501044_0044082 Ga0501044_0044082_1375_2604 403
1648 3300049823 Ga0501044_0044082 Ga0501044_0044082_2770_3999 403
1649 3300049823 Ga0501044_0085260 Ga0501044_0085260_584_1813 403
1650 3300049824 Ga0501045_0057653 Ga0501045_0057653_1417_2646 403
1651 3300050490 nmdc:mga03n38_66642_c1 nmdc:mga03n38_66642_c1_385_1614 403
1652 3300050490 nmdc:mga03n38_7090_c1 nmdc:mga03n38_7090_c1_2277_3506 403
1653 3300050491 nmdc:mga00v17_15058_c1 nmdc:mga00v17_15058_c1_1539_2768 403
1654 3300050494 nmdc:mga06z11_20446_c1 nmdc:mga06z11_20446_c1_1815_3044 403
1655 3300050496 nmdc:mga07m45_21802_c1 nmdc:mga07m45_21802_c1_317_1546 403
1656 3300050496 nmdc:mga07m45_32395_c1 nmdc:mga07m45_32395_c1_421_1650 403
1657 3300050496 nmdc:mga07m45_53965_c1 nmdc:mga07m45_53965_c1_769_1998 403
1658 3300050512 nmdc:mga0n895_24565_c1 nmdc:mga0n895_24565_c1_1234_2463 403
1659 3300053077 Ga0495601_0028223 Ga0495601_0028223_491_1720 403
1660 3300053077 Ga0495601_0081577 Ga0495601_0081577_349_1578 403
1661 3300053077 Ga0495601_0200594 Ga0495601_0200594_44_1273 403
1662 3300053078 Ga0495612_0012023 Ga0495612_0012023_199_1428 403
1663 3300053080 Ga0500635_0003136 Ga0500635_0003136_1439_2668 403
1664 3300053080 Ga0500635_0003603 Ga0500635_0003603_112_1341 403
1665 3300053080 Ga0500635_0003603 Ga0500635_0003603_1529_2758 403
1666 3300053080 Ga0500635_0042830 Ga0500635_0042830_91_1320 403
1667 3300053085 Ga0495619_0001183 Ga0495619_0001183_15931_17160 403
1668 3300053085 Ga0495619_0016178 Ga0495619_0016178_529_1758 403
1669 3300053086 Ga0500578_0086293 Ga0500578_0086293_513_1754 403
1670 3300053091 Ga0500647_0033749 Ga0500647_0033749_851_2086 403
1671 3300053093 Ga0500651_0011222 Ga0500651_0011222_1512_2753 403
1672 3300053094 Ga0500566_0006638 Ga0500566_0006638_730_1959 403
1673 3300053102 Ga0500554_003648 Ga0500554_003648_1652_2881 403
1674 3300053111 Ga0500572_000389 Ga0500572_000389_3613_4836 403
1675 3300053116 Ga0500592_001392 Ga0500592_001392_1559_2800 403
1676 3300053119 Ga0500595_001519 Ga0500595_001519_7467_8696 403
1677 3300053119 Ga0500595_001519 Ga0500595_001519_8907_10136 403
1678 3300053119 Ga0500595_002014 Ga0500595_002014_2465_3694 403
1679 3300053119 Ga0500595_003149 Ga0500595_003149_6458_7744 403
1680 3300053119 Ga0500595_006850 Ga0500595_006850_2389_3618 403
1681 3300053119 Ga0500595_046074 Ga0500595_046074_74_1306 403
1682 3300053125 Ga0500618_026238 Ga0500618_026238_85_1314 403
1683 3300053131 Ga0500652_001212 Ga0500652_001212_5523_6764 403
1684 3300053136 Ga0500559_0001715 Ga0500559_0001715_5193_6416 403
1685 3300053150 Ga0500603_000303 Ga0500603_000303_4210_5439 403
1686 3300053162 Ga0500638_001847 Ga0500638_001847_5101_6330 403
1687 3300053177 Ga0500636_0064297 Ga0500636_0064297_690_1919 403
1688 3300053177 Ga0500636_0064793 Ga0500636_0064793_794_2023 403
1689 3300053178 Ga0500637_0001085 Ga0500637_0001085_1480_2709 403
1690 3300053178 Ga0500637_0001085 Ga0500637_0001085_2897_4126 403
1691 3300053178 Ga0500637_0002841 Ga0500637_0002841_4536_5765 403
1692 3300053178 Ga0500637_0002841 Ga0500637_0002841_5976_7205 403
1693 3300053178 Ga0500637_0024766 Ga0500637_0024766_415_1644 403
1694 3300053178 Ga0500637_0026684 Ga0500637_0026684_1711_2940 403
1695 3300053730 Ga0500645_005883 Ga0500645_005883_2747_3976 403
1696 3300053731 Ga0500609_000386 Ga0500609_000386_1529_2758 403
1697 3300053733 Ga0500552_002249 Ga0500552_002249_79_1308 403
1698 3300054114 Ga0501084_0006462 Ga0501084_0006462_5830_7059 403
1699 3300054114 Ga0501084_0006462 Ga0501084_0006462_7247_8476 403
1700 3300055283 Ga0500661_000349 Ga0500661_000349_7177_8406 403
1701 3300059493 Ga0587077_001070 Ga0587077_001070_132_1361 403
1702 3300059504 Ga0587082_010826 Ga0587082_010826_28_1269 403
1703 3300059644 Ga0587075_008698 Ga0587075_008698_57_1286 403
1704 3300059647 Ga0587079_006083 Ga0587079_006083_491_1720 403
1705 3300060353 Ga0501082_0002719 Ga0501082_0002719_11955_13184 403
1706 3300060353 Ga0501082_0002719 Ga0501082_0002719_13372_14601 403
1707 iso_pu_bacteria 8019565922 8019567778 403
1708 3300005436 Ga0070713_100038019 Ga0070713_1000380192 404
1709 3300005563 Ga0068855_100281991 Ga0068855_1002819912 404
1710 3300005617 Ga0068859_100448322 Ga0068859_1004483221 404
1711 3300006931 Ga0097620_100448327 Ga0097620_1004483271 404
1712 3300009545 Ga0105237_10108190 Ga0105237_101081901 404
1713 3300021384 Ga0213876_10003691 Ga0213876_100036917 404
1714 3300021441 Ga0213871_10005083 Ga0213871_100050832 404
1715 3300025928 Ga0207700_10051229 Ga0207700_100512292 404
1716 3300031507 Ga0307509_10142988 Ga0307509_101429882 404
1717 3300031616 Ga0307508_10000012 Ga0307508_1000001221 404
1718 3300031616 Ga0307508_10180778 Ga0307508_101807781 404
1719 3300031730 Ga0307516_10012378 Ga0307516_100123786 404
1720 3300031730 Ga0307516_10047340 Ga0307516_100473403 404
1721 3300033179 Ga0307507_10075010 Ga0307507_100750101 404
1722 3300037466 Ga0395898_0035217 Ga0395898_0035217_110_1342 404
1723 3300039453 Ga0436362_0354125 Ga0436362_0354125_434_1666 404
1724 3300046524 Ga0495648_0000310 Ga0495648_0000310_3912_5144 404
1725 3300048915 Ga0496112_0000090 Ga0496112_0000090_12987_14219 404
1726 3300048924 Ga0496121_0076036 Ga0496121_0076036_189_1496 404
1727 3300048924 Ga0496121_0077391 Ga0496121_0077391_621_1994 404
1728 3300048929 Ga0496126_0047107 Ga0496126_0047107_1961_3334 404
1729 3300048929 Ga0496126_0211892 Ga0496126_0211892_93_1352 404
1730 3300049569 Ga0501032_0058259 Ga0501032_0058259_595_1827 404
1731 3300049569 Ga0501032_0128537 Ga0501032_0128537_148_1380 404
1732 3300049579 Ga0501043_0002500 Ga0501043_0002500_13207_14439 404
1733 3300049580 Ga0501046_0043332 Ga0501046_0043332_544_1776 404
1734 3300049581 Ga0501047_0250276 Ga0501047_0250276_285_1517 404
1735 3300049583 Ga0501067_0026256 Ga0501067_0026256_341_1573 404
1736 3300049586 Ga0501070_0025402 Ga0501070_0025402_3126_4358 404
1737 3300049590 Ga0501074_0154938 Ga0501074_0154938_88_1320 404
1738 3300049742 Ga0501080_0133973 Ga0501080_0133973_901_2133 404
1739 3300049822 Ga0501035_0203574 Ga0501035_0203574_194_1426 404
1740 3300050507 nmdc:mga05p37_161286_c1 nmdc:mga05p37_161286_c1_1384_2616 404
1741 3300053136 Ga0500559_0072929 Ga0500559_0072929_43_1275 404
1742 3300053140 Ga0500573_0027024 Ga0500573_0027024_1129_2361 404
1743 3300053162 Ga0500638_053434 Ga0500638_053434_396_1628 404
1744 3300053735 Ga0500596_009089 Ga0500596_009089_55_1287 404
1745 3300060353 Ga0501082_0260104 Ga0501082_0260104_184_1416 404
1746 3300005336 Ga0070680_100023945 Ga0070680_1000239454 405
1747 3300005435 Ga0070714_100160787 Ga0070714_1001607872 405
1748 3300005458 Ga0070681_10057183 Ga0070681_100571832 405
1749 3300005530 Ga0070679_100042235 Ga0070679_1000422352 405
1750 3300005563 Ga0068855_100279671 Ga0068855_1002796712 405
1751 3300009174 Ga0105241_10133754 Ga0105241_101337542 405
1752 3300025911 Ga0207654_10042159 Ga0207654_100421591 405
1753 3300025912 Ga0207707_10006061 Ga0207707_100060612 405
1754 3300025913 Ga0207695_10170178 Ga0207695_101701782 405
1755 3300025921 Ga0207652_10018163 Ga0207652_100181634 405
1756 3300025949 Ga0207667_10255953 Ga0207667_102559531 405
1757 3300026116 Ga0207674_10115851 Ga0207674_101158512 405
1758 3300037418 Ga0395900_0299778 Ga0395900_0299778_322_1560 405
1759 3300037466 Ga0395898_0189480 Ga0395898_0189480_686_1924 405
1760 3300046794 Ga0495589_0093490 Ga0495589_0093490_18_1250 405
1761 3300005435 Ga0070714_100154815 Ga0070714_1001548152 406
1762 3300005439 Ga0070711_100025037 Ga0070711_1000250373 406
1763 3300005458 Ga0070681_10036430 Ga0070681_100364303 406
1764 3300005563 Ga0068855_100016594 Ga0068855_1000165947 406
1765 3300009093 Ga0105240_10063527 Ga0105240_100635273 406
1766 3300009551 Ga0105238_10008924 Ga0105238_100089243 406
1767 3300013104 Ga0157370_10009093 Ga0157370_100090937 406
1768 3300025913 Ga0207695_10081064 Ga0207695_100810642 406
1769 3300025924 Ga0207694_10065559 Ga0207694_100655592 406
1770 3300025939 Ga0207665_10036263 Ga0207665_100362632 406
1771 3300025949 Ga0207667_10232507 Ga0207667_102325071 406
1772 3300045049 Ga0466959_0052392 Ga0466959_0052392_1350_2846 406
1773 3300000549 LJQas_1005163 LJQas_10051632 412
1774 3300007265 Ga0099794_10041225 Ga0099794_100412251 412
1775 3300048910 Ga0496107_0061908 Ga0496107_0061908_1218_2456 412
1776 3300048911 Ga0496108_0006756 Ga0496108_0006756_6713_7951 412
1777 3300048912 Ga0496109_0027858 Ga0496109_0027858_2521_3759 412
1778 3300048913 Ga0496110_0139486 Ga0496110_0139486_688_1926 412
1779 3300048916 Ga0496113_0062856 Ga0496113_0062856_209_1447 412

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13458

Peripla_BP_6

Periplasmic binding protein

124

480

0.91

PF01094

ANF_receptor

Receptor family ligand binding region

149

458

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lkb-assembly1.cif.gz_A crystal structure of a branched chain amino acid abc transporter from thermus thermophilus with bound valine 0.9022 37 405
3lop-assembly1.cif.gz_A crystal structure of substrate-binding periplasmic protein (pbp) from ralstonia solanacearum 0.9005 39 403
3lop-assembly1.cif.gz_A crystal structure of substrate-binding periplasmic protein (pbp) from ralstonia solanacearum 0.8932 39 403
1qo0-assembly1.cif.gz_B amide receptor of the amidase operon of pseudomonas aeruginosa (amic) complexed with the negative regulator amir. 0.8791 40 398
4kv7-assembly1.cif.gz_A the crystal structure of a possible leucine/isoleucine/valine-binding protein from rhodopirellula baltica sh 1 0.8709 25 399
ID Description Score Start End Superfamily
4n0qA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9028 159 288 3.40.50.2300
af_Q9SHV1_60_153_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8895 85 137 3.40.50.2300
1usiA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8867 159 286 3.40.50.2300
3lopA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8799 159 284 3.40.50.2300
af_P04816_25_358_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8754 39 403 3.40.190.10
ID Description Score Start End GO Terms
AF-K8NUS1-F1-model_v4 Leucine-binding protein domain-containing protein 0.9982 35 157
AF-A0A7Y9RAP2-F1-model_v4 ABC-type branched-subunit amino acid transport system substrate-binding protein 0.9733 45 404
AF-A0A4Q4CY52-F1-model_v4 Branched-chain amino acid ABC transporter substrate-binding protein 0.9707 34 405
AF-A0A2V7FKW0-F1-model_v4 Branched-chain amino acid ABC transporter substrate-binding protein 0.9637 45 406
AF-D9XDB9-F1-model_v4 Extracellular ligand-binding receptor 0.9626 65 404

Feature Viewer

pLDDT pTM Quality
89.71 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map