F495673
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1779 | 680 | 1233 | 408 |
Family's Representative Sequence
| Representative Sequence | 3300045049|Ga0466959_0052392|Ga0466959_0052392_1350_2846 |
| Length | 498 |
| Sequence | MVRVASQRARRKPVSPSLGCRGPIRLGGRSSAKPNPLFVSLHQPQLAGCNNRFAPPNNAKLASACAACETWRKQNGQNKTKREKTMPALKRRLISIAVLAAAXXLAASGAEAQKKYDPGASDTEIKIGNIMPYSGPASSYGVIGLTEKAYFDMINDQGGINGRKVKFITYDDGYSPPKAIEQARKLVESDEVLFIFQSLGTPSNSAIQKYMNAKKVPQLFVATGATKWGDPKNFPWTMGWQPNYQSEGRIYGKYILEHFPDAKIAVFWQNDDAGKDQVKGLRDGLGDKADKMIIADKSYEVSDPSIDSQIVALRDSGADTFFSWAAPKGSAQAIRKVGEIGWKPRFFLANVSTSVAGVLKPAGLENAKGIISSAYLKDPTDPAWKDDAGIKAWRAFMDKYYPEGDKLNSNNVYGYAVAQTMVQVLKQCGDDLTRENIMKQAASLKDFSSEVMLPGIKINTSPDDFFPIEQMQLMKFDGEAWHLFGDVITGEVGHETTH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 8 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 9 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 10 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 11 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 12 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 13 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 14 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 15 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 16 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 17 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 18 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 19 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 20 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 21 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 22 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 23 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 24 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 25 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 26 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 27 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 28 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 29 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 30 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 31 | 2791355199 | |||
| 32 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 33 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 34 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 35 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 36 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 37 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 38 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 39 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 40 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 41 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 42 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 43 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 44 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 45 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 46 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 47 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 48 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 49 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 50 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 51 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 52 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 53 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 54 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 55 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 56 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 57 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 58 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 59 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 60 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 61 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 62 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 63 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 64 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 65 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 66 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 67 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 68 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 69 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 70 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 71 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 72 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 73 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 74 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 75 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 76 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 77 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 78 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 79 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 80 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 81 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 82 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 83 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 84 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 85 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 86 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 87 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 88 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 89 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 90 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 91 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 92 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 93 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 94 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 95 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 96 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 97 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 98 | 2904699407 | |||
| 99 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 100 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 101 | 2906610324 | |||
| 102 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 103 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 104 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 105 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 106 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 107 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 108 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 109 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 110 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 111 | 2922368715 | |||
| 112 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 113 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 114 | 2922425934 | |||
| 115 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 116 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 117 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 118 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 119 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 120 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 121 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 122 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 123 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 124 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 125 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 126 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 127 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 128 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 129 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 130 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 131 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 132 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 133 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 134 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 135 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 136 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 137 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 138 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 139 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 140 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 141 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 142 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 143 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 144 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 145 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 146 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 147 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 148 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 149 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 150 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 151 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 152 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 153 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 154 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 155 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 156 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 157 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 158 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 159 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 160 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 161 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 162 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 163 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 164 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 165 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 166 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 167 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 168 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 169 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 170 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 171 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 172 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 173 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 174 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 175 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 176 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 177 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 178 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 179 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 180 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 181 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 182 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 183 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 184 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 185 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 186 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 187 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 188 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 189 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 190 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 191 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 193 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 195 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 196 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 198 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 199 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 200 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 202 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 206 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 207 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 209 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 211 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 212 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 214 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 218 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 219 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 220 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 221 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 223 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 224 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 225 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 226 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 227 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 228 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 229 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 230 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 231 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 232 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 233 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 234 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 235 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 236 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 237 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 238 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 239 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 240 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 241 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 242 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 243 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 244 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 245 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 246 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 247 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 248 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 249 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 250 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 251 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 252 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 253 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 254 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 255 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 256 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 257 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 258 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 259 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 260 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 262 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 263 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 264 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 265 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 267 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 268 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 269 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 270 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 271 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 272 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 274 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 275 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 276 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 277 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 278 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 279 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 280 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 281 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 282 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 283 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 284 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 285 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 286 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 287 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 288 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 289 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 290 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 291 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 292 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 293 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 294 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 295 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 296 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 297 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 298 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 299 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 301 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 302 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 303 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 304 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 305 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 306 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 307 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 308 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 309 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 310 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 311 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 312 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 313 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 314 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 315 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 371 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 372 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 373 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 376 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 377 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 381 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 382 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 383 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 384 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 385 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 386 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 387 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 388 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 389 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 390 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 391 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 392 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 393 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 394 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 395 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 396 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 397 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 398 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 399 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 400 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 401 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 402 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 403 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 404 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 405 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 406 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 407 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 408 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 409 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 410 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 411 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 412 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 413 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 414 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 415 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 416 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 417 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 418 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 419 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 420 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 421 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 422 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 423 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 424 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 425 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 426 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 427 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 428 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 429 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 430 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 431 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 432 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 433 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 434 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 435 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 436 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 437 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 438 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 439 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 440 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 441 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 442 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 443 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 444 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 445 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 446 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 447 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 521 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 522 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 523 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 524 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 525 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 526 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 527 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 528 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 529 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 530 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 531 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 532 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 533 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 534 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 535 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 536 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 537 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 538 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 539 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 540 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 541 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 542 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 543 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 544 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 545 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 546 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 548 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 549 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 550 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 551 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 552 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 553 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 554 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 555 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 556 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 557 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 558 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 559 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 560 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 561 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 562 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 563 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 564 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 565 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 566 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 567 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 568 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 569 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 570 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 571 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 572 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 573 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 574 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 575 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 576 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 577 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 578 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 579 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 580 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 581 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 582 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 583 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 584 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 585 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 586 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 587 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 588 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 591 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 594 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 595 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 596 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 597 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 598 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 599 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 600 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 601 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 602 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 603 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 604 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 605 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 606 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 607 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 608 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 609 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 610 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 611 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 612 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 613 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 614 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 615 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 616 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 617 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 618 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 619 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 620 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 621 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 622 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 623 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 624 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 625 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 626 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 627 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 628 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 629 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 630 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 631 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 632 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 633 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 634 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 635 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 636 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 637 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 638 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 639 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 640 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 641 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 642 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 643 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 644 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 645 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 646 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 647 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 648 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 649 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 650 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 651 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 652 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 653 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 654 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 655 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 656 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 657 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 658 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 659 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 660 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 661 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 662 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 663 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 664 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 665 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 666 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 667 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 668 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 669 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 670 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 671 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 672 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 673 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 674 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 675 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 676 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 677 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 678 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 679 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 680 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.93 |
| Metatranscriptomes | 0.62 |
| Isolates | 18.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.5 |
| Nodule | 13.43 |
| Rhizoplane | 5.06 |
| Rhizosphere | 59.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1005163 | 3300000549 | Bacteria | 1666 |
| 2 | LJQas_1007993 | 3300000549 | Bacteria | 1295 |
| 3 | JGI25406J46586_10000081 | 3300003203 | Bacteria | 43450 |
| 4 | JGI25406J46586_10005250 | 3300003203 | Bacteria | 6010 |
| 5 | JGI25406J46586_10008729 | 3300003203 | Bacteria | 4567 |
| 6 | JGI25406J46586_10010371 | 3300003203 | Bacteria | 4136 |
| 7 | JGI25153J46596_10000946 | 3300003215 | Bacteria | 17627 |
| 8 | JGI25153J46596_10001097 | 3300003215 | Bacteria | 16465 |
| 9 | JGI25153J46596_10006710 | 3300003215 | Bacteria | 5781 |
| 10 | JGI25153J46596_10015079 | 3300003215 | Bacteria | 3171 |
| 11 | JGI25404J52841_10000269 | 3300003659 | Bacteria | 6604 |
| 12 | JGI25404J52841_10001487 | 3300003659 | Bacteria | 4136 |
| 13 | JGI25404J52841_10007004 | 3300003659 | Bacteria | 2372 |
| 14 | JGI25405J52794_10012251 | 3300003911 | Bacteria | 1649 |
| 15 | Ga0058861_11933975 | 3300004800 | Bacteria | 1277 |
| 16 | Ga0065165_1002365 | 3300005262 | Bacteria | 16315 |
| 17 | Ga0070658_10015568 | 3300005327 | Bacteria | 6082 |
| 18 | Ga0070658_10033545 | 3300005327 | Bacteria | 4131 |
| 19 | Ga0070683_100006494 | 3300005329 | Bacteria | 9820 |
| 20 | Ga0070683_100088981 | 3300005329 | Bacteria | 2897 |
| 21 | Ga0070683_100138095 | 3300005329 | Bacteria | 2309 |
| 22 | Ga0070683_100282663 | 3300005329 | Bacteria | 1578 |
| 23 | Ga0068869_100029096 | 3300005334 | Bacteria | 3867 |
| 24 | Ga0068869_100039424 | 3300005334 | Bacteria | 3372 |
| 25 | Ga0070666_10080750 | 3300005335 | Bacteria | 2223 |
| 26 | Ga0070680_100001453 | 3300005336 | Bacteria | 17175 |
| 27 | Ga0070680_100008461 | 3300005336 | Bacteria | 7879 |
| 28 | Ga0070680_100009025 | 3300005336 | Bacteria | 7646 |
| 29 | Ga0070680_100020597 | 3300005336 | Bacteria | 5236 |
| 30 | Ga0070680_100023945 | 3300005336 | Bacteria | 4874 |
| 31 | Ga0070680_100124543 | 3300005336 | Bacteria | 2153 |
| 32 | Ga0070680_100211331 | 3300005336 | Bacteria | 1637 |
| 33 | Ga0070680_100261936 | 3300005336 | Bacteria | 1463 |
| 34 | Ga0070682_100050250 | 3300005337 | Bacteria | 2602 |
| 35 | Ga0070682_100163042 | 3300005337 | Bacteria | 1542 |
| 36 | Ga0068868_100147843 | 3300005338 | Bacteria | 1933 |
| 37 | Ga0070660_100012369 | 3300005339 | Bacteria | 6092 |
| 38 | Ga0070660_100016156 | 3300005339 | Bacteria | 5411 |
| 39 | Ga0070691_10058906 | 3300005341 | Bacteria | 1845 |
| 40 | Ga0070661_100042475 | 3300005344 | Bacteria | 3318 |
| 41 | Ga0070661_100072768 | 3300005344 | Bacteria | 2530 |
| 42 | Ga0070668_100013950 | 3300005347 | Bacteria | 6008 |
| 43 | Ga0070668_100133195 | 3300005347 | Bacteria | 1996 |
| 44 | Ga0070668_100185248 | 3300005347 | Bacteria | 1702 |
| 45 | Ga0070671_100010559 | 3300005355 | Bacteria | 7415 |
| 46 | Ga0070671_100046849 | 3300005355 | Bacteria | 3596 |
| 47 | Ga0070674_100008705 | 3300005356 | Bacteria | 6053 |
| 48 | Ga0070688_100047848 | 3300005365 | Bacteria | 2655 |
| 49 | Ga0070659_100107317 | 3300005366 | Bacteria | 2251 |
| 50 | Ga0070659_100158179 | 3300005366 | Bacteria | 1852 |
| 51 | Ga0070709_10001137 | 3300005434 | Bacteria | 14661 |
| 52 | Ga0070709_10025182 | 3300005434 | Bacteria | 3513 |
| 53 | Ga0070709_10040088 | 3300005434 | Bacteria | 2877 |
| 54 | Ga0070709_10059854 | 3300005434 | Bacteria | 2419 |
| 55 | Ga0070709_10129692 | 3300005434 | Bacteria | 1720 |
| 56 | Ga0070714_100007296 | 3300005435 | Bacteria | 8595 |
| 57 | Ga0070714_100018594 | 3300005435 | Bacteria | 5648 |
| 58 | Ga0070714_100064176 | 3300005435 | Bacteria | 3160 |
| 59 | Ga0070714_100154815 | 3300005435 | Bacteria | 2068 |
| 60 | Ga0070714_100160787 | 3300005435 | Bacteria | 2032 |
| 61 | Ga0070714_100319290 | 3300005435 | Bacteria | 1452 |
| 62 | Ga0070713_100004722 | 3300005436 | Bacteria | 9209 |
| 63 | Ga0070713_100011248 | 3300005436 | Bacteria | 6509 |
| 64 | Ga0070713_100038019 | 3300005436 | Bacteria | 3896 |
| 65 | Ga0070713_100049823 | 3300005436 | Bacteria | 3457 |
| 66 | Ga0070713_100145904 | 3300005436 | Bacteria | 2101 |
| 67 | Ga0070713_100168114 | 3300005436 | Bacteria | 1962 |
| 68 | Ga0070713_100189284 | 3300005436 | Bacteria | 1854 |
| 69 | Ga0070710_10001311 | 3300005437 | Bacteria | 11760 |
| 70 | Ga0070710_10015995 | 3300005437 | Bacteria | 3808 |
| 71 | Ga0070710_10028352 | 3300005437 | Bacteria | 2994 |
| 72 | Ga0070711_100006268 | 3300005439 | Bacteria | 7166 |
| 73 | Ga0070711_100007928 | 3300005439 | Bacteria | 6476 |
| 74 | Ga0070711_100010485 | 3300005439 | Bacteria | 5738 |
| 75 | Ga0070711_100020416 | 3300005439 | Bacteria | 4269 |
| 76 | Ga0070711_100025037 | 3300005439 | Bacteria | 3900 |
| 77 | Ga0070711_100031873 | 3300005439 | Bacteria | 3502 |
| 78 | Ga0070711_100037198 | 3300005439 | Bacteria | 3264 |
| 79 | Ga0070711_100191343 | 3300005439 | Bacteria | 1573 |
| 80 | Ga0070700_100071112 | 3300005441 | Bacteria | 2220 |
| 81 | Ga0070663_100004678 | 3300005455 | Bacteria | 8070 |
| 82 | Ga0070663_100012907 | 3300005455 | Bacteria | 5303 |
| 83 | Ga0070663_100017721 | 3300005455 | Bacteria | 4654 |
| 84 | Ga0070663_100040232 | 3300005455 | Bacteria | 3271 |
| 85 | Ga0070663_100044931 | 3300005455 | Bacteria | 3118 |
| 86 | Ga0070663_100076612 | 3300005455 | Bacteria | 2446 |
| 87 | Ga0070678_100016331 | 3300005456 | Bacteria | 4747 |
| 88 | Ga0070678_100121784 | 3300005456 | Bacteria | 2058 |
| 89 | Ga0070662_100065903 | 3300005457 | Bacteria | 2656 |
| 90 | Ga0070662_100080615 | 3300005457 | Bacteria | 2423 |
| 91 | Ga0070681_10000334 | 3300005458 | Bacteria | 38316 |
| 92 | Ga0070681_10006811 | 3300005458 | Bacteria | 11120 |
| 93 | Ga0070681_10007089 | 3300005458 | Bacteria | 10914 |
| 94 | Ga0070681_10033074 | 3300005458 | Bacteria | 5191 |
| 95 | Ga0070681_10036430 | 3300005458 | Bacteria | 4940 |
| 96 | Ga0070681_10049053 | 3300005458 | Bacteria | 4217 |
| 97 | Ga0070681_10057183 | 3300005458 | Bacteria | 3880 |
| 98 | Ga0070681_10085897 | 3300005458 | Bacteria | 3099 |
| 99 | Ga0070681_10089143 | 3300005458 | Bacteria | 3036 |
| 100 | Ga0070681_10227118 | 3300005458 | Bacteria | 1781 |
| 101 | Ga0070706_100085005 | 3300005467 | Bacteria | 2932 |
| 102 | Ga0070707_100090716 | 3300005468 | Bacteria | 2958 |
| 103 | Ga0070698_100071439 | 3300005471 | Bacteria | 3481 |
| 104 | Ga0070699_100016664 | 3300005518 | Bacteria | 6307 |
| 105 | Ga0070679_100005911 | 3300005530 | Bacteria | 11370 |
| 106 | Ga0070679_100014819 | 3300005530 | Bacteria | 7490 |
| 107 | Ga0070679_100042235 | 3300005530 | Bacteria | 4540 |
| 108 | Ga0070679_100213723 | 3300005530 | Bacteria | 1891 |
| 109 | Ga0070679_100251754 | 3300005530 | Bacteria | 1722 |
| 110 | Ga0070684_100007203 | 3300005535 | Bacteria | 8643 |
| 111 | Ga0070684_100034954 | 3300005535 | Bacteria | 4299 |
| 112 | Ga0070684_100056336 | 3300005535 | Bacteria | 3430 |
| 113 | Ga0070684_100192082 | 3300005535 | Bacteria | 1858 |
| 114 | Ga0070697_100002686 | 3300005536 | Bacteria | 13689 |
| 115 | Ga0070697_100128235 | 3300005536 | Bacteria | 2126 |
| 116 | Ga0068853_100014772 | 3300005539 | Bacteria | 6408 |
| 117 | Ga0068853_100023239 | 3300005539 | Bacteria | 5187 |
| 118 | Ga0068853_100044215 | 3300005539 | Bacteria | 3812 |
| 119 | Ga0068853_100044472 | 3300005539 | Bacteria | 3802 |
| 120 | Ga0068853_100078359 | 3300005539 | Bacteria | 2888 |
| 121 | Ga0068853_100094862 | 3300005539 | Bacteria | 2630 |
| 122 | Ga0068853_100202940 | 3300005539 | Bacteria | 1805 |
| 123 | Ga0068853_100213461 | 3300005539 | Bacteria | 1760 |
| 124 | Ga0070672_100060534 | 3300005543 | Bacteria | 2981 |
| 125 | Ga0070695_100004100 | 3300005545 | Bacteria | 8516 |
| 126 | Ga0070695_100141411 | 3300005545 | Bacteria | 1669 |
| 127 | Ga0070696_100102446 | 3300005546 | Bacteria | 2053 |
| 128 | Ga0070693_100036628 | 3300005547 | Bacteria | 2729 |
| 129 | Ga0070693_100069677 | 3300005547 | Bacteria | 2067 |
| 130 | Ga0070665_100026819 | 3300005548 | Bacteria | 5804 |
| 131 | Ga0070665_100047689 | 3300005548 | Bacteria | 4299 |
| 132 | Ga0070665_100059932 | 3300005548 | Bacteria | 3815 |
| 133 | Ga0070665_100151430 | 3300005548 | Bacteria | 2322 |
| 134 | Ga0070665_100200140 | 3300005548 | Bacteria | 1998 |
| 135 | Ga0070665_100232941 | 3300005548 | Bacteria | 1842 |
| 136 | Ga0070665_100308563 | 3300005548 | Bacteria | 1586 |
| 137 | Ga0070704_100145858 | 3300005549 | Bacteria | 1854 |
| 138 | Ga0068855_100010185 | 3300005563 | Bacteria | 11331 |
| 139 | Ga0068855_100016594 | 3300005563 | Bacteria | 8856 |
| 140 | Ga0068855_100065209 | 3300005563 | Bacteria | 4246 |
| 141 | Ga0068855_100093726 | 3300005563 | Bacteria | 3463 |
| 142 | Ga0068855_100188478 | 3300005563 | Bacteria | 2328 |
| 143 | Ga0068855_100279671 | 3300005563 | Bacteria | 1854 |
| 144 | Ga0068855_100281991 | 3300005563 | Bacteria | 1844 |
| 145 | Ga0068855_100324296 | 3300005563 | Bacteria | 1701 |
| 146 | Ga0070664_100036128 | 3300005564 | Bacteria | 4150 |
| 147 | Ga0068857_100006806 | 3300005577 | Bacteria | 9841 |
| 148 | Ga0068854_100188544 | 3300005578 | Bacteria | 1615 |
| 149 | Ga0068854_100218555 | 3300005578 | Bacteria | 1506 |
| 150 | Ga0068856_100000137 | 3300005614 | Bacteria | 73762 |
| 151 | Ga0068856_100105225 | 3300005614 | Bacteria | 2816 |
| 152 | Ga0068856_100333703 | 3300005614 | Bacteria | 1534 |
| 153 | Ga0070702_100065769 | 3300005615 | Bacteria | 2124 |
| 154 | Ga0068852_100015965 | 3300005616 | Bacteria | 5845 |
| 155 | Ga0068852_100020420 | 3300005616 | Bacteria | 5268 |
| 156 | Ga0068852_100028224 | 3300005616 | Bacteria | 4588 |
| 157 | Ga0068852_100212311 | 3300005616 | Bacteria | 1837 |
| 158 | Ga0068859_100115759 | 3300005617 | Bacteria | 2745 |
| 159 | Ga0068859_100448322 | 3300005617 | Bacteria | 1386 |
| 160 | Ga0068864_100034489 | 3300005618 | Bacteria | 4305 |
| 161 | Ga0068864_100056367 | 3300005618 | Bacteria | 3395 |
| 162 | Ga0068861_100199288 | 3300005719 | Bacteria | 1679 |
| 163 | Ga0068851_10020979 | 3300005834 | Bacteria | 3169 |
| 164 | Ga0068858_100057565 | 3300005842 | Bacteria | 3592 |
| 165 | Ga0068858_100099558 | 3300005842 | Bacteria | 2710 |
| 166 | Ga0068860_100004689 | 3300005843 | Bacteria | 13947 |
| 167 | Ga0068860_100005520 | 3300005843 | Bacteria | 12804 |
| 168 | Ga0068862_100088228 | 3300005844 | Bacteria | 2698 |
| 169 | Ga0068862_100105231 | 3300005844 | Bacteria | 2473 |
| 170 | Ga0068862_100126218 | 3300005844 | Bacteria | 2259 |
| 171 | Ga0068862_100131689 | 3300005844 | Bacteria | 2212 |
| 172 | Ga0068862_100282963 | 3300005844 | Bacteria | 1520 |
| 173 | Ga0081455_10000763 | 3300005937 | Bacteria | 41769 |
| 174 | Ga0081455_10003860 | 3300005937 | Bacteria | 17086 |
| 175 | Ga0081455_10004479 | 3300005937 | Bacteria | 15634 |
| 176 | Ga0081455_10006164 | 3300005937 | Bacteria | 12931 |
| 177 | Ga0081455_10006808 | 3300005937 | Bacteria | 12185 |
| 178 | Ga0081455_10010534 | 3300005937 | Bacteria | 9369 |
| 179 | Ga0081455_10017893 | 3300005937 | Bacteria | 6773 |
| 180 | Ga0081455_10037055 | 3300005937 | Bacteria | 4335 |
| 181 | Ga0081455_10037166 | 3300005937 | Bacteria | 4328 |
| 182 | Ga0081455_10063174 | 3300005937 | Bacteria | 3108 |
| 183 | Ga0081455_10078440 | 3300005937 | Bacteria | 2714 |
| 184 | Ga0081540_1001487 | 3300005983 | Bacteria | 20239 |
| 185 | Ga0081540_1002682 | 3300005983 | Bacteria | 14479 |
| 186 | Ga0081540_1003332 | 3300005983 | Bacteria | 12739 |
| 187 | Ga0081540_1003389 | 3300005983 | Bacteria | 12636 |
| 188 | Ga0081540_1003768 | 3300005983 | Bacteria | 11873 |
| 189 | Ga0081540_1004916 | 3300005983 | Bacteria | 10063 |
| 190 | Ga0081540_1006034 | 3300005983 | Bacteria | 8913 |
| 191 | Ga0081540_1006810 | 3300005983 | Bacteria | 8257 |
| 192 | Ga0081540_1010678 | 3300005983 | Bacteria | 6194 |
| 193 | Ga0081540_1011165 | 3300005983 | Bacteria | 6028 |
| 194 | Ga0081540_1012123 | 3300005983 | Bacteria | 5701 |
| 195 | Ga0081540_1013542 | 3300005983 | Bacteria | 5295 |
| 196 | Ga0081540_1013655 | 3300005983 | Bacteria | 5266 |
| 197 | Ga0081540_1026650 | 3300005983 | Bacteria | 3292 |
| 198 | Ga0081540_1028625 | 3300005983 | Bacteria | 3124 |
| 199 | Ga0081540_1028785 | 3300005983 | Bacteria | 3110 |
| 200 | Ga0081540_1032911 | 3300005983 | Bacteria | 2822 |
| 201 | Ga0081540_1036933 | 3300005983 | Bacteria | 2597 |
| 202 | Ga0081540_1043566 | 3300005983 | Bacteria | 2300 |
| 203 | Ga0081540_1045754 | 3300005983 | Bacteria | 2218 |
| 204 | Ga0081540_1045808 | 3300005983 | Bacteria | 2216 |
| 205 | Ga0081539_10000157 | 3300005985 | Bacteria | 158278 |
| 206 | Ga0081539_10000461 | 3300005985 | Bacteria | 86158 |
| 207 | Ga0081539_10000498 | 3300005985 | Bacteria | 82216 |
| 208 | Ga0081539_10006394 | 3300005985 | Bacteria | 11332 |
| 209 | Ga0081539_10010685 | 3300005985 | Bacteria | 7401 |
| 210 | Ga0081539_10027357 | 3300005985 | Bacteria | 3614 |
| 211 | Ga0081539_10031508 | 3300005985 | Bacteria | 3266 |
| 212 | Ga0081539_10044031 | 3300005985 | Bacteria | 2580 |
| 213 | Ga0081539_10078330 | 3300005985 | Bacteria | 1745 |
| 214 | Ga0070717_10001987 | 3300006028 | Bacteria | 14301 |
| 215 | Ga0070717_10012926 | 3300006028 | Bacteria | 6377 |
| 216 | Ga0070717_10017205 | 3300006028 | Bacteria | 5619 |
| 217 | Ga0070717_10018197 | 3300006028 | Bacteria | 5483 |
| 218 | Ga0070717_10285649 | 3300006028 | Bacteria | 1464 |
| 219 | Ga0075365_10036401 | 3300006038 | Bacteria | 3188 |
| 220 | Ga0075365_10086729 | 3300006038 | Bacteria | 2127 |
| 221 | Ga0075365_10095798 | 3300006038 | Bacteria | 2027 |
| 222 | Ga0075368_10024474 | 3300006042 | Bacteria | 2313 |
| 223 | Ga0075368_10028024 | 3300006042 | Bacteria | 2175 |
| 224 | Ga0075363_100060782 | 3300006048 | Bacteria | 2035 |
| 225 | Ga0075363_100123093 | 3300006048 | Bacteria | 1450 |
| 226 | Ga0075364_10035769 | 3300006051 | Bacteria | 3210 |
| 227 | Ga0075364_10038215 | 3300006051 | Bacteria | 3110 |
| 228 | Ga0075364_10071813 | 3300006051 | Bacteria | 2280 |
| 229 | Ga0075364_10133529 | 3300006051 | Bacteria | 1667 |
| 230 | Ga0075364_10187394 | 3300006051 | Bacteria | 1401 |
| 231 | Ga0070715_10022143 | 3300006163 | Bacteria | 2474 |
| 232 | Ga0070716_100016735 | 3300006173 | Bacteria | 3789 |
| 233 | Ga0070716_100071765 | 3300006173 | Bacteria | 2036 |
| 234 | Ga0070712_100005053 | 3300006175 | Bacteria | 8169 |
| 235 | Ga0070712_100012567 | 3300006175 | Bacteria | 5384 |
| 236 | Ga0070712_100020530 | 3300006175 | Bacteria | 4323 |
| 237 | Ga0070712_100127313 | 3300006175 | Bacteria | 1926 |
| 238 | Ga0075362_10006528 | 3300006177 | Bacteria | 4355 |
| 239 | Ga0075367_10036930 | 3300006178 | Bacteria | 2836 |
| 240 | Ga0075367_10037202 | 3300006178 | Bacteria | 2827 |
| 241 | Ga0075367_10063200 | 3300006178 | Bacteria | 2213 |
| 242 | Ga0075369_10002161 | 3300006186 | Bacteria | 6949 |
| 243 | Ga0075369_10043684 | 3300006186 | Bacteria | 1924 |
| 244 | Ga0097621_100026198 | 3300006237 | Bacteria | 4571 |
| 245 | Ga0097621_100290353 | 3300006237 | Bacteria | 1442 |
| 246 | Ga0075370_10056246 | 3300006353 | Bacteria | 2236 |
| 247 | Ga0075370_10124613 | 3300006353 | Bacteria | 1501 |
| 248 | Ga0068871_100053850 | 3300006358 | Bacteria | 3263 |
| 249 | Ga0075434_100026575 | 3300006871 | Bacteria | 5672 |
| 250 | Ga0075434_100059277 | 3300006871 | Bacteria | 3805 |
| 251 | Ga0075436_100000818 | 3300006914 | Bacteria | 20692 |
| 252 | Ga0075436_100200315 | 3300006914 | Bacteria | 1414 |
| 253 | Ga0097620_100115762 | 3300006931 | Bacteria | 2745 |
| 254 | Ga0097620_100448327 | 3300006931 | Bacteria | 1386 |
| 255 | Ga0099824_1022298 | 3300006942 | Bacteria | 4205 |
| 256 | Ga0099822_1000541 | 3300006943 | Bacteria | 35996 |
| 257 | Ga0075435_100211501 | 3300007076 | Bacteria | 1646 |
| 258 | Ga0075435_100289587 | 3300007076 | Bacteria | 1399 |
| 259 | Ga0099794_10001086 | 3300007265 | Bacteria | 9307 |
| 260 | Ga0099794_10041225 | 3300007265 | Bacteria | 2198 |
| 261 | Ga0099794_10044158 | 3300007265 | Bacteria | 2129 |
| 262 | Ga0099795_10031241 | 3300007788 | Bacteria | 1832 |
| 263 | Ga0099795_10034527 | 3300007788 | Bacteria | 1762 |
| 264 | Ga0105240_10003976 | 3300009093 | Bacteria | 22811 |
| 265 | Ga0105240_10004565 | 3300009093 | Bacteria | 21001 |
| 266 | Ga0105240_10005539 | 3300009093 | Bacteria | 18804 |
| 267 | Ga0105240_10018312 | 3300009093 | Bacteria | 9413 |
| 268 | Ga0105240_10063527 | 3300009093 | Bacteria | 4593 |
| 269 | Ga0105240_10065154 | 3300009093 | Bacteria | 4524 |
| 270 | Ga0105240_10067861 | 3300009093 | Bacteria | 4419 |
| 271 | Ga0105240_10092667 | 3300009093 | Bacteria | 3689 |
| 272 | Ga0105240_10101428 | 3300009093 | Bacteria | 3500 |
| 273 | Ga0111539_10100579 | 3300009094 | Bacteria | 3395 |
| 274 | Ga0105245_10137830 | 3300009098 | Bacteria | 2295 |
| 275 | Ga0105247_10016302 | 3300009101 | Bacteria | 4451 |
| 276 | Ga0105247_10072239 | 3300009101 | Bacteria | 2159 |
| 277 | Ga0105243_10083696 | 3300009148 | Bacteria | 2611 |
| 278 | Ga0105241_10047810 | 3300009174 | Bacteria | 3254 |
| 279 | Ga0105241_10133754 | 3300009174 | Bacteria | 2011 |
| 280 | Ga0105242_10035665 | 3300009176 | Bacteria | 3988 |
| 281 | Ga0105248_10052124 | 3300009177 | Bacteria | 4592 |
| 282 | Ga0105248_10295530 | 3300009177 | Bacteria | 1824 |
| 283 | Ga0105237_10008293 | 3300009545 | Bacteria | 11279 |
| 284 | Ga0105237_10012769 | 3300009545 | Bacteria | 8834 |
| 285 | Ga0105237_10028530 | 3300009545 | Bacteria | 5683 |
| 286 | Ga0105237_10034905 | 3300009545 | Bacteria | 5090 |
| 287 | Ga0105237_10062821 | 3300009545 | Bacteria | 3713 |
| 288 | Ga0105237_10091803 | 3300009545 | Bacteria | 3026 |
| 289 | Ga0105237_10108190 | 3300009545 | Bacteria | 2772 |
| 290 | Ga0105238_10001848 | 3300009551 | Bacteria | 21222 |
| 291 | Ga0105238_10008924 | 3300009551 | Bacteria | 10035 |
| 292 | Ga0105238_10069691 | 3300009551 | Bacteria | 3517 |
| 293 | Ga0105238_10126795 | 3300009551 | Bacteria | 2531 |
| 294 | Ga0105238_10147307 | 3300009551 | Bacteria | 2330 |
| 295 | Ga0105238_10174752 | 3300009551 | Bacteria | 2124 |
| 296 | Ga0105249_10030655 | 3300009553 | Bacteria | 4863 |
| 297 | Ga0099796_10015701 | 3300010159 | Bacteria | 2219 |
| 298 | Ga0099796_10025862 | 3300010159 | Bacteria | 1858 |
| 299 | Ga0099796_10034029 | 3300010159 | Bacteria | 1681 |
| 300 | Ga0099796_10047678 | 3300010159 | Bacteria | 1475 |
| 301 | Ga0105239_10002860 | 3300010375 | Bacteria | 21608 |
| 302 | Ga0105239_10005709 | 3300010375 | Bacteria | 14530 |
| 303 | Ga0105239_10023763 | 3300010375 | Bacteria | 6749 |
| 304 | Ga0105239_10025364 | 3300010375 | Bacteria | 6527 |
| 305 | Ga0105239_10074969 | 3300010375 | Bacteria | 3720 |
| 306 | Ga0105239_10079453 | 3300010375 | Bacteria | 3610 |
| 307 | Ga0105239_10225081 | 3300010375 | Bacteria | 2104 |
| 308 | Ga0105239_10244105 | 3300010375 | Bacteria | 2016 |
| 309 | Ga0105246_10021293 | 3300011119 | Bacteria | 4171 |
| 310 | Ga0157371_10008618 | 3300013102 | Bacteria | 8099 |
| 311 | Ga0157370_10009093 | 3300013104 | Bacteria | 10655 |
| 312 | Ga0157370_10077342 | 3300013104 | Bacteria | 3135 |
| 313 | Ga0157370_10080805 | 3300013104 | Bacteria | 3061 |
| 314 | Ga0157370_10113934 | 3300013104 | Bacteria | 2526 |
| 315 | Ga0157369_10005973 | 3300013105 | Bacteria | 14139 |
| 316 | Ga0157369_10006548 | 3300013105 | Bacteria | 13480 |
| 317 | Ga0157369_10012428 | 3300013105 | Bacteria | 9664 |
| 318 | Ga0157374_10043720 | 3300013296 | Bacteria | 4139 |
| 319 | Ga0157374_10081460 | 3300013296 | Bacteria | 3072 |
| 320 | Ga0157374_10236546 | 3300013296 | Bacteria | 1795 |
| 321 | Ga0157378_10242799 | 3300013297 | Bacteria | 1721 |
| 322 | Ga0157378_10287767 | 3300013297 | Bacteria | 1586 |
| 323 | Ga0163162_10039795 | 3300013306 | Bacteria | 4698 |
| 324 | Ga0163162_10054876 | 3300013306 | Bacteria | 4009 |
| 325 | Ga0163162_10083787 | 3300013306 | Bacteria | 3263 |
| 326 | Ga0163162_10105789 | 3300013306 | Bacteria | 2908 |
| 327 | Ga0157372_10139778 | 3300013307 | Bacteria | 2789 |
| 328 | Ga0157372_10169325 | 3300013307 | Bacteria | 2527 |
| 329 | Ga0157372_10300846 | 3300013307 | Bacteria | 1866 |
| 330 | Ga0157372_10323711 | 3300013307 | Bacteria | 1795 |
| 331 | Ga0157375_10062338 | 3300013308 | Bacteria | 3705 |
| 332 | Ga0157375_10075145 | 3300013308 | Bacteria | 3403 |
| 333 | Ga0157375_10283338 | 3300013308 | Bacteria | 1820 |
| 334 | Ga0163163_10032096 | 3300014325 | Bacteria | 5073 |
| 335 | Ga0163163_10032957 | 3300014325 | Bacteria | 5007 |
| 336 | Ga0163163_10035053 | 3300014325 | Bacteria | 4865 |
| 337 | Ga0163163_10043559 | 3300014325 | Bacteria | 4400 |
| 338 | Ga0163163_10055746 | 3300014325 | Bacteria | 3906 |
| 339 | Ga0157380_10104142 | 3300014326 | Bacteria | 2369 |
| 340 | Ga0182008_10000392 | 3300014497 | Bacteria | 33955 |
| 341 | Ga0157379_10181050 | 3300014968 | Bacteria | 1904 |
| 342 | Ga0157379_10206082 | 3300014968 | Bacteria | 1779 |
| 343 | Ga0157376_10075664 | 3300014969 | Bacteria | 2874 |
| 344 | Ga0157376_10101065 | 3300014969 | Bacteria | 2519 |
| 345 | Ga0157376_10284137 | 3300014969 | Bacteria | 1559 |
| 346 | Ga0206356_11666168 | 3300020070 | Bacteria | 2767 |
| 347 | Ga0154015_1059841 | 3300020610 | Bacteria | 1907 |
| 348 | Ga0214544_1000011 | 3300021320 | Bacteria | 262952 |
| 349 | Ga0214542_1000009 | 3300021321 | Bacteria | 262861 |
| 350 | Ga0214545_1000007 | 3300021324 | Bacteria | 262984 |
| 351 | Ga0214543_1000020 | 3300021327 | Bacteria | 262861 |
| 352 | Ga0213874_10016822 | 3300021377 | Bacteria | 1954 |
| 353 | Ga0213876_10000505 | 3300021384 | Bacteria | 30368 |
| 354 | Ga0213876_10003691 | 3300021384 | Bacteria | 8687 |
| 355 | Ga0213876_10005094 | 3300021384 | Bacteria | 7245 |
| 356 | Ga0213875_10006397 | 3300021388 | Bacteria | 6189 |
| 357 | Ga0213871_10005083 | 3300021441 | Bacteria | 2687 |
| 358 | Ga0209148_1000300 | 3300025254 | Bacteria | 71458 |
| 359 | Ga0209233_1008056 | 3300025261 | Bacteria | 3290 |
| 360 | Ga0209233_1009149 | 3300025261 | Bacteria | 3027 |
| 361 | Ga0209233_1017786 | 3300025261 | Bacteria | 1928 |
| 362 | Ga0209455_1002020 | 3300025272 | Bacteria | 8284 |
| 363 | Ga0209455_1018117 | 3300025272 | Bacteria | 1455 |
| 364 | Ga0209564_1002404 | 3300025295 | Bacteria | 14939 |
| 365 | Ga0209758_1001864 | 3300025297 | Bacteria | 23116 |
| 366 | Ga0209758_1004355 | 3300025297 | Bacteria | 11860 |
| 367 | Ga0209758_1005849 | 3300025297 | Bacteria | 9184 |
| 368 | Ga0209758_1036184 | 3300025297 | Bacteria | 1932 |
| 369 | Ga0209758_1056617 | 3300025297 | Bacteria | 1323 |
| 370 | Ga0207426_1003391 | 3300025302 | Bacteria | 8727 |
| 371 | Ga0209257_1003528 | 3300025304 | Bacteria | 13303 |
| 372 | Ga0207697_10054805 | 3300025315 | Bacteria | 1653 |
| 373 | Ga0207656_10002790 | 3300025321 | Bacteria | 5934 |
| 374 | Ga0207692_10000103 | 3300025898 | Bacteria | 24933 |
| 375 | Ga0207692_10042096 | 3300025898 | Bacteria | 2265 |
| 376 | Ga0207710_10041804 | 3300025900 | Bacteria | 2034 |
| 377 | Ga0207688_10045802 | 3300025901 | Bacteria | 2440 |
| 378 | Ga0207680_10209214 | 3300025903 | Bacteria | 1333 |
| 379 | Ga0207647_10053435 | 3300025904 | Bacteria | 2489 |
| 380 | Ga0207647_10060038 | 3300025904 | Bacteria | 2325 |
| 381 | Ga0207647_10086530 | 3300025904 | Bacteria | 1873 |
| 382 | Ga0207685_10008782 | 3300025905 | Bacteria | 2900 |
| 383 | Ga0207699_10003630 | 3300025906 | Bacteria | 7376 |
| 384 | Ga0207699_10019947 | 3300025906 | Bacteria | 3585 |
| 385 | Ga0207699_10036754 | 3300025906 | Bacteria | 2794 |
| 386 | Ga0207699_10059907 | 3300025906 | Bacteria | 2283 |
| 387 | Ga0207699_10168253 | 3300025906 | Bacteria | 1464 |
| 388 | Ga0207645_10097546 | 3300025907 | Bacteria | 1894 |
| 389 | Ga0207643_10047938 | 3300025908 | Bacteria | 2419 |
| 390 | Ga0207643_10121257 | 3300025908 | Bacteria | 1549 |
| 391 | Ga0207705_10036015 | 3300025909 | Bacteria | 3542 |
| 392 | Ga0207705_10090067 | 3300025909 | Bacteria | 2245 |
| 393 | Ga0207684_10072801 | 3300025910 | Bacteria | 2918 |
| 394 | Ga0207654_10033436 | 3300025911 | Bacteria | 2851 |
| 395 | Ga0207654_10042159 | 3300025911 | Bacteria | 2581 |
| 396 | Ga0207654_10152138 | 3300025911 | Bacteria | 1486 |
| 397 | Ga0207707_10000134 | 3300025912 | Bacteria | 77031 |
| 398 | Ga0207707_10000143 | 3300025912 | Bacteria | 74226 |
| 399 | Ga0207707_10000613 | 3300025912 | Bacteria | 35676 |
| 400 | Ga0207707_10006061 | 3300025912 | Bacteria | 10577 |
| 401 | Ga0207707_10009454 | 3300025912 | Bacteria | 8452 |
| 402 | Ga0207707_10030486 | 3300025912 | Bacteria | 4718 |
| 403 | Ga0207707_10031981 | 3300025912 | Bacteria | 4606 |
| 404 | Ga0207707_10075781 | 3300025912 | Bacteria | 2936 |
| 405 | Ga0207707_10088754 | 3300025912 | Bacteria | 2701 |
| 406 | Ga0207707_10101835 | 3300025912 | Bacteria | 2510 |
| 407 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 408 | Ga0207695_10000478 | 3300025913 | Bacteria | 86076 |
| 409 | Ga0207695_10009613 | 3300025913 | Bacteria | 11939 |
| 410 | Ga0207695_10051447 | 3300025913 | Bacteria | 4326 |
| 411 | Ga0207695_10081064 | 3300025913 | Bacteria | 3285 |
| 412 | Ga0207695_10084884 | 3300025913 | Bacteria | 3196 |
| 413 | Ga0207695_10166308 | 3300025913 | Bacteria | 2134 |
| 414 | Ga0207695_10170178 | 3300025913 | Bacteria | 2104 |
| 415 | Ga0207695_10215991 | 3300025913 | Bacteria | 1827 |
| 416 | Ga0207671_10005733 | 3300025914 | Bacteria | 11323 |
| 417 | Ga0207671_10008011 | 3300025914 | Bacteria | 9044 |
| 418 | Ga0207671_10034723 | 3300025914 | Bacteria | 3746 |
| 419 | Ga0207671_10053909 | 3300025914 | Bacteria | 2980 |
| 420 | Ga0207671_10131498 | 3300025914 | Bacteria | 1921 |
| 421 | Ga0207671_10144607 | 3300025914 | Bacteria | 1834 |
| 422 | Ga0207671_10156990 | 3300025914 | Bacteria | 1760 |
| 423 | Ga0207671_10166660 | 3300025914 | Bacteria | 1709 |
| 424 | Ga0207693_10001154 | 3300025915 | Bacteria | 23558 |
| 425 | Ga0207693_10012236 | 3300025915 | Bacteria | 6934 |
| 426 | Ga0207693_10024298 | 3300025915 | Bacteria | 4811 |
| 427 | Ga0207693_10033293 | 3300025915 | Bacteria | 4067 |
| 428 | Ga0207693_10033987 | 3300025915 | Bacteria | 4023 |
| 429 | Ga0207693_10156289 | 3300025915 | Bacteria | 1794 |
| 430 | Ga0207663_10000733 | 3300025916 | Bacteria | 14676 |
| 431 | Ga0207663_10008134 | 3300025916 | Bacteria | 5467 |
| 432 | Ga0207663_10010912 | 3300025916 | Bacteria | 4854 |
| 433 | Ga0207663_10025363 | 3300025916 | Bacteria | 3426 |
| 434 | Ga0207663_10038827 | 3300025916 | Bacteria | 2881 |
| 435 | Ga0207663_10088076 | 3300025916 | Bacteria | 2052 |
| 436 | Ga0207663_10098560 | 3300025916 | Bacteria | 1957 |
| 437 | Ga0207663_10160246 | 3300025916 | Bacteria | 1587 |
| 438 | Ga0207660_10001451 | 3300025917 | Bacteria | 15916 |
| 439 | Ga0207660_10047050 | 3300025917 | Bacteria | 3048 |
| 440 | Ga0207660_10047550 | 3300025917 | Bacteria | 3034 |
| 441 | Ga0207660_10050275 | 3300025917 | Bacteria | 2959 |
| 442 | Ga0207657_10003960 | 3300025919 | Bacteria | 15723 |
| 443 | Ga0207657_10220505 | 3300025919 | Bacteria | 1520 |
| 444 | Ga0207649_10097219 | 3300025920 | Bacteria | 1941 |
| 445 | Ga0207649_10116415 | 3300025920 | Bacteria | 1795 |
| 446 | Ga0207652_10008026 | 3300025921 | Bacteria | 8473 |
| 447 | Ga0207652_10018163 | 3300025921 | Bacteria | 5764 |
| 448 | Ga0207652_10024167 | 3300025921 | Bacteria | 5040 |
| 449 | Ga0207652_10045026 | 3300025921 | Bacteria | 3761 |
| 450 | Ga0207652_10101709 | 3300025921 | Bacteria | 2539 |
| 451 | Ga0207652_10133098 | 3300025921 | Bacteria | 2219 |
| 452 | Ga0207652_10200726 | 3300025921 | Bacteria | 1795 |
| 453 | Ga0207646_10208713 | 3300025922 | Bacteria | 1764 |
| 454 | Ga0207681_10148127 | 3300025923 | Bacteria | 1756 |
| 455 | Ga0207694_10003812 | 3300025924 | Bacteria | 11930 |
| 456 | Ga0207694_10027026 | 3300025924 | Bacteria | 4369 |
| 457 | Ga0207694_10031956 | 3300025924 | Bacteria | 4025 |
| 458 | Ga0207694_10057603 | 3300025924 | Bacteria | 3021 |
| 459 | Ga0207694_10065559 | 3300025924 | Bacteria | 2832 |
| 460 | Ga0207694_10105856 | 3300025924 | Bacteria | 2234 |
| 461 | Ga0207694_10150279 | 3300025924 | Bacteria | 1876 |
| 462 | Ga0207694_10157351 | 3300025924 | Bacteria | 1834 |
| 463 | Ga0207687_10083602 | 3300025927 | Bacteria | 2312 |
| 464 | Ga0207687_10103997 | 3300025927 | Bacteria | 2095 |
| 465 | Ga0207687_10198813 | 3300025927 | Bacteria | 1565 |
| 466 | Ga0207700_10007251 | 3300025928 | Bacteria | 6763 |
| 467 | Ga0207700_10011456 | 3300025928 | Bacteria | 5654 |
| 468 | Ga0207700_10018146 | 3300025928 | Bacteria | 4719 |
| 469 | Ga0207700_10032512 | 3300025928 | Bacteria | 3722 |
| 470 | Ga0207700_10051229 | 3300025928 | Bacteria | 3080 |
| 471 | Ga0207700_10086597 | 3300025928 | Bacteria | 2462 |
| 472 | Ga0207700_10124231 | 3300025928 | Bacteria | 2097 |
| 473 | Ga0207700_10137409 | 3300025928 | Bacteria | 2004 |
| 474 | Ga0207664_10002058 | 3300025929 | Bacteria | 13252 |
| 475 | Ga0207664_10020618 | 3300025929 | Bacteria | 4889 |
| 476 | Ga0207664_10069689 | 3300025929 | Bacteria | 2828 |
| 477 | Ga0207664_10091034 | 3300025929 | Bacteria | 2500 |
| 478 | Ga0207664_10119384 | 3300025929 | Bacteria | 2204 |
| 479 | Ga0207664_10119603 | 3300025929 | Bacteria | 2203 |
| 480 | Ga0207664_10254938 | 3300025929 | Bacteria | 1532 |
| 481 | Ga0207644_10262906 | 3300025931 | Bacteria | 1380 |
| 482 | Ga0207690_10144557 | 3300025932 | Bacteria | 1757 |
| 483 | Ga0207690_10168683 | 3300025932 | Bacteria | 1638 |
| 484 | Ga0207706_10079123 | 3300025933 | Bacteria | 2891 |
| 485 | Ga0207706_10123207 | 3300025933 | Bacteria | 2281 |
| 486 | Ga0207686_10021011 | 3300025934 | Bacteria | 3739 |
| 487 | Ga0207686_10038551 | 3300025934 | Bacteria | 2893 |
| 488 | Ga0207686_10088955 | 3300025934 | Bacteria | 2034 |
| 489 | Ga0207709_10013431 | 3300025935 | Bacteria | 4520 |
| 490 | Ga0207669_10007810 | 3300025937 | Bacteria | 4979 |
| 491 | Ga0207669_10023026 | 3300025937 | Bacteria | 3319 |
| 492 | Ga0207665_10000583 | 3300025939 | Bacteria | 24575 |
| 493 | Ga0207665_10009461 | 3300025939 | Bacteria | 6397 |
| 494 | Ga0207665_10022575 | 3300025939 | Bacteria | 4140 |
| 495 | Ga0207665_10036263 | 3300025939 | Bacteria | 3279 |
| 496 | Ga0207665_10112506 | 3300025939 | Bacteria | 1914 |
| 497 | Ga0207691_10110214 | 3300025940 | Bacteria | 2448 |
| 498 | Ga0207691_10198719 | 3300025940 | Bacteria | 1746 |
| 499 | Ga0207711_10109671 | 3300025941 | Bacteria | 2453 |
| 500 | Ga0207711_10158388 | 3300025941 | Bacteria | 2048 |
| 501 | Ga0207689_10047565 | 3300025942 | Bacteria | 3540 |
| 502 | Ga0207661_10000712 | 3300025944 | Bacteria | 21611 |
| 503 | Ga0207661_10034780 | 3300025944 | Bacteria | 3922 |
| 504 | Ga0207661_10084514 | 3300025944 | Bacteria | 2629 |
| 505 | Ga0207679_10046998 | 3300025945 | Bacteria | 3133 |
| 506 | Ga0207679_10096446 | 3300025945 | Bacteria | 2301 |
| 507 | Ga0207667_10010781 | 3300025949 | Bacteria | 10662 |
| 508 | Ga0207667_10053139 | 3300025949 | Bacteria | 4263 |
| 509 | Ga0207667_10092184 | 3300025949 | Bacteria | 3129 |
| 510 | Ga0207667_10092869 | 3300025949 | Bacteria | 3117 |
| 511 | Ga0207667_10160725 | 3300025949 | Bacteria | 2311 |
| 512 | Ga0207667_10232507 | 3300025949 | Bacteria | 1887 |
| 513 | Ga0207667_10255953 | 3300025949 | Bacteria | 1791 |
| 514 | Ga0207667_10373801 | 3300025949 | Bacteria | 1452 |
| 515 | Ga0207667_10412598 | 3300025949 | Bacteria | 1374 |
| 516 | Ga0207712_10000950 | 3300025961 | Bacteria | 20896 |
| 517 | Ga0207712_10010623 | 3300025961 | Bacteria | 5845 |
| 518 | Ga0207712_10167183 | 3300025961 | Bacteria | 1715 |
| 519 | Ga0207668_10015871 | 3300025972 | Bacteria | 4689 |
| 520 | Ga0207668_10017035 | 3300025972 | Bacteria | 4546 |
| 521 | Ga0207668_10079551 | 3300025972 | Bacteria | 2371 |
| 522 | Ga0207640_10061183 | 3300025981 | Bacteria | 2493 |
| 523 | Ga0207677_10082277 | 3300026023 | Bacteria | 2313 |
| 524 | Ga0207703_10061236 | 3300026035 | Bacteria | 3081 |
| 525 | Ga0207703_10113230 | 3300026035 | Bacteria | 2318 |
| 526 | Ga0207639_10003617 | 3300026041 | Bacteria | 10381 |
| 527 | Ga0207639_10107050 | 3300026041 | Bacteria | 2270 |
| 528 | Ga0207639_10130063 | 3300026041 | Bacteria | 2083 |
| 529 | Ga0207639_10135005 | 3300026041 | Bacteria | 2048 |
| 530 | Ga0207678_10015490 | 3300026067 | Bacteria | 6703 |
| 531 | Ga0207678_10022914 | 3300026067 | Bacteria | 5465 |
| 532 | Ga0207678_10062479 | 3300026067 | Bacteria | 3201 |
| 533 | Ga0207702_10000063 | 3300026078 | Bacteria | 123034 |
| 534 | Ga0207702_10106126 | 3300026078 | Bacteria | 2489 |
| 535 | Ga0207676_10044978 | 3300026095 | Bacteria | 3408 |
| 536 | Ga0207676_10136967 | 3300026095 | Bacteria | 2090 |
| 537 | Ga0207676_10155984 | 3300026095 | Bacteria | 1972 |
| 538 | Ga0207674_10008108 | 3300026116 | Bacteria | 12178 |
| 539 | Ga0207674_10115851 | 3300026116 | Bacteria | 2651 |
| 540 | Ga0207674_10119893 | 3300026116 | Bacteria | 2599 |
| 541 | Ga0207675_100156505 | 3300026118 | Bacteria | 2172 |
| 542 | Ga0207675_100223657 | 3300026118 | Bacteria | 1814 |
| 543 | Ga0207675_100241317 | 3300026118 | Bacteria | 1746 |
| 544 | Ga0207683_10038696 | 3300026121 | Bacteria | 4159 |
| 545 | Ga0207683_10064951 | 3300026121 | Bacteria | 3217 |
| 546 | Ga0207683_10108364 | 3300026121 | Bacteria | 2485 |
| 547 | Ga0207698_10015927 | 3300026142 | Bacteria | 5055 |
| 548 | Ga0207698_10019849 | 3300026142 | Bacteria | 4612 |
| 549 | Ga0207698_10023138 | 3300026142 | Bacteria | 4335 |
| 550 | Ga0209589_1000015 | 3300027357 | Bacteria | 225913 |
| 551 | Ga0209489_100015 | 3300027361 | Bacteria | 225913 |
| 552 | Ga0209700_100025 | 3300027363 | Bacteria | 225913 |
| 553 | Ga0209179_1000328 | 3300027512 | Bacteria | 4610 |
| 554 | Ga0209179_1015250 | 3300027512 | Bacteria | 1424 |
| 555 | Ga0209588_1000429 | 3300027671 | Bacteria | 10867 |
| 556 | Ga0209588_1010370 | 3300027671 | Bacteria | 2801 |
| 557 | Ga0209588_1013802 | 3300027671 | Bacteria | 2468 |
| 558 | Ga0209588_1019049 | 3300027671 | Bacteria | 2140 |
| 559 | Ga0209813_10015342 | 3300027866 | Bacteria | 2074 |
| 560 | Ga0207428_10083135 | 3300027907 | Bacteria | 2498 |
| 561 | Ga0268266_10001575 | 3300028379 | Bacteria | 26658 |
| 562 | Ga0268266_10006809 | 3300028379 | Bacteria | 10409 |
| 563 | Ga0268266_10039943 | 3300028379 | Bacteria | 3998 |
| 564 | Ga0268266_10100363 | 3300028379 | Bacteria | 2550 |
| 565 | Ga0268266_10102141 | 3300028379 | Bacteria | 2529 |
| 566 | Ga0268266_10116805 | 3300028379 | Bacteria | 2370 |
| 567 | Ga0268265_10015236 | 3300028380 | Bacteria | 5256 |
| 568 | Ga0268265_10039380 | 3300028380 | Bacteria | 3484 |
| 569 | Ga0268265_10080597 | 3300028380 | Bacteria | 2567 |
| 570 | Ga0268265_10236998 | 3300028380 | Bacteria | 1607 |
| 571 | Ga0268265_10253940 | 3300028380 | Bacteria | 1559 |
| 572 | Ga0268265_10330426 | 3300028380 | Bacteria | 1384 |
| 573 | Ga0268264_10000042 | 3300028381 | Bacteria | 372069 |
| 574 | Ga0268264_10006148 | 3300028381 | Bacteria | 10139 |
| 575 | Ga0268264_10081087 | 3300028381 | Bacteria | 2772 |
| 576 | Ga0268264_10096441 | 3300028381 | Bacteria | 2561 |
| 577 | Ga0307517_10000063 | 3300028786 | Bacteria | 144304 |
| 578 | Ga0307517_10139977 | 3300028786 | Bacteria | 1703 |
| 579 | Ga0307515_10168249 | 3300028794 | Bacteria | 2199 |
| 580 | Ga0307515_10238789 | 3300028794 | Bacteria | 1593 |
| 581 | Ga0307511_10131697 | 3300030521 | Bacteria | 1504 |
| 582 | Ga0265332_10009080 | 3300031238 | Bacteria | 4445 |
| 583 | Ga0265332_10022779 | 3300031238 | Bacteria | 2764 |
| 584 | Ga0265325_10005166 | 3300031241 | Bacteria | 8118 |
| 585 | Ga0265325_10043968 | 3300031241 | Bacteria | 2328 |
| 586 | Ga0265329_10006285 | 3300031242 | Bacteria | 4721 |
| 587 | Ga0265340_10011932 | 3300031247 | Bacteria | 4601 |
| 588 | Ga0265340_10036924 | 3300031247 | Bacteria | 2420 |
| 589 | Ga0265339_10007149 | 3300031249 | Bacteria | 7246 |
| 590 | Ga0265316_10038893 | 3300031344 | Bacteria | 3826 |
| 591 | Ga0265316_10194290 | 3300031344 | Bacteria | 1506 |
| 592 | Ga0307509_10101201 | 3300031507 | Bacteria | 2917 |
| 593 | Ga0307509_10128400 | 3300031507 | Bacteria | 2496 |
| 594 | Ga0307509_10142988 | 3300031507 | Bacteria | 2323 |
| 595 | Ga0307509_10219851 | 3300031507 | Bacteria | 1714 |
| 596 | Ga0307408_100080965 | 3300031548 | Bacteria | 2427 |
| 597 | Ga0265313_10073786 | 3300031595 | Bacteria | 1565 |
| 598 | Ga0265313_10081048 | 3300031595 | Bacteria | 1474 |
| 599 | Ga0307508_10000012 | 3300031616 | Bacteria | 243167 |
| 600 | Ga0307508_10032756 | 3300031616 | Bacteria | 4693 |
| 601 | Ga0307508_10047062 | 3300031616 | Bacteria | 3849 |
| 602 | Ga0307508_10064434 | 3300031616 | Bacteria | 3231 |
| 603 | Ga0307508_10180778 | 3300031616 | Bacteria | 1711 |
| 604 | Ga0265314_10004155 | 3300031711 | Bacteria | 13618 |
| 605 | Ga0265314_10005577 | 3300031711 | Bacteria | 11318 |
| 606 | Ga0265314_10089496 | 3300031711 | Bacteria | 2008 |
| 607 | Ga0265342_10014580 | 3300031712 | Bacteria | 5213 |
| 608 | Ga0265342_10024906 | 3300031712 | Bacteria | 3770 |
| 609 | Ga0265342_10140040 | 3300031712 | Bacteria | 1350 |
| 610 | Ga0307516_10012044 | 3300031730 | Bacteria | 9348 |
| 611 | Ga0307516_10012378 | 3300031730 | Bacteria | 9201 |
| 612 | Ga0307516_10019648 | 3300031730 | Bacteria | 6993 |
| 613 | Ga0307516_10035778 | 3300031730 | Bacteria | 4978 |
| 614 | Ga0307516_10046028 | 3300031730 | Bacteria | 4306 |
| 615 | Ga0307516_10047340 | 3300031730 | Bacteria | 4237 |
| 616 | Ga0307516_10120986 | 3300031730 | Bacteria | 2408 |
| 617 | Ga0307516_10161149 | 3300031730 | Bacteria | 1993 |
| 618 | Ga0307516_10206215 | 3300031730 | Bacteria | 1682 |
| 619 | Ga0307405_10019087 | 3300031731 | Bacteria | 3799 |
| 620 | Ga0307406_10023316 | 3300031901 | Bacteria | 3681 |
| 621 | Ga0307406_10083725 | 3300031901 | Bacteria | 2128 |
| 622 | Ga0307409_100030528 | 3300031995 | Bacteria | 3873 |
| 623 | Ga0307416_100203114 | 3300032002 | Bacteria | 1882 |
| 624 | Ga0307415_100017008 | 3300032126 | Bacteria | 4351 |
| 625 | Ga0307507_10075010 | 3300033179 | Bacteria | 3029 |
| 626 | Ga0307510_10017326 | 3300033180 | Bacteria | 8499 |
| 627 | Ga0307510_10018417 | 3300033180 | Bacteria | 8219 |
| 628 | Ga0307510_10032591 | 3300033180 | Bacteria | 5868 |
| 629 | Ga0307510_10212388 | 3300033180 | Bacteria | 1456 |
| 630 | Ga0315911_1000037 | 3300033442 | Bacteria | 62198 |
| 631 | Ga0373930_0002922 | 3300034816 | Bacteria | 2688 |
| 632 | Ga0373934_0006683 | 3300035086 | Bacteria | 4285 |
| 633 | Ga0373934_0083126 | 3300035086 | Bacteria | 1287 |
| 634 | Ga0373940_0018951 | 3300035088 | Bacteria | 1733 |
| 635 | Ga0373923_0015450 | 3300035111 | Bacteria | 2883 |
| 636 | Ga0373936_0008794 | 3300035113 | Bacteria | 3805 |
| 637 | Ga0373936_0063298 | 3300035113 | Bacteria | 1514 |
| 638 | Ga0373936_0080528 | 3300035113 | Bacteria | 1355 |
| 639 | Ga0373941_0028125 | 3300035115 | Bacteria | 1648 |
| 640 | Ga0373945_0045658 | 3300035116 | Bacteria | 1596 |
| 641 | Ga0373945_0054002 | 3300035116 | Bacteria | 1485 |
| 642 | Ga0373945_0062970 | 3300035116 | Bacteria | 1388 |
| 643 | Ga0373954_0000194 | 3300035118 | Bacteria | 21982 |
| 644 | Ga0373956_0005615 | 3300035119 | Bacteria | 5015 |
| 645 | Ga0373956_0013338 | 3300035119 | Bacteria | 3418 |
| 646 | Ga0373957_0000558 | 3300035120 | Bacteria | 9469 |
| 647 | Ga0373943_0049732 | 3300035170 | Bacteria | 2058 |
| 648 | Ga0373946_0007120 | 3300035171 | Bacteria | 4084 |
| 649 | Ga0373955_0000198 | 3300035172 | Bacteria | 24944 |
| 650 | Ga0373955_0002265 | 3300035172 | Bacteria | 8358 |
| 651 | Ga0373955_0017979 | 3300035172 | Bacteria | 3507 |
| 652 | Ga0373924_0003352 | 3300035410 | Bacteria | 5503 |
| 653 | Ga0373931_0003286 | 3300035691 | Bacteria | 7238 |
| 654 | Ga0373931_0012362 | 3300035691 | Bacteria | 4135 |
| 655 | Ga0373931_0168121 | 3300035691 | Bacteria | 1290 |
| 656 | Ga0373935_0001270 | 3300035692 | Bacteria | 13910 |
| 657 | Ga0373935_0008496 | 3300035692 | Bacteria | 6145 |
| 658 | Ga0373935_0069665 | 3300035692 | Bacteria | 2266 |
| 659 | Ga0373927_0000137 | 3300035695 | Bacteria | 56546 |
| 660 | Ga0373927_0006695 | 3300035695 | Bacteria | 7840 |
| 661 | Ga0373927_0006894 | 3300035695 | Bacteria | 7721 |
| 662 | Ga0373927_0018690 | 3300035695 | Bacteria | 4549 |
| 663 | Ga0373927_0034270 | 3300035695 | Bacteria | 3303 |
| 664 | Ga0373927_0111666 | 3300035695 | Bacteria | 1781 |
| 665 | Ga0373927_0147212 | 3300035695 | Bacteria | 1542 |
| 666 | Ga0373927_0149025 | 3300035695 | Bacteria | 1532 |
| 667 | Ga0373933_0000274 | 3300035724 | Bacteria | 33544 |
| 668 | Ga0373933_0000961 | 3300035724 | Bacteria | 17558 |
| 669 | Ga0373933_0111256 | 3300035724 | Bacteria | 1709 |
| 670 | Ga0373947_0006199 | 3300035725 | Bacteria | 6955 |
| 671 | Ga0373947_0008600 | 3300035725 | Bacteria | 5876 |
| 672 | Ga0373947_0020673 | 3300035725 | Bacteria | 3802 |
| 673 | Ga0373947_0097414 | 3300035725 | Bacteria | 1843 |
| 674 | Ga0373937_0007705 | 3300036401 | Bacteria | 9334 |
| 675 | Ga0373937_0029297 | 3300036401 | Bacteria | 4985 |
| 676 | Ga0373937_0142464 | 3300036401 | Bacteria | 2243 |
| 677 | Ga0373925_0002159 | 3300037068 | Bacteria | 16068 |
| 678 | Ga0373925_0002405 | 3300037068 | Bacteria | 15008 |
| 679 | Ga0373925_0036912 | 3300037068 | Bacteria | 3606 |
| 680 | Ga0373925_0062697 | 3300037068 | Bacteria | 2796 |
| 681 | Ga0373925_0116306 | 3300037068 | Bacteria | 2071 |
| 682 | Ga0373925_0119252 | 3300037068 | Bacteria | 2047 |
| 683 | Ga0373925_0141996 | 3300037068 | Bacteria | 1880 |
| 684 | Ga0395899_0048061 | 3300037312 | Bacteria | 3176 |
| 685 | Ga0395900_0002675 | 3300037418 | Bacteria | 19472 |
| 686 | Ga0395900_0025734 | 3300037418 | Bacteria | 6023 |
| 687 | Ga0395900_0044162 | 3300037418 | Bacteria | 4593 |
| 688 | Ga0395900_0258630 | 3300037418 | Bacteria | 1739 |
| 689 | Ga0395900_0299778 | 3300037418 | Bacteria | 1594 |
| 690 | Ga0395898_0005085 | 3300037466 | Bacteria | 14256 |
| 691 | Ga0395898_0012432 | 3300037466 | Bacteria | 8802 |
| 692 | Ga0395898_0027242 | 3300037466 | Bacteria | 5739 |
| 693 | Ga0395898_0035217 | 3300037466 | Bacteria | 4981 |
| 694 | Ga0395898_0035859 | 3300037466 | Bacteria | 4929 |
| 695 | Ga0395898_0189480 | 3300037466 | Bacteria | 1965 |
| 696 | Ga0395905_0003852 | 3300037471 | Bacteria | 15817 |
| 697 | Ga0395905_0128435 | 3300037471 | Bacteria | 2384 |
| 698 | Ga0436364_0259789 | 3300037853 | Bacteria | 1721 |
| 699 | Ga0395901_0076603 | 3300038443 | Bacteria | 3490 |
| 700 | Ga0395901_0230677 | 3300038443 | Bacteria | 1933 |
| 701 | Ga0395901_0385649 | 3300038443 | Bacteria | 1441 |
| 702 | Ga0436365_0007077 | 3300039437 | Bacteria | 42426 |
| 703 | Ga0436365_0021793 | 3300039437 | Bacteria | 95854 |
| 704 | Ga0436365_0235812 | 3300039437 | Bacteria | 2474 |
| 705 | Ga0436365_0400047 | 3300039437 | Bacteria | 2876 |
| 706 | Ga0436365_0692786 | 3300039437 | Bacteria | 7173 |
| 707 | Ga0436365_0831557 | 3300039437 | Bacteria | 3119 |
| 708 | Ga0436365_0998035 | 3300039437 | Bacteria | 2324 |
| 709 | Ga0436365_1161315 | 3300039437 | Bacteria | 24405 |
| 710 | Ga0436365_1604062 | 3300039437 | Bacteria | 1873 |
| 711 | Ga0436361_0885563 | 3300039447 | Bacteria | 3392 |
| 712 | Ga0436363_0045132 | 3300039450 | Bacteria | 7877 |
| 713 | Ga0436363_0080678 | 3300039450 | Bacteria | 9391 |
| 714 | Ga0436363_0141292 | 3300039450 | Bacteria | 1535 |
| 715 | Ga0436363_0573174 | 3300039450 | Bacteria | 7292 |
| 716 | Ga0436363_0765119 | 3300039450 | Bacteria | 2056 |
| 717 | Ga0436362_0354125 | 3300039453 | Bacteria | 2181 |
| 718 | Ga0436362_0719825 | 3300039453 | Bacteria | 1698 |
| 719 | Ga0436362_0768037 | 3300039453 | Bacteria | 10173 |
| 720 | Ga0451853_3488916 | 3300041512 | Bacteria | 1751 |
| 721 | Ga0451577_0003923 | 3300042876 | Bacteria | 16072 |
| 722 | Ga0466969_0086058 | 3300044656 | Bacteria | 1494 |
| 723 | Ga0466972_0025330 | 3300044658 | Bacteria | 2941 |
| 724 | Ga0466965_0003985 | 3300044683 | Bacteria | 6545 |
| 725 | Ga0466966_0003609 | 3300044684 | Bacteria | 10208 |
| 726 | Ga0466966_0081685 | 3300044684 | Bacteria | 2012 |
| 727 | Ga0466961_0000138 | 3300044693 | Bacteria | 48960 |
| 728 | Ga0466963_0145831 | 3300044694 | Bacteria | 1642 |
| 729 | Ga0466964_0046285 | 3300044706 | Bacteria | 1773 |
| 730 | Ga0466964_0068426 | 3300044706 | Bacteria | 1495 |
| 731 | Ga0466957_0116698 | 3300044842 | Bacteria | 1698 |
| 732 | Ga0466959_0004441 | 3300045049 | Bacteria | 9392 |
| 733 | Ga0466959_0052392 | 3300045049 | Bacteria | 2989 |
| 734 | Ga0466959_0052438 | 3300045049 | Bacteria | 2987 |
| 735 | Ga0466959_0081443 | 3300045049 | Bacteria | 2333 |
| 736 | Ga0466967_0041536 | 3300045976 | Bacteria | 3966 |
| 737 | Ga0466967_0186608 | 3300045976 | Bacteria | 1958 |
| 738 | Ga0495592_0000339 | 3300046454 | Bacteria | 38389 |
| 739 | Ga0495603_0000277 | 3300046455 | Bacteria | 27280 |
| 740 | Ga0495603_0000534 | 3300046455 | Bacteria | 21119 |
| 741 | Ga0495603_0003382 | 3300046455 | Bacteria | 9500 |
| 742 | Ga0495603_0014464 | 3300046455 | Bacteria | 4773 |
| 743 | Ga0495603_0018302 | 3300046455 | Bacteria | 4239 |
| 744 | Ga0495603_0026289 | 3300046455 | Bacteria | 3517 |
| 745 | Ga0495603_0037274 | 3300046455 | Bacteria | 2917 |
| 746 | Ga0495603_0038296 | 3300046455 | Bacteria | 2876 |
| 747 | Ga0495603_0051828 | 3300046455 | Bacteria | 2437 |
| 748 | Ga0495603_0101766 | 3300046455 | Bacteria | 1677 |
| 749 | Ga0495629_0000029 | 3300046459 | Bacteria | 127000 |
| 750 | Ga0495629_0000176 | 3300046459 | Bacteria | 56922 |
| 751 | Ga0495629_0000429 | 3300046459 | Bacteria | 35053 |
| 752 | Ga0495629_0002796 | 3300046459 | Bacteria | 13308 |
| 753 | Ga0495629_0003050 | 3300046459 | Bacteria | 12734 |
| 754 | Ga0495638_0021438 | 3300046460 | Bacteria | 4258 |
| 755 | Ga0495638_0046195 | 3300046460 | Bacteria | 2736 |
| 756 | Ga0495641_0001504 | 3300046461 | Bacteria | 19881 |
| 757 | Ga0495651_0002298 | 3300046462 | Bacteria | 14746 |
| 758 | Ga0495651_0004273 | 3300046462 | Bacteria | 10957 |
| 759 | Ga0495651_0017929 | 3300046462 | Bacteria | 5483 |
| 760 | Ga0495651_0073584 | 3300046462 | Bacteria | 2593 |
| 761 | Ga0495651_0081956 | 3300046462 | Bacteria | 2435 |
| 762 | Ga0495653_0002916 | 3300046463 | Bacteria | 13678 |
| 763 | Ga0495580_0000705 | 3300046472 | Bacteria | 28569 |
| 764 | Ga0495580_0002724 | 3300046472 | Bacteria | 15264 |
| 765 | Ga0495582_0000024 | 3300046473 | Bacteria | 82444 |
| 766 | Ga0495582_0000482 | 3300046473 | Bacteria | 21808 |
| 767 | Ga0495639_0000135 | 3300046475 | Bacteria | 38122 |
| 768 | Ga0495639_0003253 | 3300046475 | Bacteria | 7055 |
| 769 | Ga0495639_0027851 | 3300046475 | Bacteria | 2502 |
| 770 | Ga0495639_0051011 | 3300046475 | Bacteria | 1880 |
| 771 | Ga0495662_0000348 | 3300046476 | Bacteria | 20253 |
| 772 | Ga0495662_0006898 | 3300046476 | Bacteria | 5642 |
| 773 | Ga0495664_0009632 | 3300046477 | Bacteria | 5408 |
| 774 | Ga0495584_0081540 | 3300046491 | Bacteria | 1628 |
| 775 | Ga0495585_0028375 | 3300046492 | Bacteria | 3192 |
| 776 | Ga0495585_0058078 | 3300046492 | Bacteria | 2134 |
| 777 | Ga0495594_0000822 | 3300046499 | Bacteria | 16021 |
| 778 | Ga0495594_0000896 | 3300046499 | Bacteria | 15411 |
| 779 | Ga0495594_0015786 | 3300046499 | Bacteria | 3971 |
| 780 | Ga0495606_0007982 | 3300046507 | Bacteria | 9312 |
| 781 | Ga0495606_0088355 | 3300046507 | Bacteria | 1911 |
| 782 | Ga0495608_0002299 | 3300046511 | Bacteria | 13791 |
| 783 | Ga0495608_0040372 | 3300046511 | Bacteria | 3126 |
| 784 | Ga0495610_0052998 | 3300046512 | Bacteria | 1967 |
| 785 | Ga0495620_0059474 | 3300046515 | Bacteria | 1597 |
| 786 | Ga0495628_0012669 | 3300046516 | Bacteria | 7103 |
| 787 | Ga0495630_0002890 | 3300046517 | Bacteria | 11941 |
| 788 | Ga0495630_0007650 | 3300046517 | Bacteria | 7726 |
| 789 | Ga0495630_0018001 | 3300046517 | Bacteria | 5185 |
| 790 | Ga0495631_0026373 | 3300046518 | Bacteria | 2670 |
| 791 | Ga0495632_0045243 | 3300046519 | Bacteria | 2193 |
| 792 | Ga0495632_0071044 | 3300046519 | Bacteria | 1673 |
| 793 | Ga0495643_0032765 | 3300046522 | Bacteria | 2882 |
| 794 | Ga0495643_0081888 | 3300046522 | Bacteria | 1678 |
| 795 | Ga0495643_0093321 | 3300046522 | Bacteria | 1550 |
| 796 | Ga0495644_0029270 | 3300046523 | Bacteria | 2082 |
| 797 | Ga0495644_0049000 | 3300046523 | Bacteria | 1586 |
| 798 | Ga0495648_0000310 | 3300046524 | Bacteria | 53884 |
| 799 | Ga0495648_0036359 | 3300046524 | Bacteria | 3179 |
| 800 | Ga0495648_0141218 | 3300046524 | Bacteria | 1267 |
| 801 | Ga0495666_0006119 | 3300046526 | Bacteria | 6055 |
| 802 | Ga0495666_0035372 | 3300046526 | Bacteria | 2435 |
| 803 | Ga0495652_0004769 | 3300046529 | Bacteria | 12904 |
| 804 | Ga0495652_0007414 | 3300046529 | Bacteria | 10113 |
| 805 | Ga0495652_0014055 | 3300046529 | Bacteria | 7192 |
| 806 | Ga0495652_0120850 | 3300046529 | Bacteria | 2089 |
| 807 | Ga0495665_0000178 | 3300046531 | Bacteria | 32333 |
| 808 | Ga0495640_0000881 | 3300046533 | Bacteria | 23059 |
| 809 | Ga0495640_0001533 | 3300046533 | Bacteria | 18200 |
| 810 | Ga0495640_0003708 | 3300046533 | Bacteria | 12271 |
| 811 | Ga0495640_0009567 | 3300046533 | Bacteria | 7539 |
| 812 | Ga0495587_0024155 | 3300046536 | Bacteria | 3728 |
| 813 | Ga0495587_0048963 | 3300046536 | Bacteria | 2502 |
| 814 | Ga0495598_0008960 | 3300046537 | Bacteria | 2347 |
| 815 | Ga0495621_0026467 | 3300046539 | Bacteria | 1957 |
| 816 | Ga0495645_0021151 | 3300046543 | Bacteria | 4702 |
| 817 | Ga0495645_0027395 | 3300046543 | Bacteria | 4141 |
| 818 | Ga0495645_0030073 | 3300046543 | Bacteria | 3956 |
| 819 | Ga0495645_0038077 | 3300046543 | Bacteria | 3507 |
| 820 | Ga0495622_0002012 | 3300046557 | Bacteria | 9942 |
| 821 | Ga0495622_0029441 | 3300046557 | Bacteria | 2565 |
| 822 | Ga0495633_0033632 | 3300046558 | Bacteria | 2471 |
| 823 | Ga0495633_0077414 | 3300046558 | Bacteria | 1549 |
| 824 | Ga0495667_0003330 | 3300046559 | Bacteria | 10755 |
| 825 | Ga0495667_0019949 | 3300046559 | Bacteria | 4521 |
| 826 | Ga0495667_0042815 | 3300046559 | Bacteria | 3002 |
| 827 | Ga0495656_0016207 | 3300046615 | Bacteria | 2825 |
| 828 | Ga0495656_0044436 | 3300046615 | Bacteria | 1870 |
| 829 | Ga0495656_0079875 | 3300046615 | Bacteria | 1473 |
| 830 | Ga0495668_0106999 | 3300046616 | Bacteria | 1529 |
| 831 | Ga0495634_0001222 | 3300046642 | Bacteria | 23699 |
| 832 | Ga0495634_0007096 | 3300046642 | Bacteria | 8449 |
| 833 | Ga0495634_0013730 | 3300046642 | Bacteria | 5849 |
| 834 | Ga0495611_0020338 | 3300046648 | Bacteria | 2856 |
| 835 | Ga0495625_0051694 | 3300046660 | Bacteria | 2945 |
| 836 | Ga0495625_0063911 | 3300046660 | Bacteria | 2598 |
| 837 | Ga0495625_0125482 | 3300046660 | Bacteria | 1743 |
| 838 | Ga0495635_0000276 | 3300046663 | Bacteria | 32999 |
| 839 | Ga0495635_0000910 | 3300046663 | Bacteria | 19409 |
| 840 | Ga0495635_0004181 | 3300046663 | Bacteria | 10017 |
| 841 | Ga0495635_0010291 | 3300046663 | Bacteria | 6541 |
| 842 | Ga0495635_0056377 | 3300046663 | Bacteria | 2705 |
| 843 | Ga0495635_0105069 | 3300046663 | Bacteria | 1930 |
| 844 | Ga0495659_0010257 | 3300046664 | Bacteria | 3001 |
| 845 | Ga0495661_0047854 | 3300046665 | Bacteria | 2601 |
| 846 | Ga0495661_0076552 | 3300046665 | Bacteria | 1941 |
| 847 | Ga0495588_0001458 | 3300046674 | Bacteria | 10150 |
| 848 | Ga0495588_0002893 | 3300046674 | Bacteria | 7400 |
| 849 | Ga0495588_0003152 | 3300046674 | Bacteria | 7138 |
| 850 | Ga0495588_0038561 | 3300046674 | Bacteria | 2431 |
| 851 | Ga0495588_0064420 | 3300046674 | Bacteria | 1901 |
| 852 | Ga0495588_0100718 | 3300046674 | Bacteria | 1518 |
| 853 | Ga0495657_0023707 | 3300046675 | Bacteria | 4382 |
| 854 | Ga0495599_0000440 | 3300046678 | Bacteria | 23669 |
| 855 | Ga0495599_0046152 | 3300046678 | Bacteria | 2732 |
| 856 | Ga0495599_0093308 | 3300046678 | Bacteria | 1878 |
| 857 | Ga0495623_0004965 | 3300046679 | Bacteria | 8727 |
| 858 | Ga0495623_0110117 | 3300046679 | Bacteria | 1670 |
| 859 | Ga0495646_0023165 | 3300046680 | Bacteria | 3910 |
| 860 | Ga0495646_0041961 | 3300046680 | Bacteria | 2809 |
| 861 | Ga0495646_0084297 | 3300046680 | Bacteria | 1845 |
| 862 | Ga0495647_0013024 | 3300046681 | Bacteria | 2873 |
| 863 | Ga0495658_0001504 | 3300046683 | Bacteria | 12223 |
| 864 | Ga0495658_0002247 | 3300046683 | Bacteria | 9767 |
| 865 | Ga0495669_0006663 | 3300046684 | Bacteria | 4831 |
| 866 | Ga0495669_0066376 | 3300046684 | Bacteria | 1639 |
| 867 | Ga0495669_0081610 | 3300046684 | Bacteria | 1484 |
| 868 | Ga0495613_0006457 | 3300046689 | Bacteria | 8768 |
| 869 | Ga0495613_0022922 | 3300046689 | Bacteria | 4653 |
| 870 | Ga0495613_0068130 | 3300046689 | Bacteria | 2596 |
| 871 | Ga0495624_0000788 | 3300046690 | Bacteria | 24985 |
| 872 | Ga0495624_0002246 | 3300046690 | Bacteria | 14726 |
| 873 | Ga0495670_0023077 | 3300046691 | Bacteria | 3072 |
| 874 | Ga0495670_0025540 | 3300046691 | Bacteria | 2922 |
| 875 | Ga0495671_0033510 | 3300046692 | Bacteria | 2616 |
| 876 | Ga0495649_0117149 | 3300046694 | Bacteria | 1410 |
| 877 | Ga0495589_0093490 | 3300046794 | Bacteria | 1460 |
| 878 | Ga0495589_0099229 | 3300046794 | Bacteria | 1410 |
| 879 | Ga0495600_0000314 | 3300046809 | Bacteria | 25635 |
| 880 | Ga0495600_0002595 | 3300046809 | Bacteria | 10414 |
| 881 | Ga0495600_0036413 | 3300046809 | Bacteria | 3198 |
| 882 | Ga0495581_0000004 | 3300047315 | Bacteria | 84424 |
| 883 | Ga0495581_0019748 | 3300047315 | Bacteria | 3912 |
| 884 | Ga0495604_0013152 | 3300047317 | Bacteria | 6589 |
| 885 | Ga0495604_0048462 | 3300047317 | Bacteria | 3304 |
| 886 | Ga0495674_0000375 | 3300047319 | Bacteria | 39876 |
| 887 | Ga0495674_0001728 | 3300047319 | Bacteria | 21443 |
| 888 | Ga0495674_0008604 | 3300047319 | Bacteria | 9712 |
| 889 | Ga0495674_0015846 | 3300047319 | Bacteria | 7037 |
| 890 | Ga0495674_0052817 | 3300047319 | Bacteria | 3574 |
| 891 | Ga0495672_0054257 | 3300047320 | Bacteria | 2344 |
| 892 | Ga0495672_0063717 | 3300047320 | Bacteria | 2114 |
| 893 | Ga0495672_0064751 | 3300047320 | Bacteria | 2091 |
| 894 | Ga0495676_0021097 | 3300047321 | Bacteria | 5701 |
| 895 | Ga0495676_0038068 | 3300047321 | Bacteria | 3998 |
| 896 | Ga0495676_0075107 | 3300047321 | Bacteria | 2586 |
| 897 | Ga0495676_0106787 | 3300047321 | Bacteria | 2062 |
| 898 | Ga0495676_0165714 | 3300047321 | Bacteria | 1559 |
| 899 | Ga0495680_0036592 | 3300047322 | Bacteria | 3939 |
| 900 | Ga0495675_0000801 | 3300047444 | Bacteria | 19376 |
| 901 | Ga0495675_0029478 | 3300047444 | Bacteria | 3500 |
| 902 | Ga0495684_0000023 | 3300047471 | Bacteria | 133626 |
| 903 | Ga0495684_0002197 | 3300047471 | Bacteria | 15622 |
| 904 | Ga0495684_0004302 | 3300047471 | Bacteria | 11119 |
| 905 | Ga0495686_0036135 | 3300047472 | Bacteria | 3171 |
| 906 | Ga0495686_0138420 | 3300047472 | Bacteria | 1438 |
| 907 | Ga0495593_0000197 | 3300047673 | Bacteria | 31593 |
| 908 | Ga0495593_0000198 | 3300047673 | Bacteria | 31587 |
| 909 | Ga0495593_0000375 | 3300047673 | Bacteria | 24653 |
| 910 | Ga0495602_0014005 | 3300048088 | Bacteria | 8161 |
| 911 | Ga0495602_0069253 | 3300048088 | Bacteria | 3025 |
| 912 | Ga0495614_0010788 | 3300048089 | Bacteria | 4024 |
| 913 | Ga0495626_0097759 | 3300048091 | Bacteria | 1283 |
| 914 | Ga0496100_0021374 | 3300048903 | Bacteria | 3895 |
| 915 | Ga0496100_0072559 | 3300048903 | Bacteria | 2301 |
| 916 | Ga0496100_0121646 | 3300048903 | Bacteria | 1827 |
| 917 | Ga0496101_0001342 | 3300048904 | Bacteria | 14755 |
| 918 | Ga0496101_0095520 | 3300048904 | Bacteria | 2217 |
| 919 | Ga0496102_0013166 | 3300048905 | Bacteria | 7157 |
| 920 | Ga0496102_0045476 | 3300048905 | Bacteria | 3986 |
| 921 | Ga0496102_0057579 | 3300048905 | Bacteria | 3549 |
| 922 | Ga0496102_0153797 | 3300048905 | Bacteria | 2162 |
| 923 | Ga0496102_0192459 | 3300048905 | Bacteria | 1922 |
| 924 | Ga0496103_0135393 | 3300048906 | Bacteria | 1574 |
| 925 | Ga0496103_0139975 | 3300048906 | Bacteria | 1547 |
| 926 | Ga0496104_0002918 | 3300048907 | Bacteria | 14731 |
| 927 | Ga0496104_0008089 | 3300048907 | Bacteria | 9330 |
| 928 | Ga0496104_0016010 | 3300048907 | Bacteria | 6808 |
| 929 | Ga0496104_0031079 | 3300048907 | Bacteria | 4964 |
| 930 | Ga0496104_0325824 | 3300048907 | Bacteria | 1449 |
| 931 | Ga0496105_0009438 | 3300048908 | Bacteria | 7631 |
| 932 | Ga0496105_0017461 | 3300048908 | Bacteria | 5755 |
| 933 | Ga0496105_0020063 | 3300048908 | Bacteria | 5395 |
| 934 | Ga0496105_0046941 | 3300048908 | Bacteria | 3564 |
| 935 | Ga0496105_0110437 | 3300048908 | Bacteria | 2270 |
| 936 | Ga0496105_0211533 | 3300048908 | Bacteria | 1581 |
| 937 | Ga0496106_0002085 | 3300048909 | Bacteria | 14990 |
| 938 | Ga0496106_0023922 | 3300048909 | Bacteria | 4539 |
| 939 | Ga0496106_0091700 | 3300048909 | Bacteria | 2346 |
| 940 | Ga0496106_0148930 | 3300048909 | Bacteria | 1845 |
| 941 | Ga0496107_0001626 | 3300048910 | Bacteria | 14005 |
| 942 | Ga0496107_0018609 | 3300048910 | Bacteria | 4892 |
| 943 | Ga0496107_0061908 | 3300048910 | Bacteria | 2710 |
| 944 | Ga0496108_0006756 | 3300048911 | Bacteria | 9286 |
| 945 | Ga0496108_0016739 | 3300048911 | Bacteria | 5989 |
| 946 | Ga0496108_0030999 | 3300048911 | Bacteria | 4433 |
| 947 | Ga0496108_0041212 | 3300048911 | Bacteria | 3853 |
| 948 | Ga0496108_0054292 | 3300048911 | Bacteria | 3362 |
| 949 | Ga0496109_0018280 | 3300048912 | Bacteria | 6156 |
| 950 | Ga0496109_0027858 | 3300048912 | Bacteria | 5049 |
| 951 | Ga0496109_0045892 | 3300048912 | Bacteria | 3967 |
| 952 | Ga0496109_0049885 | 3300048912 | Bacteria | 3812 |
| 953 | Ga0496109_0079526 | 3300048912 | Bacteria | 3021 |
| 954 | Ga0496110_0015096 | 3300048913 | Bacteria | 6423 |
| 955 | Ga0496110_0027689 | 3300048913 | Bacteria | 4860 |
| 956 | Ga0496110_0042322 | 3300048913 | Bacteria | 3976 |
| 957 | Ga0496110_0050850 | 3300048913 | Bacteria | 3640 |
| 958 | Ga0496110_0139486 | 3300048913 | Bacteria | 2191 |
| 959 | Ga0496110_0213101 | 3300048913 | Bacteria | 1756 |
| 960 | Ga0496110_0221792 | 3300048913 | Bacteria | 1719 |
| 961 | Ga0496110_0228153 | 3300048913 | Bacteria | 1693 |
| 962 | Ga0496110_0281867 | 3300048913 | Bacteria | 1513 |
| 963 | Ga0496110_0288673 | 3300048913 | Bacteria | 1494 |
| 964 | Ga0496111_0011412 | 3300048914 | Bacteria | 5982 |
| 965 | Ga0496111_0071828 | 3300048914 | Bacteria | 2519 |
| 966 | Ga0496111_0136763 | 3300048914 | Bacteria | 1815 |
| 967 | Ga0496112_0000090 | 3300048915 | Bacteria | 59721 |
| 968 | Ga0496112_0035408 | 3300048915 | Bacteria | 4863 |
| 969 | Ga0496112_0049960 | 3300048915 | Bacteria | 4100 |
| 970 | Ga0496112_0081198 | 3300048915 | Bacteria | 3206 |
| 971 | Ga0496112_0092931 | 3300048915 | Bacteria | 2986 |
| 972 | Ga0496112_0173896 | 3300048915 | Bacteria | 2119 |
| 973 | Ga0496113_0012523 | 3300048916 | Bacteria | 5704 |
| 974 | Ga0496113_0062856 | 3300048916 | Bacteria | 2804 |
| 975 | Ga0496114_0018948 | 3300048917 | Bacteria | 5574 |
| 976 | Ga0496114_0105825 | 3300048917 | Bacteria | 2407 |
| 977 | Ga0496114_0228744 | 3300048917 | Bacteria | 1633 |
| 978 | Ga0496115_0001562 | 3300048918 | Bacteria | 16472 |
| 979 | Ga0496115_0037790 | 3300048918 | Bacteria | 3827 |
| 980 | Ga0496115_0045771 | 3300048918 | Bacteria | 3494 |
| 981 | Ga0496115_0057162 | 3300048918 | Bacteria | 3137 |
| 982 | Ga0496115_0158149 | 3300048918 | Bacteria | 1872 |
| 983 | Ga0496115_0228715 | 3300048918 | Bacteria | 1534 |
| 984 | Ga0496116_0021698 | 3300048919 | Bacteria | 4833 |
| 985 | Ga0496117_0104235 | 3300048920 | Bacteria | 1785 |
| 986 | Ga0496118_0021357 | 3300048921 | Bacteria | 5700 |
| 987 | Ga0496118_0066672 | 3300048921 | Bacteria | 2626 |
| 988 | Ga0496118_0133200 | 3300048921 | Bacteria | 1591 |
| 989 | Ga0496119_0013658 | 3300048922 | Bacteria | 6444 |
| 990 | Ga0496119_0033943 | 3300048922 | Bacteria | 3371 |
| 991 | Ga0496119_0087076 | 3300048922 | Bacteria | 1783 |
| 992 | Ga0496120_0044928 | 3300048923 | Bacteria | 2563 |
| 993 | Ga0496120_0088073 | 3300048923 | Bacteria | 1665 |
| 994 | Ga0496121_0007690 | 3300048924 | Bacteria | 12941 |
| 995 | Ga0496121_0011755 | 3300048924 | Bacteria | 9657 |
| 996 | Ga0496121_0014151 | 3300048924 | Bacteria | 8498 |
| 997 | Ga0496121_0015099 | 3300048924 | Bacteria | 8124 |
| 998 | Ga0496121_0016341 | 3300048924 | Bacteria | 7669 |
| 999 | Ga0496121_0042114 | 3300048924 | Bacteria | 3979 |
| 1000 | Ga0496121_0044377 | 3300048924 | Bacteria | 3835 |
| 1001 | Ga0496121_0076036 | 3300048924 | Bacteria | 2679 |
| 1002 | Ga0496121_0077391 | 3300048924 | Bacteria | 2649 |
| 1003 | Ga0496121_0088415 | 3300048924 | Bacteria | 2429 |
| 1004 | Ga0496121_0090364 | 3300048924 | Bacteria | 2394 |
| 1005 | Ga0496121_0092776 | 3300048924 | Bacteria | 2353 |
| 1006 | Ga0496121_0097939 | 3300048924 | Bacteria | 2271 |
| 1007 | Ga0496121_0098775 | 3300048924 | Bacteria | 2258 |
| 1008 | Ga0496121_0108513 | 3300048924 | Bacteria | 2123 |
| 1009 | Ga0496121_0121590 | 3300048924 | Bacteria | 1971 |
| 1010 | Ga0496122_0105991 | 3300048925 | Bacteria | 1862 |
| 1011 | Ga0496123_0105932 | 3300048926 | Bacteria | 1621 |
| 1012 | Ga0496123_0117135 | 3300048926 | Bacteria | 1507 |
| 1013 | Ga0496125_0000664 | 3300048928 | Bacteria | 57244 |
| 1014 | Ga0496125_0004086 | 3300048928 | Bacteria | 17078 |
| 1015 | Ga0496125_0027901 | 3300048928 | Bacteria | 5107 |
| 1016 | Ga0496125_0049142 | 3300048928 | Bacteria | 3508 |
| 1017 | Ga0496126_0005839 | 3300048929 | Bacteria | 13910 |
| 1018 | Ga0496126_0012671 | 3300048929 | Bacteria | 8627 |
| 1019 | Ga0496126_0016304 | 3300048929 | Bacteria | 7433 |
| 1020 | Ga0496126_0026887 | 3300048929 | Bacteria | 5508 |
| 1021 | Ga0496126_0030015 | 3300048929 | Bacteria | 5158 |
| 1022 | Ga0496126_0047107 | 3300048929 | Bacteria | 3948 |
| 1023 | Ga0496126_0047740 | 3300048929 | Bacteria | 3918 |
| 1024 | Ga0496126_0050615 | 3300048929 | Bacteria | 3784 |
| 1025 | Ga0496126_0056346 | 3300048929 | Bacteria | 3553 |
| 1026 | Ga0496126_0058113 | 3300048929 | Bacteria | 3487 |
| 1027 | Ga0496126_0074424 | 3300048929 | Bacteria | 3016 |
| 1028 | Ga0496126_0167490 | 3300048929 | Bacteria | 1874 |
| 1029 | Ga0496126_0192572 | 3300048929 | Bacteria | 1726 |
| 1030 | Ga0496126_0211892 | 3300048929 | Bacteria | 1631 |
| 1031 | Ga0496126_0218222 | 3300048929 | Bacteria | 1603 |
| 1032 | Ga0496126_0280886 | 3300048929 | Bacteria | 1379 |
| 1033 | Ga0495678_047442 | 3300049459 | Bacteria | 1682 |
| 1034 | Ga0501031_0001791 | 3300049568 | Bacteria | 13478 |
| 1035 | Ga0501031_0048412 | 3300049568 | Bacteria | 2770 |
| 1036 | Ga0501032_0000073 | 3300049569 | Bacteria | 85584 |
| 1037 | Ga0501032_0022837 | 3300049569 | Bacteria | 4333 |
| 1038 | Ga0501032_0058259 | 3300049569 | Bacteria | 2593 |
| 1039 | Ga0501032_0128537 | 3300049569 | Bacteria | 1672 |
| 1040 | Ga0501033_0000136 | 3300049570 | Bacteria | 70952 |
| 1041 | Ga0501033_0084302 | 3300049570 | Bacteria | 2329 |
| 1042 | Ga0501033_0245070 | 3300049570 | Bacteria | 1271 |
| 1043 | Ga0501034_0000251 | 3300049571 | Bacteria | 99406 |
| 1044 | Ga0501036_0000036 | 3300049572 | Bacteria | 87244 |
| 1045 | Ga0501036_0051369 | 3300049572 | Bacteria | 3490 |
| 1046 | Ga0501037_0001715 | 3300049573 | Bacteria | 15897 |
| 1047 | Ga0501038_0000428 | 3300049574 | Bacteria | 36623 |
| 1048 | Ga0501038_0031834 | 3300049574 | Bacteria | 4658 |
| 1049 | Ga0501039_0000273 | 3300049575 | Bacteria | 37431 |
| 1050 | Ga0501039_0085782 | 3300049575 | Bacteria | 2452 |
| 1051 | Ga0501042_0015037 | 3300049578 | Bacteria | 5293 |
| 1052 | Ga0501043_0000165 | 3300049579 | Bacteria | 59980 |
| 1053 | Ga0501043_0002500 | 3300049579 | Bacteria | 15543 |
| 1054 | Ga0501046_0001143 | 3300049580 | Bacteria | 25820 |
| 1055 | Ga0501046_0043332 | 3300049580 | Bacteria | 3583 |
| 1056 | Ga0501046_0047803 | 3300049580 | Bacteria | 3391 |
| 1057 | Ga0501046_0230349 | 3300049580 | Bacteria | 1369 |
| 1058 | Ga0501047_0000340 | 3300049581 | Bacteria | 53278 |
| 1059 | Ga0501047_0096309 | 3300049581 | Bacteria | 2838 |
| 1060 | Ga0501047_0161095 | 3300049581 | Bacteria | 2115 |
| 1061 | Ga0501047_0250276 | 3300049581 | Bacteria | 1620 |
| 1062 | Ga0501048_0004991 | 3300049582 | Bacteria | 10119 |
| 1063 | Ga0501067_0005805 | 3300049583 | Bacteria | 6851 |
| 1064 | Ga0501067_0026256 | 3300049583 | Bacteria | 3227 |
| 1065 | Ga0501067_0027971 | 3300049583 | Bacteria | 3125 |
| 1066 | Ga0501068_0000255 | 3300049584 | Bacteria | 26229 |
| 1067 | Ga0501068_0041667 | 3300049584 | Bacteria | 2760 |
| 1068 | Ga0501069_0008241 | 3300049585 | Bacteria | 5471 |
| 1069 | Ga0501070_0007747 | 3300049586 | Bacteria | 9102 |
| 1070 | Ga0501070_0010122 | 3300049586 | Bacteria | 7983 |
| 1071 | Ga0501070_0025402 | 3300049586 | Bacteria | 4969 |
| 1072 | Ga0501070_0025521 | 3300049586 | Bacteria | 4957 |
| 1073 | Ga0501071_0012098 | 3300049587 | Bacteria | 5836 |
| 1074 | Ga0501071_0122894 | 3300049587 | Bacteria | 1925 |
| 1075 | Ga0501072_0001213 | 3300049588 | Bacteria | 19257 |
| 1076 | Ga0501073_0000037 | 3300049589 | Bacteria | 87345 |
| 1077 | Ga0501074_0000133 | 3300049590 | Bacteria | 38342 |
| 1078 | Ga0501074_0107539 | 3300049590 | Bacteria | 1997 |
| 1079 | Ga0501074_0154938 | 3300049590 | Bacteria | 1637 |
| 1080 | Ga0501076_0171998 | 3300049592 | Bacteria | 1766 |
| 1081 | Ga0501079_0001057 | 3300049741 | Bacteria | 19118 |
| 1082 | Ga0501080_0000054 | 3300049742 | Bacteria | 74316 |
| 1083 | Ga0501080_0028463 | 3300049742 | Bacteria | 5198 |
| 1084 | Ga0501080_0133973 | 3300049742 | Bacteria | 2293 |
| 1085 | Ga0501080_0192598 | 3300049742 | Bacteria | 1873 |
| 1086 | Ga0501083_0003724 | 3300049744 | Bacteria | 10711 |
| 1087 | Ga0501035_0000142 | 3300049822 | Bacteria | 87561 |
| 1088 | Ga0501035_0062851 | 3300049822 | Bacteria | 3303 |
| 1089 | Ga0501035_0125053 | 3300049822 | Bacteria | 2245 |
| 1090 | Ga0501035_0203574 | 3300049822 | Bacteria | 1696 |
| 1091 | Ga0501044_0000414 | 3300049823 | Bacteria | 52784 |
| 1092 | Ga0501044_0044082 | 3300049823 | Bacteria | 4632 |
| 1093 | Ga0501044_0085260 | 3300049823 | Bacteria | 3192 |
| 1094 | Ga0501044_0086417 | 3300049823 | Bacteria | 3168 |
| 1095 | Ga0501045_0057653 | 3300049824 | Bacteria | 2842 |
| 1096 | nmdc:mga03683_2888_c1 | 3300050489 | Bacteria | 5419 |
| 1097 | nmdc:mga03n38_66642_c1 | 3300050490 | Bacteria | 1654 |
| 1098 | nmdc:mga03n38_67070_c1 | 3300050490 | Bacteria | 1650 |
| 1099 | nmdc:mga03n38_7090_c1 | 3300050490 | Bacteria | 3942 |
| 1100 | nmdc:mga00v17_15058_c1 | 3300050491 | Bacteria | 4334 |
| 1101 | nmdc:mga00v17_164365_c1 | 3300050491 | Bacteria | 1430 |
| 1102 | nmdc:mga0yw44_58334_c1 | 3300050492 | Bacteria | 2358 |
| 1103 | nmdc:mga06z11_20446_c1 | 3300050494 | Bacteria | 3060 |
| 1104 | nmdc:mga06z11_87279_c1 | 3300050494 | Bacteria | 1687 |
| 1105 | nmdc:mga04h51_10207_c1 | 3300050495 | Bacteria | 2573 |
| 1106 | nmdc:mga04h51_33113_c1 | 3300050495 | Bacteria | 1643 |
| 1107 | nmdc:mga07m45_137248_c1 | 3300050496 | Bacteria | 1416 |
| 1108 | nmdc:mga07m45_137785_c1 | 3300050496 | Bacteria | 1413 |
| 1109 | nmdc:mga07m45_21802_c1 | 3300050496 | Bacteria | 3492 |
| 1110 | nmdc:mga07m45_32395_c1 | 3300050496 | Bacteria | 2899 |
| 1111 | nmdc:mga07m45_38907_c1 | 3300050496 | Bacteria | 2656 |
| 1112 | nmdc:mga07m45_53965_c1 | 3300050496 | Bacteria | 2272 |
| 1113 | nmdc:mga05p37_161286_c1 | 3300050507 | Bacteria | 2738 |
| 1114 | nmdc:mga08y16_138194_c1 | 3300050511 | Bacteria | 2533 |
| 1115 | nmdc:mga08y16_139147_c1 | 3300050511 | Bacteria | 2524 |
| 1116 | nmdc:mga08y16_259817_c1 | 3300050511 | Bacteria | 1793 |
| 1117 | nmdc:mga0n895_24565_c1 | 3300050512 | Bacteria | 5681 |
| 1118 | nmdc:mga0rr50_7098_c1 | 3300050513 | Bacteria | 6879 |
| 1119 | nmdc:mga08x19_21_c1 | 3300050514 | Bacteria | 302369 |
| 1120 | nmdc:mga0sz30_25727_c1 | 3300050516 | Bacteria | 2408 |
| 1121 | nmdc:mga0sz30_488_c1 | 3300050516 | Bacteria | 11210 |
| 1122 | nmdc:mga0sz30_49347_c1 | 3300050516 | Bacteria | 1783 |
| 1123 | Ga0495601_0028223 | 3300053077 | Bacteria | 3475 |
| 1124 | Ga0495601_0081577 | 3300053077 | Bacteria | 2076 |
| 1125 | Ga0495601_0101022 | 3300053077 | Bacteria | 1863 |
| 1126 | Ga0495601_0179164 | 3300053077 | Bacteria | 1386 |
| 1127 | Ga0495601_0200594 | 3300053077 | Bacteria | 1304 |
| 1128 | Ga0495612_0012023 | 3300053078 | Bacteria | 3488 |
| 1129 | Ga0500635_0003136 | 3300053080 | Bacteria | 4132 |
| 1130 | Ga0500635_0003603 | 3300053080 | Bacteria | 3915 |
| 1131 | Ga0500635_0009758 | 3300053080 | Bacteria | 2674 |
| 1132 | Ga0500635_0042830 | 3300053080 | Bacteria | 1520 |
| 1133 | Ga0495595_0003578 | 3300053084 | Bacteria | 6170 |
| 1134 | Ga0495619_0000111 | 3300053085 | Bacteria | 61304 |
| 1135 | Ga0495619_0001183 | 3300053085 | Bacteria | 17177 |
| 1136 | Ga0495619_0016178 | 3300053085 | Bacteria | 4722 |
| 1137 | Ga0495619_0026281 | 3300053085 | Bacteria | 3744 |
| 1138 | Ga0500578_0086293 | 3300053086 | Bacteria | 1994 |
| 1139 | Ga0500581_045915 | 3300053089 | Bacteria | 2232 |
| 1140 | Ga0500647_0033749 | 3300053091 | Bacteria | 2442 |
| 1141 | Ga0500651_0011222 | 3300053093 | Bacteria | 5397 |
| 1142 | Ga0500651_0046722 | 3300053093 | Bacteria | 2723 |
| 1143 | Ga0500651_0181137 | 3300053093 | Bacteria | 1251 |
| 1144 | Ga0500566_0000223 | 3300053094 | Bacteria | 30380 |
| 1145 | Ga0500566_0000352 | 3300053094 | Bacteria | 24987 |
| 1146 | Ga0500566_0000445 | 3300053094 | Bacteria | 23074 |
| 1147 | Ga0500566_0000872 | 3300053094 | Bacteria | 17220 |
| 1148 | Ga0500566_0006638 | 3300053094 | Bacteria | 6852 |
| 1149 | Ga0500566_0042561 | 3300053094 | Bacteria | 2620 |
| 1150 | Ga0500640_002695 | 3300053095 | Bacteria | 5944 |
| 1151 | Ga0500650_0001140 | 3300053098 | Bacteria | 7721 |
| 1152 | Ga0500554_003648 | 3300053102 | Bacteria | 3171 |
| 1153 | Ga0500556_0000003 | 3300053104 | Bacteria | 679379 |
| 1154 | Ga0500556_0000029 | 3300053104 | Bacteria | 165326 |
| 1155 | Ga0500562_013354 | 3300053108 | Bacteria | 2096 |
| 1156 | Ga0500569_021182 | 3300053109 | Bacteria | 1715 |
| 1157 | Ga0500572_000236 | 3300053111 | Bacteria | 19616 |
| 1158 | Ga0500572_000389 | 3300053111 | Bacteria | 15536 |
| 1159 | Ga0500572_000848 | 3300053111 | Bacteria | 9536 |
| 1160 | Ga0500591_044989 | 3300053115 | Bacteria | 2088 |
| 1161 | Ga0500592_001392 | 3300053116 | Bacteria | 3910 |
| 1162 | Ga0500595_001519 | 3300053119 | Bacteria | 12326 |
| 1163 | Ga0500595_002014 | 3300053119 | Bacteria | 10407 |
| 1164 | Ga0500595_002289 | 3300053119 | Bacteria | 9610 |
| 1165 | Ga0500595_003149 | 3300053119 | Bacteria | 7818 |
| 1166 | Ga0500595_004865 | 3300053119 | Bacteria | 5945 |
| 1167 | Ga0500595_006850 | 3300053119 | Bacteria | 4795 |
| 1168 | Ga0500595_046074 | 3300053119 | Bacteria | 1373 |
| 1169 | Ga0500608_000713 | 3300053122 | Bacteria | 12184 |
| 1170 | Ga0500618_026238 | 3300053125 | Bacteria | 1392 |
| 1171 | Ga0500642_0000015 | 3300053130 | Bacteria | 181424 |
| 1172 | Ga0500642_0000329 | 3300053130 | Bacteria | 16416 |
| 1173 | Ga0500652_001212 | 3300053131 | Bacteria | 8224 |
| 1174 | Ga0500652_016900 | 3300053131 | Bacteria | 2664 |
| 1175 | Ga0500658_0068983 | 3300053134 | Bacteria | 1487 |
| 1176 | Ga0500559_0000105 | 3300053136 | Bacteria | 65809 |
| 1177 | Ga0500559_0000461 | 3300053136 | Bacteria | 28939 |
| 1178 | Ga0500559_0001715 | 3300053136 | Bacteria | 12035 |
| 1179 | Ga0500559_0002267 | 3300053136 | Bacteria | 10164 |
| 1180 | Ga0500559_0072929 | 3300053136 | Bacteria | 1548 |
| 1181 | Ga0500568_0001586 | 3300053139 | Bacteria | 14383 |
| 1182 | Ga0500568_0005182 | 3300053139 | Bacteria | 6794 |
| 1183 | Ga0500568_0020846 | 3300053139 | Bacteria | 2829 |
| 1184 | Ga0500573_0027024 | 3300053140 | Bacteria | 3298 |
| 1185 | Ga0500577_0000266 | 3300053142 | Bacteria | 13721 |
| 1186 | Ga0500577_0012174 | 3300053142 | Bacteria | 2591 |
| 1187 | Ga0500586_000403 | 3300053145 | Bacteria | 8635 |
| 1188 | Ga0500590_061601 | 3300053148 | Bacteria | 1884 |
| 1189 | Ga0500603_000178 | 3300053150 | Bacteria | 16265 |
| 1190 | Ga0500603_000237 | 3300053150 | Bacteria | 14490 |
| 1191 | Ga0500603_000303 | 3300053150 | Bacteria | 12925 |
| 1192 | Ga0500603_013292 | 3300053150 | Bacteria | 1906 |
| 1193 | Ga0500604_0002762 | 3300053151 | Bacteria | 4770 |
| 1194 | Ga0500604_0043294 | 3300053151 | Bacteria | 1367 |
| 1195 | Ga0500616_0000033 | 3300053153 | Bacteria | 398830 |
| 1196 | Ga0500616_0000038 | 3300053153 | Bacteria | 386801 |
| 1197 | Ga0500616_0001700 | 3300053153 | Bacteria | 20240 |
| 1198 | Ga0500622_0017137 | 3300053156 | Bacteria | 3859 |
| 1199 | Ga0500622_0020356 | 3300053156 | Bacteria | 3523 |
| 1200 | Ga0500622_0024347 | 3300053156 | Bacteria | 3200 |
| 1201 | Ga0500630_000468 | 3300053159 | Bacteria | 17761 |
| 1202 | Ga0500630_001248 | 3300053159 | Bacteria | 11964 |
| 1203 | Ga0500634_0061290 | 3300053161 | Bacteria | 1996 |
| 1204 | Ga0500638_001847 | 3300053162 | Bacteria | 6994 |
| 1205 | Ga0500638_053434 | 3300053162 | Bacteria | 1950 |
| 1206 | Ga0500639_000031 | 3300053163 | Bacteria | 69938 |
| 1207 | Ga0500636_0006971 | 3300053177 | Bacteria | 6514 |
| 1208 | Ga0500636_0042809 | 3300053177 | Bacteria | 2675 |
| 1209 | Ga0500636_0064297 | 3300053177 | Bacteria | 2137 |
| 1210 | Ga0500636_0064793 | 3300053177 | Bacteria | 2128 |
| 1211 | Ga0500637_0001085 | 3300053178 | Bacteria | 11197 |
| 1212 | Ga0500637_0002841 | 3300053178 | Bacteria | 7801 |
| 1213 | Ga0500637_0024766 | 3300053178 | Bacteria | 3290 |
| 1214 | Ga0500637_0026684 | 3300053178 | Bacteria | 3184 |
| 1215 | Ga0500637_0032567 | 3300053178 | Bacteria | 2907 |
| 1216 | Ga0500637_0092833 | 3300053178 | Bacteria | 1749 |
| 1217 | Ga0500645_005883 | 3300053730 | Bacteria | 4446 |
| 1218 | Ga0500609_000386 | 3300053731 | Bacteria | 6515 |
| 1219 | Ga0500552_002249 | 3300053733 | Bacteria | 1870 |
| 1220 | Ga0500596_002483 | 3300053735 | Bacteria | 3635 |
| 1221 | Ga0500596_009089 | 3300053735 | Bacteria | 1561 |
| 1222 | Ga0501084_0006462 | 3300054114 | Bacteria | 9639 |
| 1223 | Ga0500661_000349 | 3300055283 | Bacteria | 8436 |
| 1224 | Ga0587077_001070 | 3300059493 | Bacteria | 2778 |
| 1225 | Ga0587082_010826 | 3300059504 | Bacteria | 1324 |
| 1226 | Ga0587083_0018533 | 3300059505 | Bacteria | 1260 |
| 1227 | Ga0587062_000371 | 3300059639 | Bacteria | 3031 |
| 1228 | Ga0587075_001170 | 3300059644 | Bacteria | 2460 |
| 1229 | Ga0587075_008698 | 3300059644 | Bacteria | 1305 |
| 1230 | Ga0587079_006083 | 3300059647 | Bacteria | 1741 |
| 1231 | Ga0501082_0002719 | 3300060353 | Bacteria | 15447 |
| 1232 | Ga0501082_0260104 | 3300060353 | Bacteria | 1510 |
| 1233 | Ga0466962_0028097 | 3300061719 | Bacteria | 2696 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 8016548790 | 8016553994 | 329 |
| 2 | 3300046684 | Ga0495669_0066376 | Ga0495669_0066376_589_1611 | 339 |
| 3 | iso_pu_bacteria | 8019629233 | 8019635574 | 339 |
| 4 | 3300050496 | nmdc:mga07m45_38907_c1 | nmdc:mga07m45_38907_c1_17_1048 | 343 |
| 5 | iso_pu_bacteria | 8016557553 | 8016561355 | 348 |
| 6 | 3300059505 | Ga0587083_0018533 | Ga0587083_0018533_31_1089 | 351 |
| 7 | 3300048914 | Ga0496111_0136763 | Ga0496111_0136763_373_1464 | 362 |
| 8 | 3300035086 | Ga0373934_0083126 | Ga0373934_0083126_11_1180 | 367 |
| 9 | 3300035111 | Ga0373923_0015450 | Ga0373923_0015450_935_2137 | 371 |
| 10 | 3300035119 | Ga0373956_0013338 | Ga0373956_0013338_1813_3015 | 371 |
| 11 | 3300035172 | Ga0373955_0000198 | Ga0373955_0000198_984_2186 | 371 |
| 12 | 3300035724 | Ga0373933_0000274 | Ga0373933_0000274_12_1214 | 371 |
| 13 | 3300046459 | Ga0495629_0000176 | Ga0495629_0000176_8301_9503 | 371 |
| 14 | 3300046462 | Ga0495651_0002298 | Ga0495651_0002298_13148_14350 | 371 |
| 15 | 3300046511 | Ga0495608_0040372 | Ga0495608_0040372_1597_2799 | 371 |
| 16 | 3300046529 | Ga0495652_0004769 | Ga0495652_0004769_5290_6492 | 371 |
| 17 | 3300046533 | Ga0495640_0001533 | Ga0495640_0001533_8266_9468 | 371 |
| 18 | 3300046536 | Ga0495587_0048963 | Ga0495587_0048963_191_1393 | 371 |
| 19 | 3300046543 | Ga0495645_0027395 | Ga0495645_0027395_2909_4111 | 371 |
| 20 | 3300046559 | Ga0495667_0019949 | Ga0495667_0019949_405_1607 | 371 |
| 21 | 3300046663 | Ga0495635_0000276 | Ga0495635_0000276_1618_2820 | 371 |
| 22 | 3300046809 | Ga0495600_0000314 | Ga0495600_0000314_387_1589 | 371 |
| 23 | 3300047317 | Ga0495604_0048462 | Ga0495604_0048462_394_1596 | 371 |
| 24 | 3300047444 | Ga0495675_0029478 | Ga0495675_0029478_1679_2881 | 371 |
| 25 | 3300047471 | Ga0495684_0000023 | Ga0495684_0000023_82324_83526 | 371 |
| 26 | 3300053085 | Ga0495619_0000111 | Ga0495619_0000111_29261_30463 | 371 |
| 27 | 3300031238 | Ga0265332_10022779 | Ga0265332_100227792 | 385 |
| 28 | 3300031730 | Ga0307516_10046028 | Ga0307516_100460282 | 387 |
| 29 | 3300005983 | Ga0081540_1002682 | Ga0081540_10026827 | 388 |
| 30 | 3300053085 | Ga0495619_0026281 | Ga0495619_0026281_162_1388 | 388 |
| 31 | 3300005937 | Ga0081455_10004479 | Ga0081455_100044798 | 389 |
| 32 | 3300053077 | Ga0495601_0101022 | Ga0495601_0101022_483_1790 | 389 |
| 33 | iso_pu_bacteria | 3005506211 | 3005507574 | 389 |
| 34 | 3300005458 | Ga0070681_10089143 | Ga0070681_100891432 | 390 |
| 35 | 3300006042 | Ga0075368_10028024 | Ga0075368_100280241 | 391 |
| 36 | 3300006051 | Ga0075364_10133529 | Ga0075364_101335291 | 391 |
| 37 | 3300006186 | Ga0075369_10002161 | Ga0075369_100021614 | 391 |
| 38 | 3300006186 | Ga0075369_10043684 | Ga0075369_100436841 | 391 |
| 39 | 3300010375 | Ga0105239_10002860 | Ga0105239_100028608 | 391 |
| 40 | 3300010375 | Ga0105239_10005709 | Ga0105239_1000570913 | 391 |
| 41 | 3300025304 | Ga0209257_1003528 | Ga0209257_10035289 | 391 |
| 42 | 3300025904 | Ga0207647_10060038 | Ga0207647_100600382 | 391 |
| 43 | 3300031249 | Ga0265339_10007149 | Ga0265339_100071492 | 391 |
| 44 | 3300031711 | Ga0265314_10004155 | Ga0265314_100041552 | 391 |
| 45 | 3300031712 | Ga0265342_10024906 | Ga0265342_100249062 | 391 |
| 46 | 3300037471 | Ga0395905_0003852 | Ga0395905_0003852_5875_7086 | 391 |
| 47 | 3300042876 | Ga0451577_0003923 | Ga0451577_0003923_1482_2687 | 391 |
| 48 | 3300048908 | Ga0496105_0110437 | Ga0496105_0110437_1079_2257 | 391 |
| 49 | 3300050491 | nmdc:mga00v17_164365_c1 | nmdc:mga00v17_164365_c1_88_1299 | 391 |
| 50 | 3300050516 | nmdc:mga0sz30_488_c1 | nmdc:mga0sz30_488_c1_1047_2258 | 391 |
| 51 | 3300050516 | nmdc:mga0sz30_49347_c1 | nmdc:mga0sz30_49347_c1_540_1751 | 391 |
| 52 | 3300053094 | Ga0500566_0000352 | Ga0500566_0000352_17035_18258 | 391 |
| 53 | 3300053095 | Ga0500640_002695 | Ga0500640_002695_1135_2358 | 391 |
| 54 | 3300053111 | Ga0500572_000236 | Ga0500572_000236_12795_14018 | 391 |
| 55 | 3300053115 | Ga0500591_044989 | Ga0500591_044989_667_1890 | 391 |
| 56 | 3300053150 | Ga0500603_013292 | Ga0500603_013292_251_1474 | 391 |
| 57 | 3300053159 | Ga0500630_001248 | Ga0500630_001248_3971_5194 | 391 |
| 58 | 3300003215 | JGI25153J46596_10006710 | JGI25153J46596_100067102 | 392 |
| 59 | 3300005546 | Ga0070696_100102446 | Ga0070696_1001024462 | 392 |
| 60 | 3300006028 | Ga0070717_10018197 | Ga0070717_100181976 | 392 |
| 61 | 3300025919 | Ga0207657_10220505 | Ga0207657_102205051 | 392 |
| 62 | 3300050496 | nmdc:mga07m45_137785_c1 | nmdc:mga07m45_137785_c1_112_1335 | 392 |
| 63 | 3300005983 | Ga0081540_1006810 | Ga0081540_10068108 | 393 |
| 64 | 3300010159 | Ga0099796_10047678 | Ga0099796_100476781 | 393 |
| 65 | 3300025923 | Ga0207681_10148127 | Ga0207681_101481272 | 393 |
| 66 | 3300049592 | Ga0501076_0171998 | Ga0501076_0171998_57_1268 | 393 |
| 67 | 3300005983 | Ga0081540_1043566 | Ga0081540_10435662 | 394 |
| 68 | 3300045049 | Ga0466959_0052438 | Ga0466959_0052438_460_1689 | 394 |
| 69 | 3300046455 | Ga0495603_0014464 | Ga0495603_0014464_17_1246 | 394 |
| 70 | 3300046492 | Ga0495585_0028375 | Ga0495585_0028375_332_1561 | 394 |
| 71 | 3300046539 | Ga0495621_0026467 | Ga0495621_0026467_267_1496 | 394 |
| 72 | 3300046615 | Ga0495656_0016207 | Ga0495656_0016207_157_1386 | 394 |
| 73 | 3300046674 | Ga0495588_0002893 | Ga0495588_0002893_4318_5547 | 394 |
| 74 | 3300048918 | Ga0496115_0228715 | Ga0496115_0228715_23_1384 | 394 |
| 75 | 3300049459 | Ga0495678_047442 | Ga0495678_047442_240_1445 | 394 |
| 76 | 3300061719 | Ga0466962_0028097 | Ga0466962_0028097_1122_2351 | 394 |
| 77 | 3300005356 | Ga0070674_100008705 | Ga0070674_1000087053 | 395 |
| 78 | 3300005434 | Ga0070709_10001137 | Ga0070709_100011375 | 395 |
| 79 | 3300005435 | Ga0070714_100018594 | Ga0070714_1000185944 | 395 |
| 80 | 3300005437 | Ga0070710_10001311 | Ga0070710_100013113 | 395 |
| 81 | 3300005439 | Ga0070711_100006268 | Ga0070711_1000062681 | 395 |
| 82 | 3300005439 | Ga0070711_100007928 | Ga0070711_1000079285 | 395 |
| 83 | 3300005539 | Ga0068853_100213461 | Ga0068853_1002134612 | 395 |
| 84 | 3300006175 | Ga0070712_100005053 | Ga0070712_1000050532 | 395 |
| 85 | 3300025905 | Ga0207685_10008782 | Ga0207685_100087823 | 395 |
| 86 | 3300025916 | Ga0207663_10088076 | Ga0207663_100880762 | 395 |
| 87 | 3300025937 | Ga0207669_10023026 | Ga0207669_100230261 | 395 |
| 88 | 3300026041 | Ga0207639_10130063 | Ga0207639_101300632 | 395 |
| 89 | 3300035170 | Ga0373943_0049732 | Ga0373943_0049732_423_1652 | 395 |
| 90 | 3300037068 | Ga0373925_0141996 | Ga0373925_0141996_523_1752 | 395 |
| 91 | 3300046455 | Ga0495603_0037274 | Ga0495603_0037274_1218_2423 | 395 |
| 92 | 3300046460 | Ga0495638_0021438 | Ga0495638_0021438_2468_3673 | 395 |
| 93 | 3300046507 | Ga0495606_0088355 | Ga0495606_0088355_648_1853 | 395 |
| 94 | 3300046512 | Ga0495610_0052998 | Ga0495610_0052998_720_1925 | 395 |
| 95 | 3300046515 | Ga0495620_0059474 | Ga0495620_0059474_232_1437 | 395 |
| 96 | 3300046522 | Ga0495643_0093321 | Ga0495643_0093321_157_1362 | 395 |
| 97 | 3300046558 | Ga0495633_0077414 | Ga0495633_0077414_31_1236 | 395 |
| 98 | 3300046616 | Ga0495668_0106999 | Ga0495668_0106999_38_1243 | 395 |
| 99 | 3300046674 | Ga0495588_0100718 | Ga0495588_0100718_220_1449 | 395 |
| 100 | 3300048919 | Ga0496116_0021698 | Ga0496116_0021698_2279_3484 | 395 |
| 101 | 3300048920 | Ga0496117_0104235 | Ga0496117_0104235_135_1340 | 395 |
| 102 | 3300048921 | Ga0496118_0021357 | Ga0496118_0021357_3642_4847 | 395 |
| 103 | 3300048922 | Ga0496119_0087076 | Ga0496119_0087076_370_1575 | 395 |
| 104 | 3300048923 | Ga0496120_0044928 | Ga0496120_0044928_913_2118 | 395 |
| 105 | 3300048923 | Ga0496120_0088073 | Ga0496120_0088073_306_1511 | 395 |
| 106 | 3300048924 | Ga0496121_0044377 | Ga0496121_0044377_1016_2221 | 395 |
| 107 | 3300048924 | Ga0496121_0097939 | Ga0496121_0097939_826_2031 | 395 |
| 108 | 3300048928 | Ga0496125_0000664 | Ga0496125_0000664_48427_49650 | 395 |
| 109 | 3300048928 | Ga0496125_0004086 | Ga0496125_0004086_9943_11148 | 395 |
| 110 | 3300048928 | Ga0496125_0027901 | Ga0496125_0027901_1385_2590 | 395 |
| 111 | 3300048929 | Ga0496126_0050615 | Ga0496126_0050615_1853_3076 | 395 |
| 112 | 3300049570 | Ga0501033_0084302 | Ga0501033_0084302_539_1768 | 395 |
| 113 | 3300049581 | Ga0501047_0096309 | Ga0501047_0096309_900_2129 | 395 |
| 114 | 3300049822 | Ga0501035_0125053 | Ga0501035_0125053_525_1754 | 395 |
| 115 | 3300050516 | nmdc:mga0sz30_25727_c1 | nmdc:mga0sz30_25727_c1_389_1594 | 395 |
| 116 | 3300053077 | Ga0495601_0179164 | Ga0495601_0179164_152_1375 | 395 |
| 117 | 3300053093 | Ga0500651_0181137 | Ga0500651_0181137_16_1221 | 395 |
| 118 | 3300053094 | Ga0500566_0000445 | Ga0500566_0000445_9334_10539 | 395 |
| 119 | 3300053104 | Ga0500556_0000029 | Ga0500556_0000029_150324_151529 | 395 |
| 120 | 3300053122 | Ga0500608_000713 | Ga0500608_000713_4561_5766 | 395 |
| 121 | 3300053130 | Ga0500642_0000329 | Ga0500642_0000329_1392_2597 | 395 |
| 122 | 3300053131 | Ga0500652_016900 | Ga0500652_016900_28_1233 | 395 |
| 123 | 3300053136 | Ga0500559_0000105 | Ga0500559_0000105_51875_53080 | 395 |
| 124 | 3300053139 | Ga0500568_0001586 | Ga0500568_0001586_4828_6033 | 395 |
| 125 | 3300053145 | Ga0500586_000403 | Ga0500586_000403_3345_4550 | 395 |
| 126 | 3300053151 | Ga0500604_0002762 | Ga0500604_0002762_2297_3502 | 395 |
| 127 | 3300053153 | Ga0500616_0001700 | Ga0500616_0001700_13863_15068 | 395 |
| 128 | 3300053156 | Ga0500622_0024347 | Ga0500622_0024347_855_2060 | 395 |
| 129 | 3300053178 | Ga0500637_0092833 | Ga0500637_0092833_63_1268 | 395 |
| 130 | iso_pu_bacteria | 2791355197 | 2793067021 | 395 |
| 131 | iso_pu_bacteria | 2857524615 | 2857525053 | 395 |
| 132 | iso_pu_bacteria | 2885374607 | 2885380984 | 395 |
| 133 | iso_pu_bacteria | 2893066018 | 2893069640 | 395 |
| 134 | iso_pu_bacteria | 2906610324 | 2906616830 | 395 |
| 135 | iso_pu_bacteria | 2919073203 | 2919078938 | 395 |
| 136 | iso_pu_bacteria | 2922425934 | 2922431107 | 395 |
| 137 | iso_pu_bacteria | 2935630451 | 2935636906 | 395 |
| 138 | iso_pu_bacteria | 2941507105 | 2941513638 | 395 |
| 139 | iso_pu_bacteria | 2941515067 | 2941521506 | 395 |
| 140 | iso_pu_bacteria | 2941523033 | 2941529260 | 395 |
| 141 | iso_pu_bacteria | 8019555841 | 8019565691 | 395 |
| 142 | iso_pu_bacteria | 8019565922 | 8019575782 | 395 |
| 143 | 3300005435 | Ga0070714_100007296 | Ga0070714_1000072965 | 396 |
| 144 | 3300005436 | Ga0070713_100004722 | Ga0070713_1000047228 | 396 |
| 145 | 3300005563 | Ga0068855_100324296 | Ga0068855_1003242962 | 396 |
| 146 | 3300005616 | Ga0068852_100020420 | Ga0068852_1000204202 | 396 |
| 147 | 3300006173 | Ga0070716_100016735 | Ga0070716_1000167353 | 396 |
| 148 | 3300025942 | Ga0207689_10047565 | Ga0207689_100475652 | 396 |
| 149 | 3300025945 | Ga0207679_10096446 | Ga0207679_100964461 | 396 |
| 150 | 3300026078 | Ga0207702_10106126 | Ga0207702_101061261 | 396 |
| 151 | 3300031344 | Ga0265316_10038893 | Ga0265316_100388932 | 396 |
| 152 | 3300035692 | Ga0373935_0008496 | Ga0373935_0008496_151_1353 | 396 |
| 153 | 3300035695 | Ga0373927_0018690 | Ga0373927_0018690_2673_3875 | 396 |
| 154 | 3300035725 | Ga0373947_0097414 | Ga0373947_0097414_278_1486 | 396 |
| 155 | 3300037068 | Ga0373925_0119252 | Ga0373925_0119252_826_2028 | 396 |
| 156 | 3300046519 | Ga0495632_0045243 | Ga0495632_0045243_194_1402 | 396 |
| 157 | 3300046524 | Ga0495648_0141218 | Ga0495648_0141218_40_1248 | 396 |
| 158 | 3300046526 | Ga0495666_0006119 | Ga0495666_0006119_2917_4161 | 396 |
| 159 | 3300046684 | Ga0495669_0081610 | Ga0495669_0081610_225_1433 | 396 |
| 160 | 3300047319 | Ga0495674_0015846 | Ga0495674_0015846_4262_5470 | 396 |
| 161 | 3300049570 | Ga0501033_0245070 | Ga0501033_0245070_53_1261 | 396 |
| 162 | 3300050489 | nmdc:mga03683_2888_c1 | nmdc:mga03683_2888_c1_1416_2627 | 396 |
| 163 | 3300050490 | nmdc:mga03n38_67070_c1 | nmdc:mga03n38_67070_c1_354_1565 | 396 |
| 164 | 3300053084 | Ga0495595_0003578 | Ga0495595_0003578_938_2146 | 396 |
| 165 | 3300053094 | Ga0500566_0000223 | Ga0500566_0000223_15201_16409 | 396 |
| 166 | 3300053094 | Ga0500566_0042561 | Ga0500566_0042561_1174_2376 | 396 |
| 167 | 3300053111 | Ga0500572_000848 | Ga0500572_000848_2452_3660 | 396 |
| 168 | 3300053119 | Ga0500595_004865 | Ga0500595_004865_2366_3574 | 396 |
| 169 | 3300053136 | Ga0500559_0002267 | Ga0500559_0002267_5261_6469 | 396 |
| 170 | 3300053148 | Ga0500590_061601 | Ga0500590_061601_634_1842 | 396 |
| 171 | 3300053150 | Ga0500603_000237 | Ga0500603_000237_9588_10796 | 396 |
| 172 | 3300053159 | Ga0500630_000468 | Ga0500630_000468_9655_10863 | 396 |
| 173 | 3300053163 | Ga0500639_000031 | Ga0500639_000031_65906_67114 | 396 |
| 174 | 3300053735 | Ga0500596_002483 | Ga0500596_002483_1698_2906 | 396 |
| 175 | 3300005457 | Ga0070662_100065903 | Ga0070662_1000659033 | 397 |
| 176 | 3300014497 | Ga0182008_10000392 | Ga0182008_1000039232 | 397 |
| 177 | 3300025912 | Ga0207707_10075781 | Ga0207707_100757812 | 397 |
| 178 | 3300025933 | Ga0207706_10079123 | Ga0207706_100791232 | 397 |
| 179 | 3300041512 | Ga0451853_3488916 | Ga0451853_3488916_236_1465 | 397 |
| 180 | 3300048915 | Ga0496112_0049960 | Ga0496112_0049960_2473_3687 | 397 |
| 181 | 3300049580 | Ga0501046_0047803 | Ga0501046_0047803_45_1289 | 397 |
| 182 | iso_pu_bacteria | 2508501128 | 2509151530 | 397 |
| 183 | iso_pu_bacteria | 2513237141 | 2513891618 | 397 |
| 184 | iso_pu_bacteria | 2906635258 | 2906643524 | 397 |
| 185 | 3300003659 | JGI25404J52841_10007004 | JGI25404J52841_100070041 | 398 |
| 186 | 3300005983 | Ga0081540_1012123 | Ga0081540_10121231 | 398 |
| 187 | 3300006028 | Ga0070717_10017205 | Ga0070717_100172053 | 398 |
| 188 | 3300006048 | Ga0075363_100123093 | Ga0075363_1001230932 | 398 |
| 189 | 3300006178 | Ga0075367_10063200 | Ga0075367_100632002 | 398 |
| 190 | 3300007265 | Ga0099794_10001086 | Ga0099794_100010864 | 398 |
| 191 | 3300025898 | Ga0207692_10000103 | Ga0207692_1000010318 | 398 |
| 192 | 3300025906 | Ga0207699_10003630 | Ga0207699_100036307 | 398 |
| 193 | 3300025906 | Ga0207699_10059907 | Ga0207699_100599072 | 398 |
| 194 | 3300025915 | Ga0207693_10001154 | Ga0207693_100011549 | 398 |
| 195 | 3300025916 | Ga0207663_10000733 | Ga0207663_1000073311 | 398 |
| 196 | 3300025916 | Ga0207663_10038827 | Ga0207663_100388272 | 398 |
| 197 | 3300025928 | Ga0207700_10018146 | Ga0207700_100181464 | 398 |
| 198 | 3300025929 | Ga0207664_10002058 | Ga0207664_100020585 | 398 |
| 199 | 3300025929 | Ga0207664_10069689 | Ga0207664_100696892 | 398 |
| 200 | 3300025939 | Ga0207665_10000583 | Ga0207665_1000058313 | 398 |
| 201 | 3300038443 | Ga0395901_0076603 | Ga0395901_0076603_1394_2608 | 398 |
| 202 | 3300046491 | Ga0495584_0081540 | Ga0495584_0081540_188_1402 | 398 |
| 203 | 3300046499 | Ga0495594_0015786 | Ga0495594_0015786_739_1953 | 398 |
| 204 | 3300046537 | Ga0495598_0008960 | Ga0495598_0008960_1089_2303 | 398 |
| 205 | 3300046665 | Ga0495661_0076552 | Ga0495661_0076552_604_1818 | 398 |
| 206 | 3300046691 | Ga0495670_0023077 | Ga0495670_0023077_43_1257 | 398 |
| 207 | 3300047321 | Ga0495676_0075107 | Ga0495676_0075107_13_1227 | 398 |
| 208 | 3300048924 | Ga0496121_0092776 | Ga0496121_0092776_372_1595 | 398 |
| 209 | iso_pu_bacteria | 2513237092 | 2513627454 | 398 |
| 210 | iso_pu_bacteria | 2513237098 | 2513676904 | 398 |
| 211 | iso_pu_bacteria | 2513237101 | 2513696299 | 398 |
| 212 | iso_pu_bacteria | 2513237137 | 2513857227 | 398 |
| 213 | iso_pu_bacteria | 2513237137 | 2513857228 | 398 |
| 214 | iso_pu_bacteria | 2517572143 | 2517888167 | 398 |
| 215 | iso_pu_bacteria | 2517572143 | 2517888168 | 398 |
| 216 | iso_pu_bacteria | 2524023210 | 2524468623 | 398 |
| 217 | iso_pu_bacteria | 2524023228 | 2524533346 | 398 |
| 218 | iso_pu_bacteria | 2667528175 | 2671119368 | 398 |
| 219 | iso_pu_bacteria | 2667528175 | 2671119369 | 398 |
| 220 | iso_pu_bacteria | 2721755755 | 2723842268 | 398 |
| 221 | iso_pu_bacteria | 2728368998 | 2728753418 | 398 |
| 222 | iso_pu_bacteria | 2728368998 | 2728753829 | 398 |
| 223 | iso_pu_bacteria | 2791355197 | 2793073452 | 398 |
| 224 | iso_pu_bacteria | 2791355199 | 2793077960 | 398 |
| 225 | iso_pu_bacteria | 2791355199 | 2793077961 | 398 |
| 226 | iso_pu_bacteria | 2824679649 | 2824684721 | 398 |
| 227 | iso_pu_bacteria | 2841957949 | 2841960586 | 398 |
| 228 | iso_pu_bacteria | 2874604998 | 2874610143 | 398 |
| 229 | iso_pu_bacteria | 2874612657 | 2874620240 | 398 |
| 230 | iso_pu_bacteria | 2876761206 | 2876765310 | 398 |
| 231 | iso_pu_bacteria | 2876808645 | 2876809362 | 398 |
| 232 | iso_pu_bacteria | 2879110137 | 2879113607 | 398 |
| 233 | iso_pu_bacteria | 2879110137 | 2879117011 | 398 |
| 234 | iso_pu_bacteria | 2885374607 | 2885380626 | 398 |
| 235 | iso_pu_bacteria | 2885374607 | 2885380627 | 398 |
| 236 | iso_pu_bacteria | 2885383462 | 2885390777 | 398 |
| 237 | iso_pu_bacteria | 2889033259 | 2889036390 | 398 |
| 238 | iso_pu_bacteria | 2903748898 | 2903752466 | 398 |
| 239 | iso_pu_bacteria | 2903748898 | 2903752467 | 398 |
| 240 | iso_pu_bacteria | 2903768456 | 2903772231 | 398 |
| 241 | iso_pu_bacteria | 2904690495 | 2904695745 | 398 |
| 242 | iso_pu_bacteria | 2904699407 | 2904710032 | 398 |
| 243 | iso_pu_bacteria | 2906610324 | 2906614470 | 398 |
| 244 | iso_pu_bacteria | 2906635258 | 2906643400 | 398 |
| 245 | iso_pu_bacteria | 2906635258 | 2906643401 | 398 |
| 246 | iso_pu_bacteria | 2906660503 | 2906666592 | 398 |
| 247 | iso_pu_bacteria | 2906660503 | 2906666593 | 398 |
| 248 | iso_pu_bacteria | 2908739725 | 2908746700 | 398 |
| 249 | iso_pu_bacteria | 2908756301 | 2908764261 | 398 |
| 250 | iso_pu_bacteria | 2922361189 | 2922365269 | 398 |
| 251 | iso_pu_bacteria | 2922361189 | 2922366733 | 398 |
| 252 | iso_pu_bacteria | 2922386360 | 2922389364 | 398 |
| 253 | iso_pu_bacteria | 2922393267 | 2922398523 | 398 |
| 254 | iso_pu_bacteria | 2922425934 | 2922426306 | 398 |
| 255 | iso_pu_bacteria | 2935630451 | 2935632689 | 398 |
| 256 | iso_pu_bacteria | 2941507105 | 2941508647 | 398 |
| 257 | iso_pu_bacteria | 2941515067 | 2941516477 | 398 |
| 258 | iso_pu_bacteria | 2941523033 | 2941524507 | 398 |
| 259 | iso_pu_bacteria | 3005474847 | 3005475672 | 398 |
| 260 | iso_pu_bacteria | 3005474847 | 3005475673 | 398 |
| 261 | iso_pu_bacteria | 8006926726 | 8006932267 | 398 |
| 262 | iso_pu_bacteria | 8006933436 | 8006937010 | 398 |
| 263 | iso_pu_bacteria | 8006964411 | 8006966326 | 398 |
| 264 | iso_pu_bacteria | 8006973647 | 8006976975 | 398 |
| 265 | iso_pu_bacteria | 8006984368 | 8006993144 | 398 |
| 266 | iso_pu_bacteria | 8006994254 | 8006996996 | 398 |
| 267 | iso_pu_bacteria | 8019565922 | 8019571742 | 398 |
| 268 | iso_pu_bacteria | 8056673599 | 8056678182 | 398 |
| 269 | iso_pu_bacteria | 8056681323 | 8056683426 | 398 |
| 270 | iso_pu_bacteria | 8056689827 | 8056692709 | 398 |
| 271 | 3300005985 | Ga0081539_10044031 | Ga0081539_100440312 | 399 |
| 272 | 3300006177 | Ga0075362_10006528 | Ga0075362_100065283 | 399 |
| 273 | 3300006914 | Ga0075436_100200315 | Ga0075436_1002003152 | 399 |
| 274 | 3300009101 | Ga0105247_10072239 | Ga0105247_100722392 | 399 |
| 275 | 3300009551 | Ga0105238_10174752 | Ga0105238_101747522 | 399 |
| 276 | 3300014968 | Ga0157379_10206082 | Ga0157379_102060822 | 399 |
| 277 | 3300025297 | Ga0209758_1005849 | Ga0209758_10058493 | 399 |
| 278 | 3300046455 | Ga0495603_0018302 | Ga0495603_0018302_2815_4032 | 399 |
| 279 | 3300046455 | Ga0495603_0026289 | Ga0495603_0026289_287_1504 | 399 |
| 280 | 3300046475 | Ga0495639_0051011 | Ga0495639_0051011_474_1691 | 399 |
| 281 | 3300046492 | Ga0495585_0058078 | Ga0495585_0058078_481_1698 | 399 |
| 282 | 3300046523 | Ga0495644_0029270 | Ga0495644_0029270_598_1815 | 399 |
| 283 | 3300046558 | Ga0495633_0033632 | Ga0495633_0033632_594_1811 | 399 |
| 284 | 3300046615 | Ga0495656_0044436 | Ga0495656_0044436_438_1655 | 399 |
| 285 | 3300046648 | Ga0495611_0020338 | Ga0495611_0020338_1614_2831 | 399 |
| 286 | 3300046660 | Ga0495625_0063911 | Ga0495625_0063911_243_1460 | 399 |
| 287 | 3300046665 | Ga0495661_0047854 | Ga0495661_0047854_844_2154 | 399 |
| 288 | 3300046674 | Ga0495588_0001458 | Ga0495588_0001458_8170_9387 | 399 |
| 289 | 3300046691 | Ga0495670_0025540 | Ga0495670_0025540_563_1780 | 399 |
| 290 | 3300047321 | Ga0495676_0165714 | Ga0495676_0165714_217_1434 | 399 |
| 291 | 3300048905 | Ga0496102_0153797 | Ga0496102_0153797_101_1318 | 399 |
| 292 | 3300048912 | Ga0496109_0049885 | Ga0496109_0049885_2443_3660 | 399 |
| 293 | 3300048914 | Ga0496111_0071828 | Ga0496111_0071828_675_1892 | 399 |
| 294 | 3300048921 | Ga0496118_0066672 | Ga0496118_0066672_600_1910 | 399 |
| 295 | 3300048924 | Ga0496121_0016341 | Ga0496121_0016341_1577_2887 | 399 |
| 296 | 3300048926 | Ga0496123_0117135 | Ga0496123_0117135_112_1422 | 399 |
| 297 | 3300048929 | Ga0496126_0012671 | Ga0496126_0012671_6906_8123 | 399 |
| 298 | 3300048929 | Ga0496126_0074424 | Ga0496126_0074424_760_2070 | 399 |
| 299 | 3300050495 | nmdc:mga04h51_33113_c1 | nmdc:mga04h51_33113_c1_391_1608 | 399 |
| 300 | 3300053080 | Ga0500635_0009758 | Ga0500635_0009758_52_1272 | 399 |
| 301 | 3300053089 | Ga0500581_045915 | Ga0500581_045915_841_2151 | 399 |
| 302 | 3300053093 | Ga0500651_0046722 | Ga0500651_0046722_1138_2355 | 399 |
| 303 | 3300053094 | Ga0500566_0000872 | Ga0500566_0000872_7181_8404 | 399 |
| 304 | 3300053104 | Ga0500556_0000003 | Ga0500556_0000003_391826_393136 | 399 |
| 305 | 3300053108 | Ga0500562_013354 | Ga0500562_013354_217_1527 | 399 |
| 306 | 3300053109 | Ga0500569_021182 | Ga0500569_021182_234_1544 | 399 |
| 307 | 3300053119 | Ga0500595_002014 | Ga0500595_002014_1077_2294 | 399 |
| 308 | 3300053130 | Ga0500642_0000015 | Ga0500642_0000015_121530_122753 | 399 |
| 309 | 3300053131 | Ga0500652_001212 | Ga0500652_001212_1248_2558 | 399 |
| 310 | 3300053134 | Ga0500658_0068983 | Ga0500658_0068983_147_1364 | 399 |
| 311 | 3300053136 | Ga0500559_0000461 | Ga0500559_0000461_11245_12468 | 399 |
| 312 | 3300053139 | Ga0500568_0005182 | Ga0500568_0005182_2515_3825 | 399 |
| 313 | 3300053142 | Ga0500577_0012174 | Ga0500577_0012174_109_1419 | 399 |
| 314 | 3300053150 | Ga0500603_000178 | Ga0500603_000178_14540_15760 | 399 |
| 315 | 3300053151 | Ga0500604_0043294 | Ga0500604_0043294_39_1349 | 399 |
| 316 | 3300053153 | Ga0500616_0000033 | Ga0500616_0000033_73256_74566 | 399 |
| 317 | 3300053156 | Ga0500622_0017137 | Ga0500622_0017137_2157_3467 | 399 |
| 318 | 3300053177 | Ga0500636_0006971 | Ga0500636_0006971_3799_5022 | 399 |
| 319 | 3300053178 | Ga0500637_0001085 | Ga0500637_0001085_4311_5531 | 399 |
| 320 | 3300053730 | Ga0500645_005883 | Ga0500645_005883_1360_2577 | 399 |
| 321 | iso_pu_bacteria | 2507262055 | 2507505912 | 399 |
| 322 | iso_pu_bacteria | 2508501009 | 2508540102 | 399 |
| 323 | iso_pu_bacteria | 2508501042 | 2508696172 | 399 |
| 324 | iso_pu_bacteria | 2513237092 | 2513627455 | 399 |
| 325 | iso_pu_bacteria | 2513237094 | 2513638341 | 399 |
| 326 | iso_pu_bacteria | 2513237096 | 2513656651 | 399 |
| 327 | iso_pu_bacteria | 2513237098 | 2513674285 | 399 |
| 328 | iso_pu_bacteria | 2513237104 | 2513715394 | 399 |
| 329 | iso_pu_bacteria | 2513237137 | 2513858559 | 399 |
| 330 | iso_pu_bacteria | 2513237139 | 2513877256 | 399 |
| 331 | iso_pu_bacteria | 2513237141 | 2513895206 | 399 |
| 332 | iso_pu_bacteria | 2513237145 | 2513917836 | 399 |
| 333 | iso_pu_bacteria | 2513237161 | 2514014631 | 399 |
| 334 | iso_pu_bacteria | 2515154112 | 2515631385 | 399 |
| 335 | iso_pu_bacteria | 2524023205 | 2524441174 | 399 |
| 336 | iso_pu_bacteria | 2524023205 | 2524442983 | 399 |
| 337 | iso_pu_bacteria | 2524023210 | 2524468624 | 399 |
| 338 | iso_pu_bacteria | 2524023228 | 2524533345 | 399 |
| 339 | iso_pu_bacteria | 2524023228 | 2524539359 | 399 |
| 340 | iso_pu_bacteria | 2528768022 | 2528855108 | 399 |
| 341 | iso_pu_bacteria | 2602042107 | 2603857222 | 399 |
| 342 | iso_pu_bacteria | 2602042107 | 2603860073 | 399 |
| 343 | iso_pu_bacteria | 2617270735 | 2617347792 | 399 |
| 344 | iso_pu_bacteria | 2617270741 | 2617374715 | 399 |
| 345 | iso_pu_bacteria | 2617270741 | 2617374716 | 399 |
| 346 | iso_pu_bacteria | 2667528175 | 2671117748 | 399 |
| 347 | iso_pu_bacteria | 2721755755 | 2723842269 | 399 |
| 348 | iso_pu_bacteria | 2728368998 | 2728752155 | 399 |
| 349 | iso_pu_bacteria | 2728368998 | 2728753828 | 399 |
| 350 | iso_pu_bacteria | 2744054633 | 2745081423 | 399 |
| 351 | iso_pu_bacteria | 2744054633 | 2745081927 | 399 |
| 352 | iso_pu_bacteria | 2791355196 | 2793061552 | 399 |
| 353 | iso_pu_bacteria | 2791355197 | 2793073453 | 399 |
| 354 | iso_pu_bacteria | 2802429603 | 2805916144 | 399 |
| 355 | iso_pu_bacteria | 2816332527 | 2818240883 | 399 |
| 356 | iso_pu_bacteria | 2824600985 | 2824603605 | 399 |
| 357 | iso_pu_bacteria | 2824600985 | 2824603606 | 399 |
| 358 | iso_pu_bacteria | 2824609381 | 2824610808 | 399 |
| 359 | iso_pu_bacteria | 2824609381 | 2824610809 | 399 |
| 360 | iso_pu_bacteria | 2824617872 | 2824623187 | 399 |
| 361 | iso_pu_bacteria | 2824626560 | 2824632215 | 399 |
| 362 | iso_pu_bacteria | 2824635225 | 2824642550 | 399 |
| 363 | iso_pu_bacteria | 2824644064 | 2824649852 | 399 |
| 364 | iso_pu_bacteria | 2824653114 | 2824660883 | 399 |
| 365 | iso_pu_bacteria | 2824653114 | 2824660884 | 399 |
| 366 | iso_pu_bacteria | 2824661429 | 2824667334 | 399 |
| 367 | iso_pu_bacteria | 2824671348 | 2824675069 | 399 |
| 368 | iso_pu_bacteria | 2824679649 | 2824684720 | 399 |
| 369 | iso_pu_bacteria | 2824687955 | 2824691804 | 399 |
| 370 | iso_pu_bacteria | 2824696289 | 2824703283 | 399 |
| 371 | iso_pu_bacteria | 2824704595 | 2824709942 | 399 |
| 372 | iso_pu_bacteria | 2824714736 | 2824721215 | 399 |
| 373 | iso_pu_bacteria | 2824723954 | 2824730474 | 399 |
| 374 | iso_pu_bacteria | 2824732956 | 2824737746 | 399 |
| 375 | iso_pu_bacteria | 2824732956 | 2824737747 | 399 |
| 376 | iso_pu_bacteria | 2824746037 | 2824750794 | 399 |
| 377 | iso_pu_bacteria | 2824746037 | 2824750795 | 399 |
| 378 | iso_pu_bacteria | 2824753945 | 2824762452 | 399 |
| 379 | iso_pu_bacteria | 2824763712 | 2824772172 | 399 |
| 380 | iso_pu_bacteria | 2824773399 | 2824775725 | 399 |
| 381 | iso_pu_bacteria | 2838122688 | 2838125101 | 399 |
| 382 | iso_pu_bacteria | 2841941048 | 2841945839 | 399 |
| 383 | iso_pu_bacteria | 2841949485 | 2841957737 | 399 |
| 384 | iso_pu_bacteria | 2841966195 | 2841973350 | 399 |
| 385 | iso_pu_bacteria | 2841974524 | 2841979486 | 399 |
| 386 | iso_pu_bacteria | 2841983080 | 2841989389 | 399 |
| 387 | iso_pu_bacteria | 2842038055 | 2842044380 | 399 |
| 388 | iso_pu_bacteria | 2842045827 | 2842051631 | 399 |
| 389 | iso_pu_bacteria | 2844315083 | 2844316240 | 399 |
| 390 | iso_pu_bacteria | 2844315083 | 2844316241 | 399 |
| 391 | iso_pu_bacteria | 2847930680 | 2847939448 | 399 |
| 392 | iso_pu_bacteria | 2847939898 | 2847941205 | 399 |
| 393 | iso_pu_bacteria | 2857509624 | 2857513329 | 399 |
| 394 | iso_pu_bacteria | 2857524615 | 2857525056 | 399 |
| 395 | iso_pu_bacteria | 2857524615 | 2857530889 | 399 |
| 396 | iso_pu_bacteria | 2874590934 | 2874596352 | 399 |
| 397 | iso_pu_bacteria | 2874604998 | 2874610142 | 399 |
| 398 | iso_pu_bacteria | 2874612657 | 2874620241 | 399 |
| 399 | iso_pu_bacteria | 2874628541 | 2874633326 | 399 |
| 400 | iso_pu_bacteria | 2874645413 | 2874650340 | 399 |
| 401 | iso_pu_bacteria | 2876761206 | 2876761635 | 399 |
| 402 | iso_pu_bacteria | 2876761206 | 2876761636 | 399 |
| 403 | iso_pu_bacteria | 2876771140 | 2876776817 | 399 |
| 404 | iso_pu_bacteria | 2876818435 | 2876824607 | 399 |
| 405 | iso_pu_bacteria | 2879074833 | 2879080954 | 399 |
| 406 | iso_pu_bacteria | 2879083081 | 2879091110 | 399 |
| 407 | iso_pu_bacteria | 2879099564 | 2879106666 | 399 |
| 408 | iso_pu_bacteria | 2879110137 | 2879117010 | 399 |
| 409 | iso_pu_bacteria | 2879127579 | 2879133800 | 399 |
| 410 | iso_pu_bacteria | 2879142872 | 2879143060 | 399 |
| 411 | iso_pu_bacteria | 2881364244 | 2881369616 | 399 |
| 412 | iso_pu_bacteria | 2885366525 | 2885367742 | 399 |
| 413 | iso_pu_bacteria | 2885366525 | 2885367743 | 399 |
| 414 | iso_pu_bacteria | 2885374607 | 2885381402 | 399 |
| 415 | iso_pu_bacteria | 2885383462 | 2885386437 | 399 |
| 416 | iso_pu_bacteria | 2885383462 | 2885387818 | 399 |
| 417 | iso_pu_bacteria | 2885409591 | 2885418287 | 399 |
| 418 | iso_pu_bacteria | 2888378607 | 2888387726 | 399 |
| 419 | iso_pu_bacteria | 2888388044 | 2888389945 | 399 |
| 420 | iso_pu_bacteria | 2888388044 | 2888389946 | 399 |
| 421 | iso_pu_bacteria | 2888419890 | 2888421156 | 399 |
| 422 | iso_pu_bacteria | 2888419890 | 2888421157 | 399 |
| 423 | iso_pu_bacteria | 2889033259 | 2889036391 | 399 |
| 424 | iso_pu_bacteria | 2893066018 | 2893066391 | 399 |
| 425 | iso_pu_bacteria | 2893066018 | 2893069643 | 399 |
| 426 | iso_pu_bacteria | 2903727486 | 2903728422 | 399 |
| 427 | iso_pu_bacteria | 2903727486 | 2903728423 | 399 |
| 428 | iso_pu_bacteria | 2903768456 | 2903772232 | 399 |
| 429 | iso_pu_bacteria | 2904666416 | 2904671528 | 399 |
| 430 | iso_pu_bacteria | 2904690495 | 2904696550 | 399 |
| 431 | iso_pu_bacteria | 2904699407 | 2904710033 | 399 |
| 432 | iso_pu_bacteria | 2904711408 | 2904719828 | 399 |
| 433 | iso_pu_bacteria | 2906602504 | 2906606564 | 399 |
| 434 | iso_pu_bacteria | 2906602504 | 2906606565 | 399 |
| 435 | iso_pu_bacteria | 2906610324 | 2906614471 | 399 |
| 436 | iso_pu_bacteria | 2906626472 | 2906631442 | 399 |
| 437 | iso_pu_bacteria | 2906635258 | 2906636779 | 399 |
| 438 | iso_pu_bacteria | 2906643746 | 2906650307 | 399 |
| 439 | iso_pu_bacteria | 2906643746 | 2906650308 | 399 |
| 440 | iso_pu_bacteria | 2906660503 | 2906661372 | 399 |
| 441 | iso_pu_bacteria | 2908775508 | 2908777198 | 399 |
| 442 | iso_pu_bacteria | 2908775508 | 2908777199 | 399 |
| 443 | iso_pu_bacteria | 2919073203 | 2919077898 | 399 |
| 444 | iso_pu_bacteria | 2919073203 | 2919078941 | 399 |
| 445 | iso_pu_bacteria | 2922361189 | 2922366732 | 399 |
| 446 | iso_pu_bacteria | 2922368715 | 2922377432 | 399 |
| 447 | iso_pu_bacteria | 2922386360 | 2922389365 | 399 |
| 448 | iso_pu_bacteria | 2922393267 | 2922398524 | 399 |
| 449 | iso_pu_bacteria | 2922425934 | 2922426307 | 399 |
| 450 | iso_pu_bacteria | 2922425934 | 2922429369 | 399 |
| 451 | iso_pu_bacteria | 2929615660 | 2929622222 | 399 |
| 452 | iso_pu_bacteria | 2929624759 | 2929630131 | 399 |
| 453 | iso_pu_bacteria | 2932784394 | 2932787938 | 399 |
| 454 | iso_pu_bacteria | 2932794094 | 2932799428 | 399 |
| 455 | iso_pu_bacteria | 2932801729 | 2932802173 | 399 |
| 456 | iso_pu_bacteria | 2932809354 | 2932813313 | 399 |
| 457 | iso_pu_bacteria | 2932818245 | 2932820010 | 399 |
| 458 | iso_pu_bacteria | 2932828146 | 2932832926 | 399 |
| 459 | iso_pu_bacteria | 2933577622 | 2933584164 | 399 |
| 460 | iso_pu_bacteria | 2935608549 | 2935614333 | 399 |
| 461 | iso_pu_bacteria | 2935616580 | 2935620411 | 399 |
| 462 | iso_pu_bacteria | 2935630451 | 2935632690 | 399 |
| 463 | iso_pu_bacteria | 2935630451 | 2935633746 | 399 |
| 464 | iso_pu_bacteria | 2935638405 | 2935640735 | 399 |
| 465 | iso_pu_bacteria | 2935648319 | 2935649363 | 399 |
| 466 | iso_pu_bacteria | 2935656913 | 2935657865 | 399 |
| 467 | iso_pu_bacteria | 2935665750 | 2935668927 | 399 |
| 468 | iso_pu_bacteria | 2935675223 | 2935681347 | 399 |
| 469 | iso_pu_bacteria | 2935684952 | 2935687236 | 399 |
| 470 | iso_pu_bacteria | 2935694250 | 2935696793 | 399 |
| 471 | iso_pu_bacteria | 2935703347 | 2935709115 | 399 |
| 472 | iso_pu_bacteria | 2935713505 | 2935716924 | 399 |
| 473 | iso_pu_bacteria | 2935722832 | 2935722951 | 399 |
| 474 | iso_pu_bacteria | 2935732158 | 2935734508 | 399 |
| 475 | iso_pu_bacteria | 2935741537 | 2935744701 | 399 |
| 476 | iso_pu_bacteria | 2935750917 | 2935753202 | 399 |
| 477 | iso_pu_bacteria | 2935760218 | 2935767606 | 399 |
| 478 | iso_pu_bacteria | 2935769743 | 2935770201 | 399 |
| 479 | iso_pu_bacteria | 2935777560 | 2935777769 | 399 |
| 480 | iso_pu_bacteria | 2935785616 | 2935786745 | 399 |
| 481 | iso_pu_bacteria | 2935793552 | 2935794799 | 399 |
| 482 | iso_pu_bacteria | 2935801545 | 2935804845 | 399 |
| 483 | iso_pu_bacteria | 2935810662 | 2935815994 | 399 |
| 484 | iso_pu_bacteria | 2935819856 | 2935826551 | 399 |
| 485 | iso_pu_bacteria | 2935827899 | 2935832242 | 399 |
| 486 | iso_pu_bacteria | 2935837841 | 2935840928 | 399 |
| 487 | iso_pu_bacteria | 2935847175 | 2935851155 | 399 |
| 488 | iso_pu_bacteria | 2935855204 | 2935859297 | 399 |
| 489 | iso_pu_bacteria | 2935864058 | 2935864481 | 399 |
| 490 | iso_pu_bacteria | 2935873716 | 2935875167 | 399 |
| 491 | iso_pu_bacteria | 2935883170 | 2935887329 | 399 |
| 492 | iso_pu_bacteria | 2935908558 | 2935913204 | 399 |
| 493 | iso_pu_bacteria | 2935916978 | 2935922626 | 399 |
| 494 | iso_pu_bacteria | 2935926038 | 2935930871 | 399 |
| 495 | iso_pu_bacteria | 2935934488 | 2935939795 | 399 |
| 496 | iso_pu_bacteria | 2935942939 | 2935946744 | 399 |
| 497 | iso_pu_bacteria | 2935951376 | 2935956055 | 399 |
| 498 | iso_pu_bacteria | 2935959822 | 2935964959 | 399 |
| 499 | iso_pu_bacteria | 2935967501 | 2935972848 | 399 |
| 500 | iso_pu_bacteria | 2935975950 | 2935978235 | 399 |
| 501 | iso_pu_bacteria | 2935984226 | 2935985639 | 399 |
| 502 | iso_pu_bacteria | 2935992306 | 2935995858 | 399 |
| 503 | iso_pu_bacteria | 2936002035 | 2936005769 | 399 |
| 504 | iso_pu_bacteria | 2936011229 | 2936012084 | 399 |
| 505 | iso_pu_bacteria | 2936019824 | 2936020835 | 399 |
| 506 | iso_pu_bacteria | 2936028420 | 2936029377 | 399 |
| 507 | iso_pu_bacteria | 2936037263 | 2936041897 | 399 |
| 508 | iso_pu_bacteria | 2936046547 | 2936048299 | 399 |
| 509 | iso_pu_bacteria | 2936055302 | 2936056590 | 399 |
| 510 | iso_pu_bacteria | 2940556831 | 2940559115 | 399 |
| 511 | iso_pu_bacteria | 2941507105 | 2941508646 | 399 |
| 512 | iso_pu_bacteria | 2941507105 | 2941510637 | 399 |
| 513 | iso_pu_bacteria | 2941515067 | 2941516476 | 399 |
| 514 | iso_pu_bacteria | 2941515067 | 2941517624 | 399 |
| 515 | iso_pu_bacteria | 2941523033 | 2941524508 | 399 |
| 516 | iso_pu_bacteria | 2941523033 | 2941525641 | 399 |
| 517 | iso_pu_bacteria | 2941531003 | 2941534598 | 399 |
| 518 | iso_pu_bacteria | 2941531003 | 2941534600 | 399 |
| 519 | iso_pu_bacteria | 2941538514 | 2941541810 | 399 |
| 520 | iso_pu_bacteria | 3005483717 | 3005491059 | 399 |
| 521 | iso_pu_bacteria | 3005483717 | 3005491060 | 399 |
| 522 | iso_pu_bacteria | 3005506211 | 3005510900 | 399 |
| 523 | iso_pu_bacteria | 3005587118 | 3005592183 | 399 |
| 524 | iso_pu_bacteria | 3005587118 | 3005592184 | 399 |
| 525 | iso_pu_bacteria | 3005594810 | 3005595852 | 399 |
| 526 | iso_pu_bacteria | 3005594810 | 3005595853 | 399 |
| 527 | iso_pu_bacteria | 3005710791 | 3005711800 | 399 |
| 528 | iso_pu_bacteria | 3005718088 | 3005719049 | 399 |
| 529 | iso_pu_bacteria | 3005718088 | 3005719051 | 399 |
| 530 | iso_pu_bacteria | 8006926726 | 8006932271 | 399 |
| 531 | iso_pu_bacteria | 8006933436 | 8006937011 | 399 |
| 532 | iso_pu_bacteria | 8006964411 | 8006966325 | 399 |
| 533 | iso_pu_bacteria | 8006973647 | 8006976976 | 399 |
| 534 | iso_pu_bacteria | 8006984368 | 8006993143 | 399 |
| 535 | iso_pu_bacteria | 8006994254 | 8006996995 | 399 |
| 536 | iso_pu_bacteria | 8016511872 | 8016517275 | 399 |
| 537 | iso_pu_bacteria | 8016530956 | 8016532044 | 399 |
| 538 | iso_pu_bacteria | 8016539877 | 8016545253 | 399 |
| 539 | iso_pu_bacteria | 8016548790 | 8016556836 | 399 |
| 540 | iso_pu_bacteria | 8016557553 | 8016565188 | 399 |
| 541 | iso_pu_bacteria | 8016566248 | 8016570331 | 399 |
| 542 | iso_pu_bacteria | 8016575299 | 8016582879 | 399 |
| 543 | iso_pu_bacteria | 8016583857 | 8016585415 | 399 |
| 544 | iso_pu_bacteria | 8016583857 | 8016585416 | 399 |
| 545 | iso_pu_bacteria | 8016595262 | 8016602832 | 399 |
| 546 | iso_pu_bacteria | 8016603502 | 8016605700 | 399 |
| 547 | iso_pu_bacteria | 8016630954 | 8016634900 | 399 |
| 548 | iso_pu_bacteria | 8017057580 | 8017059320 | 399 |
| 549 | iso_pu_bacteria | 8019530166 | 8019531860 | 399 |
| 550 | iso_pu_bacteria | 8019538911 | 8019539670 | 399 |
| 551 | iso_pu_bacteria | 8019547302 | 8019550981 | 399 |
| 552 | iso_pu_bacteria | 8019555841 | 8019561666 | 399 |
| 553 | iso_pu_bacteria | 8019565922 | 8019571741 | 399 |
| 554 | iso_pu_bacteria | 8019576017 | 8019576306 | 399 |
| 555 | iso_pu_bacteria | 8019586578 | 8019594180 | 399 |
| 556 | iso_pu_bacteria | 8019608314 | 8019611129 | 399 |
| 557 | iso_pu_bacteria | 8019619141 | 8019621978 | 399 |
| 558 | iso_pu_bacteria | 8019629233 | 8019631343 | 399 |
| 559 | iso_pu_bacteria | 8019638758 | 8019639275 | 399 |
| 560 | iso_pu_bacteria | 8019648815 | 8019651415 | 399 |
| 561 | iso_pu_bacteria | 8019659431 | 8019668146 | 399 |
| 562 | iso_pu_bacteria | 8019668869 | 8019677612 | 399 |
| 563 | iso_pu_bacteria | 8019687851 | 8019693313 | 399 |
| 564 | iso_pu_bacteria | 8055742211 | 8055743529 | 399 |
| 565 | iso_pu_bacteria | 8056673599 | 8056678181 | 399 |
| 566 | iso_pu_bacteria | 8056681323 | 8056683427 | 399 |
| 567 | iso_pu_bacteria | 8056967851 | 8056974178 | 399 |
| 568 | 3300005336 | Ga0070680_100001453 | Ga0070680_1000014531 | 400 |
| 569 | 3300005455 | Ga0070663_100004678 | Ga0070663_1000046782 | 400 |
| 570 | 3300005458 | Ga0070681_10000334 | Ga0070681_1000033425 | 400 |
| 571 | 3300005530 | Ga0070679_100005911 | Ga0070679_1000059118 | 400 |
| 572 | 3300005530 | Ga0070679_100213723 | Ga0070679_1002137232 | 400 |
| 573 | 3300005539 | Ga0068853_100023239 | Ga0068853_1000232392 | 400 |
| 574 | 3300005548 | Ga0070665_100200140 | Ga0070665_1002001402 | 400 |
| 575 | 3300006943 | Ga0099822_1000541 | Ga0099822_10005418 | 400 |
| 576 | 3300009093 | Ga0105240_10004565 | Ga0105240_100045652 | 400 |
| 577 | 3300009551 | Ga0105238_10069691 | Ga0105238_100696912 | 400 |
| 578 | 3300010375 | Ga0105239_10244105 | Ga0105239_102441052 | 400 |
| 579 | 3300025909 | Ga0207705_10090067 | Ga0207705_100900672 | 400 |
| 580 | 3300025912 | Ga0207707_10000134 | Ga0207707_1000013468 | 400 |
| 581 | 3300025912 | Ga0207707_10031981 | Ga0207707_100319812 | 400 |
| 582 | 3300025917 | Ga0207660_10050275 | Ga0207660_100502751 | 400 |
| 583 | 3300025920 | Ga0207649_10097219 | Ga0207649_100972192 | 400 |
| 584 | 3300025921 | Ga0207652_10133098 | Ga0207652_101330982 | 400 |
| 585 | 3300025949 | Ga0207667_10092869 | Ga0207667_100928692 | 400 |
| 586 | 3300025949 | Ga0207667_10412598 | Ga0207667_104125981 | 400 |
| 587 | 3300026041 | Ga0207639_10107050 | Ga0207639_101070502 | 400 |
| 588 | 3300026121 | Ga0207683_10038696 | Ga0207683_100386962 | 400 |
| 589 | 3300028379 | Ga0268266_10100363 | Ga0268266_101003632 | 400 |
| 590 | 3300031730 | Ga0307516_10120986 | Ga0307516_101209862 | 400 |
| 591 | 3300037312 | Ga0395899_0048061 | Ga0395899_0048061_295_1515 | 400 |
| 592 | 3300037418 | Ga0395900_0002675 | Ga0395900_0002675_4882_6102 | 400 |
| 593 | 3300037466 | Ga0395898_0005085 | Ga0395898_0005085_9644_10864 | 400 |
| 594 | 3300046522 | Ga0495643_0032765 | Ga0495643_0032765_619_1851 | 400 |
| 595 | 3300046543 | Ga0495645_0021151 | Ga0495645_0021151_1624_2850 | 400 |
| 596 | 3300046660 | Ga0495625_0051694 | Ga0495625_0051694_819_2051 | 400 |
| 597 | 3300048091 | Ga0495626_0097759 | Ga0495626_0097759_42_1268 | 400 |
| 598 | 3300048922 | Ga0496119_0033943 | Ga0496119_0033943_208_1461 | 400 |
| 599 | 3300048926 | Ga0496123_0105932 | Ga0496123_0105932_19_1239 | 400 |
| 600 | 3300049569 | Ga0501032_0022837 | Ga0501032_0022837_1034_2254 | 400 |
| 601 | 3300049823 | Ga0501044_0086417 | Ga0501044_0086417_813_2033 | 400 |
| 602 | 3300053094 | Ga0500566_0000872 | Ga0500566_0000872_2993_4213 | 400 |
| 603 | 3300053098 | Ga0500650_0001140 | Ga0500650_0001140_2632_3864 | 400 |
| 604 | 3300053104 | Ga0500556_0000003 | Ga0500556_0000003_387620_388852 | 400 |
| 605 | 3300053136 | Ga0500559_0000461 | Ga0500559_0000461_15436_16656 | 400 |
| 606 | 3300053139 | Ga0500568_0020846 | Ga0500568_0020846_132_1364 | 400 |
| 607 | 3300053153 | Ga0500616_0000033 | Ga0500616_0000033_77539_78771 | 400 |
| 608 | 3300053156 | Ga0500622_0020356 | Ga0500622_0020356_1532_2764 | 400 |
| 609 | 3300053161 | Ga0500634_0061290 | Ga0500634_0061290_380_1609 | 400 |
| 610 | 3300053177 | Ga0500636_0042809 | Ga0500636_0042809_16_1236 | 400 |
| 611 | 3300053178 | Ga0500637_0032567 | Ga0500637_0032567_1004_2224 | 400 |
| 612 | iso_pu_bacteria | 2508501128 | 2509151531 | 400 |
| 613 | iso_pu_bacteria | 2513237141 | 2513891619 | 400 |
| 614 | 3300003203 | JGI25406J46586_10005250 | JGI25406J46586_100052503 | 401 |
| 615 | 3300003203 | JGI25406J46586_10008729 | JGI25406J46586_100087294 | 401 |
| 616 | 3300003659 | JGI25404J52841_10001487 | JGI25404J52841_100014874 | 401 |
| 617 | 3300003911 | JGI25405J52794_10012251 | JGI25405J52794_100122511 | 401 |
| 618 | 3300005336 | Ga0070680_100124543 | Ga0070680_1001245432 | 401 |
| 619 | 3300005436 | Ga0070713_100049823 | Ga0070713_1000498231 | 401 |
| 620 | 3300005458 | Ga0070681_10049053 | Ga0070681_100490533 | 401 |
| 621 | 3300005536 | Ga0070697_100002686 | Ga0070697_1000026863 | 401 |
| 622 | 3300005545 | Ga0070695_100004100 | Ga0070695_1000041007 | 401 |
| 623 | 3300005545 | Ga0070695_100141411 | Ga0070695_1001414112 | 401 |
| 624 | 3300005548 | Ga0070665_100308563 | Ga0070665_1003085632 | 401 |
| 625 | 3300005937 | Ga0081455_10000763 | Ga0081455_1000076312 | 401 |
| 626 | 3300005937 | Ga0081455_10003860 | Ga0081455_1000386010 | 401 |
| 627 | 3300005937 | Ga0081455_10017893 | Ga0081455_100178937 | 401 |
| 628 | 3300005983 | Ga0081540_1013655 | Ga0081540_10136553 | 401 |
| 629 | 3300005983 | Ga0081540_1026650 | Ga0081540_10266502 | 401 |
| 630 | 3300005983 | Ga0081540_1036933 | Ga0081540_10369332 | 401 |
| 631 | 3300005985 | Ga0081539_10000157 | Ga0081539_1000015745 | 401 |
| 632 | 3300005985 | Ga0081539_10000498 | Ga0081539_1000049868 | 401 |
| 633 | 3300005985 | Ga0081539_10031508 | Ga0081539_100315083 | 401 |
| 634 | 3300006051 | Ga0075364_10035769 | Ga0075364_100357693 | 401 |
| 635 | 3300006914 | Ga0075436_100000818 | Ga0075436_1000008189 | 401 |
| 636 | 3300013102 | Ga0157371_10008618 | Ga0157371_100086187 | 401 |
| 637 | 3300013104 | Ga0157370_10080805 | Ga0157370_100808053 | 401 |
| 638 | 3300021384 | Ga0213876_10000505 | Ga0213876_1000050519 | 401 |
| 639 | 3300021384 | Ga0213876_10005094 | Ga0213876_100050942 | 401 |
| 640 | 3300021388 | Ga0213875_10006397 | Ga0213875_100063974 | 401 |
| 641 | 3300025906 | Ga0207699_10019947 | Ga0207699_100199471 | 401 |
| 642 | 3300025914 | Ga0207671_10053909 | Ga0207671_100539092 | 401 |
| 643 | 3300025924 | Ga0207694_10027026 | Ga0207694_100270262 | 401 |
| 644 | 3300025928 | Ga0207700_10137409 | Ga0207700_101374092 | 401 |
| 645 | 3300025929 | Ga0207664_10020618 | Ga0207664_100206183 | 401 |
| 646 | 3300025961 | Ga0207712_10000950 | Ga0207712_100009507 | 401 |
| 647 | 3300027671 | Ga0209588_1013802 | Ga0209588_10138024 | 401 |
| 648 | 3300031242 | Ga0265329_10006285 | Ga0265329_100062854 | 401 |
| 649 | 3300031247 | Ga0265340_10036924 | Ga0265340_100369242 | 401 |
| 650 | 3300031712 | Ga0265342_10014580 | Ga0265342_100145804 | 401 |
| 651 | 3300035113 | Ga0373936_0008794 | Ga0373936_0008794_1188_2408 | 401 |
| 652 | 3300035116 | Ga0373945_0054002 | Ga0373945_0054002_66_1289 | 401 |
| 653 | 3300037853 | Ga0436364_0259789 | Ga0436364_0259789_464_1693 | 401 |
| 654 | 3300039437 | Ga0436365_0021793 | Ga0436365_0021793_39678_40907 | 401 |
| 655 | 3300039437 | Ga0436365_0235812 | Ga0436365_0235812_1189_2412 | 401 |
| 656 | 3300039437 | Ga0436365_0400047 | Ga0436365_0400047_1416_2645 | 401 |
| 657 | 3300039437 | Ga0436365_1161315 | Ga0436365_1161315_22657_23886 | 401 |
| 658 | 3300039447 | Ga0436361_0885563 | Ga0436361_0885563_218_1438 | 401 |
| 659 | 3300039450 | Ga0436363_0045132 | Ga0436363_0045132_6442_7671 | 401 |
| 660 | 3300039450 | Ga0436363_0080678 | Ga0436363_0080678_5249_6478 | 401 |
| 661 | 3300039453 | Ga0436362_0719825 | Ga0436362_0719825_32_1261 | 401 |
| 662 | 3300039453 | Ga0436362_0768037 | Ga0436362_0768037_4446_5675 | 401 |
| 663 | 3300044656 | Ga0466969_0086058 | Ga0466969_0086058_227_1450 | 401 |
| 664 | 3300044684 | Ga0466966_0081685 | Ga0466966_0081685_652_1875 | 401 |
| 665 | 3300046455 | Ga0495603_0101766 | Ga0495603_0101766_388_1611 | 401 |
| 666 | 3300048915 | Ga0496112_0049960 | Ga0496112_0049960_1079_2302 | 401 |
| 667 | 3300048924 | Ga0496121_0098775 | Ga0496121_0098775_667_1902 | 401 |
| 668 | 3300049568 | Ga0501031_0048412 | Ga0501031_0048412_1345_2568 | 401 |
| 669 | 3300049569 | Ga0501032_0000073 | Ga0501032_0000073_74446_75669 | 401 |
| 670 | 3300049570 | Ga0501033_0000136 | Ga0501033_0000136_36471_37694 | 401 |
| 671 | 3300049571 | Ga0501034_0000251 | Ga0501034_0000251_55022_56245 | 401 |
| 672 | 3300049572 | Ga0501036_0000036 | Ga0501036_0000036_33269_34492 | 401 |
| 673 | 3300049573 | Ga0501037_0001715 | Ga0501037_0001715_13523_14746 | 401 |
| 674 | 3300049574 | Ga0501038_0000428 | Ga0501038_0000428_1804_3027 | 401 |
| 675 | 3300049575 | Ga0501039_0000273 | Ga0501039_0000273_28591_29814 | 401 |
| 676 | 3300049579 | Ga0501043_0000165 | Ga0501043_0000165_47498_48721 | 401 |
| 677 | 3300049580 | Ga0501046_0001143 | Ga0501046_0001143_11231_12454 | 401 |
| 678 | 3300049581 | Ga0501047_0000340 | Ga0501047_0000340_18793_20016 | 401 |
| 679 | 3300049583 | Ga0501067_0027971 | Ga0501067_0027971_1592_2815 | 401 |
| 680 | 3300049584 | Ga0501068_0000255 | Ga0501068_0000255_5883_7106 | 401 |
| 681 | 3300049586 | Ga0501070_0007747 | Ga0501070_0007747_4253_5476 | 401 |
| 682 | 3300049587 | Ga0501071_0012098 | Ga0501071_0012098_3257_4480 | 401 |
| 683 | 3300049589 | Ga0501073_0000037 | Ga0501073_0000037_52781_54004 | 401 |
| 684 | 3300049590 | Ga0501074_0000133 | Ga0501074_0000133_9827_11050 | 401 |
| 685 | 3300049741 | Ga0501079_0001057 | Ga0501079_0001057_14787_16010 | 401 |
| 686 | 3300049742 | Ga0501080_0000054 | Ga0501080_0000054_6744_7967 | 401 |
| 687 | 3300049744 | Ga0501083_0003724 | Ga0501083_0003724_2819_4042 | 401 |
| 688 | 3300049822 | Ga0501035_0000142 | Ga0501035_0000142_31317_32540 | 401 |
| 689 | 3300049823 | Ga0501044_0000414 | Ga0501044_0000414_31495_32718 | 401 |
| 690 | 3300050513 | nmdc:mga0rr50_7098_c1 | nmdc:mga0rr50_7098_c1_5216_6442 | 401 |
| 691 | 3300050514 | nmdc:mga08x19_21_c1 | nmdc:mga08x19_21_c1_62461_63687 | 401 |
| 692 | 3300053142 | Ga0500577_0000266 | Ga0500577_0000266_1498_2721 | 401 |
| 693 | iso_pu_bacteria | 2617270735 | 2617347794 | 401 |
| 694 | iso_pu_bacteria | 2841957949 | 2841960589 | 401 |
| 695 | iso_pu_bacteria | 3005506211 | 3005510902 | 401 |
| 696 | iso_pu_bacteria | 8016575299 | 8016582881 | 401 |
| 697 | 3300003203 | JGI25406J46586_10010371 | JGI25406J46586_100103713 | 402 |
| 698 | 3300003215 | JGI25153J46596_10001097 | JGI25153J46596_100010972 | 402 |
| 699 | 3300003215 | JGI25153J46596_10015079 | JGI25153J46596_100150792 | 402 |
| 700 | 3300005329 | Ga0070683_100138095 | Ga0070683_1001380952 | 402 |
| 701 | 3300005336 | Ga0070680_100009025 | Ga0070680_1000090253 | 402 |
| 702 | 3300005337 | Ga0070682_100050250 | Ga0070682_1000502502 | 402 |
| 703 | 3300005338 | Ga0068868_100147843 | Ga0068868_1001478432 | 402 |
| 704 | 3300005347 | Ga0070668_100013950 | Ga0070668_1000139504 | 402 |
| 705 | 3300005366 | Ga0070659_100107317 | Ga0070659_1001073172 | 402 |
| 706 | 3300005434 | Ga0070709_10059854 | Ga0070709_100598542 | 402 |
| 707 | 3300005455 | Ga0070663_100040232 | Ga0070663_1000402322 | 402 |
| 708 | 3300005458 | Ga0070681_10007089 | Ga0070681_100070895 | 402 |
| 709 | 3300005535 | Ga0070684_100034954 | Ga0070684_1000349543 | 402 |
| 710 | 3300005548 | Ga0070665_100059932 | Ga0070665_1000599322 | 402 |
| 711 | 3300005548 | Ga0070665_100232941 | Ga0070665_1002329412 | 402 |
| 712 | 3300005549 | Ga0070704_100145858 | Ga0070704_1001458582 | 402 |
| 713 | 3300005578 | Ga0068854_100218555 | Ga0068854_1002185551 | 402 |
| 714 | 3300005615 | Ga0070702_100065769 | Ga0070702_1000657692 | 402 |
| 715 | 3300005937 | Ga0081455_10006164 | Ga0081455_100061646 | 402 |
| 716 | 3300005937 | Ga0081455_10006808 | Ga0081455_100068085 | 402 |
| 717 | 3300005937 | Ga0081455_10063174 | Ga0081455_100631742 | 402 |
| 718 | 3300005983 | Ga0081540_1003768 | Ga0081540_10037683 | 402 |
| 719 | 3300005983 | Ga0081540_1004916 | Ga0081540_10049166 | 402 |
| 720 | 3300005983 | Ga0081540_1006034 | Ga0081540_10060343 | 402 |
| 721 | 3300005983 | Ga0081540_1010678 | Ga0081540_10106782 | 402 |
| 722 | 3300005983 | Ga0081540_1011165 | Ga0081540_10111654 | 402 |
| 723 | 3300005983 | Ga0081540_1013542 | Ga0081540_10135421 | 402 |
| 724 | 3300005983 | Ga0081540_1028625 | Ga0081540_10286252 | 402 |
| 725 | 3300005983 | Ga0081540_1032911 | Ga0081540_10329111 | 402 |
| 726 | 3300005985 | Ga0081539_10006394 | Ga0081539_100063949 | 402 |
| 727 | 3300005985 | Ga0081539_10027357 | Ga0081539_100273571 | 402 |
| 728 | 3300005985 | Ga0081539_10078330 | Ga0081539_100783302 | 402 |
| 729 | 3300006038 | Ga0075365_10036401 | Ga0075365_100364012 | 402 |
| 730 | 3300006038 | Ga0075365_10086729 | Ga0075365_100867292 | 402 |
| 731 | 3300006051 | Ga0075364_10038215 | Ga0075364_100382151 | 402 |
| 732 | 3300006353 | Ga0075370_10124613 | Ga0075370_101246131 | 402 |
| 733 | 3300006942 | Ga0099824_1022298 | Ga0099824_10222982 | 402 |
| 734 | 3300006943 | Ga0099822_1000541 | Ga0099822_100054111 | 402 |
| 735 | 3300009093 | Ga0105240_10092667 | Ga0105240_100926673 | 402 |
| 736 | 3300009094 | Ga0111539_10100579 | Ga0111539_101005792 | 402 |
| 737 | 3300009545 | Ga0105237_10028530 | Ga0105237_100285304 | 402 |
| 738 | 3300009551 | Ga0105238_10126795 | Ga0105238_101267953 | 402 |
| 739 | 3300009551 | Ga0105238_10147307 | Ga0105238_101473072 | 402 |
| 740 | 3300010159 | Ga0099796_10025862 | Ga0099796_100258622 | 402 |
| 741 | 3300010375 | Ga0105239_10079453 | Ga0105239_100794531 | 402 |
| 742 | 3300025297 | Ga0209758_1036184 | Ga0209758_10361841 | 402 |
| 743 | 3300025903 | Ga0207680_10209214 | Ga0207680_102092141 | 402 |
| 744 | 3300025904 | Ga0207647_10086530 | Ga0207647_100865302 | 402 |
| 745 | 3300025912 | Ga0207707_10101835 | Ga0207707_101018351 | 402 |
| 746 | 3300025914 | Ga0207671_10034723 | Ga0207671_100347234 | 402 |
| 747 | 3300025924 | Ga0207694_10031956 | Ga0207694_100319564 | 402 |
| 748 | 3300025924 | Ga0207694_10105856 | Ga0207694_101058562 | 402 |
| 749 | 3300025924 | Ga0207694_10150279 | Ga0207694_101502791 | 402 |
| 750 | 3300025927 | Ga0207687_10198813 | Ga0207687_101988131 | 402 |
| 751 | 3300025934 | Ga0207686_10088955 | Ga0207686_100889552 | 402 |
| 752 | 3300025935 | Ga0207709_10013431 | Ga0207709_100134314 | 402 |
| 753 | 3300025949 | Ga0207667_10373801 | Ga0207667_103738012 | 402 |
| 754 | 3300025961 | Ga0207712_10010623 | Ga0207712_100106235 | 402 |
| 755 | 3300025972 | Ga0207668_10079551 | Ga0207668_100795512 | 402 |
| 756 | 3300027357 | Ga0209589_1000015 | Ga0209589_1000015160 | 402 |
| 757 | 3300027361 | Ga0209489_100015 | Ga0209489_100015160 | 402 |
| 758 | 3300027363 | Ga0209700_100025 | Ga0209700_100025160 | 402 |
| 759 | 3300027512 | Ga0209179_1015250 | Ga0209179_10152502 | 402 |
| 760 | 3300027671 | Ga0209588_1000429 | Ga0209588_10004296 | 402 |
| 761 | 3300027671 | Ga0209588_1010370 | Ga0209588_10103702 | 402 |
| 762 | 3300027866 | Ga0209813_10015342 | Ga0209813_100153422 | 402 |
| 763 | 3300027907 | Ga0207428_10083135 | Ga0207428_100831352 | 402 |
| 764 | 3300028379 | Ga0268266_10001575 | Ga0268266_100015753 | 402 |
| 765 | 3300028379 | Ga0268266_10006809 | Ga0268266_100068096 | 402 |
| 766 | 3300028379 | Ga0268266_10102141 | Ga0268266_101021412 | 402 |
| 767 | 3300028380 | Ga0268265_10015236 | Ga0268265_100152362 | 402 |
| 768 | 3300028380 | Ga0268265_10039380 | Ga0268265_100393803 | 402 |
| 769 | 3300028381 | Ga0268264_10081087 | Ga0268264_100810872 | 402 |
| 770 | 3300028786 | Ga0307517_10000063 | Ga0307517_10000063126 | 402 |
| 771 | 3300028794 | Ga0307515_10168249 | Ga0307515_101682492 | 402 |
| 772 | 3300031241 | Ga0265325_10005166 | Ga0265325_100051666 | 402 |
| 773 | 3300031247 | Ga0265340_10011932 | Ga0265340_100119323 | 402 |
| 774 | 3300031249 | Ga0265339_10007149 | Ga0265339_100071491 | 402 |
| 775 | 3300031507 | Ga0307509_10101201 | Ga0307509_101012011 | 402 |
| 776 | 3300031507 | Ga0307509_10219851 | Ga0307509_102198512 | 402 |
| 777 | 3300031595 | Ga0265313_10073786 | Ga0265313_100737862 | 402 |
| 778 | 3300031616 | Ga0307508_10032756 | Ga0307508_100327564 | 402 |
| 779 | 3300031616 | Ga0307508_10064434 | Ga0307508_100644342 | 402 |
| 780 | 3300031712 | Ga0265342_10140040 | Ga0265342_101400401 | 402 |
| 781 | 3300031730 | Ga0307516_10161149 | Ga0307516_101611492 | 402 |
| 782 | 3300031901 | Ga0307406_10023316 | Ga0307406_100233161 | 402 |
| 783 | 3300032126 | Ga0307415_100017008 | Ga0307415_1000170083 | 402 |
| 784 | 3300033180 | Ga0307510_10017326 | Ga0307510_100173261 | 402 |
| 785 | 3300033180 | Ga0307510_10018417 | Ga0307510_100184175 | 402 |
| 786 | 3300033442 | Ga0315911_1000037 | Ga0315911_100003714 | 402 |
| 787 | 3300033442 | Ga0315911_1000037 | Ga0315911_100003715 | 402 |
| 788 | 3300035116 | Ga0373945_0062970 | Ga0373945_0062970_39_1265 | 402 |
| 789 | 3300035695 | Ga0373927_0147212 | Ga0373927_0147212_235_1467 | 402 |
| 790 | 3300037418 | Ga0395900_0025734 | Ga0395900_0025734_1984_3210 | 402 |
| 791 | 3300037466 | Ga0395898_0027242 | Ga0395898_0027242_2091_3317 | 402 |
| 792 | 3300037466 | Ga0395898_0035859 | Ga0395898_0035859_997_2223 | 402 |
| 793 | 3300037471 | Ga0395905_0128435 | Ga0395905_0128435_627_1853 | 402 |
| 794 | 3300038443 | Ga0395901_0230677 | Ga0395901_0230677_517_1743 | 402 |
| 795 | 3300039437 | Ga0436365_0007077 | Ga0436365_0007077_10532_11764 | 402 |
| 796 | 3300039437 | Ga0436365_1604062 | Ga0436365_1604062_332_1558 | 402 |
| 797 | 3300045049 | Ga0466959_0081443 | Ga0466959_0081443_777_2003 | 402 |
| 798 | 3300046455 | Ga0495603_0026289 | Ga0495603_0026289_1673_2899 | 402 |
| 799 | 3300046615 | Ga0495656_0079875 | Ga0495656_0079875_233_1459 | 402 |
| 800 | 3300046684 | Ga0495669_0006663 | Ga0495669_0006663_1049_2275 | 402 |
| 801 | 3300047319 | Ga0495674_0052817 | Ga0495674_0052817_2228_3454 | 402 |
| 802 | 3300047320 | Ga0495672_0064751 | Ga0495672_0064751_404_1630 | 402 |
| 803 | 3300048905 | Ga0496102_0045476 | Ga0496102_0045476_323_1549 | 402 |
| 804 | 3300048913 | Ga0496110_0228153 | Ga0496110_0228153_238_1464 | 402 |
| 805 | 3300048918 | Ga0496115_0057162 | Ga0496115_0057162_1562_2791 | 402 |
| 806 | 3300048924 | Ga0496121_0011755 | Ga0496121_0011755_5408_6634 | 402 |
| 807 | 3300048924 | Ga0496121_0015099 | Ga0496121_0015099_6228_7454 | 402 |
| 808 | 3300048924 | Ga0496121_0088415 | Ga0496121_0088415_917_2143 | 402 |
| 809 | 3300048924 | Ga0496121_0090364 | Ga0496121_0090364_1093_2319 | 402 |
| 810 | 3300048925 | Ga0496122_0105991 | Ga0496122_0105991_556_1782 | 402 |
| 811 | 3300048929 | Ga0496126_0005839 | Ga0496126_0005839_2764_3990 | 402 |
| 812 | 3300048929 | Ga0496126_0030015 | Ga0496126_0030015_109_1335 | 402 |
| 813 | 3300048929 | Ga0496126_0058113 | Ga0496126_0058113_317_1546 | 402 |
| 814 | 3300050490 | nmdc:mga03n38_7090_c1 | nmdc:mga03n38_7090_c1_889_2115 | 402 |
| 815 | 3300050491 | nmdc:mga00v17_15058_c1 | nmdc:mga00v17_15058_c1_151_1377 | 402 |
| 816 | 3300050492 | nmdc:mga0yw44_58334_c1 | nmdc:mga0yw44_58334_c1_651_1871 | 402 |
| 817 | 3300050494 | nmdc:mga06z11_87279_c1 | nmdc:mga06z11_87279_c1_312_1538 | 402 |
| 818 | 3300050495 | nmdc:mga04h51_10207_c1 | nmdc:mga04h51_10207_c1_793_2019 | 402 |
| 819 | 3300050496 | nmdc:mga07m45_137248_c1 | nmdc:mga07m45_137248_c1_154_1380 | 402 |
| 820 | 3300050511 | nmdc:mga08y16_138194_c1 | nmdc:mga08y16_138194_c1_598_1824 | 402 |
| 821 | 3300050511 | nmdc:mga08y16_139147_c1 | nmdc:mga08y16_139147_c1_292_1518 | 402 |
| 822 | 3300050511 | nmdc:mga08y16_259817_c1 | nmdc:mga08y16_259817_c1_394_1656 | 402 |
| 823 | 3300053119 | Ga0500595_002289 | Ga0500595_002289_7336_8556 | 402 |
| 824 | 3300053145 | Ga0500586_000403 | Ga0500586_000403_1972_3243 | 402 |
| 825 | 3300053153 | Ga0500616_0000038 | Ga0500616_0000038_292183_293409 | 402 |
| 826 | 3300059639 | Ga0587062_000371 | Ga0587062_000371_148_1374 | 402 |
| 827 | 3300059644 | Ga0587075_001170 | Ga0587075_001170_1064_2290 | 402 |
| 828 | iso_pu_bacteria | 2513237098 | 2513672240 | 402 |
| 829 | iso_pu_bacteria | 2903768456 | 2903772567 | 402 |
| 830 | 3300000549 | LJQas_1007993 | LJQas_10079931 | 403 |
| 831 | 3300003203 | JGI25406J46586_10000081 | JGI25406J46586_100000811 | 403 |
| 832 | 3300003203 | JGI25406J46586_10000081 | JGI25406J46586_100000812 | 403 |
| 833 | 3300003203 | JGI25406J46586_10008729 | JGI25406J46586_100087293 | 403 |
| 834 | 3300003215 | JGI25153J46596_10000946 | JGI25153J46596_1000094611 | 403 |
| 835 | 3300003215 | JGI25153J46596_10006710 | JGI25153J46596_100067104 | 403 |
| 836 | 3300003659 | JGI25404J52841_10000269 | JGI25404J52841_100002694 | 403 |
| 837 | 3300004800 | Ga0058861_11933975 | Ga0058861_119339751 | 403 |
| 838 | 3300005262 | Ga0065165_1002365 | Ga0065165_100236511 | 403 |
| 839 | 3300005327 | Ga0070658_10015568 | Ga0070658_100155683 | 403 |
| 840 | 3300005327 | Ga0070658_10015568 | Ga0070658_100155684 | 403 |
| 841 | 3300005327 | Ga0070658_10015568 | Ga0070658_100155685 | 403 |
| 842 | 3300005327 | Ga0070658_10033545 | Ga0070658_100335452 | 403 |
| 843 | 3300005329 | Ga0070683_100006494 | Ga0070683_1000064943 | 403 |
| 844 | 3300005329 | Ga0070683_100006494 | Ga0070683_1000064944 | 403 |
| 845 | 3300005329 | Ga0070683_100006494 | Ga0070683_1000064945 | 403 |
| 846 | 3300005329 | Ga0070683_100088981 | Ga0070683_1000889812 | 403 |
| 847 | 3300005329 | Ga0070683_100282663 | Ga0070683_1002826631 | 403 |
| 848 | 3300005334 | Ga0068869_100029096 | Ga0068869_1000290963 | 403 |
| 849 | 3300005334 | Ga0068869_100039424 | Ga0068869_1000394242 | 403 |
| 850 | 3300005335 | Ga0070666_10080750 | Ga0070666_100807501 | 403 |
| 851 | 3300005336 | Ga0070680_100008461 | Ga0070680_1000084612 | 403 |
| 852 | 3300005336 | Ga0070680_100008461 | Ga0070680_1000084613 | 403 |
| 853 | 3300005336 | Ga0070680_100009025 | Ga0070680_1000090252 | 403 |
| 854 | 3300005336 | Ga0070680_100020597 | Ga0070680_1000205972 | 403 |
| 855 | 3300005336 | Ga0070680_100211331 | Ga0070680_1002113311 | 403 |
| 856 | 3300005336 | Ga0070680_100261936 | Ga0070680_1002619361 | 403 |
| 857 | 3300005337 | Ga0070682_100163042 | Ga0070682_1001630421 | 403 |
| 858 | 3300005339 | Ga0070660_100012369 | Ga0070660_1000123692 | 403 |
| 859 | 3300005339 | Ga0070660_100016156 | Ga0070660_1000161565 | 403 |
| 860 | 3300005341 | Ga0070691_10058906 | Ga0070691_100589062 | 403 |
| 861 | 3300005344 | Ga0070661_100042475 | Ga0070661_1000424752 | 403 |
| 862 | 3300005344 | Ga0070661_100072768 | Ga0070661_1000727682 | 403 |
| 863 | 3300005347 | Ga0070668_100013950 | Ga0070668_1000139503 | 403 |
| 864 | 3300005347 | Ga0070668_100133195 | Ga0070668_1001331952 | 403 |
| 865 | 3300005347 | Ga0070668_100185248 | Ga0070668_1001852481 | 403 |
| 866 | 3300005355 | Ga0070671_100010559 | Ga0070671_1000105593 | 403 |
| 867 | 3300005355 | Ga0070671_100046849 | Ga0070671_1000468493 | 403 |
| 868 | 3300005365 | Ga0070688_100047848 | Ga0070688_1000478482 | 403 |
| 869 | 3300005366 | Ga0070659_100158179 | Ga0070659_1001581791 | 403 |
| 870 | 3300005434 | Ga0070709_10001137 | Ga0070709_100011374 | 403 |
| 871 | 3300005434 | Ga0070709_10025182 | Ga0070709_100251822 | 403 |
| 872 | 3300005434 | Ga0070709_10040088 | Ga0070709_100400882 | 403 |
| 873 | 3300005434 | Ga0070709_10129692 | Ga0070709_101296921 | 403 |
| 874 | 3300005435 | Ga0070714_100064176 | Ga0070714_1000641761 | 403 |
| 875 | 3300005435 | Ga0070714_100319290 | Ga0070714_1003192901 | 403 |
| 876 | 3300005436 | Ga0070713_100011248 | Ga0070713_1000112483 | 403 |
| 877 | 3300005436 | Ga0070713_100038019 | Ga0070713_1000380191 | 403 |
| 878 | 3300005436 | Ga0070713_100145904 | Ga0070713_1001459042 | 403 |
| 879 | 3300005436 | Ga0070713_100168114 | Ga0070713_1001681141 | 403 |
| 880 | 3300005436 | Ga0070713_100189284 | Ga0070713_1001892841 | 403 |
| 881 | 3300005437 | Ga0070710_10015995 | Ga0070710_100159952 | 403 |
| 882 | 3300005437 | Ga0070710_10028352 | Ga0070710_100283522 | 403 |
| 883 | 3300005439 | Ga0070711_100010485 | Ga0070711_1000104851 | 403 |
| 884 | 3300005439 | Ga0070711_100010485 | Ga0070711_1000104852 | 403 |
| 885 | 3300005439 | Ga0070711_100020416 | Ga0070711_1000204163 | 403 |
| 886 | 3300005439 | Ga0070711_100031873 | Ga0070711_1000318732 | 403 |
| 887 | 3300005439 | Ga0070711_100037198 | Ga0070711_1000371982 | 403 |
| 888 | 3300005439 | Ga0070711_100191343 | Ga0070711_1001913431 | 403 |
| 889 | 3300005441 | Ga0070700_100071112 | Ga0070700_1000711122 | 403 |
| 890 | 3300005455 | Ga0070663_100012907 | Ga0070663_1000129072 | 403 |
| 891 | 3300005455 | Ga0070663_100017721 | Ga0070663_1000177212 | 403 |
| 892 | 3300005455 | Ga0070663_100044931 | Ga0070663_1000449311 | 403 |
| 893 | 3300005455 | Ga0070663_100076612 | Ga0070663_1000766122 | 403 |
| 894 | 3300005456 | Ga0070678_100016331 | Ga0070678_1000163312 | 403 |
| 895 | 3300005456 | Ga0070678_100121784 | Ga0070678_1001217842 | 403 |
| 896 | 3300005457 | Ga0070662_100080615 | Ga0070662_1000806153 | 403 |
| 897 | 3300005458 | Ga0070681_10006811 | Ga0070681_100068114 | 403 |
| 898 | 3300005458 | Ga0070681_10006811 | Ga0070681_100068115 | 403 |
| 899 | 3300005458 | Ga0070681_10007089 | Ga0070681_100070897 | 403 |
| 900 | 3300005458 | Ga0070681_10033074 | Ga0070681_100330742 | 403 |
| 901 | 3300005458 | Ga0070681_10085897 | Ga0070681_100858972 | 403 |
| 902 | 3300005458 | Ga0070681_10227118 | Ga0070681_102271182 | 403 |
| 903 | 3300005467 | Ga0070706_100085005 | Ga0070706_1000850051 | 403 |
| 904 | 3300005467 | Ga0070706_100085005 | Ga0070706_1000850052 | 403 |
| 905 | 3300005468 | Ga0070707_100090716 | Ga0070707_1000907162 | 403 |
| 906 | 3300005471 | Ga0070698_100071439 | Ga0070698_1000714392 | 403 |
| 907 | 3300005518 | Ga0070699_100016664 | Ga0070699_1000166646 | 403 |
| 908 | 3300005530 | Ga0070679_100014819 | Ga0070679_1000148197 | 403 |
| 909 | 3300005530 | Ga0070679_100251754 | Ga0070679_1002517541 | 403 |
| 910 | 3300005535 | Ga0070684_100007203 | Ga0070684_1000072032 | 403 |
| 911 | 3300005535 | Ga0070684_100007203 | Ga0070684_1000072033 | 403 |
| 912 | 3300005535 | Ga0070684_100034954 | Ga0070684_1000349544 | 403 |
| 913 | 3300005535 | Ga0070684_100056336 | Ga0070684_1000563363 | 403 |
| 914 | 3300005535 | Ga0070684_100192082 | Ga0070684_1001920822 | 403 |
| 915 | 3300005536 | Ga0070697_100128235 | Ga0070697_1001282352 | 403 |
| 916 | 3300005539 | Ga0068853_100014772 | Ga0068853_1000147725 | 403 |
| 917 | 3300005539 | Ga0068853_100044215 | Ga0068853_1000442151 | 403 |
| 918 | 3300005539 | Ga0068853_100044472 | Ga0068853_1000444722 | 403 |
| 919 | 3300005539 | Ga0068853_100078359 | Ga0068853_1000783592 | 403 |
| 920 | 3300005539 | Ga0068853_100094862 | Ga0068853_1000948622 | 403 |
| 921 | 3300005539 | Ga0068853_100202940 | Ga0068853_1002029401 | 403 |
| 922 | 3300005543 | Ga0070672_100060534 | Ga0070672_1000605342 | 403 |
| 923 | 3300005547 | Ga0070693_100036628 | Ga0070693_1000366282 | 403 |
| 924 | 3300005547 | Ga0070693_100069677 | Ga0070693_1000696772 | 403 |
| 925 | 3300005548 | Ga0070665_100026819 | Ga0070665_1000268192 | 403 |
| 926 | 3300005548 | Ga0070665_100047689 | Ga0070665_1000476892 | 403 |
| 927 | 3300005548 | Ga0070665_100151430 | Ga0070665_1001514302 | 403 |
| 928 | 3300005563 | Ga0068855_100010185 | Ga0068855_1000101856 | 403 |
| 929 | 3300005563 | Ga0068855_100010185 | Ga0068855_1000101857 | 403 |
| 930 | 3300005563 | Ga0068855_100010185 | Ga0068855_1000101858 | 403 |
| 931 | 3300005563 | Ga0068855_100065209 | Ga0068855_1000652092 | 403 |
| 932 | 3300005563 | Ga0068855_100065209 | Ga0068855_1000652093 | 403 |
| 933 | 3300005563 | Ga0068855_100093726 | Ga0068855_1000937263 | 403 |
| 934 | 3300005563 | Ga0068855_100188478 | Ga0068855_1001884782 | 403 |
| 935 | 3300005564 | Ga0070664_100036128 | Ga0070664_1000361283 | 403 |
| 936 | 3300005564 | Ga0070664_100036128 | Ga0070664_1000361284 | 403 |
| 937 | 3300005577 | Ga0068857_100006806 | Ga0068857_1000068066 | 403 |
| 938 | 3300005577 | Ga0068857_100006806 | Ga0068857_1000068067 | 403 |
| 939 | 3300005578 | Ga0068854_100188544 | Ga0068854_1001885442 | 403 |
| 940 | 3300005614 | Ga0068856_100000137 | Ga0068856_10000013739 | 403 |
| 941 | 3300005614 | Ga0068856_100000137 | Ga0068856_10000013740 | 403 |
| 942 | 3300005614 | Ga0068856_100105225 | Ga0068856_1001052252 | 403 |
| 943 | 3300005614 | Ga0068856_100333703 | Ga0068856_1003337031 | 403 |
| 944 | 3300005616 | Ga0068852_100015965 | Ga0068852_1000159652 | 403 |
| 945 | 3300005616 | Ga0068852_100028224 | Ga0068852_1000282242 | 403 |
| 946 | 3300005616 | Ga0068852_100028224 | Ga0068852_1000282243 | 403 |
| 947 | 3300005616 | Ga0068852_100212311 | Ga0068852_1002123112 | 403 |
| 948 | 3300005617 | Ga0068859_100115759 | Ga0068859_1001157592 | 403 |
| 949 | 3300005618 | Ga0068864_100034489 | Ga0068864_1000344892 | 403 |
| 950 | 3300005618 | Ga0068864_100056367 | Ga0068864_1000563672 | 403 |
| 951 | 3300005719 | Ga0068861_100199288 | Ga0068861_1001992881 | 403 |
| 952 | 3300005834 | Ga0068851_10020979 | Ga0068851_100209792 | 403 |
| 953 | 3300005842 | Ga0068858_100057565 | Ga0068858_1000575651 | 403 |
| 954 | 3300005842 | Ga0068858_100099558 | Ga0068858_1000995582 | 403 |
| 955 | 3300005843 | Ga0068860_100004689 | Ga0068860_10000468910 | 403 |
| 956 | 3300005843 | Ga0068860_100005520 | Ga0068860_1000055207 | 403 |
| 957 | 3300005844 | Ga0068862_100088228 | Ga0068862_1000882282 | 403 |
| 958 | 3300005844 | Ga0068862_100105231 | Ga0068862_1001052312 | 403 |
| 959 | 3300005844 | Ga0068862_100126218 | Ga0068862_1001262182 | 403 |
| 960 | 3300005844 | Ga0068862_100131689 | Ga0068862_1001316892 | 403 |
| 961 | 3300005844 | Ga0068862_100282963 | Ga0068862_1002829632 | 403 |
| 962 | 3300005937 | Ga0081455_10003860 | Ga0081455_1000386011 | 403 |
| 963 | 3300005937 | Ga0081455_10006164 | Ga0081455_100061645 | 403 |
| 964 | 3300005937 | Ga0081455_10010534 | Ga0081455_1001053414 | 403 |
| 965 | 3300005937 | Ga0081455_10037055 | Ga0081455_100370553 | 403 |
| 966 | 3300005937 | Ga0081455_10037166 | Ga0081455_100371662 | 403 |
| 967 | 3300005937 | Ga0081455_10078440 | Ga0081455_100784402 | 403 |
| 968 | 3300005983 | Ga0081540_1001487 | Ga0081540_100148712 | 403 |
| 969 | 3300005983 | Ga0081540_1003332 | Ga0081540_10033323 | 403 |
| 970 | 3300005983 | Ga0081540_1003389 | Ga0081540_10033892 | 403 |
| 971 | 3300005983 | Ga0081540_1003768 | Ga0081540_10037684 | 403 |
| 972 | 3300005983 | Ga0081540_1004916 | Ga0081540_10049167 | 403 |
| 973 | 3300005983 | Ga0081540_1006034 | Ga0081540_10060344 | 403 |
| 974 | 3300005983 | Ga0081540_1006810 | Ga0081540_10068107 | 403 |
| 975 | 3300005983 | Ga0081540_1011165 | Ga0081540_10111653 | 403 |
| 976 | 3300005983 | Ga0081540_1026650 | Ga0081540_10266503 | 403 |
| 977 | 3300005983 | Ga0081540_1028785 | Ga0081540_10287853 | 403 |
| 978 | 3300005983 | Ga0081540_1032911 | Ga0081540_10329112 | 403 |
| 979 | 3300005983 | Ga0081540_1045754 | Ga0081540_10457542 | 403 |
| 980 | 3300005983 | Ga0081540_1045808 | Ga0081540_10458082 | 403 |
| 981 | 3300005985 | Ga0081539_10000157 | Ga0081539_1000015744 | 403 |
| 982 | 3300005985 | Ga0081539_10000461 | Ga0081539_1000046140 | 403 |
| 983 | 3300005985 | Ga0081539_10000461 | Ga0081539_1000046141 | 403 |
| 984 | 3300005985 | Ga0081539_10010685 | Ga0081539_100106857 | 403 |
| 985 | 3300006028 | Ga0070717_10001987 | Ga0070717_100019877 | 403 |
| 986 | 3300006028 | Ga0070717_10012926 | Ga0070717_100129265 | 403 |
| 987 | 3300006028 | Ga0070717_10018197 | Ga0070717_100181974 | 403 |
| 988 | 3300006028 | Ga0070717_10285649 | Ga0070717_102856492 | 403 |
| 989 | 3300006038 | Ga0075365_10095798 | Ga0075365_100957982 | 403 |
| 990 | 3300006042 | Ga0075368_10024474 | Ga0075368_100244742 | 403 |
| 991 | 3300006048 | Ga0075363_100060782 | Ga0075363_1000607821 | 403 |
| 992 | 3300006051 | Ga0075364_10038215 | Ga0075364_100382152 | 403 |
| 993 | 3300006051 | Ga0075364_10071813 | Ga0075364_100718131 | 403 |
| 994 | 3300006051 | Ga0075364_10187394 | Ga0075364_101873942 | 403 |
| 995 | 3300006163 | Ga0070715_10022143 | Ga0070715_100221432 | 403 |
| 996 | 3300006173 | Ga0070716_100071765 | Ga0070716_1000717652 | 403 |
| 997 | 3300006175 | Ga0070712_100005053 | Ga0070712_1000050533 | 403 |
| 998 | 3300006175 | Ga0070712_100012567 | Ga0070712_1000125673 | 403 |
| 999 | 3300006175 | Ga0070712_100012567 | Ga0070712_1000125674 | 403 |
| 1000 | 3300006175 | Ga0070712_100020530 | Ga0070712_1000205302 | 403 |
| 1001 | 3300006175 | Ga0070712_100127313 | Ga0070712_1001273132 | 403 |
| 1002 | 3300006178 | Ga0075367_10036930 | Ga0075367_100369302 | 403 |
| 1003 | 3300006178 | Ga0075367_10037202 | Ga0075367_100372021 | 403 |
| 1004 | 3300006237 | Ga0097621_100026198 | Ga0097621_1000261982 | 403 |
| 1005 | 3300006237 | Ga0097621_100026198 | Ga0097621_1000261983 | 403 |
| 1006 | 3300006237 | Ga0097621_100290353 | Ga0097621_1002903531 | 403 |
| 1007 | 3300006353 | Ga0075370_10056246 | Ga0075370_100562463 | 403 |
| 1008 | 3300006358 | Ga0068871_100053850 | Ga0068871_1000538502 | 403 |
| 1009 | 3300006358 | Ga0068871_100053850 | Ga0068871_1000538503 | 403 |
| 1010 | 3300006871 | Ga0075434_100026575 | Ga0075434_1000265752 | 403 |
| 1011 | 3300006871 | Ga0075434_100059277 | Ga0075434_1000592773 | 403 |
| 1012 | 3300006931 | Ga0097620_100115762 | Ga0097620_1001157622 | 403 |
| 1013 | 3300006942 | Ga0099824_1022298 | Ga0099824_10222983 | 403 |
| 1014 | 3300007076 | Ga0075435_100211501 | Ga0075435_1002115011 | 403 |
| 1015 | 3300007076 | Ga0075435_100289587 | Ga0075435_1002895871 | 403 |
| 1016 | 3300007265 | Ga0099794_10001086 | Ga0099794_100010862 | 403 |
| 1017 | 3300007265 | Ga0099794_10001086 | Ga0099794_100010863 | 403 |
| 1018 | 3300007265 | Ga0099794_10044158 | Ga0099794_100441581 | 403 |
| 1019 | 3300007788 | Ga0099795_10031241 | Ga0099795_100312412 | 403 |
| 1020 | 3300007788 | Ga0099795_10034527 | Ga0099795_100345271 | 403 |
| 1021 | 3300009093 | Ga0105240_10003976 | Ga0105240_1000397616 | 403 |
| 1022 | 3300009093 | Ga0105240_10005539 | Ga0105240_100055394 | 403 |
| 1023 | 3300009093 | Ga0105240_10018312 | Ga0105240_100183124 | 403 |
| 1024 | 3300009093 | Ga0105240_10018312 | Ga0105240_100183125 | 403 |
| 1025 | 3300009093 | Ga0105240_10065154 | Ga0105240_100651543 | 403 |
| 1026 | 3300009093 | Ga0105240_10067861 | Ga0105240_100678612 | 403 |
| 1027 | 3300009093 | Ga0105240_10092667 | Ga0105240_100926672 | 403 |
| 1028 | 3300009093 | Ga0105240_10101428 | Ga0105240_101014282 | 403 |
| 1029 | 3300009098 | Ga0105245_10137830 | Ga0105245_101378302 | 403 |
| 1030 | 3300009101 | Ga0105247_10016302 | Ga0105247_100163026 | 403 |
| 1031 | 3300009148 | Ga0105243_10083696 | Ga0105243_100836962 | 403 |
| 1032 | 3300009174 | Ga0105241_10047810 | Ga0105241_100478102 | 403 |
| 1033 | 3300009176 | Ga0105242_10035665 | Ga0105242_100356652 | 403 |
| 1034 | 3300009176 | Ga0105242_10035665 | Ga0105242_100356653 | 403 |
| 1035 | 3300009177 | Ga0105248_10052124 | Ga0105248_100521243 | 403 |
| 1036 | 3300009177 | Ga0105248_10295530 | Ga0105248_102955302 | 403 |
| 1037 | 3300009545 | Ga0105237_10008293 | Ga0105237_100082936 | 403 |
| 1038 | 3300009545 | Ga0105237_10012769 | Ga0105237_100127692 | 403 |
| 1039 | 3300009545 | Ga0105237_10012769 | Ga0105237_100127693 | 403 |
| 1040 | 3300009545 | Ga0105237_10012769 | Ga0105237_100127694 | 403 |
| 1041 | 3300009545 | Ga0105237_10028530 | Ga0105237_100285305 | 403 |
| 1042 | 3300009545 | Ga0105237_10034905 | Ga0105237_100349052 | 403 |
| 1043 | 3300009545 | Ga0105237_10062821 | Ga0105237_100628212 | 403 |
| 1044 | 3300009545 | Ga0105237_10091803 | Ga0105237_100918031 | 403 |
| 1045 | 3300009545 | Ga0105237_10091803 | Ga0105237_100918032 | 403 |
| 1046 | 3300009551 | Ga0105238_10001848 | Ga0105238_1000184810 | 403 |
| 1047 | 3300009551 | Ga0105238_10001848 | Ga0105238_100018489 | 403 |
| 1048 | 3300009551 | Ga0105238_10069691 | Ga0105238_100696913 | 403 |
| 1049 | 3300009553 | Ga0105249_10030655 | Ga0105249_100306554 | 403 |
| 1050 | 3300010159 | Ga0099796_10015701 | Ga0099796_100157011 | 403 |
| 1051 | 3300010159 | Ga0099796_10034029 | Ga0099796_100340291 | 403 |
| 1052 | 3300010375 | Ga0105239_10023763 | Ga0105239_100237635 | 403 |
| 1053 | 3300010375 | Ga0105239_10023763 | Ga0105239_100237636 | 403 |
| 1054 | 3300010375 | Ga0105239_10025364 | Ga0105239_100253642 | 403 |
| 1055 | 3300010375 | Ga0105239_10025364 | Ga0105239_100253643 | 403 |
| 1056 | 3300010375 | Ga0105239_10025364 | Ga0105239_100253644 | 403 |
| 1057 | 3300010375 | Ga0105239_10074969 | Ga0105239_100749693 | 403 |
| 1058 | 3300010375 | Ga0105239_10225081 | Ga0105239_102250811 | 403 |
| 1059 | 3300011119 | Ga0105246_10021293 | Ga0105246_100212933 | 403 |
| 1060 | 3300013102 | Ga0157371_10008618 | Ga0157371_100086188 | 403 |
| 1061 | 3300013104 | Ga0157370_10077342 | Ga0157370_100773422 | 403 |
| 1062 | 3300013104 | Ga0157370_10113934 | Ga0157370_101139342 | 403 |
| 1063 | 3300013105 | Ga0157369_10005973 | Ga0157369_100059733 | 403 |
| 1064 | 3300013105 | Ga0157369_10005973 | Ga0157369_100059734 | 403 |
| 1065 | 3300013105 | Ga0157369_10005973 | Ga0157369_100059735 | 403 |
| 1066 | 3300013105 | Ga0157369_10006548 | Ga0157369_1000654811 | 403 |
| 1067 | 3300013105 | Ga0157369_10012428 | Ga0157369_100124282 | 403 |
| 1068 | 3300013296 | Ga0157374_10043720 | Ga0157374_100437202 | 403 |
| 1069 | 3300013296 | Ga0157374_10043720 | Ga0157374_100437203 | 403 |
| 1070 | 3300013296 | Ga0157374_10081460 | Ga0157374_100814602 | 403 |
| 1071 | 3300013296 | Ga0157374_10236546 | Ga0157374_102365462 | 403 |
| 1072 | 3300013297 | Ga0157378_10242799 | Ga0157378_102427992 | 403 |
| 1073 | 3300013297 | Ga0157378_10287767 | Ga0157378_102877671 | 403 |
| 1074 | 3300013306 | Ga0163162_10039795 | Ga0163162_100397952 | 403 |
| 1075 | 3300013306 | Ga0163162_10054876 | Ga0163162_100548763 | 403 |
| 1076 | 3300013306 | Ga0163162_10083787 | Ga0163162_100837872 | 403 |
| 1077 | 3300013306 | Ga0163162_10105789 | Ga0163162_101057892 | 403 |
| 1078 | 3300013307 | Ga0157372_10139778 | Ga0157372_101397782 | 403 |
| 1079 | 3300013307 | Ga0157372_10169325 | Ga0157372_101693252 | 403 |
| 1080 | 3300013307 | Ga0157372_10300846 | Ga0157372_103008462 | 403 |
| 1081 | 3300013307 | Ga0157372_10323711 | Ga0157372_103237111 | 403 |
| 1082 | 3300013308 | Ga0157375_10062338 | Ga0157375_100623382 | 403 |
| 1083 | 3300013308 | Ga0157375_10075145 | Ga0157375_100751452 | 403 |
| 1084 | 3300013308 | Ga0157375_10075145 | Ga0157375_100751453 | 403 |
| 1085 | 3300013308 | Ga0157375_10283338 | Ga0157375_102833381 | 403 |
| 1086 | 3300014325 | Ga0163163_10032096 | Ga0163163_100320964 | 403 |
| 1087 | 3300014325 | Ga0163163_10032957 | Ga0163163_100329572 | 403 |
| 1088 | 3300014325 | Ga0163163_10035053 | Ga0163163_100350534 | 403 |
| 1089 | 3300014325 | Ga0163163_10043559 | Ga0163163_100435592 | 403 |
| 1090 | 3300014325 | Ga0163163_10055746 | Ga0163163_100557463 | 403 |
| 1091 | 3300014326 | Ga0157380_10104142 | Ga0157380_101041423 | 403 |
| 1092 | 3300014968 | Ga0157379_10181050 | Ga0157379_101810501 | 403 |
| 1093 | 3300014969 | Ga0157376_10075664 | Ga0157376_100756642 | 403 |
| 1094 | 3300014969 | Ga0157376_10101065 | Ga0157376_101010652 | 403 |
| 1095 | 3300014969 | Ga0157376_10284137 | Ga0157376_102841371 | 403 |
| 1096 | 3300020070 | Ga0206356_11666168 | Ga0206356_116661681 | 403 |
| 1097 | 3300020070 | Ga0206356_11666168 | Ga0206356_116661682 | 403 |
| 1098 | 3300020610 | Ga0154015_1059841 | Ga0154015_10598411 | 403 |
| 1099 | 3300021320 | Ga0214544_1000011 | Ga0214544_1000011101 | 403 |
| 1100 | 3300021321 | Ga0214542_1000009 | Ga0214542_1000009141 | 403 |
| 1101 | 3300021324 | Ga0214545_1000007 | Ga0214545_1000007101 | 403 |
| 1102 | 3300021327 | Ga0214543_1000020 | Ga0214543_1000020141 | 403 |
| 1103 | 3300021377 | Ga0213874_10016822 | Ga0213874_100168222 | 403 |
| 1104 | 3300025254 | Ga0209148_1000300 | Ga0209148_100030056 | 403 |
| 1105 | 3300025254 | Ga0209148_1000300 | Ga0209148_100030058 | 403 |
| 1106 | 3300025261 | Ga0209233_1008056 | Ga0209233_10080562 | 403 |
| 1107 | 3300025261 | Ga0209233_1009149 | Ga0209233_10091492 | 403 |
| 1108 | 3300025261 | Ga0209233_1017786 | Ga0209233_10177862 | 403 |
| 1109 | 3300025272 | Ga0209455_1002020 | Ga0209455_10020204 | 403 |
| 1110 | 3300025272 | Ga0209455_1002020 | Ga0209455_10020206 | 403 |
| 1111 | 3300025272 | Ga0209455_1018117 | Ga0209455_10181171 | 403 |
| 1112 | 3300025295 | Ga0209564_1002404 | Ga0209564_10024044 | 403 |
| 1113 | 3300025297 | Ga0209758_1001864 | Ga0209758_100186416 | 403 |
| 1114 | 3300025297 | Ga0209758_1001864 | Ga0209758_100186417 | 403 |
| 1115 | 3300025297 | Ga0209758_1004355 | Ga0209758_10043559 | 403 |
| 1116 | 3300025297 | Ga0209758_1056617 | Ga0209758_10566171 | 403 |
| 1117 | 3300025302 | Ga0207426_1003391 | Ga0207426_10033914 | 403 |
| 1118 | 3300025315 | Ga0207697_10054805 | Ga0207697_100548051 | 403 |
| 1119 | 3300025321 | Ga0207656_10002790 | Ga0207656_100027902 | 403 |
| 1120 | 3300025321 | Ga0207656_10002790 | Ga0207656_100027903 | 403 |
| 1121 | 3300025898 | Ga0207692_10042096 | Ga0207692_100420962 | 403 |
| 1122 | 3300025900 | Ga0207710_10041804 | Ga0207710_100418042 | 403 |
| 1123 | 3300025901 | Ga0207688_10045802 | Ga0207688_100458022 | 403 |
| 1124 | 3300025904 | Ga0207647_10053435 | Ga0207647_100534352 | 403 |
| 1125 | 3300025906 | Ga0207699_10019947 | Ga0207699_100199472 | 403 |
| 1126 | 3300025906 | Ga0207699_10036754 | Ga0207699_100367542 | 403 |
| 1127 | 3300025906 | Ga0207699_10168253 | Ga0207699_101682531 | 403 |
| 1128 | 3300025907 | Ga0207645_10097546 | Ga0207645_100975462 | 403 |
| 1129 | 3300025908 | Ga0207643_10047938 | Ga0207643_100479381 | 403 |
| 1130 | 3300025908 | Ga0207643_10121257 | Ga0207643_101212571 | 403 |
| 1131 | 3300025909 | Ga0207705_10036015 | Ga0207705_100360152 | 403 |
| 1132 | 3300025909 | Ga0207705_10036015 | Ga0207705_100360153 | 403 |
| 1133 | 3300025910 | Ga0207684_10072801 | Ga0207684_100728013 | 403 |
| 1134 | 3300025911 | Ga0207654_10033436 | Ga0207654_100334362 | 403 |
| 1135 | 3300025911 | Ga0207654_10152138 | Ga0207654_101521381 | 403 |
| 1136 | 3300025912 | Ga0207707_10000143 | Ga0207707_1000014311 | 403 |
| 1137 | 3300025912 | Ga0207707_10000613 | Ga0207707_1000061310 | 403 |
| 1138 | 3300025912 | Ga0207707_10000613 | Ga0207707_1000061311 | 403 |
| 1139 | 3300025912 | Ga0207707_10000613 | Ga0207707_100006139 | 403 |
| 1140 | 3300025912 | Ga0207707_10009454 | Ga0207707_100094542 | 403 |
| 1141 | 3300025912 | Ga0207707_10030486 | Ga0207707_100304862 | 403 |
| 1142 | 3300025912 | Ga0207707_10030486 | Ga0207707_100304863 | 403 |
| 1143 | 3300025912 | Ga0207707_10088754 | Ga0207707_100887542 | 403 |
| 1144 | 3300025913 | Ga0207695_10000006 | Ga0207695_10000006560 | 403 |
| 1145 | 3300025913 | Ga0207695_10000478 | Ga0207695_1000047867 | 403 |
| 1146 | 3300025913 | Ga0207695_10009613 | Ga0207695_1000961310 | 403 |
| 1147 | 3300025913 | Ga0207695_10009613 | Ga0207695_100096138 | 403 |
| 1148 | 3300025913 | Ga0207695_10009613 | Ga0207695_100096139 | 403 |
| 1149 | 3300025913 | Ga0207695_10051447 | Ga0207695_100514473 | 403 |
| 1150 | 3300025913 | Ga0207695_10084884 | Ga0207695_100848841 | 403 |
| 1151 | 3300025913 | Ga0207695_10084884 | Ga0207695_100848842 | 403 |
| 1152 | 3300025913 | Ga0207695_10166308 | Ga0207695_101663082 | 403 |
| 1153 | 3300025913 | Ga0207695_10215991 | Ga0207695_102159912 | 403 |
| 1154 | 3300025914 | Ga0207671_10005733 | Ga0207671_100057335 | 403 |
| 1155 | 3300025914 | Ga0207671_10008011 | Ga0207671_100080118 | 403 |
| 1156 | 3300025914 | Ga0207671_10131498 | Ga0207671_101314982 | 403 |
| 1157 | 3300025914 | Ga0207671_10144607 | Ga0207671_101446072 | 403 |
| 1158 | 3300025914 | Ga0207671_10156990 | Ga0207671_101569901 | 403 |
| 1159 | 3300025914 | Ga0207671_10166660 | Ga0207671_101666601 | 403 |
| 1160 | 3300025915 | Ga0207693_10012236 | Ga0207693_100122367 | 403 |
| 1161 | 3300025915 | Ga0207693_10024298 | Ga0207693_100242982 | 403 |
| 1162 | 3300025915 | Ga0207693_10033293 | Ga0207693_100332933 | 403 |
| 1163 | 3300025915 | Ga0207693_10033987 | Ga0207693_100339871 | 403 |
| 1164 | 3300025915 | Ga0207693_10156289 | Ga0207693_101562891 | 403 |
| 1165 | 3300025916 | Ga0207663_10008134 | Ga0207663_100081344 | 403 |
| 1166 | 3300025916 | Ga0207663_10010912 | Ga0207663_100109123 | 403 |
| 1167 | 3300025916 | Ga0207663_10025363 | Ga0207663_100253632 | 403 |
| 1168 | 3300025916 | Ga0207663_10098560 | Ga0207663_100985602 | 403 |
| 1169 | 3300025916 | Ga0207663_10160246 | Ga0207663_101602461 | 403 |
| 1170 | 3300025917 | Ga0207660_10001451 | Ga0207660_1000145110 | 403 |
| 1171 | 3300025917 | Ga0207660_10001451 | Ga0207660_100014518 | 403 |
| 1172 | 3300025917 | Ga0207660_10001451 | Ga0207660_100014519 | 403 |
| 1173 | 3300025917 | Ga0207660_10047050 | Ga0207660_100470502 | 403 |
| 1174 | 3300025917 | Ga0207660_10047550 | Ga0207660_100475502 | 403 |
| 1175 | 3300025919 | Ga0207657_10003960 | Ga0207657_100039606 | 403 |
| 1176 | 3300025919 | Ga0207657_10003960 | Ga0207657_100039607 | 403 |
| 1177 | 3300025919 | Ga0207657_10003960 | Ga0207657_100039608 | 403 |
| 1178 | 3300025920 | Ga0207649_10116415 | Ga0207649_101164151 | 403 |
| 1179 | 3300025921 | Ga0207652_10008026 | Ga0207652_100080263 | 403 |
| 1180 | 3300025921 | Ga0207652_10008026 | Ga0207652_100080265 | 403 |
| 1181 | 3300025921 | Ga0207652_10024167 | Ga0207652_100241672 | 403 |
| 1182 | 3300025921 | Ga0207652_10045026 | Ga0207652_100450262 | 403 |
| 1183 | 3300025921 | Ga0207652_10101709 | Ga0207652_101017092 | 403 |
| 1184 | 3300025921 | Ga0207652_10200726 | Ga0207652_102007262 | 403 |
| 1185 | 3300025922 | Ga0207646_10208713 | Ga0207646_102087132 | 403 |
| 1186 | 3300025924 | Ga0207694_10003812 | Ga0207694_100038123 | 403 |
| 1187 | 3300025924 | Ga0207694_10003812 | Ga0207694_100038124 | 403 |
| 1188 | 3300025924 | Ga0207694_10003812 | Ga0207694_100038125 | 403 |
| 1189 | 3300025924 | Ga0207694_10027026 | Ga0207694_100270263 | 403 |
| 1190 | 3300025924 | Ga0207694_10057603 | Ga0207694_100576032 | 403 |
| 1191 | 3300025924 | Ga0207694_10157351 | Ga0207694_101573511 | 403 |
| 1192 | 3300025927 | Ga0207687_10083602 | Ga0207687_100836022 | 403 |
| 1193 | 3300025927 | Ga0207687_10103997 | Ga0207687_101039971 | 403 |
| 1194 | 3300025928 | Ga0207700_10007251 | Ga0207700_100072514 | 403 |
| 1195 | 3300025928 | Ga0207700_10011456 | Ga0207700_100114562 | 403 |
| 1196 | 3300025928 | Ga0207700_10011456 | Ga0207700_100114563 | 403 |
| 1197 | 3300025928 | Ga0207700_10032512 | Ga0207700_100325123 | 403 |
| 1198 | 3300025928 | Ga0207700_10051229 | Ga0207700_100512291 | 403 |
| 1199 | 3300025928 | Ga0207700_10086597 | Ga0207700_100865972 | 403 |
| 1200 | 3300025928 | Ga0207700_10124231 | Ga0207700_101242313 | 403 |
| 1201 | 3300025929 | Ga0207664_10091034 | Ga0207664_100910341 | 403 |
| 1202 | 3300025929 | Ga0207664_10119384 | Ga0207664_101193842 | 403 |
| 1203 | 3300025929 | Ga0207664_10119603 | Ga0207664_101196032 | 403 |
| 1204 | 3300025929 | Ga0207664_10254938 | Ga0207664_102549381 | 403 |
| 1205 | 3300025931 | Ga0207644_10262906 | Ga0207644_102629061 | 403 |
| 1206 | 3300025932 | Ga0207690_10144557 | Ga0207690_101445571 | 403 |
| 1207 | 3300025932 | Ga0207690_10168683 | Ga0207690_101686832 | 403 |
| 1208 | 3300025933 | Ga0207706_10123207 | Ga0207706_101232072 | 403 |
| 1209 | 3300025934 | Ga0207686_10021011 | Ga0207686_100210112 | 403 |
| 1210 | 3300025934 | Ga0207686_10021011 | Ga0207686_100210113 | 403 |
| 1211 | 3300025934 | Ga0207686_10038551 | Ga0207686_100385512 | 403 |
| 1212 | 3300025935 | Ga0207709_10013431 | Ga0207709_100134313 | 403 |
| 1213 | 3300025937 | Ga0207669_10007810 | Ga0207669_100078106 | 403 |
| 1214 | 3300025939 | Ga0207665_10009461 | Ga0207665_100094613 | 403 |
| 1215 | 3300025939 | Ga0207665_10022575 | Ga0207665_100225752 | 403 |
| 1216 | 3300025939 | Ga0207665_10112506 | Ga0207665_101125062 | 403 |
| 1217 | 3300025940 | Ga0207691_10110214 | Ga0207691_101102142 | 403 |
| 1218 | 3300025940 | Ga0207691_10198719 | Ga0207691_101987191 | 403 |
| 1219 | 3300025941 | Ga0207711_10109671 | Ga0207711_101096712 | 403 |
| 1220 | 3300025941 | Ga0207711_10158388 | Ga0207711_101583882 | 403 |
| 1221 | 3300025944 | Ga0207661_10000712 | Ga0207661_1000071210 | 403 |
| 1222 | 3300025944 | Ga0207661_10034780 | Ga0207661_100347802 | 403 |
| 1223 | 3300025944 | Ga0207661_10034780 | Ga0207661_100347803 | 403 |
| 1224 | 3300025944 | Ga0207661_10084514 | Ga0207661_100845142 | 403 |
| 1225 | 3300025945 | Ga0207679_10046998 | Ga0207679_100469982 | 403 |
| 1226 | 3300025949 | Ga0207667_10010781 | Ga0207667_100107813 | 403 |
| 1227 | 3300025949 | Ga0207667_10010781 | Ga0207667_100107814 | 403 |
| 1228 | 3300025949 | Ga0207667_10010781 | Ga0207667_100107815 | 403 |
| 1229 | 3300025949 | Ga0207667_10053139 | Ga0207667_100531393 | 403 |
| 1230 | 3300025949 | Ga0207667_10092184 | Ga0207667_100921842 | 403 |
| 1231 | 3300025949 | Ga0207667_10160725 | Ga0207667_101607251 | 403 |
| 1232 | 3300025961 | Ga0207712_10167183 | Ga0207712_101671832 | 403 |
| 1233 | 3300025972 | Ga0207668_10015871 | Ga0207668_100158716 | 403 |
| 1234 | 3300025972 | Ga0207668_10017035 | Ga0207668_100170353 | 403 |
| 1235 | 3300025981 | Ga0207640_10061183 | Ga0207640_100611832 | 403 |
| 1236 | 3300026023 | Ga0207677_10082277 | Ga0207677_100822772 | 403 |
| 1237 | 3300026035 | Ga0207703_10061236 | Ga0207703_100612362 | 403 |
| 1238 | 3300026035 | Ga0207703_10113230 | Ga0207703_101132302 | 403 |
| 1239 | 3300026041 | Ga0207639_10003617 | Ga0207639_100036173 | 403 |
| 1240 | 3300026041 | Ga0207639_10003617 | Ga0207639_100036174 | 403 |
| 1241 | 3300026041 | Ga0207639_10003617 | Ga0207639_100036175 | 403 |
| 1242 | 3300026041 | Ga0207639_10135005 | Ga0207639_101350052 | 403 |
| 1243 | 3300026067 | Ga0207678_10015490 | Ga0207678_100154904 | 403 |
| 1244 | 3300026067 | Ga0207678_10022914 | Ga0207678_100229142 | 403 |
| 1245 | 3300026067 | Ga0207678_10062479 | Ga0207678_100624792 | 403 |
| 1246 | 3300026078 | Ga0207702_10000063 | Ga0207702_1000006336 | 403 |
| 1247 | 3300026078 | Ga0207702_10000063 | Ga0207702_1000006337 | 403 |
| 1248 | 3300026095 | Ga0207676_10044978 | Ga0207676_100449782 | 403 |
| 1249 | 3300026095 | Ga0207676_10136967 | Ga0207676_101369672 | 403 |
| 1250 | 3300026095 | Ga0207676_10155984 | Ga0207676_101559841 | 403 |
| 1251 | 3300026116 | Ga0207674_10008108 | Ga0207674_100081082 | 403 |
| 1252 | 3300026116 | Ga0207674_10008108 | Ga0207674_100081083 | 403 |
| 1253 | 3300026116 | Ga0207674_10119893 | Ga0207674_101198932 | 403 |
| 1254 | 3300026118 | Ga0207675_100156505 | Ga0207675_1001565052 | 403 |
| 1255 | 3300026118 | Ga0207675_100223657 | Ga0207675_1002236572 | 403 |
| 1256 | 3300026118 | Ga0207675_100241317 | Ga0207675_1002413171 | 403 |
| 1257 | 3300026121 | Ga0207683_10064951 | Ga0207683_100649513 | 403 |
| 1258 | 3300026121 | Ga0207683_10108364 | Ga0207683_101083642 | 403 |
| 1259 | 3300026142 | Ga0207698_10015927 | Ga0207698_100159271 | 403 |
| 1260 | 3300026142 | Ga0207698_10015927 | Ga0207698_100159272 | 403 |
| 1261 | 3300026142 | Ga0207698_10015927 | Ga0207698_100159273 | 403 |
| 1262 | 3300026142 | Ga0207698_10019849 | Ga0207698_100198492 | 403 |
| 1263 | 3300026142 | Ga0207698_10023138 | Ga0207698_100231383 | 403 |
| 1264 | 3300027357 | Ga0209589_1000015 | Ga0209589_1000015161 | 403 |
| 1265 | 3300027361 | Ga0209489_100015 | Ga0209489_100015161 | 403 |
| 1266 | 3300027363 | Ga0209700_100025 | Ga0209700_100025161 | 403 |
| 1267 | 3300027512 | Ga0209179_1000328 | Ga0209179_10003284 | 403 |
| 1268 | 3300027671 | Ga0209588_1000429 | Ga0209588_10004297 | 403 |
| 1269 | 3300027671 | Ga0209588_1019049 | Ga0209588_10190492 | 403 |
| 1270 | 3300028379 | Ga0268266_10001575 | Ga0268266_100015754 | 403 |
| 1271 | 3300028379 | Ga0268266_10006809 | Ga0268266_100068097 | 403 |
| 1272 | 3300028379 | Ga0268266_10039943 | Ga0268266_100399434 | 403 |
| 1273 | 3300028379 | Ga0268266_10116805 | Ga0268266_101168052 | 403 |
| 1274 | 3300028380 | Ga0268265_10015236 | Ga0268265_100152363 | 403 |
| 1275 | 3300028380 | Ga0268265_10039380 | Ga0268265_100393802 | 403 |
| 1276 | 3300028380 | Ga0268265_10080597 | Ga0268265_100805972 | 403 |
| 1277 | 3300028380 | Ga0268265_10236998 | Ga0268265_102369982 | 403 |
| 1278 | 3300028380 | Ga0268265_10253940 | Ga0268265_102539401 | 403 |
| 1279 | 3300028380 | Ga0268265_10330426 | Ga0268265_103304261 | 403 |
| 1280 | 3300028381 | Ga0268264_10000042 | Ga0268264_10000042227 | 403 |
| 1281 | 3300028381 | Ga0268264_10006148 | Ga0268264_100061482 | 403 |
| 1282 | 3300028381 | Ga0268264_10096441 | Ga0268264_100964412 | 403 |
| 1283 | 3300028786 | Ga0307517_10139977 | Ga0307517_101399771 | 403 |
| 1284 | 3300028794 | Ga0307515_10238789 | Ga0307515_102387891 | 403 |
| 1285 | 3300030521 | Ga0307511_10131697 | Ga0307511_101316971 | 403 |
| 1286 | 3300031238 | Ga0265332_10009080 | Ga0265332_100090801 | 403 |
| 1287 | 3300031238 | Ga0265332_10009080 | Ga0265332_100090802 | 403 |
| 1288 | 3300031241 | Ga0265325_10043968 | Ga0265325_100439681 | 403 |
| 1289 | 3300031344 | Ga0265316_10194290 | Ga0265316_101942901 | 403 |
| 1290 | 3300031507 | Ga0307509_10101201 | Ga0307509_101012012 | 403 |
| 1291 | 3300031507 | Ga0307509_10128400 | Ga0307509_101284002 | 403 |
| 1292 | 3300031548 | Ga0307408_100080965 | Ga0307408_1000809652 | 403 |
| 1293 | 3300031595 | Ga0265313_10081048 | Ga0265313_100810481 | 403 |
| 1294 | 3300031616 | Ga0307508_10047062 | Ga0307508_100470622 | 403 |
| 1295 | 3300031711 | Ga0265314_10005577 | Ga0265314_100055777 | 403 |
| 1296 | 3300031711 | Ga0265314_10089496 | Ga0265314_100894961 | 403 |
| 1297 | 3300031730 | Ga0307516_10012044 | Ga0307516_100120446 | 403 |
| 1298 | 3300031730 | Ga0307516_10012044 | Ga0307516_100120447 | 403 |
| 1299 | 3300031730 | Ga0307516_10012378 | Ga0307516_100123787 | 403 |
| 1300 | 3300031730 | Ga0307516_10019648 | Ga0307516_100196487 | 403 |
| 1301 | 3300031730 | Ga0307516_10035778 | Ga0307516_100357783 | 403 |
| 1302 | 3300031730 | Ga0307516_10047340 | Ga0307516_100473402 | 403 |
| 1303 | 3300031730 | Ga0307516_10206215 | Ga0307516_102062152 | 403 |
| 1304 | 3300031731 | Ga0307405_10019087 | Ga0307405_100190871 | 403 |
| 1305 | 3300031901 | Ga0307406_10083725 | Ga0307406_100837252 | 403 |
| 1306 | 3300031995 | Ga0307409_100030528 | Ga0307409_1000305283 | 403 |
| 1307 | 3300032002 | Ga0307416_100203114 | Ga0307416_1002031141 | 403 |
| 1308 | 3300033180 | Ga0307510_10018417 | Ga0307510_100184176 | 403 |
| 1309 | 3300033180 | Ga0307510_10032591 | Ga0307510_100325913 | 403 |
| 1310 | 3300033180 | Ga0307510_10032591 | Ga0307510_100325914 | 403 |
| 1311 | 3300033180 | Ga0307510_10032591 | Ga0307510_100325915 | 403 |
| 1312 | 3300033180 | Ga0307510_10212388 | Ga0307510_102123881 | 403 |
| 1313 | 3300034816 | Ga0373930_0002922 | Ga0373930_0002922_77_1306 | 403 |
| 1314 | 3300035086 | Ga0373934_0006683 | Ga0373934_0006683_1241_2470 | 403 |
| 1315 | 3300035088 | Ga0373940_0018951 | Ga0373940_0018951_101_1330 | 403 |
| 1316 | 3300035113 | Ga0373936_0063298 | Ga0373936_0063298_61_1290 | 403 |
| 1317 | 3300035113 | Ga0373936_0080528 | Ga0373936_0080528_97_1326 | 403 |
| 1318 | 3300035115 | Ga0373941_0028125 | Ga0373941_0028125_353_1582 | 403 |
| 1319 | 3300035116 | Ga0373945_0045658 | Ga0373945_0045658_276_1505 | 403 |
| 1320 | 3300035118 | Ga0373954_0000194 | Ga0373954_0000194_8047_9276 | 403 |
| 1321 | 3300035119 | Ga0373956_0005615 | Ga0373956_0005615_1052_2281 | 403 |
| 1322 | 3300035120 | Ga0373957_0000558 | Ga0373957_0000558_5417_6646 | 403 |
| 1323 | 3300035171 | Ga0373946_0007120 | Ga0373946_0007120_2438_3667 | 403 |
| 1324 | 3300035172 | Ga0373955_0002265 | Ga0373955_0002265_4096_5325 | 403 |
| 1325 | 3300035172 | Ga0373955_0017979 | Ga0373955_0017979_253_1482 | 403 |
| 1326 | 3300035410 | Ga0373924_0003352 | Ga0373924_0003352_1239_2468 | 403 |
| 1327 | 3300035691 | Ga0373931_0003286 | Ga0373931_0003286_49_1278 | 403 |
| 1328 | 3300035691 | Ga0373931_0012362 | Ga0373931_0012362_249_1478 | 403 |
| 1329 | 3300035691 | Ga0373931_0168121 | Ga0373931_0168121_33_1262 | 403 |
| 1330 | 3300035692 | Ga0373935_0001270 | Ga0373935_0001270_11751_12980 | 403 |
| 1331 | 3300035692 | Ga0373935_0069665 | Ga0373935_0069665_142_1371 | 403 |
| 1332 | 3300035695 | Ga0373927_0000137 | Ga0373927_0000137_13516_14820 | 403 |
| 1333 | 3300035695 | Ga0373927_0006695 | Ga0373927_0006695_379_1608 | 403 |
| 1334 | 3300035695 | Ga0373927_0006894 | Ga0373927_0006894_4549_5778 | 403 |
| 1335 | 3300035695 | Ga0373927_0034270 | Ga0373927_0034270_901_2130 | 403 |
| 1336 | 3300035695 | Ga0373927_0111666 | Ga0373927_0111666_280_1509 | 403 |
| 1337 | 3300035695 | Ga0373927_0149025 | Ga0373927_0149025_118_1347 | 403 |
| 1338 | 3300035724 | Ga0373933_0000961 | Ga0373933_0000961_5615_6844 | 403 |
| 1339 | 3300035724 | Ga0373933_0111256 | Ga0373933_0111256_46_1278 | 403 |
| 1340 | 3300035725 | Ga0373947_0006199 | Ga0373947_0006199_3217_4521 | 403 |
| 1341 | 3300035725 | Ga0373947_0008600 | Ga0373947_0008600_442_1671 | 403 |
| 1342 | 3300035725 | Ga0373947_0020673 | Ga0373947_0020673_438_1667 | 403 |
| 1343 | 3300036401 | Ga0373937_0007705 | Ga0373937_0007705_7766_8995 | 403 |
| 1344 | 3300036401 | Ga0373937_0029297 | Ga0373937_0029297_448_1677 | 403 |
| 1345 | 3300036401 | Ga0373937_0142464 | Ga0373937_0142464_864_2093 | 403 |
| 1346 | 3300037068 | Ga0373925_0002159 | Ga0373925_0002159_10712_12016 | 403 |
| 1347 | 3300037068 | Ga0373925_0002405 | Ga0373925_0002405_9738_10967 | 403 |
| 1348 | 3300037068 | Ga0373925_0036912 | Ga0373925_0036912_2261_3562 | 403 |
| 1349 | 3300037068 | Ga0373925_0062697 | Ga0373925_0062697_1551_2780 | 403 |
| 1350 | 3300037068 | Ga0373925_0116306 | Ga0373925_0116306_351_1580 | 403 |
| 1351 | 3300037418 | Ga0395900_0025734 | Ga0395900_0025734_3382_4611 | 403 |
| 1352 | 3300037418 | Ga0395900_0044162 | Ga0395900_0044162_2308_3537 | 403 |
| 1353 | 3300037418 | Ga0395900_0044162 | Ga0395900_0044162_913_2142 | 403 |
| 1354 | 3300037418 | Ga0395900_0258630 | Ga0395900_0258630_194_1423 | 403 |
| 1355 | 3300037466 | Ga0395898_0012432 | Ga0395898_0012432_5477_6706 | 403 |
| 1356 | 3300037466 | Ga0395898_0012432 | Ga0395898_0012432_6871_8100 | 403 |
| 1357 | 3300037466 | Ga0395898_0027242 | Ga0395898_0027242_3490_4719 | 403 |
| 1358 | 3300037466 | Ga0395898_0035217 | Ga0395898_0035217_2885_4114 | 403 |
| 1359 | 3300038443 | Ga0395901_0385649 | Ga0395901_0385649_24_1253 | 403 |
| 1360 | 3300039437 | Ga0436365_0692786 | Ga0436365_0692786_917_2140 | 403 |
| 1361 | 3300039437 | Ga0436365_0831557 | Ga0436365_0831557_1193_2422 | 403 |
| 1362 | 3300039437 | Ga0436365_0998035 | Ga0436365_0998035_189_1415 | 403 |
| 1363 | 3300039450 | Ga0436363_0141292 | Ga0436363_0141292_286_1518 | 403 |
| 1364 | 3300039450 | Ga0436363_0573174 | Ga0436363_0573174_5326_6555 | 403 |
| 1365 | 3300039450 | Ga0436363_0765119 | Ga0436363_0765119_50_1282 | 403 |
| 1366 | 3300044658 | Ga0466972_0025330 | Ga0466972_0025330_1481_2710 | 403 |
| 1367 | 3300044683 | Ga0466965_0003985 | Ga0466965_0003985_3673_4902 | 403 |
| 1368 | 3300044684 | Ga0466966_0003609 | Ga0466966_0003609_2348_3577 | 403 |
| 1369 | 3300044693 | Ga0466961_0000138 | Ga0466961_0000138_2932_4161 | 403 |
| 1370 | 3300044694 | Ga0466963_0145831 | Ga0466963_0145831_76_1305 | 403 |
| 1371 | 3300044706 | Ga0466964_0046285 | Ga0466964_0046285_128_1357 | 403 |
| 1372 | 3300044706 | Ga0466964_0068426 | Ga0466964_0068426_214_1443 | 403 |
| 1373 | 3300044842 | Ga0466957_0116698 | Ga0466957_0116698_444_1673 | 403 |
| 1374 | 3300045049 | Ga0466959_0004441 | Ga0466959_0004441_4493_5722 | 403 |
| 1375 | 3300045976 | Ga0466967_0041536 | Ga0466967_0041536_587_1816 | 403 |
| 1376 | 3300045976 | Ga0466967_0186608 | Ga0466967_0186608_84_1313 | 403 |
| 1377 | 3300046454 | Ga0495592_0000339 | Ga0495592_0000339_4245_5474 | 403 |
| 1378 | 3300046455 | Ga0495603_0000277 | Ga0495603_0000277_13161_14465 | 403 |
| 1379 | 3300046455 | Ga0495603_0000534 | Ga0495603_0000534_14577_15806 | 403 |
| 1380 | 3300046455 | Ga0495603_0003382 | Ga0495603_0003382_2556_3857 | 403 |
| 1381 | 3300046455 | Ga0495603_0018302 | Ga0495603_0018302_1418_2647 | 403 |
| 1382 | 3300046455 | Ga0495603_0038296 | Ga0495603_0038296_1079_2308 | 403 |
| 1383 | 3300046455 | Ga0495603_0051828 | Ga0495603_0051828_486_1715 | 403 |
| 1384 | 3300046459 | Ga0495629_0000029 | Ga0495629_0000029_13661_14965 | 403 |
| 1385 | 3300046459 | Ga0495629_0000429 | Ga0495629_0000429_11221_12450 | 403 |
| 1386 | 3300046459 | Ga0495629_0002796 | Ga0495629_0002796_9327_10556 | 403 |
| 1387 | 3300046459 | Ga0495629_0003050 | Ga0495629_0003050_8133_9362 | 403 |
| 1388 | 3300046460 | Ga0495638_0046195 | Ga0495638_0046195_1187_2416 | 403 |
| 1389 | 3300046461 | Ga0495641_0001504 | Ga0495641_0001504_13581_14885 | 403 |
| 1390 | 3300046462 | Ga0495651_0004273 | Ga0495651_0004273_8068_9297 | 403 |
| 1391 | 3300046462 | Ga0495651_0017929 | Ga0495651_0017929_131_1360 | 403 |
| 1392 | 3300046462 | Ga0495651_0073584 | Ga0495651_0073584_769_1998 | 403 |
| 1393 | 3300046462 | Ga0495651_0081956 | Ga0495651_0081956_121_1353 | 403 |
| 1394 | 3300046463 | Ga0495653_0002916 | Ga0495653_0002916_8068_9297 | 403 |
| 1395 | 3300046472 | Ga0495580_0000705 | Ga0495580_0000705_26454_27758 | 403 |
| 1396 | 3300046472 | Ga0495580_0002724 | Ga0495580_0002724_10714_11943 | 403 |
| 1397 | 3300046473 | Ga0495582_0000024 | Ga0495582_0000024_13639_14943 | 403 |
| 1398 | 3300046473 | Ga0495582_0000482 | Ga0495582_0000482_804_2033 | 403 |
| 1399 | 3300046475 | Ga0495639_0000135 | Ga0495639_0000135_30393_31697 | 403 |
| 1400 | 3300046475 | Ga0495639_0003253 | Ga0495639_0003253_804_2033 | 403 |
| 1401 | 3300046475 | Ga0495639_0027851 | Ga0495639_0027851_407_1636 | 403 |
| 1402 | 3300046476 | Ga0495662_0000348 | Ga0495662_0000348_34_1263 | 403 |
| 1403 | 3300046476 | Ga0495662_0006898 | Ga0495662_0006898_251_1480 | 403 |
| 1404 | 3300046477 | Ga0495664_0009632 | Ga0495664_0009632_255_1559 | 403 |
| 1405 | 3300046499 | Ga0495594_0000822 | Ga0495594_0000822_4535_5839 | 403 |
| 1406 | 3300046499 | Ga0495594_0000896 | Ga0495594_0000896_1839_3068 | 403 |
| 1407 | 3300046507 | Ga0495606_0007982 | Ga0495606_0007982_6970_8199 | 403 |
| 1408 | 3300046511 | Ga0495608_0002299 | Ga0495608_0002299_6689_7918 | 403 |
| 1409 | 3300046516 | Ga0495628_0012669 | Ga0495628_0012669_5837_7066 | 403 |
| 1410 | 3300046517 | Ga0495630_0002890 | Ga0495630_0002890_7908_9137 | 403 |
| 1411 | 3300046517 | Ga0495630_0007650 | Ga0495630_0007650_1375_2679 | 403 |
| 1412 | 3300046517 | Ga0495630_0018001 | Ga0495630_0018001_2198_3427 | 403 |
| 1413 | 3300046518 | Ga0495631_0026373 | Ga0495631_0026373_1115_2356 | 403 |
| 1414 | 3300046519 | Ga0495632_0071044 | Ga0495632_0071044_381_1610 | 403 |
| 1415 | 3300046522 | Ga0495643_0081888 | Ga0495643_0081888_397_1626 | 403 |
| 1416 | 3300046523 | Ga0495644_0049000 | Ga0495644_0049000_64_1293 | 403 |
| 1417 | 3300046524 | Ga0495648_0000310 | Ga0495648_0000310_2372_3601 | 403 |
| 1418 | 3300046524 | Ga0495648_0036359 | Ga0495648_0036359_672_1901 | 403 |
| 1419 | 3300046526 | Ga0495666_0035372 | Ga0495666_0035372_996_2225 | 403 |
| 1420 | 3300046529 | Ga0495652_0007414 | Ga0495652_0007414_7256_8485 | 403 |
| 1421 | 3300046529 | Ga0495652_0014055 | Ga0495652_0014055_505_1809 | 403 |
| 1422 | 3300046529 | Ga0495652_0120850 | Ga0495652_0120850_805_2034 | 403 |
| 1423 | 3300046531 | Ga0495665_0000178 | Ga0495665_0000178_13586_14890 | 403 |
| 1424 | 3300046533 | Ga0495640_0000881 | Ga0495640_0000881_10099_11328 | 403 |
| 1425 | 3300046533 | Ga0495640_0003708 | Ga0495640_0003708_5057_6361 | 403 |
| 1426 | 3300046533 | Ga0495640_0009567 | Ga0495640_0009567_2456_3685 | 403 |
| 1427 | 3300046536 | Ga0495587_0024155 | Ga0495587_0024155_1410_2639 | 403 |
| 1428 | 3300046543 | Ga0495645_0030073 | Ga0495645_0030073_1975_3204 | 403 |
| 1429 | 3300046543 | Ga0495645_0038077 | Ga0495645_0038077_1718_2947 | 403 |
| 1430 | 3300046557 | Ga0495622_0002012 | Ga0495622_0002012_5821_7050 | 403 |
| 1431 | 3300046557 | Ga0495622_0029441 | Ga0495622_0029441_366_1595 | 403 |
| 1432 | 3300046559 | Ga0495667_0003330 | Ga0495667_0003330_1243_2472 | 403 |
| 1433 | 3300046559 | Ga0495667_0042815 | Ga0495667_0042815_1498_2802 | 403 |
| 1434 | 3300046642 | Ga0495634_0001222 | Ga0495634_0001222_6464_7693 | 403 |
| 1435 | 3300046642 | Ga0495634_0007096 | Ga0495634_0007096_2916_4145 | 403 |
| 1436 | 3300046642 | Ga0495634_0013730 | Ga0495634_0013730_323_1627 | 403 |
| 1437 | 3300046648 | Ga0495611_0020338 | Ga0495611_0020338_215_1444 | 403 |
| 1438 | 3300046660 | Ga0495625_0125482 | Ga0495625_0125482_66_1295 | 403 |
| 1439 | 3300046663 | Ga0495635_0000910 | Ga0495635_0000910_10217_11446 | 403 |
| 1440 | 3300046663 | Ga0495635_0004181 | Ga0495635_0004181_7256_8485 | 403 |
| 1441 | 3300046663 | Ga0495635_0010291 | Ga0495635_0010291_412_1716 | 403 |
| 1442 | 3300046663 | Ga0495635_0056377 | Ga0495635_0056377_1325_2554 | 403 |
| 1443 | 3300046663 | Ga0495635_0105069 | Ga0495635_0105069_220_1449 | 403 |
| 1444 | 3300046664 | Ga0495659_0010257 | Ga0495659_0010257_679_1908 | 403 |
| 1445 | 3300046674 | Ga0495588_0003152 | Ga0495588_0003152_5284_6513 | 403 |
| 1446 | 3300046674 | Ga0495588_0038561 | Ga0495588_0038561_1150_2379 | 403 |
| 1447 | 3300046674 | Ga0495588_0064420 | Ga0495588_0064420_524_1753 | 403 |
| 1448 | 3300046675 | Ga0495657_0023707 | Ga0495657_0023707_1621_2850 | 403 |
| 1449 | 3300046678 | Ga0495599_0000440 | Ga0495599_0000440_4001_5230 | 403 |
| 1450 | 3300046678 | Ga0495599_0046152 | Ga0495599_0046152_885_2114 | 403 |
| 1451 | 3300046678 | Ga0495599_0093308 | Ga0495599_0093308_139_1368 | 403 |
| 1452 | 3300046679 | Ga0495623_0004965 | Ga0495623_0004965_1661_2890 | 403 |
| 1453 | 3300046679 | Ga0495623_0110117 | Ga0495623_0110117_185_1414 | 403 |
| 1454 | 3300046680 | Ga0495646_0023165 | Ga0495646_0023165_1695_2924 | 403 |
| 1455 | 3300046680 | Ga0495646_0041961 | Ga0495646_0041961_98_1327 | 403 |
| 1456 | 3300046680 | Ga0495646_0084297 | Ga0495646_0084297_92_1396 | 403 |
| 1457 | 3300046681 | Ga0495647_0013024 | Ga0495647_0013024_1533_2837 | 403 |
| 1458 | 3300046683 | Ga0495658_0001504 | Ga0495658_0001504_8639_9943 | 403 |
| 1459 | 3300046683 | Ga0495658_0002247 | Ga0495658_0002247_5115_6344 | 403 |
| 1460 | 3300046684 | Ga0495669_0006663 | Ga0495669_0006663_2432_3661 | 403 |
| 1461 | 3300046689 | Ga0495613_0006457 | Ga0495613_0006457_1122_2426 | 403 |
| 1462 | 3300046689 | Ga0495613_0022922 | Ga0495613_0022922_195_1424 | 403 |
| 1463 | 3300046689 | Ga0495613_0068130 | Ga0495613_0068130_1257_2486 | 403 |
| 1464 | 3300046690 | Ga0495624_0000788 | Ga0495624_0000788_10075_11379 | 403 |
| 1465 | 3300046690 | Ga0495624_0002246 | Ga0495624_0002246_10713_11942 | 403 |
| 1466 | 3300046691 | Ga0495670_0023077 | Ga0495670_0023077_1419_2648 | 403 |
| 1467 | 3300046692 | Ga0495671_0033510 | Ga0495671_0033510_27_1268 | 403 |
| 1468 | 3300046694 | Ga0495649_0117149 | Ga0495649_0117149_165_1394 | 403 |
| 1469 | 3300046794 | Ga0495589_0099229 | Ga0495589_0099229_62_1291 | 403 |
| 1470 | 3300046809 | Ga0495600_0002595 | Ga0495600_0002595_8068_9297 | 403 |
| 1471 | 3300046809 | Ga0495600_0036413 | Ga0495600_0036413_1014_2318 | 403 |
| 1472 | 3300047315 | Ga0495581_0000004 | Ga0495581_0000004_69068_70297 | 403 |
| 1473 | 3300047315 | Ga0495581_0000004 | Ga0495581_0000004_70476_71780 | 403 |
| 1474 | 3300047315 | Ga0495581_0019748 | Ga0495581_0019748_2434_3663 | 403 |
| 1475 | 3300047317 | Ga0495604_0013152 | Ga0495604_0013152_4118_5347 | 403 |
| 1476 | 3300047319 | Ga0495674_0000375 | Ga0495674_0000375_32688_33917 | 403 |
| 1477 | 3300047319 | Ga0495674_0001728 | Ga0495674_0001728_17153_18457 | 403 |
| 1478 | 3300047319 | Ga0495674_0008604 | Ga0495674_0008604_5393_6622 | 403 |
| 1479 | 3300047319 | Ga0495674_0015846 | Ga0495674_0015846_2821_4050 | 403 |
| 1480 | 3300047320 | Ga0495672_0054257 | Ga0495672_0054257_448_1677 | 403 |
| 1481 | 3300047320 | Ga0495672_0063717 | Ga0495672_0063717_357_1586 | 403 |
| 1482 | 3300047321 | Ga0495676_0021097 | Ga0495676_0021097_1512_2816 | 403 |
| 1483 | 3300047321 | Ga0495676_0038068 | Ga0495676_0038068_388_1617 | 403 |
| 1484 | 3300047321 | Ga0495676_0106787 | Ga0495676_0106787_705_2006 | 403 |
| 1485 | 3300047322 | Ga0495680_0036592 | Ga0495680_0036592_1090_2319 | 403 |
| 1486 | 3300047444 | Ga0495675_0000801 | Ga0495675_0000801_8068_9297 | 403 |
| 1487 | 3300047471 | Ga0495684_0002197 | Ga0495684_0002197_12733_13962 | 403 |
| 1488 | 3300047471 | Ga0495684_0004302 | Ga0495684_0004302_8718_9947 | 403 |
| 1489 | 3300047472 | Ga0495686_0036135 | Ga0495686_0036135_1614_2855 | 403 |
| 1490 | 3300047472 | Ga0495686_0138420 | Ga0495686_0138420_142_1371 | 403 |
| 1491 | 3300047673 | Ga0495593_0000197 | Ga0495593_0000197_10050_11279 | 403 |
| 1492 | 3300047673 | Ga0495593_0000198 | Ga0495593_0000198_30124_31428 | 403 |
| 1493 | 3300047673 | Ga0495593_0000375 | Ga0495593_0000375_3521_4750 | 403 |
| 1494 | 3300048088 | Ga0495602_0014005 | Ga0495602_0014005_1661_2890 | 403 |
| 1495 | 3300048088 | Ga0495602_0069253 | Ga0495602_0069253_33_1262 | 403 |
| 1496 | 3300048089 | Ga0495614_0010788 | Ga0495614_0010788_2756_3985 | 403 |
| 1497 | 3300048903 | Ga0496100_0021374 | Ga0496100_0021374_2629_3858 | 403 |
| 1498 | 3300048903 | Ga0496100_0072559 | Ga0496100_0072559_335_1564 | 403 |
| 1499 | 3300048903 | Ga0496100_0121646 | Ga0496100_0121646_401_1630 | 403 |
| 1500 | 3300048904 | Ga0496101_0001342 | Ga0496101_0001342_7109_8338 | 403 |
| 1501 | 3300048904 | Ga0496101_0001342 | Ga0496101_0001342_8520_9749 | 403 |
| 1502 | 3300048904 | Ga0496101_0095520 | Ga0496101_0095520_345_1574 | 403 |
| 1503 | 3300048905 | Ga0496102_0013166 | Ga0496102_0013166_1506_2735 | 403 |
| 1504 | 3300048905 | Ga0496102_0013166 | Ga0496102_0013166_2903_4132 | 403 |
| 1505 | 3300048905 | Ga0496102_0057579 | Ga0496102_0057579_2113_3342 | 403 |
| 1506 | 3300048905 | Ga0496102_0057579 | Ga0496102_0057579_702_1931 | 403 |
| 1507 | 3300048905 | Ga0496102_0192459 | Ga0496102_0192459_342_1571 | 403 |
| 1508 | 3300048906 | Ga0496103_0135393 | Ga0496103_0135393_165_1394 | 403 |
| 1509 | 3300048906 | Ga0496103_0139975 | Ga0496103_0139975_32_1261 | 403 |
| 1510 | 3300048907 | Ga0496104_0002918 | Ga0496104_0002918_7398_8627 | 403 |
| 1511 | 3300048907 | Ga0496104_0008089 | Ga0496104_0008089_3534_4763 | 403 |
| 1512 | 3300048907 | Ga0496104_0008089 | Ga0496104_0008089_4931_6160 | 403 |
| 1513 | 3300048907 | Ga0496104_0016010 | Ga0496104_0016010_3209_4441 | 403 |
| 1514 | 3300048907 | Ga0496104_0031079 | Ga0496104_0031079_2723_3952 | 403 |
| 1515 | 3300048907 | Ga0496104_0325824 | Ga0496104_0325824_82_1311 | 403 |
| 1516 | 3300048908 | Ga0496105_0009438 | Ga0496105_0009438_4666_5895 | 403 |
| 1517 | 3300048908 | Ga0496105_0017461 | Ga0496105_0017461_4072_5409 | 403 |
| 1518 | 3300048908 | Ga0496105_0020063 | Ga0496105_0020063_231_1460 | 403 |
| 1519 | 3300048908 | Ga0496105_0046941 | Ga0496105_0046941_2251_3480 | 403 |
| 1520 | 3300048908 | Ga0496105_0211533 | Ga0496105_0211533_180_1409 | 403 |
| 1521 | 3300048909 | Ga0496106_0002085 | Ga0496106_0002085_2154_3386 | 403 |
| 1522 | 3300048909 | Ga0496106_0023922 | Ga0496106_0023922_1682_2911 | 403 |
| 1523 | 3300048909 | Ga0496106_0023922 | Ga0496106_0023922_271_1500 | 403 |
| 1524 | 3300048909 | Ga0496106_0091700 | Ga0496106_0091700_882_2111 | 403 |
| 1525 | 3300048909 | Ga0496106_0148930 | Ga0496106_0148930_55_1284 | 403 |
| 1526 | 3300048910 | Ga0496107_0001626 | Ga0496107_0001626_5825_7054 | 403 |
| 1527 | 3300048910 | Ga0496107_0001626 | Ga0496107_0001626_7236_8465 | 403 |
| 1528 | 3300048910 | Ga0496107_0018609 | Ga0496107_0018609_309_1538 | 403 |
| 1529 | 3300048911 | Ga0496108_0016739 | Ga0496108_0016739_3847_5076 | 403 |
| 1530 | 3300048911 | Ga0496108_0030999 | Ga0496108_0030999_2615_3844 | 403 |
| 1531 | 3300048911 | Ga0496108_0041212 | Ga0496108_0041212_2509_3738 | 403 |
| 1532 | 3300048911 | Ga0496108_0054292 | Ga0496108_0054292_1074_2306 | 403 |
| 1533 | 3300048912 | Ga0496109_0018280 | Ga0496109_0018280_2297_3526 | 403 |
| 1534 | 3300048912 | Ga0496109_0018280 | Ga0496109_0018280_3708_4937 | 403 |
| 1535 | 3300048912 | Ga0496109_0045892 | Ga0496109_0045892_1254_2483 | 403 |
| 1536 | 3300048912 | Ga0496109_0049885 | Ga0496109_0049885_1045_2274 | 403 |
| 1537 | 3300048912 | Ga0496109_0079526 | Ga0496109_0079526_1664_2896 | 403 |
| 1538 | 3300048913 | Ga0496110_0015096 | Ga0496110_0015096_10_1242 | 403 |
| 1539 | 3300048913 | Ga0496110_0027689 | Ga0496110_0027689_1810_3039 | 403 |
| 1540 | 3300048913 | Ga0496110_0027689 | Ga0496110_0027689_3221_4450 | 403 |
| 1541 | 3300048913 | Ga0496110_0042322 | Ga0496110_0042322_145_1482 | 403 |
| 1542 | 3300048913 | Ga0496110_0050850 | Ga0496110_0050850_1494_2723 | 403 |
| 1543 | 3300048913 | Ga0496110_0213101 | Ga0496110_0213101_120_1349 | 403 |
| 1544 | 3300048913 | Ga0496110_0221792 | Ga0496110_0221792_255_1484 | 403 |
| 1545 | 3300048913 | Ga0496110_0281867 | Ga0496110_0281867_140_1369 | 403 |
| 1546 | 3300048913 | Ga0496110_0288673 | Ga0496110_0288673_166_1395 | 403 |
| 1547 | 3300048914 | Ga0496111_0011412 | Ga0496111_0011412_2969_4198 | 403 |
| 1548 | 3300048914 | Ga0496111_0011412 | Ga0496111_0011412_4380_5609 | 403 |
| 1549 | 3300048915 | Ga0496112_0000090 | Ga0496112_0000090_14591_15820 | 403 |
| 1550 | 3300048915 | Ga0496112_0035408 | Ga0496112_0035408_2261_3490 | 403 |
| 1551 | 3300048915 | Ga0496112_0081198 | Ga0496112_0081198_1554_2783 | 403 |
| 1552 | 3300048915 | Ga0496112_0092931 | Ga0496112_0092931_361_1590 | 403 |
| 1553 | 3300048915 | Ga0496112_0173896 | Ga0496112_0173896_699_1928 | 403 |
| 1554 | 3300048916 | Ga0496113_0012523 | Ga0496113_0012523_1891_3120 | 403 |
| 1555 | 3300048916 | Ga0496113_0012523 | Ga0496113_0012523_494_1723 | 403 |
| 1556 | 3300048917 | Ga0496114_0018948 | Ga0496114_0018948_1876_3105 | 403 |
| 1557 | 3300048917 | Ga0496114_0018948 | Ga0496114_0018948_3273_4502 | 403 |
| 1558 | 3300048917 | Ga0496114_0105825 | Ga0496114_0105825_287_1570 | 403 |
| 1559 | 3300048917 | Ga0496114_0228744 | Ga0496114_0228744_58_1287 | 403 |
| 1560 | 3300048918 | Ga0496115_0001562 | Ga0496115_0001562_2061_3290 | 403 |
| 1561 | 3300048918 | Ga0496115_0001562 | Ga0496115_0001562_3472_4701 | 403 |
| 1562 | 3300048918 | Ga0496115_0037790 | Ga0496115_0037790_809_2038 | 403 |
| 1563 | 3300048918 | Ga0496115_0045771 | Ga0496115_0045771_1268_2497 | 403 |
| 1564 | 3300048918 | Ga0496115_0158149 | Ga0496115_0158149_314_1543 | 403 |
| 1565 | 3300048921 | Ga0496118_0133200 | Ga0496118_0133200_168_1397 | 403 |
| 1566 | 3300048922 | Ga0496119_0013658 | Ga0496119_0013658_2593_3822 | 403 |
| 1567 | 3300048924 | Ga0496121_0007690 | Ga0496121_0007690_4792_6021 | 403 |
| 1568 | 3300048924 | Ga0496121_0011755 | Ga0496121_0011755_6795_8024 | 403 |
| 1569 | 3300048924 | Ga0496121_0014151 | Ga0496121_0014151_842_2071 | 403 |
| 1570 | 3300048924 | Ga0496121_0042114 | Ga0496121_0042114_1243_2472 | 403 |
| 1571 | 3300048924 | Ga0496121_0108513 | Ga0496121_0108513_835_2064 | 403 |
| 1572 | 3300048924 | Ga0496121_0121590 | Ga0496121_0121590_461_1690 | 403 |
| 1573 | 3300048928 | Ga0496125_0049142 | Ga0496125_0049142_468_1871 | 403 |
| 1574 | 3300048929 | Ga0496126_0012671 | Ga0496126_0012671_5509_6738 | 403 |
| 1575 | 3300048929 | Ga0496126_0016304 | Ga0496126_0016304_6141_7370 | 403 |
| 1576 | 3300048929 | Ga0496126_0026887 | Ga0496126_0026887_3545_4774 | 403 |
| 1577 | 3300048929 | Ga0496126_0030015 | Ga0496126_0030015_1501_2730 | 403 |
| 1578 | 3300048929 | Ga0496126_0047740 | Ga0496126_0047740_569_1798 | 403 |
| 1579 | 3300048929 | Ga0496126_0056346 | Ga0496126_0056346_536_1765 | 403 |
| 1580 | 3300048929 | Ga0496126_0167490 | Ga0496126_0167490_145_1374 | 403 |
| 1581 | 3300048929 | Ga0496126_0192572 | Ga0496126_0192572_130_1359 | 403 |
| 1582 | 3300048929 | Ga0496126_0218222 | Ga0496126_0218222_350_1579 | 403 |
| 1583 | 3300048929 | Ga0496126_0280886 | Ga0496126_0280886_25_1254 | 403 |
| 1584 | 3300049568 | Ga0501031_0001791 | Ga0501031_0001791_277_1506 | 403 |
| 1585 | 3300049569 | Ga0501032_0000073 | Ga0501032_0000073_75963_77192 | 403 |
| 1586 | 3300049569 | Ga0501032_0000073 | Ga0501032_0000073_77380_78609 | 403 |
| 1587 | 3300049570 | Ga0501033_0000136 | Ga0501033_0000136_37988_39217 | 403 |
| 1588 | 3300049570 | Ga0501033_0000136 | Ga0501033_0000136_39405_40634 | 403 |
| 1589 | 3300049571 | Ga0501034_0000251 | Ga0501034_0000251_56539_57768 | 403 |
| 1590 | 3300049571 | Ga0501034_0000251 | Ga0501034_0000251_57956_59185 | 403 |
| 1591 | 3300049572 | Ga0501036_0000036 | Ga0501036_0000036_30329_31558 | 403 |
| 1592 | 3300049572 | Ga0501036_0000036 | Ga0501036_0000036_31746_32975 | 403 |
| 1593 | 3300049572 | Ga0501036_0051369 | Ga0501036_0051369_1074_2303 | 403 |
| 1594 | 3300049573 | Ga0501037_0001715 | Ga0501037_0001715_10583_11812 | 403 |
| 1595 | 3300049573 | Ga0501037_0001715 | Ga0501037_0001715_12000_13229 | 403 |
| 1596 | 3300049574 | Ga0501038_0000428 | Ga0501038_0000428_3321_4550 | 403 |
| 1597 | 3300049574 | Ga0501038_0000428 | Ga0501038_0000428_4738_5967 | 403 |
| 1598 | 3300049574 | Ga0501038_0031834 | Ga0501038_0031834_3169_4398 | 403 |
| 1599 | 3300049575 | Ga0501039_0000273 | Ga0501039_0000273_25651_26880 | 403 |
| 1600 | 3300049575 | Ga0501039_0000273 | Ga0501039_0000273_27068_28297 | 403 |
| 1601 | 3300049575 | Ga0501039_0085782 | Ga0501039_0085782_785_2014 | 403 |
| 1602 | 3300049578 | Ga0501042_0015037 | Ga0501042_0015037_2762_3991 | 403 |
| 1603 | 3300049579 | Ga0501043_0000165 | Ga0501043_0000165_44558_45787 | 403 |
| 1604 | 3300049579 | Ga0501043_0000165 | Ga0501043_0000165_45975_47204 | 403 |
| 1605 | 3300049580 | Ga0501046_0001143 | Ga0501046_0001143_12748_13977 | 403 |
| 1606 | 3300049580 | Ga0501046_0001143 | Ga0501046_0001143_14165_15394 | 403 |
| 1607 | 3300049580 | Ga0501046_0230349 | Ga0501046_0230349_93_1322 | 403 |
| 1608 | 3300049581 | Ga0501047_0000340 | Ga0501047_0000340_20310_21539 | 403 |
| 1609 | 3300049581 | Ga0501047_0000340 | Ga0501047_0000340_21727_22956 | 403 |
| 1610 | 3300049581 | Ga0501047_0161095 | Ga0501047_0161095_601_1830 | 403 |
| 1611 | 3300049582 | Ga0501048_0004991 | Ga0501048_0004991_1448_2677 | 403 |
| 1612 | 3300049582 | Ga0501048_0004991 | Ga0501048_0004991_2865_4094 | 403 |
| 1613 | 3300049583 | Ga0501067_0005805 | Ga0501067_0005805_1388_2617 | 403 |
| 1614 | 3300049584 | Ga0501068_0000255 | Ga0501068_0000255_2943_4172 | 403 |
| 1615 | 3300049584 | Ga0501068_0000255 | Ga0501068_0000255_4360_5589 | 403 |
| 1616 | 3300049584 | Ga0501068_0041667 | Ga0501068_0041667_1023_2252 | 403 |
| 1617 | 3300049585 | Ga0501069_0008241 | Ga0501069_0008241_1461_2690 | 403 |
| 1618 | 3300049585 | Ga0501069_0008241 | Ga0501069_0008241_2878_4107 | 403 |
| 1619 | 3300049586 | Ga0501070_0007747 | Ga0501070_0007747_5770_6999 | 403 |
| 1620 | 3300049586 | Ga0501070_0007747 | Ga0501070_0007747_7187_8416 | 403 |
| 1621 | 3300049586 | Ga0501070_0010122 | Ga0501070_0010122_5233_6462 | 403 |
| 1622 | 3300049586 | Ga0501070_0025402 | Ga0501070_0025402_389_1618 | 403 |
| 1623 | 3300049586 | Ga0501070_0025521 | Ga0501070_0025521_1611_2840 | 403 |
| 1624 | 3300049586 | Ga0501070_0025521 | Ga0501070_0025521_179_1402 | 403 |
| 1625 | 3300049587 | Ga0501071_0122894 | Ga0501071_0122894_11_1240 | 403 |
| 1626 | 3300049588 | Ga0501072_0001213 | Ga0501072_0001213_8257_9486 | 403 |
| 1627 | 3300049588 | Ga0501072_0001213 | Ga0501072_0001213_9674_10903 | 403 |
| 1628 | 3300049589 | Ga0501073_0000037 | Ga0501073_0000037_54298_55527 | 403 |
| 1629 | 3300049589 | Ga0501073_0000037 | Ga0501073_0000037_55715_56944 | 403 |
| 1630 | 3300049590 | Ga0501074_0000133 | Ga0501074_0000133_6887_8116 | 403 |
| 1631 | 3300049590 | Ga0501074_0000133 | Ga0501074_0000133_8304_9533 | 403 |
| 1632 | 3300049590 | Ga0501074_0107539 | Ga0501074_0107539_283_1506 | 403 |
| 1633 | 3300049741 | Ga0501079_0001057 | Ga0501079_0001057_11847_13076 | 403 |
| 1634 | 3300049741 | Ga0501079_0001057 | Ga0501079_0001057_13264_14493 | 403 |
| 1635 | 3300049742 | Ga0501080_0000054 | Ga0501080_0000054_3804_5033 | 403 |
| 1636 | 3300049742 | Ga0501080_0000054 | Ga0501080_0000054_5221_6450 | 403 |
| 1637 | 3300049742 | Ga0501080_0028463 | Ga0501080_0028463_2302_3525 | 403 |
| 1638 | 3300049742 | Ga0501080_0028463 | Ga0501080_0028463_864_2093 | 403 |
| 1639 | 3300049742 | Ga0501080_0192598 | Ga0501080_0192598_70_1299 | 403 |
| 1640 | 3300049744 | Ga0501083_0003724 | Ga0501083_0003724_1296_2525 | 403 |
| 1641 | 3300049822 | Ga0501035_0000142 | Ga0501035_0000142_28377_29606 | 403 |
| 1642 | 3300049822 | Ga0501035_0000142 | Ga0501035_0000142_29794_31023 | 403 |
| 1643 | 3300049822 | Ga0501035_0062851 | Ga0501035_0062851_1916_3145 | 403 |
| 1644 | 3300049822 | Ga0501035_0062851 | Ga0501035_0062851_497_1726 | 403 |
| 1645 | 3300049823 | Ga0501044_0000414 | Ga0501044_0000414_28555_29784 | 403 |
| 1646 | 3300049823 | Ga0501044_0000414 | Ga0501044_0000414_29972_31201 | 403 |
| 1647 | 3300049823 | Ga0501044_0044082 | Ga0501044_0044082_1375_2604 | 403 |
| 1648 | 3300049823 | Ga0501044_0044082 | Ga0501044_0044082_2770_3999 | 403 |
| 1649 | 3300049823 | Ga0501044_0085260 | Ga0501044_0085260_584_1813 | 403 |
| 1650 | 3300049824 | Ga0501045_0057653 | Ga0501045_0057653_1417_2646 | 403 |
| 1651 | 3300050490 | nmdc:mga03n38_66642_c1 | nmdc:mga03n38_66642_c1_385_1614 | 403 |
| 1652 | 3300050490 | nmdc:mga03n38_7090_c1 | nmdc:mga03n38_7090_c1_2277_3506 | 403 |
| 1653 | 3300050491 | nmdc:mga00v17_15058_c1 | nmdc:mga00v17_15058_c1_1539_2768 | 403 |
| 1654 | 3300050494 | nmdc:mga06z11_20446_c1 | nmdc:mga06z11_20446_c1_1815_3044 | 403 |
| 1655 | 3300050496 | nmdc:mga07m45_21802_c1 | nmdc:mga07m45_21802_c1_317_1546 | 403 |
| 1656 | 3300050496 | nmdc:mga07m45_32395_c1 | nmdc:mga07m45_32395_c1_421_1650 | 403 |
| 1657 | 3300050496 | nmdc:mga07m45_53965_c1 | nmdc:mga07m45_53965_c1_769_1998 | 403 |
| 1658 | 3300050512 | nmdc:mga0n895_24565_c1 | nmdc:mga0n895_24565_c1_1234_2463 | 403 |
| 1659 | 3300053077 | Ga0495601_0028223 | Ga0495601_0028223_491_1720 | 403 |
| 1660 | 3300053077 | Ga0495601_0081577 | Ga0495601_0081577_349_1578 | 403 |
| 1661 | 3300053077 | Ga0495601_0200594 | Ga0495601_0200594_44_1273 | 403 |
| 1662 | 3300053078 | Ga0495612_0012023 | Ga0495612_0012023_199_1428 | 403 |
| 1663 | 3300053080 | Ga0500635_0003136 | Ga0500635_0003136_1439_2668 | 403 |
| 1664 | 3300053080 | Ga0500635_0003603 | Ga0500635_0003603_112_1341 | 403 |
| 1665 | 3300053080 | Ga0500635_0003603 | Ga0500635_0003603_1529_2758 | 403 |
| 1666 | 3300053080 | Ga0500635_0042830 | Ga0500635_0042830_91_1320 | 403 |
| 1667 | 3300053085 | Ga0495619_0001183 | Ga0495619_0001183_15931_17160 | 403 |
| 1668 | 3300053085 | Ga0495619_0016178 | Ga0495619_0016178_529_1758 | 403 |
| 1669 | 3300053086 | Ga0500578_0086293 | Ga0500578_0086293_513_1754 | 403 |
| 1670 | 3300053091 | Ga0500647_0033749 | Ga0500647_0033749_851_2086 | 403 |
| 1671 | 3300053093 | Ga0500651_0011222 | Ga0500651_0011222_1512_2753 | 403 |
| 1672 | 3300053094 | Ga0500566_0006638 | Ga0500566_0006638_730_1959 | 403 |
| 1673 | 3300053102 | Ga0500554_003648 | Ga0500554_003648_1652_2881 | 403 |
| 1674 | 3300053111 | Ga0500572_000389 | Ga0500572_000389_3613_4836 | 403 |
| 1675 | 3300053116 | Ga0500592_001392 | Ga0500592_001392_1559_2800 | 403 |
| 1676 | 3300053119 | Ga0500595_001519 | Ga0500595_001519_7467_8696 | 403 |
| 1677 | 3300053119 | Ga0500595_001519 | Ga0500595_001519_8907_10136 | 403 |
| 1678 | 3300053119 | Ga0500595_002014 | Ga0500595_002014_2465_3694 | 403 |
| 1679 | 3300053119 | Ga0500595_003149 | Ga0500595_003149_6458_7744 | 403 |
| 1680 | 3300053119 | Ga0500595_006850 | Ga0500595_006850_2389_3618 | 403 |
| 1681 | 3300053119 | Ga0500595_046074 | Ga0500595_046074_74_1306 | 403 |
| 1682 | 3300053125 | Ga0500618_026238 | Ga0500618_026238_85_1314 | 403 |
| 1683 | 3300053131 | Ga0500652_001212 | Ga0500652_001212_5523_6764 | 403 |
| 1684 | 3300053136 | Ga0500559_0001715 | Ga0500559_0001715_5193_6416 | 403 |
| 1685 | 3300053150 | Ga0500603_000303 | Ga0500603_000303_4210_5439 | 403 |
| 1686 | 3300053162 | Ga0500638_001847 | Ga0500638_001847_5101_6330 | 403 |
| 1687 | 3300053177 | Ga0500636_0064297 | Ga0500636_0064297_690_1919 | 403 |
| 1688 | 3300053177 | Ga0500636_0064793 | Ga0500636_0064793_794_2023 | 403 |
| 1689 | 3300053178 | Ga0500637_0001085 | Ga0500637_0001085_1480_2709 | 403 |
| 1690 | 3300053178 | Ga0500637_0001085 | Ga0500637_0001085_2897_4126 | 403 |
| 1691 | 3300053178 | Ga0500637_0002841 | Ga0500637_0002841_4536_5765 | 403 |
| 1692 | 3300053178 | Ga0500637_0002841 | Ga0500637_0002841_5976_7205 | 403 |
| 1693 | 3300053178 | Ga0500637_0024766 | Ga0500637_0024766_415_1644 | 403 |
| 1694 | 3300053178 | Ga0500637_0026684 | Ga0500637_0026684_1711_2940 | 403 |
| 1695 | 3300053730 | Ga0500645_005883 | Ga0500645_005883_2747_3976 | 403 |
| 1696 | 3300053731 | Ga0500609_000386 | Ga0500609_000386_1529_2758 | 403 |
| 1697 | 3300053733 | Ga0500552_002249 | Ga0500552_002249_79_1308 | 403 |
| 1698 | 3300054114 | Ga0501084_0006462 | Ga0501084_0006462_5830_7059 | 403 |
| 1699 | 3300054114 | Ga0501084_0006462 | Ga0501084_0006462_7247_8476 | 403 |
| 1700 | 3300055283 | Ga0500661_000349 | Ga0500661_000349_7177_8406 | 403 |
| 1701 | 3300059493 | Ga0587077_001070 | Ga0587077_001070_132_1361 | 403 |
| 1702 | 3300059504 | Ga0587082_010826 | Ga0587082_010826_28_1269 | 403 |
| 1703 | 3300059644 | Ga0587075_008698 | Ga0587075_008698_57_1286 | 403 |
| 1704 | 3300059647 | Ga0587079_006083 | Ga0587079_006083_491_1720 | 403 |
| 1705 | 3300060353 | Ga0501082_0002719 | Ga0501082_0002719_11955_13184 | 403 |
| 1706 | 3300060353 | Ga0501082_0002719 | Ga0501082_0002719_13372_14601 | 403 |
| 1707 | iso_pu_bacteria | 8019565922 | 8019567778 | 403 |
| 1708 | 3300005436 | Ga0070713_100038019 | Ga0070713_1000380192 | 404 |
| 1709 | 3300005563 | Ga0068855_100281991 | Ga0068855_1002819912 | 404 |
| 1710 | 3300005617 | Ga0068859_100448322 | Ga0068859_1004483221 | 404 |
| 1711 | 3300006931 | Ga0097620_100448327 | Ga0097620_1004483271 | 404 |
| 1712 | 3300009545 | Ga0105237_10108190 | Ga0105237_101081901 | 404 |
| 1713 | 3300021384 | Ga0213876_10003691 | Ga0213876_100036917 | 404 |
| 1714 | 3300021441 | Ga0213871_10005083 | Ga0213871_100050832 | 404 |
| 1715 | 3300025928 | Ga0207700_10051229 | Ga0207700_100512292 | 404 |
| 1716 | 3300031507 | Ga0307509_10142988 | Ga0307509_101429882 | 404 |
| 1717 | 3300031616 | Ga0307508_10000012 | Ga0307508_1000001221 | 404 |
| 1718 | 3300031616 | Ga0307508_10180778 | Ga0307508_101807781 | 404 |
| 1719 | 3300031730 | Ga0307516_10012378 | Ga0307516_100123786 | 404 |
| 1720 | 3300031730 | Ga0307516_10047340 | Ga0307516_100473403 | 404 |
| 1721 | 3300033179 | Ga0307507_10075010 | Ga0307507_100750101 | 404 |
| 1722 | 3300037466 | Ga0395898_0035217 | Ga0395898_0035217_110_1342 | 404 |
| 1723 | 3300039453 | Ga0436362_0354125 | Ga0436362_0354125_434_1666 | 404 |
| 1724 | 3300046524 | Ga0495648_0000310 | Ga0495648_0000310_3912_5144 | 404 |
| 1725 | 3300048915 | Ga0496112_0000090 | Ga0496112_0000090_12987_14219 | 404 |
| 1726 | 3300048924 | Ga0496121_0076036 | Ga0496121_0076036_189_1496 | 404 |
| 1727 | 3300048924 | Ga0496121_0077391 | Ga0496121_0077391_621_1994 | 404 |
| 1728 | 3300048929 | Ga0496126_0047107 | Ga0496126_0047107_1961_3334 | 404 |
| 1729 | 3300048929 | Ga0496126_0211892 | Ga0496126_0211892_93_1352 | 404 |
| 1730 | 3300049569 | Ga0501032_0058259 | Ga0501032_0058259_595_1827 | 404 |
| 1731 | 3300049569 | Ga0501032_0128537 | Ga0501032_0128537_148_1380 | 404 |
| 1732 | 3300049579 | Ga0501043_0002500 | Ga0501043_0002500_13207_14439 | 404 |
| 1733 | 3300049580 | Ga0501046_0043332 | Ga0501046_0043332_544_1776 | 404 |
| 1734 | 3300049581 | Ga0501047_0250276 | Ga0501047_0250276_285_1517 | 404 |
| 1735 | 3300049583 | Ga0501067_0026256 | Ga0501067_0026256_341_1573 | 404 |
| 1736 | 3300049586 | Ga0501070_0025402 | Ga0501070_0025402_3126_4358 | 404 |
| 1737 | 3300049590 | Ga0501074_0154938 | Ga0501074_0154938_88_1320 | 404 |
| 1738 | 3300049742 | Ga0501080_0133973 | Ga0501080_0133973_901_2133 | 404 |
| 1739 | 3300049822 | Ga0501035_0203574 | Ga0501035_0203574_194_1426 | 404 |
| 1740 | 3300050507 | nmdc:mga05p37_161286_c1 | nmdc:mga05p37_161286_c1_1384_2616 | 404 |
| 1741 | 3300053136 | Ga0500559_0072929 | Ga0500559_0072929_43_1275 | 404 |
| 1742 | 3300053140 | Ga0500573_0027024 | Ga0500573_0027024_1129_2361 | 404 |
| 1743 | 3300053162 | Ga0500638_053434 | Ga0500638_053434_396_1628 | 404 |
| 1744 | 3300053735 | Ga0500596_009089 | Ga0500596_009089_55_1287 | 404 |
| 1745 | 3300060353 | Ga0501082_0260104 | Ga0501082_0260104_184_1416 | 404 |
| 1746 | 3300005336 | Ga0070680_100023945 | Ga0070680_1000239454 | 405 |
| 1747 | 3300005435 | Ga0070714_100160787 | Ga0070714_1001607872 | 405 |
| 1748 | 3300005458 | Ga0070681_10057183 | Ga0070681_100571832 | 405 |
| 1749 | 3300005530 | Ga0070679_100042235 | Ga0070679_1000422352 | 405 |
| 1750 | 3300005563 | Ga0068855_100279671 | Ga0068855_1002796712 | 405 |
| 1751 | 3300009174 | Ga0105241_10133754 | Ga0105241_101337542 | 405 |
| 1752 | 3300025911 | Ga0207654_10042159 | Ga0207654_100421591 | 405 |
| 1753 | 3300025912 | Ga0207707_10006061 | Ga0207707_100060612 | 405 |
| 1754 | 3300025913 | Ga0207695_10170178 | Ga0207695_101701782 | 405 |
| 1755 | 3300025921 | Ga0207652_10018163 | Ga0207652_100181634 | 405 |
| 1756 | 3300025949 | Ga0207667_10255953 | Ga0207667_102559531 | 405 |
| 1757 | 3300026116 | Ga0207674_10115851 | Ga0207674_101158512 | 405 |
| 1758 | 3300037418 | Ga0395900_0299778 | Ga0395900_0299778_322_1560 | 405 |
| 1759 | 3300037466 | Ga0395898_0189480 | Ga0395898_0189480_686_1924 | 405 |
| 1760 | 3300046794 | Ga0495589_0093490 | Ga0495589_0093490_18_1250 | 405 |
| 1761 | 3300005435 | Ga0070714_100154815 | Ga0070714_1001548152 | 406 |
| 1762 | 3300005439 | Ga0070711_100025037 | Ga0070711_1000250373 | 406 |
| 1763 | 3300005458 | Ga0070681_10036430 | Ga0070681_100364303 | 406 |
| 1764 | 3300005563 | Ga0068855_100016594 | Ga0068855_1000165947 | 406 |
| 1765 | 3300009093 | Ga0105240_10063527 | Ga0105240_100635273 | 406 |
| 1766 | 3300009551 | Ga0105238_10008924 | Ga0105238_100089243 | 406 |
| 1767 | 3300013104 | Ga0157370_10009093 | Ga0157370_100090937 | 406 |
| 1768 | 3300025913 | Ga0207695_10081064 | Ga0207695_100810642 | 406 |
| 1769 | 3300025924 | Ga0207694_10065559 | Ga0207694_100655592 | 406 |
| 1770 | 3300025939 | Ga0207665_10036263 | Ga0207665_100362632 | 406 |
| 1771 | 3300025949 | Ga0207667_10232507 | Ga0207667_102325071 | 406 |
| 1772 | 3300045049 | Ga0466959_0052392 | Ga0466959_0052392_1350_2846 | 406 |
| 1773 | 3300000549 | LJQas_1005163 | LJQas_10051632 | 412 |
| 1774 | 3300007265 | Ga0099794_10041225 | Ga0099794_100412251 | 412 |
| 1775 | 3300048910 | Ga0496107_0061908 | Ga0496107_0061908_1218_2456 | 412 |
| 1776 | 3300048911 | Ga0496108_0006756 | Ga0496108_0006756_6713_7951 | 412 |
| 1777 | 3300048912 | Ga0496109_0027858 | Ga0496109_0027858_2521_3759 | 412 |
| 1778 | 3300048913 | Ga0496110_0139486 | Ga0496110_0139486_688_1926 | 412 |
| 1779 | 3300048916 | Ga0496113_0062856 | Ga0496113_0062856_209_1447 | 412 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lkb-assembly1.cif.gz_A | crystal structure of a branched chain amino acid abc transporter from thermus thermophilus with bound valine | 0.9022 | 37 | 405 |
| 3lop-assembly1.cif.gz_A | crystal structure of substrate-binding periplasmic protein (pbp) from ralstonia solanacearum | 0.9005 | 39 | 403 |
| 3lop-assembly1.cif.gz_A | crystal structure of substrate-binding periplasmic protein (pbp) from ralstonia solanacearum | 0.8932 | 39 | 403 |
| 1qo0-assembly1.cif.gz_B | amide receptor of the amidase operon of pseudomonas aeruginosa (amic) complexed with the negative regulator amir. | 0.8791 | 40 | 398 |
| 4kv7-assembly1.cif.gz_A | the crystal structure of a possible leucine/isoleucine/valine-binding protein from rhodopirellula baltica sh 1 | 0.8709 | 25 | 399 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4n0qA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9028 | 159 | 288 | 3.40.50.2300 |
| af_Q9SHV1_60_153_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8895 | 85 | 137 | 3.40.50.2300 |
| 1usiA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8867 | 159 | 286 | 3.40.50.2300 |
| 3lopA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8799 | 159 | 284 | 3.40.50.2300 |
| af_P04816_25_358_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8754 | 39 | 403 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-K8NUS1-F1-model_v4 | Leucine-binding protein domain-containing protein | 0.9982 | 35 | 157 |
|
| AF-A0A7Y9RAP2-F1-model_v4 | ABC-type branched-subunit amino acid transport system substrate-binding protein | 0.9733 | 45 | 404 |
|
| AF-A0A4Q4CY52-F1-model_v4 | Branched-chain amino acid ABC transporter substrate-binding protein | 0.9707 | 34 | 405 |
|
| AF-A0A2V7FKW0-F1-model_v4 | Branched-chain amino acid ABC transporter substrate-binding protein | 0.9637 | 45 | 406 |
|
| AF-D9XDB9-F1-model_v4 | Extracellular ligand-binding receptor | 0.9626 | 65 | 404 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar