F495671

General Info

Members Datasets Scaffolds Average Seq Length
1779 413 1764 191

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10003787|Ga0075366_100037875
Length 218
Sequence MIDDLVRAVEATLFAAEEPLAPEAISAHLGGANVRGALVELAATYHGRGIELVERGGRWHFQTASDLAHLLRRERQDVRRLSRAATEVLAIVAYHEPVSRAEIEAIRGVQTAKGTLDVLLEAGWVRIAGRREVPGRPVIYATTRGFLVHFGLASRRDLPGIDELRAAGLLDPVDDALADALEESMSSGSHHSDAVGSDEAEIALGGTDAGLASGKESA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
4 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
5 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
6 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
7 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
8 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
9 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
10 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
11 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
12 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
13 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
14 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
15 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
16 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
17 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
18 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
19 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
20 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
21 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
22 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
23 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
24 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
25 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
26 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
27 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
28 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
49 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
50 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
62 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
65 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
66 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
67 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
68 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
69 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
70 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
71 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
72 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
98 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
99 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
100 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
101 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
102 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
103 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
104 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
105 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
106 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
107 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
108 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
109 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
112 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
113 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
114 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
115 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
116 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
117 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
119 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
120 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
121 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
122 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
124 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
125 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
126 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
127 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
128 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
129 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
130 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
131 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
132 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
133 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
134 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
135 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
136 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
137 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
138 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
139 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
140 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
141 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
142 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
143 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
144 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
145 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
146 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
147 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
148 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
149 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
154 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
155 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
156 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
157 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
160 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
226 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
227 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
231 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
232 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
233 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
234 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
235 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
236 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
237 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
238 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
239 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
240 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
241 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
242 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
243 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
244 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
245 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
246 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
247 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
248 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
249 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
250 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
251 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
252 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
253 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
254 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
255 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
256 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
257 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
258 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
259 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
260 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
261 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
262 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
263 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
264 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
265 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
266 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
267 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
268 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
269 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
270 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
271 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
272 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
273 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
274 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
275 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
276 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
277 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
278 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
279 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
280 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
281 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
282 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
283 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
284 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
285 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
286 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
287 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
288 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
289 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
290 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
291 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
292 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
293 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
294 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
295 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
296 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
297 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
298 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
299 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
300 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
301 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
302 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
303 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
304 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
305 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
306 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
307 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
308 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
309 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
310 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
311 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
312 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
313 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
314 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
315 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
316 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
317 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
318 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
319 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
320 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
321 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
322 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
323 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
324 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
325 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
326 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
327 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
328 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
329 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
330 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
331 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
332 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
333 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
334 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
335 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
336 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
337 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
338 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
339 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
340 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
341 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
342 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
343 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
344 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
345 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
346 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
347 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
348 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
349 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
350 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
351 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
357 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
358 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
359 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
360 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
361 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
362 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
363 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
364 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
365 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
366 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
367 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
368 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
369 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
370 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
371 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
372 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
373 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
374 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
375 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
376 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
377 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
378 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
379 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
380 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
381 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
382 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
383 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
384 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
385 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
386 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
387 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
388 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
389 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
390 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
391 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
392 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
393 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
394 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
395 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
396 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
397 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
398 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
399 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
400 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
401 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
402 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
403 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
404 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
405 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
406 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
407 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
408 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
409 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
410 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
411 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
412 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
413 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.82
Metatranscriptomes 0.34
Isolates 0.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.77
Nodule 0
Rhizoplane 3.15
Rhizosphere 90.95
Stem 0
Stem Tuber 0
Unclassified 2.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3274429 2162886007 Bacteria 2714
2 JGI24741J21665_1000145 3300001915 Bacteria 19841
3 JGI24752J21851_1016998 3300001976 Bacteria 948
4 JGI24740J21852_10002079 3300001979 Bacteria 9142
5 JGI24740J21852_10003457 3300001979 Bacteria 6937
6 JGI24740J21852_10007981 3300001979 Bacteria 4258
7 JGI24740J21852_10017904 3300001979 Bacteria 2524
8 JGI24739J22299_10009764 3300001989 Bacteria 3569
9 JGI24739J22299_10028590 3300001989 Bacteria 1944
10 JGI24737J22298_10000238 3300001990 Bacteria 18297
11 JGI24737J22298_10002375 3300001990 Bacteria 6714
12 JGI24737J22298_10004139 3300001990 Bacteria 5070
13 JGI24737J22298_10006005 3300001990 Bacteria 4169
14 JGI24737J22298_10007218 3300001990 Bacteria 3757
15 JGI24743J22301_10046281 3300001991 Bacteria 880
16 JGI24735J21928_10004453 3300002067 Bacteria 4709
17 JGI24735J21928_10008487 3300002067 Bacteria 3320
18 JGI24735J21928_10009940 3300002067 Bacteria 3046
19 JGI24735J21928_10010445 3300002067 Bacteria 2960
20 JGI24745J21846_1000475 3300002073 Bacteria 3563
21 JGI24738J21930_10000420 3300002075 Bacteria 11973
22 JGI24738J21930_10003652 3300002075 Bacteria 3854
23 JGI24749J21850_1000027 3300002076 Bacteria 27769
24 JGI24751J29686_10000089 3300002459 Bacteria 50993
25 JGI24751J29686_10039306 3300002459 Bacteria 979
26 JGI25153J46596_10004533 3300003215 Bacteria 7470
27 Ga0055537_1006712 3300003773 Bacteria 2877
28 Ga0055524_1000030 3300003775 Bacteria 187756
29 Ga0055530_10028094 3300003791 Bacteria 1524
30 Ga0055531_10001371 3300003794 Bacteria 18085
31 Ga0065165_1002945 3300005262 Bacteria 12965
32 Ga0065165_1006364 3300005262 Bacteria 6224
33 Ga0065704_10001076 3300005289 Bacteria 11654
34 Ga0065704_10071428 3300005289 Bacteria 11209
35 Ga0065715_10215908 3300005293 Bacteria 1293
36 Ga0065715_10405442 3300005293 Bacteria 876
37 Ga0065707_10203355 3300005295 Bacteria 1300
38 Ga0070658_10003861 3300005327 Bacteria 12286
39 Ga0070658_10014066 3300005327 Bacteria 6425
40 Ga0070658_10020714 3300005327 Bacteria 5268
41 Ga0070658_10028553 3300005327 Bacteria 4480
42 Ga0070658_10041396 3300005327 Bacteria 3717
43 Ga0070658_10066945 3300005327 Bacteria 2935
44 Ga0070658_10087134 3300005327 Bacteria 2569
45 Ga0070658_10135370 3300005327 Bacteria 2055
46 Ga0070658_10139297 3300005327 Bacteria 2026
47 Ga0070658_10171719 3300005327 Bacteria 1821
48 Ga0070658_10182655 3300005327 Bacteria 1765
49 Ga0070658_10312087 3300005327 Bacteria 1342
50 Ga0070658_10312667 3300005327 Bacteria 1340
51 Ga0070658_10350546 3300005327 Bacteria 1263
52 Ga0070658_10351328 3300005327 Bacteria 1262
53 Ga0070658_10390992 3300005327 Bacteria 1194
54 Ga0070658_10693961 3300005327 Bacteria 883
55 Ga0070658_10782631 3300005327 Bacteria 829
56 Ga0070676_10120658 3300005328 Bacteria 1645
57 Ga0070676_10249384 3300005328 Bacteria 1184
58 Ga0070683_100000307 3300005329 Bacteria 33571
59 Ga0070683_100010266 3300005329 Bacteria 8049
60 Ga0070683_100024181 3300005329 Bacteria 5438
61 Ga0070683_100043840 3300005329 Bacteria 4123
62 Ga0070683_100095294 3300005329 Bacteria 2798
63 Ga0070683_100325652 3300005329 Bacteria 1463
64 Ga0070683_100359766 3300005329 Bacteria 1386
65 Ga0070683_100797894 3300005329 Bacteria 905
66 Ga0070690_100084600 3300005330 Bacteria 2079
67 Ga0070690_100110586 3300005330 Bacteria 1833
68 Ga0070690_100185149 3300005330 Bacteria 1440
69 Ga0070690_100784410 3300005330 Bacteria 738
70 Ga0070670_100000028 3300005331 Bacteria 184816
71 Ga0070670_100000814 3300005331 Bacteria 24305
72 Ga0070670_100009988 3300005331 Bacteria 8100
73 Ga0070670_100030696 3300005331 Bacteria 4628
74 Ga0070670_100064704 3300005331 Bacteria 3137
75 Ga0070670_100069930 3300005331 Bacteria 3013
76 Ga0070670_100096191 3300005331 Bacteria 2547
77 Ga0070670_100280215 3300005331 Bacteria 1455
78 Ga0070670_100313477 3300005331 Bacteria 1373
79 Ga0070670_100351605 3300005331 Bacteria 1295
80 Ga0070677_10000842 3300005333 Bacteria 10070
81 Ga0070677_10008724 3300005333 Bacteria 3420
82 Ga0070677_10016276 3300005333 Bacteria 2646
83 Ga0070677_10093129 3300005333 Bacteria 1314
84 Ga0070677_10127787 3300005333 Bacteria 1156
85 Ga0068869_100054585 3300005334 Bacteria 2909
86 Ga0070666_10000129 3300005335 Bacteria 53219
87 Ga0070666_10001161 3300005335 Bacteria 16001
88 Ga0070666_10044915 3300005335 Bacteria 2961
89 Ga0070666_10047456 3300005335 Bacteria 2883
90 Ga0070666_10060084 3300005335 Bacteria 2572
91 Ga0070666_10174304 3300005335 Bacteria 1507
92 Ga0070666_10307055 3300005335 Bacteria 1130
93 Ga0070666_10812266 3300005335 Bacteria 689
94 Ga0070680_100001087 3300005336 Bacteria 19479
95 Ga0070680_100001672 3300005336 Bacteria 16236
96 Ga0070680_100013496 3300005336 Bacteria 6363
97 Ga0070680_100049943 3300005336 Bacteria 3411
98 Ga0070680_100080932 3300005336 Bacteria 2679
99 Ga0070680_100091293 3300005336 Bacteria 2521
100 Ga0070680_100237402 3300005336 Bacteria 1540
101 Ga0070680_100244140 3300005336 Bacteria 1518
102 Ga0070680_100403173 3300005336 Bacteria 1166
103 Ga0070680_100772402 3300005336 Bacteria 827
104 Ga0070682_100147603 3300005337 Bacteria 1610
105 Ga0068868_100000503 3300005338 Bacteria 26082
106 Ga0068868_100073255 3300005338 Bacteria 2734
107 Ga0068868_100125888 3300005338 Bacteria 2093
108 Ga0070660_100000042 3300005339 Bacteria 73112
109 Ga0070660_100000856 3300005339 Bacteria 20282
110 Ga0070660_100006020 3300005339 Bacteria 8387
111 Ga0070660_100017159 3300005339 Bacteria 5272
112 Ga0070660_100023819 3300005339 Bacteria 4538
113 Ga0070660_100024166 3300005339 Bacteria 4507
114 Ga0070660_100030336 3300005339 Bacteria 4057
115 Ga0070660_100031461 3300005339 Bacteria 3985
116 Ga0070660_100046275 3300005339 Bacteria 3334
117 Ga0070660_100080426 3300005339 Bacteria 2557
118 Ga0070660_100090116 3300005339 Bacteria 2417
119 Ga0070660_100121943 3300005339 Bacteria 2081
120 Ga0070660_100138710 3300005339 Bacteria 1949
121 Ga0070660_100157276 3300005339 Bacteria 1830
122 Ga0070660_100175721 3300005339 Bacteria 1732
123 Ga0070660_100206869 3300005339 Bacteria 1593
124 Ga0070660_100304578 3300005339 Bacteria 1307
125 Ga0070689_100283876 3300005340 Bacteria 1374
126 Ga0070691_10112889 3300005341 Bacteria 1361
127 Ga0070687_100070364 3300005343 Bacteria 1877
128 Ga0070687_100147403 3300005343 Bacteria 1377
129 Ga0070661_100000120 3300005344 Bacteria 65485
130 Ga0070661_100013463 3300005344 Bacteria 5742
131 Ga0070661_100027792 3300005344 Bacteria 4076
132 Ga0070661_100028731 3300005344 Bacteria 4012
133 Ga0070661_100042451 3300005344 Bacteria 3319
134 Ga0070661_100079199 3300005344 Bacteria 2424
135 Ga0070661_100081906 3300005344 Bacteria 2383
136 Ga0070661_100086650 3300005344 Bacteria 2316
137 Ga0070661_100095392 3300005344 Bacteria 2206
138 Ga0070661_100184037 3300005344 Bacteria 1590
139 Ga0070661_100198666 3300005344 Bacteria 1531
140 Ga0070661_100263928 3300005344 Bacteria 1332
141 Ga0070661_100493872 3300005344 Bacteria 979
142 Ga0070661_100555025 3300005344 Bacteria 924
143 Ga0070692_10017366 3300005345 Bacteria 3439
144 Ga0070692_10057684 3300005345 Bacteria 2037
145 Ga0070692_10065069 3300005345 Bacteria 1930
146 Ga0070692_10139290 3300005345 Bacteria 1371
147 Ga0070692_10820297 3300005345 Bacteria 637
148 Ga0070668_100000030 3300005347 Bacteria 87912
149 Ga0070668_100005753 3300005347 Bacteria 9197
150 Ga0070668_100013578 3300005347 Bacteria 6081
151 Ga0070668_100018876 3300005347 Bacteria 5181
152 Ga0070668_100032725 3300005347 Bacteria 3956
153 Ga0070668_100039704 3300005347 Bacteria 3599
154 Ga0070668_100058442 3300005347 Bacteria 2983
155 Ga0070668_100075026 3300005347 Bacteria 2639
156 Ga0070668_100088754 3300005347 Bacteria 2434
157 Ga0070668_100188721 3300005347 Bacteria 1687
158 Ga0070668_100193904 3300005347 Bacteria 1665
159 Ga0070668_100291645 3300005347 Bacteria 1366
160 Ga0070668_100339607 3300005347 Bacteria 1268
161 Ga0070668_100589942 3300005347 Bacteria 971
162 Ga0070668_101288758 3300005347 Bacteria 664
163 Ga0070669_100000004 3300005353 Bacteria 314707
164 Ga0070669_100000005 3300005353 Bacteria 309134
165 Ga0070669_100012657 3300005353 Bacteria 5988
166 Ga0070669_100024623 3300005353 Bacteria 4317
167 Ga0070669_100065731 3300005353 Bacteria 2672
168 Ga0070669_100116249 3300005353 Bacteria 2035
169 Ga0070669_100191184 3300005353 Bacteria 1606
170 Ga0070669_100245517 3300005353 Bacteria 1424
171 Ga0070669_100632211 3300005353 Bacteria 899
172 Ga0070669_100922225 3300005353 Bacteria 747
173 Ga0070669_100999425 3300005353 Bacteria 718
174 Ga0070675_100005338 3300005354 Bacteria 9825
175 Ga0070675_100272924 3300005354 Bacteria 1484
176 Ga0070675_100296583 3300005354 Bacteria 1423
177 Ga0070675_100297732 3300005354 Bacteria 1421
178 Ga0070675_100356760 3300005354 Bacteria 1297
179 Ga0070675_100997171 3300005354 Bacteria 769
180 Ga0070675_101121280 3300005354 Bacteria 723
181 Ga0070675_101148383 3300005354 Bacteria 715
182 Ga0070671_100000125 3300005355 Bacteria 49771
183 Ga0070671_100001295 3300005355 Bacteria 18759
184 Ga0070671_100015485 3300005355 Bacteria 6161
185 Ga0070671_100034715 3300005355 Bacteria 4175
186 Ga0070671_100036772 3300005355 Bacteria 4060
187 Ga0070671_100050679 3300005355 Bacteria 3453
188 Ga0070671_100076109 3300005355 Bacteria 2804
189 Ga0070671_100110232 3300005355 Bacteria 2312
190 Ga0070671_100436738 3300005355 Bacteria 1122
191 Ga0070674_100004953 3300005356 Bacteria 7634
192 Ga0070674_100051297 3300005356 Bacteria 2842
193 Ga0070674_100061418 3300005356 Bacteria 2622
194 Ga0070674_100183095 3300005356 Bacteria 1606
195 Ga0070674_100199546 3300005356 Bacteria 1544
196 Ga0070674_100272652 3300005356 Bacteria 1338
197 Ga0070673_100000497 3300005364 Bacteria 20985
198 Ga0070673_100007743 3300005364 Bacteria 7108
199 Ga0070673_100073492 3300005364 Bacteria 2752
200 Ga0070673_100250744 3300005364 Bacteria 1543
201 Ga0070673_100531383 3300005364 Bacteria 1067
202 Ga0070673_100703428 3300005364 Bacteria 928
203 Ga0070659_100000159 3300005366 Bacteria 51703
204 Ga0070659_100001690 3300005366 Bacteria 15882
205 Ga0070659_100002178 3300005366 Bacteria 13947
206 Ga0070659_100012694 3300005366 Bacteria 6249
207 Ga0070659_100015516 3300005366 Bacteria 5707
208 Ga0070659_100029260 3300005366 Bacteria 4257
209 Ga0070659_100033112 3300005366 Bacteria 4012
210 Ga0070659_100044812 3300005366 Bacteria 3464
211 Ga0070659_100045687 3300005366 Bacteria 3431
212 Ga0070659_100046721 3300005366 Bacteria 3393
213 Ga0070659_100063608 3300005366 Bacteria 2919
214 Ga0070659_100068918 3300005366 Bacteria 2807
215 Ga0070659_100112981 3300005366 Bacteria 2194
216 Ga0070659_100129260 3300005366 Bacteria 2050
217 Ga0070659_100202608 3300005366 Bacteria 1634
218 Ga0070659_100317535 3300005366 Bacteria 1302
219 Ga0070659_100440445 3300005366 Bacteria 1104
220 Ga0070659_100449813 3300005366 Bacteria 1092
221 Ga0070659_100611157 3300005366 Bacteria 938
222 Ga0070659_100933282 3300005366 Bacteria 760
223 Ga0070667_100000024 3300005367 Bacteria 191216
224 Ga0070667_100000036 3300005367 Bacteria 172536
225 Ga0070667_100000071 3300005367 Bacteria 125713
226 Ga0070667_100001055 3300005367 Bacteria 25176
227 Ga0070667_100007145 3300005367 Bacteria 9280
228 Ga0070667_100007459 3300005367 Bacteria 9081
229 Ga0070667_100012753 3300005367 Bacteria 6949
230 Ga0070667_100012908 3300005367 Bacteria 6904
231 Ga0070667_100025144 3300005367 Bacteria 4950
232 Ga0070667_100028198 3300005367 Bacteria 4673
233 Ga0070667_100076376 3300005367 Bacteria 2860
234 Ga0070667_100079674 3300005367 Bacteria 2800
235 Ga0070667_100084646 3300005367 Bacteria 2718
236 Ga0070667_100192262 3300005367 Bacteria 1808
237 Ga0070667_100849836 3300005367 Bacteria 848
238 Ga0070667_100942183 3300005367 Bacteria 804
239 Ga0070709_10071522 3300005434 Bacteria 2239
240 Ga0070709_10186331 3300005434 Bacteria 1461
241 Ga0070714_100005271 3300005435 Bacteria 9849
242 Ga0070714_100054319 3300005435 Bacteria 3422
243 Ga0070714_100087645 3300005435 Bacteria 2722
244 Ga0070714_100099909 3300005435 Bacteria 2554
245 Ga0070714_100182084 3300005435 Bacteria 1912
246 Ga0070714_100445388 3300005435 Bacteria 1229
247 Ga0070714_100490438 3300005435 Bacteria 1171
248 Ga0070714_101329748 3300005435 Bacteria 701
249 Ga0070713_100064415 3300005436 Bacteria 3076
250 Ga0070713_100187588 3300005436 Bacteria 1862
251 Ga0070713_100436699 3300005436 Bacteria 1227
252 Ga0070705_100014085 3300005440 Bacteria 4105
253 Ga0070694_100009449 3300005444 Bacteria 5982
254 Ga0070708_100210362 3300005445 Bacteria 1822
255 Ga0070663_100015066 3300005455 Bacteria 4977
256 Ga0070663_100036659 3300005455 Bacteria 3408
257 Ga0070663_100037816 3300005455 Bacteria 3362
258 Ga0070663_100073796 3300005455 Bacteria 2489
259 Ga0070663_100094293 3300005455 Bacteria 2222
260 Ga0070663_100108840 3300005455 Bacteria 2079
261 Ga0070663_100128830 3300005455 Bacteria 1919
262 Ga0070663_100160625 3300005455 Bacteria 1729
263 Ga0070663_100275184 3300005455 Bacteria 1340
264 Ga0070663_100493476 3300005455 Bacteria 1016
265 Ga0070678_100025945 3300005456 Bacteria 3953
266 Ga0070678_100066889 3300005456 Bacteria 2672
267 Ga0070678_100103020 3300005456 Bacteria 2216
268 Ga0070678_100882664 3300005456 Bacteria 816
269 Ga0070662_100000160 3300005457 Bacteria 38823
270 Ga0070662_100001750 3300005457 Bacteria 13370
271 Ga0070662_100024348 3300005457 Bacteria 4170
272 Ga0070662_100038198 3300005457 Bacteria 3409
273 Ga0070662_100040251 3300005457 Bacteria 3326
274 Ga0070662_100046561 3300005457 Bacteria 3116
275 Ga0070662_100056744 3300005457 Bacteria 2843
276 Ga0070662_100074826 3300005457 Bacteria 2507
277 Ga0070662_100110619 3300005457 Bacteria 2092
278 Ga0070662_100115223 3300005457 Bacteria 2053
279 Ga0070662_100336237 3300005457 Bacteria 1234
280 Ga0070662_100485990 3300005457 Bacteria 1028
281 Ga0070662_100573121 3300005457 Bacteria 947
282 Ga0070662_100707165 3300005457 Bacteria 853
283 Ga0070662_101019869 3300005457 Bacteria 709
284 Ga0070681_10019981 3300005458 Bacteria 6710
285 Ga0070681_10120015 3300005458 Bacteria 2565
286 Ga0070681_10137674 3300005458 Bacteria 2372
287 Ga0070681_10356227 3300005458 Bacteria 1374
288 Ga0070681_10369631 3300005458 Bacteria 1344
289 Ga0070681_10437438 3300005458 Bacteria 1220
290 Ga0070681_10500206 3300005458 Bacteria 1128
291 Ga0070681_10501538 3300005458 Bacteria 1127
292 Ga0068867_100189296 3300005459 Bacteria 1641
293 Ga0068867_100195273 3300005459 Bacteria 1617
294 Ga0068867_100210178 3300005459 Bacteria 1562
295 Ga0068867_100304483 3300005459 Bacteria 1315
296 Ga0070685_10280305 3300005466 Bacteria 1116
297 Ga0070679_100134398 3300005530 Bacteria 2454
298 Ga0070679_100182710 3300005530 Bacteria 2069
299 Ga0070679_100216829 3300005530 Bacteria 1876
300 Ga0070679_101045747 3300005530 Bacteria 761
301 Ga0070684_100031782 3300005535 Bacteria 4496
302 Ga0070684_100145528 3300005535 Bacteria 2145
303 Ga0070684_100204392 3300005535 Bacteria 1799
304 Ga0070684_100334423 3300005535 Bacteria 1392
305 Ga0070684_100349153 3300005535 Bacteria 1360
306 Ga0070684_100703606 3300005535 Bacteria 942
307 Ga0070684_100967248 3300005535 Bacteria 799
308 Ga0068853_100002498 3300005539 Bacteria 13796
309 Ga0068853_100006476 3300005539 Bacteria 9310
310 Ga0068853_100006969 3300005539 Bacteria 9027
311 Ga0068853_100009313 3300005539 Bacteria 7919
312 Ga0068853_100025194 3300005539 Bacteria 4991
313 Ga0068853_100047163 3300005539 Bacteria 3697
314 Ga0068853_100200540 3300005539 Bacteria 1816
315 Ga0068853_100334611 3300005539 Bacteria 1406
316 Ga0068853_100391223 3300005539 Bacteria 1300
317 Ga0068853_100999965 3300005539 Bacteria 805
318 Ga0070672_100013564 3300005543 Bacteria 5761
319 Ga0070672_100041805 3300005543 Bacteria 3527
320 Ga0070672_100081851 3300005543 Bacteria 2589
321 Ga0070672_100267233 3300005543 Bacteria 1443
322 Ga0070686_100086866 3300005544 Bacteria 2083
323 Ga0070695_100086771 3300005545 Bacteria 2080
324 Ga0070696_100061030 3300005546 Bacteria 2637
325 Ga0070696_100105646 3300005546 Bacteria 2023
326 Ga0070696_100733474 3300005546 Bacteria 808
327 Ga0070693_100003515 3300005547 Bacteria 7306
328 Ga0070693_100083556 3300005547 Bacteria 1909
329 Ga0070665_100001688 3300005548 Bacteria 25443
330 Ga0070665_100017313 3300005548 Bacteria 7234
331 Ga0070665_100028917 3300005548 Bacteria 5579
332 Ga0070665_100034565 3300005548 Bacteria 5083
333 Ga0070665_100110339 3300005548 Bacteria 2754
334 Ga0070665_100183983 3300005548 Bacteria 2090
335 Ga0070665_100224567 3300005548 Bacteria 1878
336 Ga0070665_100279835 3300005548 Bacteria 1670
337 Ga0068855_100001458 3300005563 Bacteria 29522
338 Ga0068855_100007354 3300005563 Bacteria 13335
339 Ga0068855_100019628 3300005563 Bacteria 8120
340 Ga0068855_100040249 3300005563 Bacteria 5547
341 Ga0068855_100053508 3300005563 Bacteria 4749
342 Ga0068855_100073993 3300005563 Bacteria 3957
343 Ga0068855_100087777 3300005563 Bacteria 3593
344 Ga0068855_100117095 3300005563 Bacteria 3053
345 Ga0068855_100139824 3300005563 Bacteria 2761
346 Ga0068855_100204124 3300005563 Bacteria 2224
347 Ga0068855_100208814 3300005563 Bacteria 2195
348 Ga0068855_100314694 3300005563 Bacteria 1731
349 Ga0068855_100586157 3300005563 Bacteria 1204
350 Ga0068855_100810230 3300005563 Bacteria 995
351 Ga0068855_101232450 3300005563 Bacteria 777
352 Ga0068855_101277698 3300005563 Bacteria 760
353 Ga0070664_100000071 3300005564 Bacteria 63639
354 Ga0070664_100022534 3300005564 Bacteria 5195
355 Ga0070664_100024270 3300005564 Bacteria 5014
356 Ga0070664_100039394 3300005564 Bacteria 3982
357 Ga0070664_100041656 3300005564 Bacteria 3875
358 Ga0070664_100045191 3300005564 Bacteria 3719
359 Ga0070664_100057327 3300005564 Bacteria 3311
360 Ga0070664_100135240 3300005564 Bacteria 2167
361 Ga0070664_100173788 3300005564 Bacteria 1912
362 Ga0070664_100194387 3300005564 Bacteria 1808
363 Ga0070664_100244047 3300005564 Bacteria 1613
364 Ga0070664_100435265 3300005564 Bacteria 1202
365 Ga0070664_100612646 3300005564 Bacteria 1010
366 Ga0068857_100000315 3300005577 Bacteria 33485
367 Ga0068857_100015582 3300005577 Bacteria 6641
368 Ga0068857_100021422 3300005577 Bacteria 5689
369 Ga0068857_100025044 3300005577 Bacteria 5256
370 Ga0068857_100060082 3300005577 Bacteria 3377
371 Ga0068857_100121742 3300005577 Bacteria 2349
372 Ga0068857_100164819 3300005577 Bacteria 2012
373 Ga0068857_100194341 3300005577 Bacteria 1849
374 Ga0068857_100212500 3300005577 Bacteria 1765
375 Ga0068857_100267652 3300005577 Bacteria 1570
376 Ga0068857_100353499 3300005577 Bacteria 1361
377 Ga0068857_101060347 3300005577 Bacteria 782
378 Ga0068854_100001206 3300005578 Bacteria 15499
379 Ga0068854_100017221 3300005578 Bacteria 4832
380 Ga0068854_100023236 3300005578 Bacteria 4233
381 Ga0068854_100025206 3300005578 Bacteria 4080
382 Ga0068854_100026711 3300005578 Bacteria 3971
383 Ga0068854_100027252 3300005578 Bacteria 3937
384 Ga0068854_100041359 3300005578 Bacteria 3256
385 Ga0068854_100042894 3300005578 Bacteria 3204
386 Ga0068854_100050371 3300005578 Bacteria 2979
387 Ga0068854_100059619 3300005578 Bacteria 2758
388 Ga0068854_100072460 3300005578 Bacteria 2522
389 Ga0068854_100111719 3300005578 Bacteria 2062
390 Ga0068854_100146769 3300005578 Bacteria 1815
391 Ga0068854_100308928 3300005578 Bacteria 1282
392 Ga0068856_100000244 3300005614 Bacteria 59255
393 Ga0068856_100008866 3300005614 Bacteria 9789
394 Ga0068856_100021889 3300005614 Bacteria 6214
395 Ga0068856_100022262 3300005614 Bacteria 6162
396 Ga0068856_100044318 3300005614 Bacteria 4378
397 Ga0068856_100086575 3300005614 Bacteria 3113
398 Ga0068856_100163613 3300005614 Bacteria 2236
399 Ga0068856_100253494 3300005614 Bacteria 1775
400 Ga0068856_100565383 3300005614 Bacteria 1158
401 Ga0068856_101183286 3300005614 Bacteria 781
402 Ga0070702_100056758 3300005615 Bacteria 2263
403 Ga0068852_100001863 3300005616 Bacteria 14345
404 Ga0068852_100002128 3300005616 Bacteria 13573
405 Ga0068852_100003541 3300005616 Bacteria 10930
406 Ga0068852_100006623 3300005616 Bacteria 8392
407 Ga0068852_100017325 3300005616 Bacteria 5649
408 Ga0068852_100021794 3300005616 Bacteria 5125
409 Ga0068852_100046115 3300005616 Bacteria 3712
410 Ga0068852_100051544 3300005616 Bacteria 3532
411 Ga0068852_100060834 3300005616 Bacteria 3280
412 Ga0068852_100097710 3300005616 Bacteria 2642
413 Ga0068852_100161030 3300005616 Bacteria 2095
414 Ga0068852_100418894 3300005616 Bacteria 1321
415 Ga0068852_100726136 3300005616 Bacteria 1004
416 Ga0068852_101999943 3300005616 Bacteria 602
417 Ga0068859_100000144 3300005617 Bacteria 67220
418 Ga0068859_100001288 3300005617 Bacteria 25603
419 Ga0068859_100001818 3300005617 Bacteria 21728
420 Ga0068859_100026991 3300005617 Bacteria 5761
421 Ga0068859_100156542 3300005617 Bacteria 2356
422 Ga0068859_100209306 3300005617 Bacteria 2036
423 Ga0068859_100214524 3300005617 Bacteria 2012
424 Ga0068859_100384456 3300005617 Bacteria 1499
425 Ga0068859_100801376 3300005617 Bacteria 1030
426 Ga0068859_101221312 3300005617 Bacteria 828
427 Ga0068864_100000092 3300005618 Bacteria 94499
428 Ga0068864_100000336 3300005618 Bacteria 41315
429 Ga0068864_100007503 3300005618 Bacteria 8985
430 Ga0068864_100016790 3300005618 Bacteria 6101
431 Ga0068864_100091835 3300005618 Bacteria 2679
432 Ga0068864_100098812 3300005618 Bacteria 2585
433 Ga0068866_10047459 3300005718 Bacteria 2165
434 Ga0068866_10049083 3300005718 Bacteria 2137
435 Ga0068866_10183768 3300005718 Bacteria 1237
436 Ga0068861_100101837 3300005719 Bacteria 2285
437 Ga0068861_100196297 3300005719 Bacteria 1691
438 Ga0068861_100248325 3300005719 Bacteria 1517
439 Ga0068861_100511998 3300005719 Bacteria 1087
440 Ga0068851_10008092 3300005834 Bacteria 4852
441 Ga0068851_10045631 3300005834 Bacteria 2215
442 Ga0068851_10064730 3300005834 Bacteria 1879
443 Ga0068851_10076713 3300005834 Bacteria 1739
444 Ga0068851_10108806 3300005834 Bacteria 1478
445 Ga0068851_10138542 3300005834 Bacteria 1321
446 Ga0068851_10170108 3300005834 Bacteria 1202
447 Ga0068863_100000082 3300005841 Bacteria 105688
448 Ga0068863_100000222 3300005841 Bacteria 60169
449 Ga0068863_100000670 3300005841 Bacteria 34540
450 Ga0068863_100003355 3300005841 Bacteria 15820
451 Ga0068863_100004067 3300005841 Bacteria 14443
452 Ga0068863_100060175 3300005841 Bacteria 3592
453 Ga0068863_100060705 3300005841 Bacteria 3575
454 Ga0068863_100069721 3300005841 Bacteria 3324
455 Ga0068863_100083690 3300005841 Bacteria 3023
456 Ga0068863_100152176 3300005841 Bacteria 2214
457 Ga0068863_100176435 3300005841 Bacteria 2051
458 Ga0068863_100262058 3300005841 Bacteria 1671
459 Ga0068858_100000256 3300005842 Bacteria 56844
460 Ga0068858_100002663 3300005842 Bacteria 17966
461 Ga0068858_100003763 3300005842 Bacteria 15003
462 Ga0068858_100045258 3300005842 Bacteria 4077
463 Ga0068858_100099331 3300005842 Bacteria 2714
464 Ga0068858_100342760 3300005842 Bacteria 1430
465 Ga0068858_101536777 3300005842 Bacteria 657
466 Ga0068860_100000007 3300005843 Bacteria 429329
467 Ga0068860_100000049 3300005843 Bacteria 208782
468 Ga0068860_100000063 3300005843 Bacteria 189519
469 Ga0068860_100001415 3300005843 Bacteria 25996
470 Ga0068860_100002571 3300005843 Bacteria 18988
471 Ga0068860_100002979 3300005843 Bacteria 17493
472 Ga0068860_100101492 3300005843 Bacteria 2745
473 Ga0068860_100302584 3300005843 Bacteria 1567
474 Ga0068860_100315968 3300005843 Bacteria 1532
475 Ga0068860_100449273 3300005843 Bacteria 1281
476 Ga0068860_100592134 3300005843 Bacteria 1114
477 Ga0068860_101257869 3300005843 Bacteria 761
478 Ga0068862_100000005 3300005844 Bacteria 350713
479 Ga0068862_100000067 3300005844 Bacteria 123668
480 Ga0068862_100000134 3300005844 Bacteria 85840
481 Ga0068862_100001195 3300005844 Bacteria 24489
482 Ga0068862_100005331 3300005844 Bacteria 10774
483 Ga0068862_100005835 3300005844 Bacteria 10261
484 Ga0068862_100011848 3300005844 Bacteria 7201
485 Ga0068862_100412659 3300005844 Bacteria 1265
486 Ga0068862_101495505 3300005844 Bacteria 680
487 Ga0068862_101753794 3300005844 Bacteria 630
488 Ga0081540_1074990 3300005983 Bacteria 1547
489 Ga0081539_10018771 3300005985 Bacteria 4774
490 Ga0081539_10052286 3300005985 Bacteria 2296
491 Ga0070717_10051068 3300006028 Bacteria 3402
492 Ga0070717_10066510 3300006028 Bacteria 2998
493 Ga0070717_10188847 3300006028 Bacteria 1799
494 Ga0070717_10924860 3300006028 Bacteria 794
495 Ga0075368_10001345 3300006042 Bacteria 7816
496 Ga0075363_100002604 3300006048 Bacteria 7433
497 Ga0075363_100220732 3300006048 Bacteria 1086
498 Ga0075364_10037942 3300006051 Bacteria 3122
499 Ga0070716_100165213 3300006173 Bacteria 1438
500 Ga0070712_100002819 3300006175 Bacteria 10753
501 Ga0070712_100075616 3300006175 Bacteria 2422
502 Ga0070712_100543031 3300006175 Bacteria 979
503 Ga0075362_10000119 3300006177 Bacteria 22052
504 Ga0075367_10010071 3300006178 Bacteria 4956
505 Ga0075369_10001089 3300006186 Bacteria 9105
506 Ga0075366_10000014 3300006195 Bacteria 66940
507 Ga0075366_10003787 3300006195 Bacteria 8045
508 Ga0097621_100128905 3300006237 Bacteria 2151
509 Ga0097621_100537062 3300006237 Bacteria 1063
510 Ga0075370_10000141 3300006353 Bacteria 24359
511 Ga0068871_100175920 3300006358 Bacteria 1837
512 Ga0068871_100253940 3300006358 Bacteria 1532
513 Ga0068871_101018643 3300006358 Bacteria 772
514 Ga0075431_100008702 3300006847 Bacteria 10169
515 Ga0075431_100593629 3300006847 Bacteria 1092
516 Ga0075434_100097001 3300006871 Bacteria 2953
517 Ga0075429_100200592 3300006880 Bacteria 1748
518 Ga0075429_100332451 3300006880 Bacteria 1330
519 Ga0068865_100002706 3300006881 Bacteria 10514
520 Ga0068865_100013435 3300006881 Bacteria 5172
521 Ga0068865_100103578 3300006881 Bacteria 2087
522 Ga0068865_100624595 3300006881 Bacteria 913
523 Ga0097620_100000144 3300006931 Bacteria 67220
524 Ga0097620_100001288 3300006931 Bacteria 25603
525 Ga0097620_100001818 3300006931 Bacteria 21728
526 Ga0097620_100026991 3300006931 Bacteria 5761
527 Ga0097620_100156538 3300006931 Bacteria 2356
528 Ga0097620_100209290 3300006931 Bacteria 2036
529 Ga0097620_100214526 3300006931 Bacteria 2012
530 Ga0097620_100384436 3300006931 Bacteria 1499
531 Ga0097620_100801412 3300006931 Bacteria 1030
532 Ga0097620_101221403 3300006931 Bacteria 828
533 Ga0075435_100356215 3300007076 Bacteria 1255
534 Ga0105251_10016546 3300009011 Bacteria 3981
535 Ga0105250_10017542 3300009092 Bacteria 2911
536 Ga0105240_10014684 3300009093 Bacteria 10686
537 Ga0105240_10094931 3300009093 Bacteria 3637
538 Ga0105240_10121821 3300009093 Bacteria 3140
539 Ga0105240_10427397 3300009093 Bacteria 1487
540 Ga0105240_10497236 3300009093 Bacteria 1356
541 Ga0105240_10519508 3300009093 Bacteria 1321
542 Ga0105240_10557693 3300009093 Bacteria 1267
543 Ga0105240_10628205 3300009093 Bacteria 1180
544 Ga0111539_10023713 3300009094 Bacteria 7539
545 Ga0111539_10471626 3300009094 Bacteria 1462
546 Ga0105245_10007077 3300009098 Bacteria 9841
547 Ga0105245_10161479 3300009098 Bacteria 2127
548 Ga0105247_10005192 3300009101 Bacteria 8235
549 Ga0105247_10278385 3300009101 Bacteria 1153
550 Ga0105247_10460311 3300009101 Bacteria 919
551 Ga0105243_10040963 3300009148 Bacteria 3621
552 Ga0105243_10073164 3300009148 Bacteria 2776
553 Ga0105243_10118799 3300009148 Bacteria 2225
554 Ga0105243_10285746 3300009148 Bacteria 1488
555 Ga0105243_10368276 3300009148 Bacteria 1325
556 Ga0105243_10396607 3300009148 Bacteria 1281
557 Ga0105243_11287424 3300009148 Bacteria 748
558 Ga0105241_10035184 3300009174 Bacteria 3767
559 Ga0105241_10054250 3300009174 Bacteria 3067
560 Ga0105241_10071184 3300009174 Bacteria 2699
561 Ga0105241_10126124 3300009174 Bacteria 2067
562 Ga0105242_10101955 3300009176 Bacteria 2433
563 Ga0105242_10129373 3300009176 Bacteria 2177
564 Ga0105248_10000218 3300009177 Bacteria 66074
565 Ga0105248_10000587 3300009177 Bacteria 41432
566 Ga0105248_10000773 3300009177 Bacteria 35907
567 Ga0105248_10002607 3300009177 Bacteria 20059
568 Ga0105248_10028414 3300009177 Bacteria 6231
569 Ga0105248_10218960 3300009177 Bacteria 2144
570 Ga0105248_10694599 3300009177 Bacteria 1148
571 Ga0105248_11123092 3300009177 Bacteria 888
572 Ga0105237_10012608 3300009545 Bacteria 8902
573 Ga0105237_10042186 3300009545 Bacteria 4602
574 Ga0105238_10029976 3300009551 Bacteria 5537
575 Ga0105238_10133037 3300009551 Bacteria 2465
576 Ga0105238_10266847 3300009551 Bacteria 1692
577 Ga0105238_10373171 3300009551 Bacteria 1417
578 Ga0105238_10931830 3300009551 Bacteria 888
579 Ga0105249_10000105 3300009553 Bacteria 117181
580 Ga0105249_10009482 3300009553 Bacteria 8526
581 Ga0105249_10208405 3300009553 Bacteria 1917
582 Ga0105249_10349008 3300009553 Bacteria 1498
583 Ga0105249_10362097 3300009553 Bacteria 1472
584 Ga0105249_10367064 3300009553 Bacteria 1462
585 Ga0105249_11070196 3300009553 Bacteria 876
586 Ga0105239_10011604 3300010375 Bacteria 9830
587 Ga0105239_10803137 3300010375 Bacteria 1078
588 Ga0157326_1000266 3300012513 Bacteria 6071
589 Ga0157373_10003467 3300013100 Bacteria 11928
590 Ga0157373_10010060 3300013100 Bacteria 6969
591 Ga0157373_10017414 3300013100 Bacteria 5234
592 Ga0157373_10023626 3300013100 Bacteria 4455
593 Ga0157373_10048609 3300013100 Bacteria 3024
594 Ga0157373_10054170 3300013100 Bacteria 2851
595 Ga0157373_10080578 3300013100 Bacteria 2296
596 Ga0157373_10082891 3300013100 Bacteria 2260
597 Ga0157373_10087200 3300013100 Bacteria 2199
598 Ga0157373_10136161 3300013100 Bacteria 1727
599 Ga0157373_10173200 3300013100 Bacteria 1518
600 Ga0157373_10297508 3300013100 Bacteria 1145
601 Ga0157371_10008769 3300013102 Bacteria 8020
602 Ga0157371_10010092 3300013102 Bacteria 7383
603 Ga0157371_10011964 3300013102 Bacteria 6654
604 Ga0157371_10021475 3300013102 Bacteria 4739
605 Ga0157371_10023626 3300013102 Bacteria 4496
606 Ga0157371_10044688 3300013102 Bacteria 3153
607 Ga0157371_10051615 3300013102 Bacteria 2922
608 Ga0157371_10098950 3300013102 Bacteria 2068
609 Ga0157371_10213428 3300013102 Bacteria 1385
610 Ga0157371_10277695 3300013102 Bacteria 1210
611 Ga0157371_10278832 3300013102 Bacteria 1207
612 Ga0157371_10332646 3300013102 Bacteria 1104
613 Ga0157371_10365196 3300013102 Bacteria 1052
614 Ga0157371_10451344 3300013102 Bacteria 945
615 Ga0157371_10557174 3300013102 Bacteria 850
616 Ga0157370_10001722 3300013104 Bacteria 26937
617 Ga0157370_10053809 3300013104 Bacteria 3837
618 Ga0157370_10055445 3300013104 Bacteria 3776
619 Ga0157370_10073909 3300013104 Bacteria 3216
620 Ga0157370_10096001 3300013104 Bacteria 2781
621 Ga0157370_10209345 3300013104 Bacteria 1807
622 Ga0157370_10257419 3300013104 Bacteria 1613
623 Ga0157370_10275276 3300013104 Bacteria 1555
624 Ga0157369_10004588 3300013105 Bacteria 16235
625 Ga0157369_10019901 3300013105 Bacteria 7508
626 Ga0157369_10023001 3300013105 Bacteria 6948
627 Ga0157369_10030659 3300013105 Bacteria 5929
628 Ga0157369_10041088 3300013105 Bacteria 5048
629 Ga0157369_10069347 3300013105 Bacteria 3788
630 Ga0157369_10084970 3300013105 Bacteria 3382
631 Ga0157369_10090164 3300013105 Bacteria 3273
632 Ga0157369_10102999 3300013105 Bacteria 3040
633 Ga0157369_10140237 3300013105 Bacteria 2558
634 Ga0157369_10154395 3300013105 Bacteria 2425
635 Ga0157369_10181970 3300013105 Bacteria 2211
636 Ga0157369_10213614 3300013105 Bacteria 2021
637 Ga0157369_10336068 3300013105 Bacteria 1569
638 Ga0157369_10692999 3300013105 Bacteria 1049
639 Ga0157369_11353032 3300013105 Bacteria 725
640 Ga0157374_10034037 3300013296 Bacteria 4652
641 Ga0157374_10178516 3300013296 Bacteria 2073
642 Ga0157374_10904870 3300013296 Bacteria 900
643 Ga0157378_10015380 3300013297 Bacteria 6701
644 Ga0163162_10014733 3300013306 Bacteria 7641
645 Ga0163162_10032821 3300013306 Bacteria 5156
646 Ga0163162_10190474 3300013306 Bacteria 2178
647 Ga0163162_10255852 3300013306 Bacteria 1883
648 Ga0163162_10579789 3300013306 Bacteria 1249
649 Ga0157372_10006954 3300013307 Bacteria 12043
650 Ga0157372_10050035 3300013307 Bacteria 4649
651 Ga0157372_10076696 3300013307 Bacteria 3774
652 Ga0157372_10086690 3300013307 Bacteria 3552
653 Ga0157372_10275604 3300013307 Bacteria 1955
654 Ga0157372_10401395 3300013307 Bacteria 1597
655 Ga0157372_10429185 3300013307 Bacteria 1540
656 Ga0157372_10469849 3300013307 Bacteria 1466
657 Ga0157372_10912118 3300013307 Bacteria 1019
658 Ga0157375_10006908 3300013308 Bacteria 9903
659 Ga0157375_10125933 3300013308 Bacteria 2676
660 Ga0157375_10396567 3300013308 Bacteria 1547
661 Ga0157375_10540420 3300013308 Bacteria 1328
662 Ga0157375_10744076 3300013308 Bacteria 1132
663 Ga0157375_10885841 3300013308 Bacteria 1037
664 Ga0157375_10889394 3300013308 Bacteria 1035
665 Ga0163163_10000080 3300014325 Bacteria 106006
666 Ga0163163_10000464 3300014325 Bacteria 37051
667 Ga0163163_10004007 3300014325 Bacteria 12566
668 Ga0163163_10068640 3300014325 Bacteria 3527
669 Ga0163163_10121453 3300014325 Bacteria 2646
670 Ga0163163_10304986 3300014325 Bacteria 1645
671 Ga0157380_10000023 3300014326 Bacteria 113686
672 Ga0157380_10067913 3300014326 Bacteria 2872
673 Ga0157380_10097219 3300014326 Bacteria 2443
674 Ga0157380_10098592 3300014326 Bacteria 2428
675 Ga0157377_10065466 3300014745 Bacteria 2088
676 Ga0157377_10108916 3300014745 Bacteria 1662
677 Ga0157377_10240534 3300014745 Bacteria 1168
678 Ga0157379_10005589 3300014968 Bacteria 10805
679 Ga0157379_10043381 3300014968 Bacteria 4015
680 Ga0157379_10163230 3300014968 Bacteria 2011
681 Ga0157376_10005211 3300014969 Bacteria 9071
682 Ga0157376_10823582 3300014969 Bacteria 942
683 Ga0157376_11020990 3300014969 Bacteria 850
684 Ga0163161_10291021 3300017792 Bacteria 1284
685 Ga0163161_10394567 3300017792 Bacteria 1109
686 Ga0197907_10924108 3300020069 Bacteria 2061
687 Ga0206356_10945929 3300020070 Bacteria 1198
688 Ga0206354_10231885 3300020081 Bacteria 2403
689 Ga0206354_10912860 3300020081 Bacteria 1652
690 Ga0206353_11476642 3300020082 Bacteria 1256
691 Ga0206353_11915595 3300020082 Bacteria 2485
692 Ga0213873_10000042 3300021358 Bacteria 30839
693 Ga0213876_10000050 3300021384 Bacteria 144836
694 Ga0213876_10007945 3300021384 Bacteria 5755
695 Ga0213876_10023182 3300021384 Bacteria 3279
696 Ga0213875_10002606 3300021388 Bacteria 10707
697 Ga0207425_1018044 3300025245 Bacteria 1538
698 Ga0209565_1000012 3300025263 Bacteria 606500
699 Ga0209673_1001810 3300025273 Bacteria 17588
700 Ga0209758_1004619 3300025297 Bacteria 11303
701 Ga0209050_1008559 3300025298 Bacteria 5430
702 Ga0209256_1000012 3300025299 Bacteria 790371
703 Ga0209257_1003549 3300025304 Bacteria 13254
704 Ga0207697_10000502 3300025315 Bacteria 22013
705 Ga0207697_10023020 3300025315 Bacteria 2551
706 Ga0207656_10002365 3300025321 Bacteria 6333
707 Ga0207656_10003463 3300025321 Bacteria 5427
708 Ga0207656_10013260 3300025321 Bacteria 3145
709 Ga0207656_10029225 3300025321 Bacteria 2268
710 Ga0207656_10076375 3300025321 Bacteria 1498
711 Ga0207656_10108559 3300025321 Bacteria 1280
712 Ga0207713_1037137 3300025735 Bacteria 2081
713 Ga0207682_10001153 3300025893 Bacteria 12256
714 Ga0207682_10005329 3300025893 Bacteria 5251
715 Ga0207682_10008330 3300025893 Bacteria 4101
716 Ga0207682_10011031 3300025893 Bacteria 3537
717 Ga0207642_10015428 3300025899 Bacteria 2846
718 Ga0207642_10105864 3300025899 Bacteria 1422
719 Ga0207710_10002821 3300025900 Bacteria 7922
720 Ga0207710_10007596 3300025900 Bacteria 4587
721 Ga0207710_10234230 3300025900 Bacteria 914
722 Ga0207688_10008353 3300025901 Bacteria 5631
723 Ga0207680_10000106 3300025903 Bacteria 38390
724 Ga0207680_10002081 3300025903 Bacteria 9377
725 Ga0207680_10006822 3300025903 Bacteria 5541
726 Ga0207680_10071197 3300025903 Bacteria 2155
727 Ga0207680_10142945 3300025903 Bacteria 1588
728 Ga0207680_10321898 3300025903 Bacteria 1081
729 Ga0207680_10687556 3300025903 Bacteria 733
730 Ga0207647_10001153 3300025904 Bacteria 20350
731 Ga0207647_10001911 3300025904 Bacteria 15961
732 Ga0207647_10002139 3300025904 Bacteria 15092
733 Ga0207647_10007197 3300025904 Bacteria 8059
734 Ga0207647_10008602 3300025904 Bacteria 7305
735 Ga0207647_10009442 3300025904 Bacteria 6931
736 Ga0207647_10027393 3300025904 Bacteria 3715
737 Ga0207647_10055099 3300025904 Bacteria 2444
738 Ga0207647_10059639 3300025904 Bacteria 2334
739 Ga0207647_10066878 3300025904 Bacteria 2179
740 Ga0207647_10067402 3300025904 Bacteria 2169
741 Ga0207647_10093715 3300025904 Bacteria 1789
742 Ga0207647_10297439 3300025904 Bacteria 919
743 Ga0207699_10228477 3300025906 Bacteria 1274
744 Ga0207645_10016295 3300025907 Bacteria 4921
745 Ga0207645_10021097 3300025907 Bacteria 4252
746 Ga0207645_10098361 3300025907 Bacteria 1886
747 Ga0207705_10000135 3300025909 Bacteria 79350
748 Ga0207705_10000469 3300025909 Bacteria 34559
749 Ga0207705_10000764 3300025909 Bacteria 26574
750 Ga0207705_10002589 3300025909 Bacteria 13894
751 Ga0207705_10006049 3300025909 Bacteria 8998
752 Ga0207705_10006095 3300025909 Bacteria 8973
753 Ga0207705_10013901 3300025909 Bacteria 5805
754 Ga0207705_10022048 3300025909 Bacteria 4545
755 Ga0207705_10027109 3300025909 Bacteria 4084
756 Ga0207705_10029746 3300025909 Bacteria 3894
757 Ga0207705_10044605 3300025909 Bacteria 3186
758 Ga0207705_10047346 3300025909 Bacteria 3092
759 Ga0207705_10050213 3300025909 Bacteria 3003
760 Ga0207705_10051887 3300025909 Bacteria 2952
761 Ga0207705_10066815 3300025909 Bacteria 2601
762 Ga0207705_10122948 3300025909 Bacteria 1927
763 Ga0207705_10131046 3300025909 Bacteria 1866
764 Ga0207705_10238950 3300025909 Bacteria 1383
765 Ga0207705_10243266 3300025909 Bacteria 1371
766 Ga0207705_10339059 3300025909 Bacteria 1157
767 Ga0207654_10043156 3300025911 Bacteria 2555
768 Ga0207654_10238977 3300025911 Bacteria 1213
769 Ga0207707_10004365 3300025912 Bacteria 12504
770 Ga0207707_10012875 3300025912 Bacteria 7280
771 Ga0207707_10094729 3300025912 Bacteria 2609
772 Ga0207707_10719424 3300025912 Bacteria 837
773 Ga0207695_10011701 3300025913 Bacteria 10602
774 Ga0207695_10070537 3300025913 Bacteria 3571
775 Ga0207695_10135847 3300025913 Bacteria 2412
776 Ga0207695_10214215 3300025913 Bacteria 1836
777 Ga0207695_10260755 3300025913 Bacteria 1631
778 Ga0207671_10011347 3300025914 Bacteria 7258
779 Ga0207671_10017230 3300025914 Bacteria 5580
780 Ga0207671_10146978 3300025914 Bacteria 1819
781 Ga0207693_10158781 3300025915 Bacteria 1779
782 Ga0207660_10000472 3300025917 Bacteria 26680
783 Ga0207660_10001812 3300025917 Bacteria 14236
784 Ga0207660_10001982 3300025917 Bacteria 13637
785 Ga0207660_10006179 3300025917 Bacteria 7780
786 Ga0207660_10018348 3300025917 Bacteria 4661
787 Ga0207660_10119892 3300025917 Bacteria 1991
788 Ga0207660_10329321 3300025917 Bacteria 1221
789 Ga0207660_10337384 3300025917 Bacteria 1206
790 Ga0207660_10591822 3300025917 Bacteria 903
791 Ga0207662_10149389 3300025918 Bacteria 1485
792 Ga0207657_10000864 3300025919 Bacteria 31944
793 Ga0207657_10001741 3300025919 Bacteria 23460
794 Ga0207657_10003876 3300025919 Bacteria 15873
795 Ga0207657_10006128 3300025919 Bacteria 12497
796 Ga0207657_10008302 3300025919 Bacteria 10563
797 Ga0207657_10008634 3300025919 Bacteria 10315
798 Ga0207657_10010390 3300025919 Bacteria 9292
799 Ga0207657_10028000 3300025919 Bacteria 5150
800 Ga0207657_10031358 3300025919 Bacteria 4815
801 Ga0207657_10032063 3300025919 Bacteria 4752
802 Ga0207657_10035190 3300025919 Bacteria 4494
803 Ga0207657_10036492 3300025919 Bacteria 4399
804 Ga0207657_10042285 3300025919 Bacteria 4022
805 Ga0207657_10044544 3300025919 Bacteria 3900
806 Ga0207657_10046598 3300025919 Bacteria 3797
807 Ga0207657_10056126 3300025919 Bacteria 3399
808 Ga0207657_10056166 3300025919 Bacteria 3397
809 Ga0207657_10058172 3300025919 Bacteria 3328
810 Ga0207657_10103917 3300025919 Bacteria 2354
811 Ga0207657_10219712 3300025919 Bacteria 1523
812 Ga0207657_10329181 3300025919 Bacteria 1207
813 Ga0207649_10000559 3300025920 Bacteria 25614
814 Ga0207649_10002603 3300025920 Bacteria 10019
815 Ga0207649_10005077 3300025920 Bacteria 7116
816 Ga0207649_10005743 3300025920 Bacteria 6717
817 Ga0207649_10025946 3300025920 Bacteria 3423
818 Ga0207649_10052276 3300025920 Bacteria 2534
819 Ga0207649_10053636 3300025920 Bacteria 2506
820 Ga0207649_10064133 3300025920 Bacteria 2322
821 Ga0207649_10072942 3300025920 Bacteria 2198
822 Ga0207649_10321341 3300025920 Bacteria 1137
823 Ga0207649_10414884 3300025920 Bacteria 1010
824 Ga0207652_10003434 3300025921 Bacteria 13073
825 Ga0207652_10019293 3300025921 Bacteria 5606
826 Ga0207652_10219160 3300025921 Bacteria 1714
827 Ga0207681_10000003 3300025923 Bacteria 713245
828 Ga0207681_10000010 3300025923 Bacteria 403379
829 Ga0207681_10027099 3300025923 Bacteria 3703
830 Ga0207681_10042851 3300025923 Bacteria 3026
831 Ga0207681_10042889 3300025923 Bacteria 3025
832 Ga0207681_10083561 3300025923 Bacteria 2260
833 Ga0207681_10139611 3300025923 Bacteria 1803
834 Ga0207681_10164182 3300025923 Bacteria 1677
835 Ga0207681_10681715 3300025923 Bacteria 854
836 Ga0207681_10715208 3300025923 Bacteria 833
837 Ga0207694_10002972 3300025924 Bacteria 13607
838 Ga0207694_10009944 3300025924 Bacteria 7177
839 Ga0207694_10156899 3300025924 Bacteria 1836
840 Ga0207694_10558072 3300025924 Bacteria 961
841 Ga0207650_10000012 3300025925 Bacteria 437889
842 Ga0207650_10006506 3300025925 Bacteria 7966
843 Ga0207650_10036227 3300025925 Bacteria 3588
844 Ga0207650_10044704 3300025925 Bacteria 3255
845 Ga0207650_10066371 3300025925 Bacteria 2706
846 Ga0207650_10092802 3300025925 Bacteria 2310
847 Ga0207650_10129863 3300025925 Bacteria 1971
848 Ga0207650_10235533 3300025925 Bacteria 1478
849 Ga0207650_10286401 3300025925 Bacteria 1343
850 Ga0207650_10596999 3300025925 Bacteria 928
851 Ga0207650_10782660 3300025925 Bacteria 808
852 Ga0207650_10976780 3300025925 Bacteria 720
853 Ga0207659_10002296 3300025926 Bacteria 11393
854 Ga0207659_10040194 3300025926 Bacteria 3268
855 Ga0207659_10064439 3300025926 Bacteria 2652
856 Ga0207659_10209968 3300025926 Bacteria 1560
857 Ga0207659_10349452 3300025926 Bacteria 1227
858 Ga0207659_10413205 3300025926 Bacteria 1130
859 Ga0207659_11087949 3300025926 Bacteria 688
860 Ga0207687_10096833 3300025927 Bacteria 2163
861 Ga0207687_10130685 3300025927 Bacteria 1892
862 Ga0207700_10281486 3300025928 Bacteria 1431
863 Ga0207700_10311330 3300025928 Bacteria 1362
864 Ga0207664_10015465 3300025929 Bacteria 5540
865 Ga0207664_10048758 3300025929 Bacteria 3332
866 Ga0207664_10053650 3300025929 Bacteria 3192
867 Ga0207664_10145494 3300025929 Bacteria 2009
868 Ga0207664_10169243 3300025929 Bacteria 1869
869 Ga0207664_10183898 3300025929 Bacteria 1795
870 Ga0207664_10635230 3300025929 Bacteria 959
871 Ga0207644_10000355 3300025931 Bacteria 29742
872 Ga0207644_10000558 3300025931 Bacteria 23912
873 Ga0207644_10001095 3300025931 Bacteria 17391
874 Ga0207644_10004060 3300025931 Bacteria 9493
875 Ga0207644_10011130 3300025931 Bacteria 5942
876 Ga0207644_10024128 3300025931 Bacteria 4172
877 Ga0207644_10042480 3300025931 Bacteria 3221
878 Ga0207644_10065496 3300025931 Bacteria 2642
879 Ga0207644_10104742 3300025931 Bacteria 2130
880 Ga0207644_10114877 3300025931 Bacteria 2041
881 Ga0207644_10146890 3300025931 Bacteria 1821
882 Ga0207644_10231247 3300025931 Bacteria 1469
883 Ga0207690_10000177 3300025932 Bacteria 49108
884 Ga0207690_10000204 3300025932 Bacteria 46363
885 Ga0207690_10001036 3300025932 Bacteria 17793
886 Ga0207690_10001200 3300025932 Bacteria 16374
887 Ga0207690_10004620 3300025932 Bacteria 8139
888 Ga0207690_10004691 3300025932 Bacteria 8073
889 Ga0207690_10006234 3300025932 Bacteria 7058
890 Ga0207690_10009194 3300025932 Bacteria 5867
891 Ga0207690_10017979 3300025932 Bacteria 4329
892 Ga0207690_10045080 3300025932 Bacteria 2911
893 Ga0207690_10082255 3300025932 Bacteria 2252
894 Ga0207690_10124682 3300025932 Bacteria 1876
895 Ga0207690_10140683 3300025932 Bacteria 1778
896 Ga0207690_10240677 3300025932 Bacteria 1393
897 Ga0207690_10247024 3300025932 Bacteria 1377
898 Ga0207690_10268518 3300025932 Bacteria 1324
899 Ga0207690_10373690 3300025932 Bacteria 1131
900 Ga0207690_10639104 3300025932 Bacteria 871
901 Ga0207706_10001066 3300025933 Bacteria 27876
902 Ga0207706_10003811 3300025933 Bacteria 14371
903 Ga0207706_10011697 3300025933 Bacteria 8002
904 Ga0207706_10013529 3300025933 Bacteria 7416
905 Ga0207706_10014742 3300025933 Bacteria 7078
906 Ga0207706_10020950 3300025933 Bacteria 5871
907 Ga0207706_10025486 3300025933 Bacteria 5298
908 Ga0207706_10027801 3300025933 Bacteria 5055
909 Ga0207706_10046579 3300025933 Bacteria 3839
910 Ga0207706_10049237 3300025933 Bacteria 3725
911 Ga0207706_10057218 3300025933 Bacteria 3436
912 Ga0207706_10062662 3300025933 Bacteria 3274
913 Ga0207706_10067721 3300025933 Bacteria 3142
914 Ga0207706_10128390 3300025933 Bacteria 2230
915 Ga0207706_10313763 3300025933 Bacteria 1365
916 Ga0207706_10406996 3300025933 Bacteria 1179
917 Ga0207706_10709315 3300025933 Bacteria 859
918 Ga0207706_11128540 3300025933 Bacteria 654
919 Ga0207686_10261934 3300025934 Bacteria 1268
920 Ga0207709_10057435 3300025935 Bacteria 2413
921 Ga0207709_10075505 3300025935 Bacteria 2154
922 Ga0207709_10217698 3300025935 Bacteria 1375
923 Ga0207709_10259946 3300025935 Bacteria 1272
924 Ga0207709_10863405 3300025935 Bacteria 734
925 Ga0207669_10075077 3300025937 Bacteria 2140
926 Ga0207669_10223998 3300025937 Bacteria 1382
927 Ga0207669_10247392 3300025937 Bacteria 1325
928 Ga0207669_10311684 3300025937 Bacteria 1200
929 Ga0207704_10172163 3300025938 Bacteria 1554
930 Ga0207704_10225745 3300025938 Bacteria 1389
931 Ga0207665_10029410 3300025939 Bacteria 3631
932 Ga0207665_10076169 3300025939 Bacteria 2300
933 Ga0207691_10006235 3300025940 Bacteria 11517
934 Ga0207691_10017231 3300025940 Bacteria 6854
935 Ga0207691_10049185 3300025940 Bacteria 3863
936 Ga0207691_10054088 3300025940 Bacteria 3662
937 Ga0207691_10112350 3300025940 Bacteria 2422
938 Ga0207691_10309335 3300025940 Bacteria 1356
939 Ga0207691_10366380 3300025940 Bacteria 1231
940 Ga0207711_10000423 3300025941 Bacteria 44463
941 Ga0207711_10000510 3300025941 Bacteria 39938
942 Ga0207711_10000772 3300025941 Bacteria 31495
943 Ga0207711_10001789 3300025941 Bacteria 19690
944 Ga0207711_10002781 3300025941 Bacteria 15387
945 Ga0207711_10003889 3300025941 Bacteria 12853
946 Ga0207711_10004718 3300025941 Bacteria 11585
947 Ga0207711_10005386 3300025941 Bacteria 10826
948 Ga0207711_10035624 3300025941 Bacteria 4220
949 Ga0207711_10043762 3300025941 Bacteria 3821
950 Ga0207711_10054943 3300025941 Bacteria 3418
951 Ga0207711_10073390 3300025941 Bacteria 2973
952 Ga0207711_10135504 3300025941 Bacteria 2211
953 Ga0207711_10145251 3300025941 Bacteria 2137
954 Ga0207689_10006231 3300025942 Bacteria 10565
955 Ga0207689_10006847 3300025942 Bacteria 10024
956 Ga0207689_10117126 3300025942 Bacteria 2190
957 Ga0207661_10002283 3300025944 Bacteria 13208
958 Ga0207661_10005249 3300025944 Bacteria 9112
959 Ga0207661_10005485 3300025944 Bacteria 8947
960 Ga0207661_10025939 3300025944 Bacteria 4460
961 Ga0207661_10034241 3300025944 Bacteria 3948
962 Ga0207661_10286216 3300025944 Bacteria 1474
963 Ga0207679_10000147 3300025945 Bacteria 57784
964 Ga0207679_10001091 3300025945 Bacteria 17278
965 Ga0207679_10010926 3300025945 Bacteria 5858
966 Ga0207679_10013308 3300025945 Bacteria 5390
967 Ga0207679_10021091 3300025945 Bacteria 4408
968 Ga0207679_10042476 3300025945 Bacteria 3268
969 Ga0207679_10078653 3300025945 Bacteria 2512
970 Ga0207679_10102645 3300025945 Bacteria 2240
971 Ga0207679_10112165 3300025945 Bacteria 2154
972 Ga0207679_10113610 3300025945 Bacteria 2142
973 Ga0207679_10129648 3300025945 Bacteria 2021
974 Ga0207679_10174142 3300025945 Bacteria 1774
975 Ga0207667_10000829 3300025949 Bacteria 39957
976 Ga0207667_10002809 3300025949 Bacteria 21579
977 Ga0207667_10004972 3300025949 Bacteria 16236
978 Ga0207667_10017906 3300025949 Bacteria 7962
979 Ga0207667_10018739 3300025949 Bacteria 7752
980 Ga0207667_10018797 3300025949 Bacteria 7737
981 Ga0207667_10038296 3300025949 Bacteria 5122
982 Ga0207667_10075733 3300025949 Bacteria 3493
983 Ga0207667_10091066 3300025949 Bacteria 3151
984 Ga0207667_10141128 3300025949 Bacteria 2480
985 Ga0207667_10206659 3300025949 Bacteria 2013
986 Ga0207667_10219386 3300025949 Bacteria 1949
987 Ga0207667_10395869 3300025949 Bacteria 1406
988 Ga0207667_10490549 3300025949 Bacteria 1246
989 Ga0207667_10522757 3300025949 Bacteria 1202
990 Ga0207667_10697042 3300025949 Bacteria 1018
991 Ga0207667_11244095 3300025949 Bacteria 722
992 Ga0207651_10004876 3300025960 Bacteria 6839
993 Ga0207651_10009499 3300025960 Bacteria 5333
994 Ga0207651_10061945 3300025960 Bacteria 2605
995 Ga0207651_10077547 3300025960 Bacteria 2379
996 Ga0207651_10267283 3300025960 Bacteria 1407
997 Ga0207651_10316302 3300025960 Bacteria 1303
998 Ga0207651_10347443 3300025960 Bacteria 1248
999 Ga0207651_11012785 3300025960 Bacteria 742
1000 Ga0207712_10000015 3300025961 Bacteria 346689
1001 Ga0207712_10001340 3300025961 Bacteria 16875
1002 Ga0207712_10071807 3300025961 Bacteria 2490
1003 Ga0207712_10416406 3300025961 Bacteria 1132
1004 Ga0207668_10000011 3300025972 Bacteria 184484
1005 Ga0207668_10000156 3300025972 Bacteria 47336
1006 Ga0207668_10000405 3300025972 Bacteria 27108
1007 Ga0207668_10008280 3300025972 Bacteria 6195
1008 Ga0207668_10013409 3300025972 Bacteria 5046
1009 Ga0207668_10064477 3300025972 Bacteria 2589
1010 Ga0207668_10170457 3300025972 Bacteria 1706
1011 Ga0207668_10188139 3300025972 Bacteria 1634
1012 Ga0207668_10218701 3300025972 Bacteria 1528
1013 Ga0207668_10259968 3300025972 Bacteria 1414
1014 Ga0207668_10410332 3300025972 Bacteria 1147
1015 Ga0207668_10566624 3300025972 Bacteria 986
1016 Ga0207668_11310218 3300025972 Bacteria 652
1017 Ga0207640_10003858 3300025981 Bacteria 8091
1018 Ga0207640_10004839 3300025981 Bacteria 7310
1019 Ga0207640_10006312 3300025981 Bacteria 6501
1020 Ga0207640_10006844 3300025981 Bacteria 6267
1021 Ga0207640_10015386 3300025981 Bacteria 4428
1022 Ga0207640_10055334 3300025981 Bacteria 2598
1023 Ga0207640_10075918 3300025981 Bacteria 2279
1024 Ga0207640_10119140 3300025981 Bacteria 1887
1025 Ga0207640_10291996 3300025981 Bacteria 1286
1026 Ga0207640_10358322 3300025981 Bacteria 1174
1027 Ga0207640_10384397 3300025981 Bacteria 1138
1028 Ga0207640_10399029 3300025981 Bacteria 1119
1029 Ga0207640_10404201 3300025981 Bacteria 1113
1030 Ga0207658_10000014 3300025986 Bacteria 218248
1031 Ga0207658_10000022 3300025986 Bacteria 191235
1032 Ga0207658_10001665 3300025986 Bacteria 16935
1033 Ga0207658_10006795 3300025986 Bacteria 7792
1034 Ga0207658_10008361 3300025986 Bacteria 7045
1035 Ga0207658_10020502 3300025986 Bacteria 4576
1036 Ga0207658_10030809 3300025986 Bacteria 3802
1037 Ga0207658_10057243 3300025986 Bacteria 2896
1038 Ga0207658_10100890 3300025986 Bacteria 2260
1039 Ga0207658_10198113 3300025986 Bacteria 1674
1040 Ga0207658_10206692 3300025986 Bacteria 1643
1041 Ga0207677_10001450 3300026023 Bacteria 12555
1042 Ga0207677_10001998 3300026023 Bacteria 10764
1043 Ga0207677_10054251 3300026023 Bacteria 2734
1044 Ga0207677_10283264 3300026023 Bacteria 1361
1045 Ga0207677_10285672 3300026023 Bacteria 1356
1046 Ga0207703_10002144 3300026035 Bacteria 17346
1047 Ga0207703_10003264 3300026035 Bacteria 13622
1048 Ga0207703_10008978 3300026035 Bacteria 7873
1049 Ga0207703_10026918 3300026035 Bacteria 4529
1050 Ga0207703_10033974 3300026035 Bacteria 4045
1051 Ga0207703_10055543 3300026035 Bacteria 3222
1052 Ga0207703_10076090 3300026035 Bacteria 2783
1053 Ga0207703_10094183 3300026035 Bacteria 2524
1054 Ga0207703_10098941 3300026035 Bacteria 2468
1055 Ga0207703_10202561 3300026035 Bacteria 1764
1056 Ga0207639_10000213 3300026041 Bacteria 43227
1057 Ga0207639_10000961 3300026041 Bacteria 19565
1058 Ga0207639_10002346 3300026041 Bacteria 12724
1059 Ga0207639_10002382 3300026041 Bacteria 12616
1060 Ga0207639_10020560 3300026041 Bacteria 4726
1061 Ga0207639_10032844 3300026041 Bacteria 3824
1062 Ga0207639_10075393 3300026041 Bacteria 2652
1063 Ga0207639_10149900 3300026041 Bacteria 1952
1064 Ga0207639_10244977 3300026041 Bacteria 1560
1065 Ga0207639_10260154 3300026041 Bacteria 1517
1066 Ga0207639_10342251 3300026041 Bacteria 1334
1067 Ga0207639_10485171 3300026041 Bacteria 1127
1068 Ga0207678_10000726 3300026067 Bacteria 30104
1069 Ga0207678_10021310 3300026067 Bacteria 5682
1070 Ga0207678_10027495 3300026067 Bacteria 4964
1071 Ga0207678_10032729 3300026067 Bacteria 4532
1072 Ga0207678_10055740 3300026067 Bacteria 3404
1073 Ga0207678_10082579 3300026067 Bacteria 2749
1074 Ga0207678_10116562 3300026067 Bacteria 2279
1075 Ga0207678_10229361 3300026067 Bacteria 1590
1076 Ga0207678_10392819 3300026067 Bacteria 1200
1077 Ga0207678_10573065 3300026067 Bacteria 988
1078 Ga0207678_10746110 3300026067 Bacteria 863
1079 Ga0207708_10348463 3300026075 Bacteria 1214
1080 Ga0207702_10000892 3300026078 Bacteria 30967
1081 Ga0207702_10006555 3300026078 Bacteria 10016
1082 Ga0207702_10013813 3300026078 Bacteria 6707
1083 Ga0207702_10022619 3300026078 Bacteria 5213
1084 Ga0207702_10026871 3300026078 Bacteria 4779
1085 Ga0207702_10094961 3300026078 Bacteria 2619
1086 Ga0207702_10586322 3300026078 Bacteria 1093
1087 Ga0207702_11011785 3300026078 Bacteria 824
1088 Ga0207702_11080281 3300026078 Bacteria 796
1089 Ga0207641_10000042 3300026088 Bacteria 186384
1090 Ga0207641_10000139 3300026088 Bacteria 105740
1091 Ga0207641_10000175 3300026088 Bacteria 89110
1092 Ga0207641_10000292 3300026088 Bacteria 62689
1093 Ga0207641_10003100 3300026088 Bacteria 14947
1094 Ga0207641_10004799 3300026088 Bacteria 11651
1095 Ga0207641_10084077 3300026088 Bacteria 2770
1096 Ga0207641_10089057 3300026088 Bacteria 2696
1097 Ga0207641_10104150 3300026088 Bacteria 2505
1098 Ga0207641_10133149 3300026088 Bacteria 2234
1099 Ga0207641_10925185 3300026088 Bacteria 866
1100 Ga0207648_10009361 3300026089 Bacteria 9386
1101 Ga0207648_10039415 3300026089 Bacteria 4155
1102 Ga0207648_10216962 3300026089 Bacteria 1699
1103 Ga0207648_10254090 3300026089 Bacteria 1567
1104 Ga0207648_10337437 3300026089 Bacteria 1357
1105 Ga0207648_10367568 3300026089 Bacteria 1299
1106 Ga0207676_10000009 3300026095 Bacteria 545256
1107 Ga0207676_10000138 3300026095 Bacteria 63283
1108 Ga0207676_10004107 3300026095 Bacteria 10276
1109 Ga0207676_10124656 3300026095 Bacteria 2179
1110 Ga0207676_10129744 3300026095 Bacteria 2141
1111 Ga0207676_10190074 3300026095 Bacteria 1806
1112 Ga0207676_10278613 3300026095 Bacteria 1517
1113 Ga0207674_10000082 3300026116 Bacteria 101650
1114 Ga0207674_10005334 3300026116 Bacteria 15292
1115 Ga0207674_10005456 3300026116 Bacteria 15103
1116 Ga0207674_10007818 3300026116 Bacteria 12430
1117 Ga0207674_10020368 3300026116 Bacteria 7166
1118 Ga0207674_10024437 3300026116 Bacteria 6458
1119 Ga0207674_10067005 3300026116 Bacteria 3615
1120 Ga0207674_10079070 3300026116 Bacteria 3293
1121 Ga0207674_10088867 3300026116 Bacteria 3082
1122 Ga0207674_10116178 3300026116 Bacteria 2647
1123 Ga0207674_10295736 3300026116 Bacteria 1568
1124 Ga0207674_10355587 3300026116 Bacteria 1416
1125 Ga0207674_10369917 3300026116 Bacteria 1386
1126 Ga0207675_100000075 3300026118 Bacteria 76201
1127 Ga0207675_100000350 3300026118 Bacteria 43897
1128 Ga0207675_100143816 3300026118 Bacteria 2267
1129 Ga0207675_100808542 3300026118 Bacteria 951
1130 Ga0207683_10005277 3300026121 Bacteria 11090
1131 Ga0207683_10028509 3300026121 Bacteria 4827
1132 Ga0207683_10038452 3300026121 Bacteria 4171
1133 Ga0207683_10190588 3300026121 Bacteria 1861
1134 Ga0207683_10423542 3300026121 Bacteria 1226
1135 Ga0207698_10000706 3300026142 Bacteria 19357
1136 Ga0207698_10000785 3300026142 Bacteria 18490
1137 Ga0207698_10002760 3300026142 Bacteria 10478
1138 Ga0207698_10003657 3300026142 Bacteria 9283
1139 Ga0207698_10004846 3300026142 Bacteria 8243
1140 Ga0207698_10007271 3300026142 Bacteria 6938
1141 Ga0207698_10020309 3300026142 Bacteria 4569
1142 Ga0207698_10025135 3300026142 Bacteria 4190
1143 Ga0207698_10078952 3300026142 Bacteria 2645
1144 Ga0207698_10145574 3300026142 Bacteria 2048
1145 Ga0207698_10241236 3300026142 Bacteria 1647
1146 Ga0207698_10246716 3300026142 Bacteria 1631
1147 Ga0207698_10397983 3300026142 Bacteria 1315
1148 Ga0207698_10621439 3300026142 Bacteria 1067
1149 Ga0207698_10863475 3300026142 Bacteria 910
1150 Ga0207698_11342160 3300026142 Bacteria 730
1151 Ga0209983_1076041 3300027665 Bacteria 751
1152 Ga0209813_10000072 3300027866 Bacteria 37812
1153 Ga0207428_10409762 3300027907 Bacteria 992
1154 Ga0268266_10000432 3300028379 Bacteria 62927
1155 Ga0268266_10002247 3300028379 Bacteria 21039
1156 Ga0268266_10006558 3300028379 Bacteria 10641
1157 Ga0268266_10011079 3300028379 Bacteria 7852
1158 Ga0268266_10012344 3300028379 Bacteria 7389
1159 Ga0268266_10045675 3300028379 Bacteria 3747
1160 Ga0268266_10263015 3300028379 Bacteria 1599
1161 Ga0268265_10000001 3300028380 Bacteria 1230727
1162 Ga0268265_10000021 3300028380 Bacteria 272292
1163 Ga0268265_10001179 3300028380 Bacteria 22889
1164 Ga0268265_10001694 3300028380 Bacteria 17945
1165 Ga0268265_10006460 3300028380 Bacteria 7946
1166 Ga0268265_10006936 3300028380 Bacteria 7663
1167 Ga0268265_10033660 3300028380 Bacteria 3728
1168 Ga0268265_10039089 3300028380 Bacteria 3494
1169 Ga0268265_10435342 3300028380 Bacteria 1221
1170 Ga0268265_11149006 3300028380 Bacteria 772
1171 Ga0268264_10000106 3300028381 Bacteria 210031
1172 Ga0268264_10000121 3300028381 Bacteria 190368
1173 Ga0268264_10000134 3300028381 Bacteria 179475
1174 Ga0268264_10000932 3300028381 Bacteria 30353
1175 Ga0268264_10001130 3300028381 Bacteria 26167
1176 Ga0268264_10003943 3300028381 Bacteria 12705
1177 Ga0268264_10033615 3300028381 Bacteria 4215
1178 Ga0268264_10051497 3300028381 Bacteria 3431
1179 Ga0268264_11113980 3300028381 Bacteria 798
1180 Ga0316176_1185896 3300030732 Bacteria 1314
1181 Ga0314311_1260554 3300030733 Bacteria 1605
1182 Ga0316182_1276230 3300030745 Bacteria 736
1183 Ga0265331_10009784 3300031250 Bacteria 5351
1184 Ga0307513_10073272 3300031456 Bacteria 3566
1185 Ga0307408_100008664 3300031548 Bacteria 6718
1186 Ga0307408_100011392 3300031548 Bacteria 5876
1187 Ga0307408_100012567 3300031548 Bacteria 5612
1188 Ga0307408_100015638 3300031548 Bacteria 5055
1189 Ga0307408_100017392 3300031548 Bacteria 4810
1190 Ga0307408_100154998 3300031548 Bacteria 1813
1191 Ga0307408_100159743 3300031548 Bacteria 1789
1192 Ga0307408_100263105 3300031548 Bacteria 1428
1193 Ga0307408_100358200 3300031548 Bacteria 1240
1194 Ga0307408_100588063 3300031548 Bacteria 987
1195 Ga0307405_10011297 3300031731 Bacteria 4672
1196 Ga0307405_10012331 3300031731 Bacteria 4518
1197 Ga0307405_10028240 3300031731 Bacteria 3265
1198 Ga0307405_10034872 3300031731 Bacteria 2999
1199 Ga0307405_10072549 3300031731 Bacteria 2219
1200 Ga0307405_10108974 3300031731 Bacteria 1872
1201 Ga0307405_10135162 3300031731 Bacteria 1710
1202 Ga0307405_10457626 3300031731 Bacteria 1013
1203 Ga0307405_10663118 3300031731 Bacteria 859
1204 Ga0307413_10000908 3300031824 Bacteria 10480
1205 Ga0307413_10003272 3300031824 Bacteria 6791
1206 Ga0307413_10022088 3300031824 Bacteria 3421
1207 Ga0307413_10029705 3300031824 Bacteria 3062
1208 Ga0307413_10045246 3300031824 Bacteria 2608
1209 Ga0307413_10060865 3300031824 Bacteria 2326
1210 Ga0307413_10093028 3300031824 Bacteria 1969
1211 Ga0307413_10193956 3300031824 Bacteria 1461
1212 Ga0307413_10210556 3300031824 Bacteria 1411
1213 Ga0307413_10322457 3300031824 Bacteria 1180
1214 Ga0307413_10575750 3300031824 Bacteria 918
1215 Ga0307413_10677503 3300031824 Bacteria 854
1216 Ga0307413_10849631 3300031824 Bacteria 771
1217 Ga0307410_10001686 3300031852 Bacteria 10160
1218 Ga0307410_10005106 3300031852 Bacteria 6901
1219 Ga0307410_10006358 3300031852 Bacteria 6370
1220 Ga0307410_10007053 3300031852 Bacteria 6121
1221 Ga0307410_10009075 3300031852 Bacteria 5556
1222 Ga0307410_10011831 3300031852 Bacteria 5012
1223 Ga0307410_10049525 3300031852 Bacteria 2821
1224 Ga0307410_10054949 3300031852 Bacteria 2701
1225 Ga0307410_10094154 3300031852 Bacteria 2133
1226 Ga0307410_10143296 3300031852 Bacteria 1770
1227 Ga0307410_10166789 3300031852 Bacteria 1655
1228 Ga0307410_10213053 3300031852 Bacteria 1481
1229 Ga0307410_10316899 3300031852 Bacteria 1236
1230 Ga0307410_10353767 3300031852 Bacteria 1174
1231 Ga0307410_10765455 3300031852 Bacteria 818
1232 Ga0307410_11010455 3300031852 Bacteria 717
1233 Ga0307406_10001642 3300031901 Bacteria 12289
1234 Ga0307406_10021176 3300031901 Bacteria 3842
1235 Ga0307406_10025265 3300031901 Bacteria 3555
1236 Ga0307406_10050341 3300031901 Bacteria 2640
1237 Ga0307406_10121526 3300031901 Bacteria 1817
1238 Ga0307406_10121906 3300031901 Bacteria 1814
1239 Ga0307406_10149543 3300031901 Bacteria 1664
1240 Ga0307406_10182814 3300031901 Bacteria 1528
1241 Ga0307406_10266238 3300031901 Bacteria 1299
1242 Ga0307406_10310439 3300031901 Bacteria 1215
1243 Ga0307407_10004156 3300031903 Bacteria 6101
1244 Ga0307407_10014436 3300031903 Bacteria 3868
1245 Ga0307407_10064377 3300031903 Bacteria 2154
1246 Ga0307407_10083078 3300031903 Bacteria 1942
1247 Ga0307407_10085581 3300031903 Bacteria 1918
1248 Ga0307407_10212044 3300031903 Bacteria 1304
1249 Ga0307412_10001919 3300031911 Bacteria 11484
1250 Ga0307412_10013460 3300031911 Bacteria 4799
1251 Ga0307412_10023327 3300031911 Bacteria 3805
1252 Ga0307412_10026247 3300031911 Bacteria 3618
1253 Ga0307412_10073188 3300031911 Bacteria 2343
1254 Ga0307412_10077657 3300031911 Bacteria 2284
1255 Ga0307412_10083205 3300031911 Bacteria 2218
1256 Ga0307412_10287072 3300031911 Bacteria 1294
1257 Ga0307412_10406584 3300031911 Bacteria 1110
1258 Ga0307412_10416414 3300031911 Bacteria 1098
1259 Ga0307412_10772358 3300031911 Bacteria 831
1260 Ga0307412_10900016 3300031911 Bacteria 775
1261 Ga0307409_100002023 3300031995 Bacteria 10410
1262 Ga0307409_100010697 3300031995 Bacteria 5727
1263 Ga0307409_100019598 3300031995 Bacteria 4585
1264 Ga0307409_100037622 3300031995 Bacteria 3569
1265 Ga0307409_100052196 3300031995 Bacteria 3133
1266 Ga0307409_100058181 3300031995 Bacteria 3000
1267 Ga0307409_100072897 3300031995 Bacteria 2736
1268 Ga0307409_100089539 3300031995 Bacteria 2516
1269 Ga0307409_100102910 3300031995 Bacteria 2374
1270 Ga0307409_100115351 3300031995 Bacteria 2261
1271 Ga0307409_100168007 3300031995 Bacteria 1927
1272 Ga0307409_100205677 3300031995 Bacteria 1765
1273 Ga0307409_100226461 3300031995 Bacteria 1691
1274 Ga0307409_100264499 3300031995 Bacteria 1580
1275 Ga0307409_100335513 3300031995 Bacteria 1420
1276 Ga0307409_100398217 3300031995 Bacteria 1314
1277 Ga0307409_100563513 3300031995 Bacteria 1120
1278 Ga0307409_100656167 3300031995 Bacteria 1043
1279 Ga0307416_100021750 3300032002 Bacteria 4612
1280 Ga0307416_100033185 3300032002 Bacteria 3910
1281 Ga0307416_100076914 3300032002 Bacteria 2800
1282 Ga0307416_100077141 3300032002 Bacteria 2797
1283 Ga0307416_100085909 3300032002 Bacteria 2680
1284 Ga0307416_100102324 3300032002 Bacteria 2497
1285 Ga0307416_100154497 3300032002 Bacteria 2110
1286 Ga0307416_100392554 3300032002 Bacteria 1422
1287 Ga0307416_100471123 3300032002 Bacteria 1313
1288 Ga0307416_100542795 3300032002 Bacteria 1235
1289 Ga0307416_100775092 3300032002 Bacteria 1053
1290 Ga0307416_100833797 3300032002 Bacteria 1019
1291 Ga0307414_10000296 3300032004 Bacteria 29101
1292 Ga0307414_10014872 3300032004 Bacteria 4683
1293 Ga0307414_10022301 3300032004 Bacteria 3991
1294 Ga0307414_10022482 3300032004 Bacteria 3978
1295 Ga0307414_10029969 3300032004 Bacteria 3548
1296 Ga0307414_10046272 3300032004 Bacteria 2985
1297 Ga0307414_10063291 3300032004 Bacteria 2628
1298 Ga0307414_10152881 3300032004 Bacteria 1823
1299 Ga0307414_10234686 3300032004 Bacteria 1515
1300 Ga0307414_10303597 3300032004 Bacteria 1351
1301 Ga0307414_10450484 3300032004 Bacteria 1128
1302 Ga0307414_10473713 3300032004 Bacteria 1103
1303 Ga0307414_10476916 3300032004 Bacteria 1099
1304 Ga0307414_10638649 3300032004 Bacteria 958
1305 Ga0307411_10001268 3300032005 Bacteria 10104
1306 Ga0307411_10002560 3300032005 Bacteria 8112
1307 Ga0307411_10011601 3300032005 Bacteria 4766
1308 Ga0307411_10020983 3300032005 Bacteria 3811
1309 Ga0307411_10024507 3300032005 Bacteria 3598
1310 Ga0307411_10029823 3300032005 Bacteria 3337
1311 Ga0307411_10035342 3300032005 Bacteria 3119
1312 Ga0307411_10039321 3300032005 Bacteria 2991
1313 Ga0307411_10054003 3300032005 Bacteria 2635
1314 Ga0307411_10061435 3300032005 Bacteria 2501
1315 Ga0307411_10065030 3300032005 Bacteria 2444
1316 Ga0307411_10087538 3300032005 Bacteria 2163
1317 Ga0307411_10101065 3300032005 Bacteria 2040
1318 Ga0307411_10107929 3300032005 Bacteria 1985
1319 Ga0307411_10113796 3300032005 Bacteria 1942
1320 Ga0307411_10130644 3300032005 Bacteria 1835
1321 Ga0307411_10164379 3300032005 Bacteria 1666
1322 Ga0307411_10486228 3300032005 Bacteria 1040
1323 Ga0307415_100009209 3300032126 Bacteria 5519
1324 Ga0307415_100027343 3300032126 Bacteria 3612
1325 Ga0307415_100144428 3300032126 Bacteria 1822
1326 Ga0307415_100196480 3300032126 Bacteria 1596
1327 Ga0307415_100198219 3300032126 Bacteria 1590
1328 Ga0307415_100311344 3300032126 Bacteria 1309
1329 Ga0307415_100385488 3300032126 Bacteria 1191
1330 Ga0307415_100396358 3300032126 Bacteria 1177
1331 Ga0307415_100592962 3300032126 Bacteria 985
1332 Ga0307415_100963601 3300032126 Bacteria 790
1333 Ga0307415_101044604 3300032126 Bacteria 762
1334 Ga0373940_0034525 3300035088 Bacteria 1365
1335 Ga0373941_0115583 3300035115 Bacteria 951
1336 Ga0373960_0187544 3300035121 Bacteria 725
1337 Ga0373943_0251355 3300035170 Bacteria 993
1338 Ga0373942_0058358 3300035207 Bacteria 1100
1339 Ga0373942_0250797 3300035207 Bacteria 602
1340 Ga0373962_0022501 3300035242 Bacteria 1672
1341 Ga0373931_0020477 3300035691 Bacteria 3310
1342 Ga0373925_0123142 3300037068 Bacteria 2015
1343 Ga0373925_0290706 3300037068 Bacteria 1318
1344 Ga0395899_0000352 3300037312 Bacteria 56166
1345 Ga0395899_0000684 3300037312 Bacteria 34177
1346 Ga0395899_0002069 3300037312 Bacteria 16505
1347 Ga0395899_0005031 3300037312 Bacteria 10278
1348 Ga0395899_0007075 3300037312 Bacteria 8685
1349 Ga0395899_0016419 3300037312 Bacteria 5643
1350 Ga0395899_0026380 3300037312 Bacteria 4384
1351 Ga0395899_0066576 3300037312 Bacteria 2645
1352 Ga0395899_0066592 3300037312 Bacteria 2644
1353 Ga0395899_0081542 3300037312 Bacteria 2353
1354 Ga0395899_0112997 3300037312 Bacteria 1951
1355 Ga0395899_0161007 3300037312 Bacteria 1585
1356 Ga0395899_0175615 3300037312 Bacteria 1506
1357 Ga0395899_0258777 3300037312 Bacteria 1191
1358 Ga0395899_0301197 3300037312 Bacteria 1085
1359 Ga0395899_0305868 3300037312 Bacteria 1074
1360 Ga0395899_0338546 3300037312 Bacteria 1009
1361 Ga0395899_0365777 3300037312 Bacteria 961
1362 Ga0395899_0419276 3300037312 Bacteria 882
1363 Ga0395900_0000405 3300037418 Bacteria 62091
1364 Ga0395900_0001013 3300037418 Bacteria 36249
1365 Ga0395900_0001333 3300037418 Bacteria 29893
1366 Ga0395900_0003891 3300037418 Bacteria 15948
1367 Ga0395900_0010189 3300037418 Bacteria 9615
1368 Ga0395900_0011820 3300037418 Bacteria 8927
1369 Ga0395900_0015989 3300037418 Bacteria 7646
1370 Ga0395900_0025818 3300037418 Bacteria 6013
1371 Ga0395900_0031705 3300037418 Bacteria 5432
1372 Ga0395900_0046010 3300037418 Bacteria 4494
1373 Ga0395900_0052525 3300037418 Bacteria 4195
1374 Ga0395900_0056076 3300037418 Bacteria 4056
1375 Ga0395900_0069396 3300037418 Bacteria 3622
1376 Ga0395900_0086363 3300037418 Bacteria 3224
1377 Ga0395900_0091220 3300037418 Bacteria 3131
1378 Ga0395900_0103626 3300037418 Bacteria 2922
1379 Ga0395900_0192240 3300037418 Bacteria 2069
1380 Ga0395900_0212398 3300037418 Bacteria 1953
1381 Ga0395900_0278219 3300037418 Bacteria 1666
1382 Ga0395900_0305529 3300037418 Bacteria 1575
1383 Ga0395900_0337303 3300037418 Bacteria 1484
1384 Ga0395900_0349857 3300037418 Bacteria 1451
1385 Ga0395900_0349901 3300037418 Bacteria 1451
1386 Ga0395900_0416677 3300037418 Bacteria 1304
1387 Ga0395900_0709102 3300037418 Bacteria 939
1388 Ga0395900_0816089 3300037418 Bacteria 860
1389 Ga0395900_0896221 3300037418 Bacteria 810
1390 Ga0395900_1073621 3300037418 Bacteria 723
1391 Ga0395900_1315721 3300037418 Bacteria 636
1392 Ga0395898_0000856 3300037466 Bacteria 49957
1393 Ga0395898_0003285 3300037466 Bacteria 18179
1394 Ga0395898_0005062 3300037466 Bacteria 14290
1395 Ga0395898_0008246 3300037466 Bacteria 11016
1396 Ga0395898_0010431 3300037466 Bacteria 9711
1397 Ga0395898_0015591 3300037466 Bacteria 7791
1398 Ga0395898_0023812 3300037466 Bacteria 6183
1399 Ga0395898_0088780 3300037466 Bacteria 2975
1400 Ga0395898_0097474 3300037466 Bacteria 2824
1401 Ga0395898_0117063 3300037466 Bacteria 2553
1402 Ga0395898_0121323 3300037466 Bacteria 2504
1403 Ga0395898_0157439 3300037466 Bacteria 2172
1404 Ga0395898_0222645 3300037466 Bacteria 1799
1405 Ga0395898_0377267 3300037466 Bacteria 1352
1406 Ga0395898_0392308 3300037466 Bacteria 1323
1407 Ga0395905_0000756 3300037471 Bacteria 42590
1408 Ga0395905_0001965 3300037471 Bacteria 23516
1409 Ga0395905_0002309 3300037471 Bacteria 21339
1410 Ga0395905_0004552 3300037471 Bacteria 14353
1411 Ga0395905_0006834 3300037471 Bacteria 11410
1412 Ga0395905_0012503 3300037471 Bacteria 8170
1413 Ga0395905_0013837 3300037471 Bacteria 7719
1414 Ga0395905_0018156 3300037471 Bacteria 6675
1415 Ga0395905_0037822 3300037471 Bacteria 4529
1416 Ga0395905_0047727 3300037471 Bacteria 4012
1417 Ga0395905_0076689 3300037471 Bacteria 3132
1418 Ga0395905_0080402 3300037471 Bacteria 3054
1419 Ga0395905_0097433 3300037471 Bacteria 2761
1420 Ga0395905_0115842 3300037471 Bacteria 2518
1421 Ga0395905_0123520 3300037471 Bacteria 2434
1422 Ga0395905_0133946 3300037471 Bacteria 2331
1423 Ga0395905_0167702 3300037471 Bacteria 2063
1424 Ga0395905_0189282 3300037471 Bacteria 1931
1425 Ga0395905_0210288 3300037471 Bacteria 1822
1426 Ga0395905_0236454 3300037471 Bacteria 1707
1427 Ga0395905_0246686 3300037471 Bacteria 1668
1428 Ga0395905_0246886 3300037471 Bacteria 1668
1429 Ga0395905_0279511 3300037471 Bacteria 1555
1430 Ga0395905_0396025 3300037471 Bacteria 1275
1431 Ga0395905_0398312 3300037471 Bacteria 1271
1432 Ga0395905_0402165 3300037471 Bacteria 1264
1433 Ga0395905_0481420 3300037471 Bacteria 1140
1434 Ga0395905_0493154 3300037471 Bacteria 1125
1435 Ga0395905_0541176 3300037471 Bacteria 1065
1436 Ga0395905_0694586 3300037471 Bacteria 920
1437 Ga0395905_1037034 3300037471 Bacteria 723
1438 Ga0395905_1040617 3300037471 Bacteria 722
1439 Ga0436364_1406360 3300037853 Bacteria 26034
1440 Ga0395901_0000047 3300038443 Bacteria 175221
1441 Ga0395901_0000168 3300038443 Bacteria 85645
1442 Ga0395901_0001266 3300038443 Bacteria 26792
1443 Ga0395901_0003939 3300038443 Bacteria 14935
1444 Ga0395901_0010867 3300038443 Bacteria 9227
1445 Ga0395901_0014130 3300038443 Bacteria 8128
1446 Ga0395901_0021538 3300038443 Bacteria 6605
1447 Ga0395901_0024789 3300038443 Bacteria 6157
1448 Ga0395901_0027469 3300038443 Bacteria 5848
1449 Ga0395901_0051634 3300038443 Bacteria 4276
1450 Ga0395901_0057401 3300038443 Bacteria 4048
1451 Ga0395901_0068076 3300038443 Bacteria 3709
1452 Ga0395901_0085952 3300038443 Bacteria 3288
1453 Ga0395901_0088711 3300038443 Bacteria 3235
1454 Ga0395901_0204920 3300038443 Bacteria 2067
1455 Ga0395901_0212823 3300038443 Bacteria 2022
1456 Ga0395901_0222910 3300038443 Bacteria 1970
1457 Ga0395901_0232935 3300038443 Bacteria 1922
1458 Ga0395901_0284795 3300038443 Bacteria 1716
1459 Ga0395901_0348916 3300038443 Bacteria 1527
1460 Ga0395901_0365333 3300038443 Bacteria 1487
1461 Ga0395901_0369545 3300038443 Bacteria 1477
1462 Ga0395901_0441341 3300038443 Bacteria 1332
1463 Ga0395901_0535849 3300038443 Bacteria 1188
1464 Ga0395901_0551573 3300038443 Bacteria 1168
1465 Ga0395901_0554923 3300038443 Bacteria 1164
1466 Ga0395901_0609519 3300038443 Bacteria 1100
1467 Ga0395901_0633558 3300038443 Bacteria 1074
1468 Ga0395901_0716914 3300038443 Bacteria 996
1469 Ga0395901_0819126 3300038443 Bacteria 918
1470 Ga0395901_1472025 3300038443 Bacteria 637
1471 Ga0395901_1611338 3300038443 Bacteria 602
1472 Ga0436365_0440923 3300039437 Bacteria 20557
1473 Ga0436365_0522706 3300039437 Bacteria 1014
1474 Ga0436365_1697258 3300039437 Bacteria 30915
1475 Ga0436362_1132945 3300039453 Bacteria 19454
1476 Ga0439461_0000271 3300041410 Bacteria 7470
1477 Ga0439465_0001054 3300041413 Bacteria 8787
1478 Ga0451845_0434811 3300041501 Bacteria 833
1479 Ga0439431_0000566 3300041997 Bacteria 7863
1480 Ga0439442_009713 3300042002 Bacteria 1946
1481 Ga0439445_0000821 3300042004 Bacteria 6551
1482 Ga0439448_0060260 3300042005 Bacteria 1254
1483 Ga0439432_000787 3300042006 Bacteria 11912
1484 Ga0439432_090244 3300042006 Bacteria 923
1485 Ga0439462_0000698 3300042015 Bacteria 6866
1486 Ga0450912_003240 3300042116 Bacteria 1149
1487 Ga0450890_002474 3300042127 Bacteria 2541
1488 Ga0450905_000267 3300042142 Bacteria 6167
1489 Ga0450889_000142 3300042144 Bacteria 7220
1490 Ga0439446_0011872 3300042156 Bacteria 2372
1491 Ga0439458_0002529 3300042157 Bacteria 4428
1492 Ga0439458_0013319 3300042157 Bacteria 1850
1493 Ga0439434_0000746 3300042435 Bacteria 9337
1494 Ga0439464_0000045 3300042439 Bacteria 16165
1495 Ga0439460_0062825 3300042461 Bacteria 1137
1496 Ga0451577_0362075 3300042876 Bacteria 1316
1497 Ga0466969_0139186 3300044656 Bacteria 1122
1498 Ga0466972_0037839 3300044658 Bacteria 2358
1499 Ga0466972_0056145 3300044658 Bacteria 1893
1500 Ga0466972_0119071 3300044658 Bacteria 1246
1501 Ga0466965_0193078 3300044683 Bacteria 1078
1502 Ga0466965_0427902 3300044683 Bacteria 735
1503 Ga0466966_0040985 3300044684 Bacteria 2978
1504 Ga0466966_0054688 3300044684 Bacteria 2528
1505 Ga0466966_0062865 3300044684 Bacteria 2340
1506 Ga0466966_0086845 3300044684 Bacteria 1944
1507 Ga0466961_0049227 3300044693 Bacteria 2693
1508 Ga0466961_0496449 3300044693 Bacteria 737
1509 Ga0466963_0011241 3300044694 Bacteria 5447
1510 Ga0466963_0021746 3300044694 Bacteria 4051
1511 Ga0466963_0025341 3300044694 Bacteria 3782
1512 Ga0466963_0034639 3300044694 Bacteria 3286
1513 Ga0466963_0055329 3300044694 Bacteria 2638
1514 Ga0466963_0063809 3300044694 Bacteria 2466
1515 Ga0466963_0193726 3300044694 Bacteria 1420
1516 Ga0466964_0160837 3300044706 Bacteria 1049
1517 Ga0466964_0196738 3300044706 Bacteria 965
1518 Ga0453684_0934325 3300044712 Bacteria 927
1519 Ga0466971_0006570 3300044719 Bacteria 5053
1520 Ga0466971_0099490 3300044719 Bacteria 1335
1521 Ga0466970_0039464 3300044765 Bacteria 2505
1522 Ga0466970_0070703 3300044765 Bacteria 1876
1523 Ga0466970_0247054 3300044765 Bacteria 999
1524 Ga0466957_0002638 3300044842 Bacteria 9680
1525 Ga0466957_0020439 3300044842 Bacteria 3896
1526 Ga0466957_0039933 3300044842 Bacteria 2832
1527 Ga0466957_0077721 3300044842 Bacteria 2063
1528 Ga0466957_0341808 3300044842 Bacteria 1014
1529 Ga0466957_0489300 3300044842 Bacteria 852
1530 Ga0466960_0078573 3300044901 Bacteria 1657
1531 Ga0466960_0091205 3300044901 Bacteria 1553
1532 Ga0466959_0034665 3300045049 Bacteria 3734
1533 Ga0466959_0041415 3300045049 Bacteria 3400
1534 Ga0466959_0263373 3300045049 Bacteria 1186
1535 Ga0466959_0507577 3300045049 Bacteria 815
1536 Ga0466959_0531777 3300045049 Bacteria 793
1537 Ga0451576_0000041 3300045051 Bacteria 343432
1538 Ga0466958_0008889 3300045836 Bacteria 5580
1539 Ga0466958_0011120 3300045836 Bacteria 5062
1540 Ga0466958_0066831 3300045836 Bacteria 2195
1541 Ga0466958_0436178 3300045836 Bacteria 848
1542 Ga0466958_0565120 3300045836 Bacteria 739
1543 Ga0466967_0013943 3300045976 Bacteria 6236
1544 Ga0466967_0026203 3300045976 Bacteria 4824
1545 Ga0466967_0046618 3300045976 Bacteria 3775
1546 Ga0466967_0047532 3300045976 Bacteria 3741
1547 Ga0466967_0057413 3300045976 Bacteria 3436
1548 Ga0466967_0072683 3300045976 Bacteria 3083
1549 Ga0466967_0303202 3300045976 Bacteria 1537
1550 Ga0466967_0389109 3300045976 Bacteria 1355
1551 Ga0466967_0512433 3300045976 Bacteria 1178
1552 Ga0466967_0586350 3300045976 Bacteria 1099
1553 Ga0466967_1096626 3300045976 Bacteria 793
1554 Ga0466967_1371498 3300045976 Bacteria 704
1555 Ga0495627_000094 3300046453 Bacteria 108256
1556 Ga0495627_000229 3300046453 Bacteria 59494
1557 Ga0495627_047853 3300046453 Bacteria 1296
1558 Ga0495638_0081301 3300046460 Bacteria 1967
1559 Ga0495650_0001141 3300046471 Bacteria 28788
1560 Ga0495582_0159187 3300046473 Bacteria 1284
1561 Ga0495585_0066722 3300046492 Bacteria 1970
1562 Ga0495596_0081306 3300046500 Bacteria 1258
1563 Ga0495610_0000043 3300046512 Bacteria 158045
1564 Ga0495616_0000017 3300046513 Bacteria 167324
1565 Ga0495632_0195351 3300046519 Bacteria 923
1566 Ga0495632_0365567 3300046519 Bacteria 633
1567 Ga0495637_0031015 3300046520 Bacteria 2367
1568 Ga0495643_0135020 3300046522 Bacteria 1235
1569 Ga0495643_0136097 3300046522 Bacteria 1229
1570 Ga0495648_0011851 3300046524 Bacteria 6540
1571 Ga0495663_0091895 3300046525 Bacteria 990
1572 Ga0495642_0052850 3300046528 Bacteria 1674
1573 Ga0495598_0000660 3300046537 Bacteria 6533
1574 Ga0495598_0212246 3300046537 Bacteria 703
1575 Ga0495621_0004874 3300046539 Bacteria 3808
1576 Ga0495621_0066705 3300046539 Bacteria 1317
1577 Ga0495621_0116168 3300046539 Bacteria 1030
1578 Ga0495597_0015961 3300046542 Bacteria 3551
1579 Ga0495622_0033798 3300046557 Bacteria 2387
1580 Ga0495633_0056823 3300046558 Bacteria 1839
1581 Ga0495633_0098396 3300046558 Bacteria 1358
1582 Ga0495668_0007073 3300046616 Bacteria 7224
1583 Ga0495668_0007147 3300046616 Bacteria 7180
1584 Ga0495668_0008633 3300046616 Bacteria 6335
1585 Ga0495668_0030101 3300046616 Bacteria 3066
1586 Ga0495625_0015725 3300046660 Bacteria 5978
1587 Ga0495669_0000354 3300046684 Bacteria 23487
1588 Ga0495669_0014128 3300046684 Bacteria 3413
1589 Ga0495669_0033958 3300046684 Bacteria 2247
1590 Ga0495669_0111038 3300046684 Bacteria 1280
1591 Ga0495669_0211208 3300046684 Bacteria 929
1592 Ga0495670_0001425 3300046691 Bacteria 11745
1593 Ga0495670_0162918 3300046691 Bacteria 1172
1594 Ga0495670_0195507 3300046691 Bacteria 1070
1595 Ga0495671_0010652 3300046692 Bacteria 5086
1596 Ga0495660_0256050 3300046810 Bacteria 810
1597 Ga0495677_0020757 3300047445 Bacteria 2380
1598 Ga0495677_0045608 3300047445 Bacteria 1608
1599 Ga0495677_0082249 3300047445 Bacteria 1208
1600 Ga0495681_0000025 3300047470 Bacteria 148216
1601 Ga0495681_0014947 3300047470 Bacteria 4422
1602 Ga0495686_0024726 3300047472 Bacteria 3943
1603 Ga0495615_0012080 3300048090 Bacteria 1773
1604 Ga0495615_0064477 3300048090 Bacteria 974
1605 Ga0496100_0206331 3300048903 Bacteria 1435
1606 Ga0496101_0022205 3300048904 Bacteria 4367
1607 Ga0496101_0040490 3300048904 Bacteria 3318
1608 Ga0496102_0122899 3300048905 Bacteria 2425
1609 Ga0496102_0485640 3300048905 Bacteria 1157
1610 Ga0496103_0079072 3300048906 Bacteria 2066
1611 Ga0496103_0219780 3300048906 Bacteria 1222
1612 Ga0496103_0234449 3300048906 Bacteria 1181
1613 Ga0496105_0000435 3300048908 Bacteria 27394
1614 Ga0496105_0097313 3300048908 Bacteria 2431
1615 Ga0496105_0237458 3300048908 Bacteria 1480
1616 Ga0496106_0096024 3300048909 Bacteria 2293
1617 Ga0496106_0192080 3300048909 Bacteria 1624
1618 Ga0496106_0199859 3300048909 Bacteria 1591
1619 Ga0496107_0000263 3300048910 Bacteria 27781
1620 Ga0496107_0008273 3300048910 Bacteria 7200
1621 Ga0496107_0068237 3300048910 Bacteria 2581
1622 Ga0496107_0160890 3300048910 Bacteria 1664
1623 Ga0496107_0179914 3300048910 Bacteria 1570
1624 Ga0496107_0271962 3300048910 Bacteria 1261
1625 Ga0496108_0014814 3300048911 Bacteria 6361
1626 Ga0496108_0062546 3300048911 Bacteria 3134
1627 Ga0496108_0074296 3300048911 Bacteria 2870
1628 Ga0496108_0074981 3300048911 Bacteria 2857
1629 Ga0496108_0102507 3300048911 Bacteria 2442
1630 Ga0496108_0151901 3300048911 Bacteria 1998
1631 Ga0496108_0697408 3300048911 Bacteria 880
1632 Ga0496109_0004961 3300048912 Bacteria 11116
1633 Ga0496109_0064607 3300048912 Bacteria 3349
1634 Ga0496109_0239742 3300048912 Bacteria 1706
1635 Ga0496109_0264122 3300048912 Bacteria 1621
1636 Ga0496110_0001595 3300048913 Bacteria 16573
1637 Ga0496110_0015522 3300048913 Bacteria 6341
1638 Ga0496110_0082787 3300048913 Bacteria 2862
1639 Ga0496110_0112879 3300048913 Bacteria 2443
1640 Ga0496110_0142533 3300048913 Bacteria 2167
1641 Ga0496110_0157969 3300048913 Bacteria 2054
1642 Ga0496110_0443462 3300048913 Bacteria 1183
1643 Ga0496110_0503416 3300048913 Bacteria 1103
1644 Ga0496111_0009204 3300048914 Bacteria 6578
1645 Ga0496111_0025156 3300048914 Bacteria 4198
1646 Ga0496111_0100321 3300048914 Bacteria 2126
1647 Ga0496111_0209438 3300048914 Bacteria 1448
1648 Ga0496111_0358757 3300048914 Bacteria 1079
1649 Ga0496111_0608774 3300048914 Bacteria 799
1650 Ga0496111_0663225 3300048914 Bacteria 761
1651 Ga0496112_0008615 3300048915 Bacteria 9142
1652 Ga0496112_0017222 3300048915 Bacteria 6784
1653 Ga0496112_0033735 3300048915 Bacteria 4977
1654 Ga0496113_0040760 3300048916 Bacteria 3423
1655 Ga0496113_0044945 3300048916 Bacteria 3274
1656 Ga0496113_0065433 3300048916 Bacteria 2751
1657 Ga0496113_0112679 3300048916 Bacteria 2119
1658 Ga0496113_0376635 3300048916 Bacteria 1139
1659 Ga0496114_0000033 3300048917 Bacteria 166897
1660 Ga0496114_0034740 3300048917 Bacteria 4161
1661 Ga0496116_0009059 3300048919 Bacteria 8538
1662 Ga0496117_0009462 3300048920 Bacteria 9064
1663 Ga0496117_0024081 3300048920 Bacteria 4828
1664 Ga0496117_0273247 3300048920 Bacteria 909
1665 Ga0496118_0000811 3300048921 Bacteria 49879
1666 Ga0496118_0023763 3300048921 Bacteria 5312
1667 Ga0496118_0112492 3300048921 Bacteria 1802
1668 Ga0496121_0000454 3300048924 Bacteria 80561
1669 Ga0496121_0000740 3300048924 Bacteria 60212
1670 Ga0496121_0033968 3300048924 Bacteria 4602
1671 Ga0496121_0085336 3300048924 Bacteria 2486
1672 Ga0496122_0031024 3300048925 Bacteria 4460
1673 Ga0496122_0119036 3300048925 Bacteria 1709
1674 Ga0496123_0020086 3300048926 Bacteria 5240
1675 Ga0496123_0062355 3300048926 Bacteria 2389
1676 Ga0496124_0016408 3300048927 Bacteria 7043
1677 Ga0496124_0020089 3300048927 Bacteria 6185
1678 Ga0496125_0015869 3300048928 Bacteria 7257
1679 Ga0496125_0023712 3300048928 Bacteria 5657
1680 Ga0496125_0028980 3300048928 Bacteria 4985
1681 Ga0496125_0056823 3300048928 Bacteria 3174
1682 Ga0496125_0219312 3300048928 Bacteria 1227
1683 Ga0496126_0055405 3300048929 Bacteria 3587
1684 Ga0495678_014767 3300049459 Bacteria 3620
1685 Ga0501032_0019795 3300049569 Bacteria 4700
1686 Ga0501043_0019704 3300049579 Bacteria 5298
1687 Ga0501046_0142927 3300049580 Bacteria 1809
1688 Ga0501047_0000447 3300049581 Bacteria 45607
1689 Ga0501048_0471752 3300049582 Bacteria 899
1690 Ga0501067_0172796 3300049583 Bacteria 1204
1691 Ga0501071_0060775 3300049587 Bacteria 2736
1692 Ga0501074_0008468 3300049590 Bacteria 7453
1693 Ga0501076_1003670 3300049592 Bacteria 688
1694 Ga0501211_000125 3300049658 Bacteria 5920
1695 Ga0501217_003013 3300049661 Bacteria 3376
1696 Ga0501223_000010 3300049663 Bacteria 106901
1697 Ga0501224_019296 3300049664 Bacteria 1016
1698 Ga0501227_074734 3300049665 Bacteria 883
1699 Ga0501233_054676 3300049668 Bacteria 976
1700 Ga0501242_023740 3300049674 Bacteria 801
1701 Ga0501243_031240 3300049675 Bacteria 910
1702 Ga0501249_001062 3300049679 Bacteria 5847
1703 Ga0501249_010567 3300049679 Bacteria 1933
1704 Ga0501221_141452 3300049704 Bacteria 631
1705 Ga0501225_0000008 3300049705 Bacteria 95521
1706 Ga0501225_0000114 3300049705 Bacteria 25105
1707 Ga0501079_0825967 3300049741 Bacteria 730
1708 Ga0501241_029760 3300049758 Bacteria 1029
1709 Ga0501263_007560 3300049760 Bacteria 1281
1710 Ga0501270_055016 3300049767 Bacteria 731
1711 Ga0501273_017659 3300049770 Bacteria 944
1712 Ga0501282_006804 3300049778 Bacteria 1222
1713 Ga0501044_0054710 3300049823 Bacteria 4101
1714 nmdc:mga03683_192869_c1 3300050489 Bacteria 933
1715 nmdc:mga03683_32_c1 3300050489 Bacteria 68182
1716 nmdc:mga03n38_1854_c1 3300050490 Bacteria 6310
1717 nmdc:mga00v17_297873_c1 3300050491 Bacteria 1047
1718 nmdc:mga00v17_33433_c1 3300050491 Bacteria 3046
1719 nmdc:mga0k408_7_c1 3300050493 Bacteria 164270
1720 nmdc:mga0k408_9751_c1 3300050493 Bacteria 5185
1721 nmdc:mga04h51_60_c1 3300050495 Bacteria 35086
1722 nmdc:mga07m45_3_c1 3300050496 Bacteria 421414
1723 nmdc:mga06r32_3622_c1 3300050510 Bacteria 13786
1724 nmdc:mga08y16_201554_c1 3300050511 Bacteria 2062
1725 nmdc:mga0rr50_82788_c1 3300050513 Bacteria 2479
1726 nmdc:mga0a205_18103_c1 3300050515 Bacteria 6619
1727 nmdc:mga0sz30_788_c1 3300050516 Bacteria 11508
1728 Ga0495655_0118829 3300053083 Bacteria 802
1729 Ga0500643_000135 3300053087 Bacteria 74911
1730 Ga0500643_000137 3300053087 Bacteria 74194
1731 Ga0500643_002542 3300053087 Bacteria 9306
1732 Ga0500643_008873 3300053087 Bacteria 3901
1733 Ga0500651_0078586 3300053093 Bacteria 2046
1734 Ga0500566_0005929 3300053094 Bacteria 7266
1735 Ga0500556_0000076 3300053104 Bacteria 95452
1736 Ga0500592_022391 3300053116 Bacteria 1019
1737 Ga0500597_001461 3300053120 Bacteria 6001
1738 Ga0500614_064079 3300053123 Bacteria 994
1739 Ga0500642_0000001 3300053130 Bacteria 1468402
1740 Ga0500642_0003102 3300053130 Bacteria 4973
1741 Ga0500655_000063 3300053133 Bacteria 29223
1742 Ga0500658_0000149 3300053134 Bacteria 33339
1743 Ga0500658_0008240 3300053134 Bacteria 3850
1744 Ga0500559_0070886 3300053136 Bacteria 1569
1745 Ga0500559_0144001 3300053136 Bacteria 1117
1746 Ga0500568_0032622 3300053139 Bacteria 2141
1747 Ga0500590_006648 3300053148 Bacteria 5648
1748 Ga0500604_0000017 3300053151 Bacteria 82010
1749 Ga0500604_0001253 3300053151 Bacteria 7086
1750 Ga0500604_0058973 3300053151 Bacteria 1201
1751 Ga0500622_0054556 3300053156 Bacteria 2050
1752 Ga0500624_000019 3300053157 Bacteria 125903
1753 Ga0500624_000023 3300053157 Bacteria 114997
1754 Ga0500624_000055 3300053157 Bacteria 72708
1755 Ga0500639_099290 3300053163 Bacteria 1436
1756 Ga0500636_0014570 3300053177 Bacteria 4623
1757 Ga0500637_0000013 3300053178 Bacteria 73168
1758 Ga0500570_000050 3300053724 Bacteria 29070
1759 Ga0500645_000555 3300053730 Bacteria 24682
1760 Ga0500661_000754 3300055283 Bacteria 6061
1761 Ga0466962_0006218 3300061719 Bacteria 5734
1762 Ga0466962_0009510 3300061719 Bacteria 4662
1763 Ga0466962_0164138 3300061719 Bacteria 1080
1764 Ga0466962_0244560 3300061719 Bacteria 881

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046524 Ga0495648_0011851 Ga0495648_0011851_3625_4176 166
2 3300032002 Ga0307416_100392554 Ga0307416_1003925542 170
3 3300032126 Ga0307415_100396358 Ga0307415_1003963582 170
4 3300037418 Ga0395900_0349901 Ga0395900_0349901_845_1435 172
5 3300035207 Ga0373942_0250797 Ga0373942_0250797_57_590 173
6 3300025904 Ga0207647_10059639 Ga0207647_100596394 176
7 3300025909 Ga0207705_10000135 Ga0207705_1000013518 176
8 3300025919 Ga0207657_10001741 Ga0207657_1000174122 176
9 3300025949 Ga0207667_10000829 Ga0207667_1000082920 176
10 3300025972 Ga0207668_10188139 Ga0207668_101881392 176
11 3300031824 Ga0307413_10193956 Ga0307413_101939562 176
12 3300005327 Ga0070658_10171719 Ga0070658_101717192 177
13 3300005535 Ga0070684_100703606 Ga0070684_1007036061 177
14 3300005563 Ga0068855_100314694 Ga0068855_1003146942 177
15 3300005578 Ga0068854_100041359 Ga0068854_1000413591 177
16 3300009093 Ga0105240_10121821 Ga0105240_101218213 177
17 3300013105 Ga0157369_10084970 Ga0157369_100849704 177
18 3300013105 Ga0157369_10336068 Ga0157369_103360682 177
19 iso_pu_bacteria 2919138771 2919142074 177
20 3300005564 Ga0070664_100612646 Ga0070664_1006126462 179
21 3300013308 Ga0157375_10889394 Ga0157375_108893942 179
22 3300020069 Ga0197907_10924108 Ga0197907_109241084 179
23 3300025925 Ga0207650_10286401 Ga0207650_102864012 179
24 3300025933 Ga0207706_10406996 Ga0207706_104069962 179
25 3300025945 Ga0207679_10174142 Ga0207679_101741422 179
26 3300025981 Ga0207640_10055334 Ga0207640_100553342 179
27 3300026142 Ga0207698_10025135 Ga0207698_100251352 179
28 3300031548 Ga0307408_100588063 Ga0307408_1005880632 179
29 3300031731 Ga0307405_10457626 Ga0307405_104576262 179
30 3300032002 Ga0307416_100833797 Ga0307416_1008337971 179
31 3300032004 Ga0307414_10152881 Ga0307414_101528814 179
32 3300001990 JGI24737J22298_10002375 JGI24737J22298_100023756 180
33 3300005331 Ga0070670_100096191 Ga0070670_1000961912 180
34 3300005366 Ga0070659_100012694 Ga0070659_1000126944 180
35 3300005457 Ga0070662_101019869 Ga0070662_1010198691 180
36 3300005539 Ga0068853_100047163 Ga0068853_1000471635 180
37 3300005578 Ga0068854_100025206 Ga0068854_1000252064 180
38 3300005616 Ga0068852_100097710 Ga0068852_1000977104 180
39 3300013102 Ga0157371_10098950 Ga0157371_100989503 180
40 3300013105 Ga0157369_10181970 Ga0157369_101819704 180
41 3300025929 Ga0207664_10015465 Ga0207664_100154655 180
42 3300025972 Ga0207668_11310218 Ga0207668_113102181 180
43 3300038443 Ga0395901_1472025 Ga0395901_1472025_23_577 180
44 3300046660 Ga0495625_0015725 Ga0495625_0015725_2374_2955 180
45 iso_pu_bacteria 2896429255 2896431188 180
46 3300005546 Ga0070696_100733474 Ga0070696_1007334742 181
47 iso_pu_bacteria 8057101203 8057105723 181
48 3300037471 Ga0395905_0694586 Ga0395905_0694586_92_691 182
49 3300049592 Ga0501076_1003670 Ga0501076_1003670_97_663 182
50 3300005331 Ga0070670_100351605 Ga0070670_1003516052 183
51 3300005344 Ga0070661_100079199 Ga0070661_1000791992 183
52 3300005455 Ga0070663_100073796 Ga0070663_1000737962 183
53 3300005563 Ga0068855_100007354 Ga0068855_10000735414 183
54 3300005614 Ga0068856_100022262 Ga0068856_1000222623 183
55 3300005616 Ga0068852_100002128 Ga0068852_1000021284 183
56 3300006028 Ga0070717_10066510 Ga0070717_100665105 183
57 3300013102 Ga0157371_10021475 Ga0157371_100214755 183
58 3300013105 Ga0157369_10004588 Ga0157369_100045886 183
59 3300013105 Ga0157369_10023001 Ga0157369_100230015 183
60 3300021388 Ga0213875_10002606 Ga0213875_100026064 183
61 3300025920 Ga0207649_10064133 Ga0207649_100641332 183
62 3300025949 Ga0207667_10017906 Ga0207667_100179067 183
63 3300026067 Ga0207678_10082579 Ga0207678_100825792 183
64 3300026078 Ga0207702_10022619 Ga0207702_100226193 183
65 3300026142 Ga0207698_10003657 Ga0207698_100036578 183
66 3300030732 Ga0316176_1185896 Ga0316176_11858963 183
67 3300031548 Ga0307408_100012567 Ga0307408_1000125676 183
68 3300037418 Ga0395900_0052525 Ga0395900_0052525_229_795 183
69 3300037418 Ga0395900_0349857 Ga0395900_0349857_845_1435 183
70 3300037853 Ga0436364_1406360 Ga0436364_1406360_11856_12422 183
71 3300038443 Ga0395901_0284795 Ga0395901_0284795_1001_1567 183
72 3300044693 Ga0466961_0496449 Ga0466961_0496449_58_624 183
73 3300044765 Ga0466970_0247054 Ga0466970_0247054_58_624 183
74 3300001979 JGI24740J21852_10003457 JGI24740J21852_100034572 184
75 3300001979 JGI24740J21852_10007981 JGI24740J21852_100079814 184
76 3300001979 JGI24740J21852_10017904 JGI24740J21852_100179043 184
77 3300001989 JGI24739J22299_10028590 JGI24739J22299_100285904 184
78 3300001990 JGI24737J22298_10000238 JGI24737J22298_1000023815 184
79 3300001990 JGI24737J22298_10006005 JGI24737J22298_100060055 184
80 3300001990 JGI24737J22298_10007218 JGI24737J22298_100072182 184
81 3300001991 JGI24743J22301_10046281 JGI24743J22301_100462812 184
82 3300002067 JGI24735J21928_10008487 JGI24735J21928_100084873 184
83 3300002067 JGI24735J21928_10009940 JGI24735J21928_100099403 184
84 3300002073 JGI24745J21846_1000475 JGI24745J21846_10004755 184
85 3300002075 JGI24738J21930_10000420 JGI24738J21930_1000042013 184
86 3300002075 JGI24738J21930_10003652 JGI24738J21930_100036522 184
87 3300005293 Ga0065715_10215908 Ga0065715_102159082 184
88 3300005293 Ga0065715_10405442 Ga0065715_104054422 184
89 3300005327 Ga0070658_10003861 Ga0070658_1000386110 184
90 3300005327 Ga0070658_10020714 Ga0070658_100207146 184
91 3300005327 Ga0070658_10028553 Ga0070658_100285536 184
92 3300005327 Ga0070658_10041396 Ga0070658_100413963 184
93 3300005327 Ga0070658_10066945 Ga0070658_100669452 184
94 3300005327 Ga0070658_10087134 Ga0070658_100871344 184
95 3300005327 Ga0070658_10135370 Ga0070658_101353703 184
96 3300005327 Ga0070658_10139297 Ga0070658_101392972 184
97 3300005327 Ga0070658_10312667 Ga0070658_103126672 184
98 3300005327 Ga0070658_10350546 Ga0070658_103505462 184
99 3300005327 Ga0070658_10351328 Ga0070658_103513283 184
100 3300005327 Ga0070658_10390992 Ga0070658_103909922 184
101 3300005327 Ga0070658_10782631 Ga0070658_107826311 184
102 3300005328 Ga0070676_10120658 Ga0070676_101206584 184
103 3300005328 Ga0070676_10249384 Ga0070676_102493843 184
104 3300005329 Ga0070683_100000307 Ga0070683_1000003076 184
105 3300005329 Ga0070683_100010266 Ga0070683_1000102669 184
106 3300005329 Ga0070683_100043840 Ga0070683_1000438403 184
107 3300005329 Ga0070683_100095294 Ga0070683_1000952944 184
108 3300005329 Ga0070683_100325652 Ga0070683_1003256523 184
109 3300005329 Ga0070683_100359766 Ga0070683_1003597662 184
110 3300005329 Ga0070683_100797894 Ga0070683_1007978942 184
111 3300005330 Ga0070690_100084600 Ga0070690_1000846002 184
112 3300005330 Ga0070690_100110586 Ga0070690_1001105862 184
113 3300005330 Ga0070690_100185149 Ga0070690_1001851493 184
114 3300005330 Ga0070690_100784410 Ga0070690_1007844101 184
115 3300005331 Ga0070670_100009988 Ga0070670_1000099887 184
116 3300005331 Ga0070670_100064704 Ga0070670_1000647045 184
117 3300005331 Ga0070670_100069930 Ga0070670_1000699305 184
118 3300005331 Ga0070670_100280215 Ga0070670_1002802152 184
119 3300005331 Ga0070670_100313477 Ga0070670_1003134773 184
120 3300005333 Ga0070677_10008724 Ga0070677_100087243 184
121 3300005333 Ga0070677_10016276 Ga0070677_100162761 184
122 3300005333 Ga0070677_10093129 Ga0070677_100931291 184
123 3300005333 Ga0070677_10127787 Ga0070677_101277872 184
124 3300005334 Ga0068869_100054585 Ga0068869_1000545855 184
125 3300005335 Ga0070666_10001161 Ga0070666_100011619 184
126 3300005335 Ga0070666_10044915 Ga0070666_100449153 184
127 3300005335 Ga0070666_10060084 Ga0070666_100600842 184
128 3300005335 Ga0070666_10812266 Ga0070666_108122661 184
129 3300005336 Ga0070680_100001087 Ga0070680_1000010874 184
130 3300005336 Ga0070680_100001672 Ga0070680_1000016724 184
131 3300005336 Ga0070680_100013496 Ga0070680_1000134964 184
132 3300005336 Ga0070680_100049943 Ga0070680_1000499433 184
133 3300005336 Ga0070680_100091293 Ga0070680_1000912932 184
134 3300005336 Ga0070680_100237402 Ga0070680_1002374022 184
135 3300005336 Ga0070680_100403173 Ga0070680_1004031732 184
136 3300005336 Ga0070680_100772402 Ga0070680_1007724021 184
137 3300005337 Ga0070682_100147603 Ga0070682_1001476032 184
138 3300005338 Ga0068868_100073255 Ga0068868_1000732554 184
139 3300005338 Ga0068868_100125888 Ga0068868_1001258884 184
140 3300005339 Ga0070660_100000042 Ga0070660_10000004267 184
141 3300005339 Ga0070660_100017159 Ga0070660_1000171595 184
142 3300005339 Ga0070660_100023819 Ga0070660_1000238193 184
143 3300005339 Ga0070660_100024166 Ga0070660_1000241664 184
144 3300005339 Ga0070660_100031461 Ga0070660_1000314614 184
145 3300005339 Ga0070660_100046275 Ga0070660_1000462754 184
146 3300005339 Ga0070660_100090116 Ga0070660_1000901162 184
147 3300005339 Ga0070660_100138710 Ga0070660_1001387102 184
148 3300005339 Ga0070660_100157276 Ga0070660_1001572764 184
149 3300005339 Ga0070660_100175721 Ga0070660_1001757212 184
150 3300005339 Ga0070660_100206869 Ga0070660_1002068691 184
151 3300005339 Ga0070660_100304578 Ga0070660_1003045782 184
152 3300005340 Ga0070689_100283876 Ga0070689_1002838763 184
153 3300005341 Ga0070691_10112889 Ga0070691_101128892 184
154 3300005343 Ga0070687_100147403 Ga0070687_1001474032 184
155 3300005344 Ga0070661_100000120 Ga0070661_10000012067 184
156 3300005344 Ga0070661_100013463 Ga0070661_1000134636 184
157 3300005344 Ga0070661_100027792 Ga0070661_1000277924 184
158 3300005344 Ga0070661_100028731 Ga0070661_1000287313 184
159 3300005344 Ga0070661_100042451 Ga0070661_1000424513 184
160 3300005344 Ga0070661_100081906 Ga0070661_1000819064 184
161 3300005344 Ga0070661_100086650 Ga0070661_1000866502 184
162 3300005344 Ga0070661_100095392 Ga0070661_1000953922 184
163 3300005344 Ga0070661_100493872 Ga0070661_1004938722 184
164 3300005344 Ga0070661_100555025 Ga0070661_1005550252 184
165 3300005345 Ga0070692_10017366 Ga0070692_100173662 184
166 3300005345 Ga0070692_10057684 Ga0070692_100576842 184
167 3300005345 Ga0070692_10065069 Ga0070692_100650694 184
168 3300005345 Ga0070692_10139290 Ga0070692_101392903 184
169 3300005345 Ga0070692_10820297 Ga0070692_108202971 184
170 3300005347 Ga0070668_100058442 Ga0070668_1000584424 184
171 3300005347 Ga0070668_100088754 Ga0070668_1000887543 184
172 3300005347 Ga0070668_100188721 Ga0070668_1001887212 184
173 3300005347 Ga0070668_100193904 Ga0070668_1001939042 184
174 3300005347 Ga0070668_100589942 Ga0070668_1005899422 184
175 3300005347 Ga0070668_101288758 Ga0070668_1012887581 184
176 3300005353 Ga0070669_100024623 Ga0070669_1000246236 184
177 3300005353 Ga0070669_100116249 Ga0070669_1001162494 184
178 3300005353 Ga0070669_100191184 Ga0070669_1001911842 184
179 3300005353 Ga0070669_100245517 Ga0070669_1002455172 184
180 3300005353 Ga0070669_100632211 Ga0070669_1006322111 184
181 3300005353 Ga0070669_100922225 Ga0070669_1009222251 184
182 3300005354 Ga0070675_100005338 Ga0070675_1000053386 184
183 3300005354 Ga0070675_100296583 Ga0070675_1002965832 184
184 3300005354 Ga0070675_100297732 Ga0070675_1002977322 184
185 3300005354 Ga0070675_100356760 Ga0070675_1003567602 184
186 3300005354 Ga0070675_100997171 Ga0070675_1009971711 184
187 3300005354 Ga0070675_101121280 Ga0070675_1011212802 184
188 3300005355 Ga0070671_100001295 Ga0070671_1000012954 184
189 3300005355 Ga0070671_100015485 Ga0070671_1000154852 184
190 3300005355 Ga0070671_100034715 Ga0070671_1000347152 184
191 3300005355 Ga0070671_100036772 Ga0070671_1000367724 184
192 3300005355 Ga0070671_100050679 Ga0070671_1000506793 184
193 3300005355 Ga0070671_100076109 Ga0070671_1000761092 184
194 3300005355 Ga0070671_100436738 Ga0070671_1004367381 184
195 3300005356 Ga0070674_100004953 Ga0070674_1000049531 184
196 3300005356 Ga0070674_100051297 Ga0070674_1000512973 184
197 3300005356 Ga0070674_100061418 Ga0070674_1000614184 184
198 3300005356 Ga0070674_100183095 Ga0070674_1001830954 184
199 3300005356 Ga0070674_100199546 Ga0070674_1001995463 184
200 3300005364 Ga0070673_100000497 Ga0070673_10000049717 184
201 3300005364 Ga0070673_100007743 Ga0070673_10000774310 184
202 3300005364 Ga0070673_100073492 Ga0070673_1000734925 184
203 3300005364 Ga0070673_100531383 Ga0070673_1005313831 184
204 3300005364 Ga0070673_100703428 Ga0070673_1007034282 184
205 3300005366 Ga0070659_100001690 Ga0070659_1000016909 184
206 3300005366 Ga0070659_100002178 Ga0070659_10000217811 184
207 3300005366 Ga0070659_100015516 Ga0070659_1000155165 184
208 3300005366 Ga0070659_100029260 Ga0070659_1000292605 184
209 3300005366 Ga0070659_100044812 Ga0070659_1000448124 184
210 3300005366 Ga0070659_100045687 Ga0070659_1000456874 184
211 3300005366 Ga0070659_100046721 Ga0070659_1000467214 184
212 3300005366 Ga0070659_100063608 Ga0070659_1000636083 184
213 3300005366 Ga0070659_100068918 Ga0070659_1000689183 184
214 3300005366 Ga0070659_100112981 Ga0070659_1001129812 184
215 3300005366 Ga0070659_100129260 Ga0070659_1001292604 184
216 3300005366 Ga0070659_100202608 Ga0070659_1002026081 184
217 3300005366 Ga0070659_100317535 Ga0070659_1003175352 184
218 3300005366 Ga0070659_100449813 Ga0070659_1004498132 184
219 3300005366 Ga0070659_100611157 Ga0070659_1006111571 184
220 3300005366 Ga0070659_100933282 Ga0070659_1009332821 184
221 3300005367 Ga0070667_100007145 Ga0070667_1000071455 184
222 3300005367 Ga0070667_100007459 Ga0070667_1000074598 184
223 3300005367 Ga0070667_100012753 Ga0070667_1000127535 184
224 3300005367 Ga0070667_100012908 Ga0070667_1000129085 184
225 3300005367 Ga0070667_100025144 Ga0070667_1000251444 184
226 3300005367 Ga0070667_100028198 Ga0070667_1000281983 184
227 3300005367 Ga0070667_100076376 Ga0070667_1000763762 184
228 3300005367 Ga0070667_100079674 Ga0070667_1000796741 184
229 3300005367 Ga0070667_100084646 Ga0070667_1000846463 184
230 3300005367 Ga0070667_100849836 Ga0070667_1008498361 184
231 3300005367 Ga0070667_100942183 Ga0070667_1009421831 184
232 3300005434 Ga0070709_10186331 Ga0070709_101863312 184
233 3300005435 Ga0070714_100054319 Ga0070714_1000543194 184
234 3300005435 Ga0070714_100087645 Ga0070714_1000876452 184
235 3300005435 Ga0070714_100182084 Ga0070714_1001820842 184
236 3300005435 Ga0070714_100445388 Ga0070714_1004453883 184
237 3300005435 Ga0070714_100490438 Ga0070714_1004904381 184
238 3300005435 Ga0070714_101329748 Ga0070714_1013297481 184
239 3300005436 Ga0070713_100064415 Ga0070713_1000644154 184
240 3300005436 Ga0070713_100187588 Ga0070713_1001875883 184
241 3300005436 Ga0070713_100436699 Ga0070713_1004366992 184
242 3300005444 Ga0070694_100009449 Ga0070694_1000094494 184
243 3300005455 Ga0070663_100015066 Ga0070663_1000150664 184
244 3300005455 Ga0070663_100036659 Ga0070663_1000366593 184
245 3300005455 Ga0070663_100094293 Ga0070663_1000942934 184
246 3300005455 Ga0070663_100108840 Ga0070663_1001088402 184
247 3300005455 Ga0070663_100128830 Ga0070663_1001288302 184
248 3300005455 Ga0070663_100275184 Ga0070663_1002751842 184
249 3300005455 Ga0070663_100493476 Ga0070663_1004934762 184
250 3300005456 Ga0070678_100025945 Ga0070678_1000259455 184
251 3300005456 Ga0070678_100103020 Ga0070678_1001030204 184
252 3300005456 Ga0070678_100882664 Ga0070678_1008826641 184
253 3300005457 Ga0070662_100000160 Ga0070662_10000016028 184
254 3300005457 Ga0070662_100024348 Ga0070662_1000243484 184
255 3300005457 Ga0070662_100038198 Ga0070662_1000381984 184
256 3300005457 Ga0070662_100040251 Ga0070662_1000402514 184
257 3300005457 Ga0070662_100046561 Ga0070662_1000465613 184
258 3300005457 Ga0070662_100074826 Ga0070662_1000748262 184
259 3300005457 Ga0070662_100115223 Ga0070662_1001152234 184
260 3300005457 Ga0070662_100336237 Ga0070662_1003362373 184
261 3300005457 Ga0070662_100485990 Ga0070662_1004859902 184
262 3300005457 Ga0070662_100573121 Ga0070662_1005731211 184
263 3300005457 Ga0070662_100707165 Ga0070662_1007071651 184
264 3300005458 Ga0070681_10019981 Ga0070681_100199814 184
265 3300005458 Ga0070681_10120015 Ga0070681_101200153 184
266 3300005458 Ga0070681_10137674 Ga0070681_101376742 184
267 3300005458 Ga0070681_10369631 Ga0070681_103696312 184
268 3300005458 Ga0070681_10437438 Ga0070681_104374382 184
269 3300005458 Ga0070681_10500206 Ga0070681_105002062 184
270 3300005458 Ga0070681_10501538 Ga0070681_105015381 184
271 3300005459 Ga0068867_100189296 Ga0068867_1001892962 184
272 3300005459 Ga0068867_100210178 Ga0068867_1002101784 184
273 3300005459 Ga0068867_100304483 Ga0068867_1003044832 184
274 3300005466 Ga0070685_10280305 Ga0070685_102803052 184
275 3300005530 Ga0070679_100134398 Ga0070679_1001343982 184
276 3300005530 Ga0070679_100216829 Ga0070679_1002168292 184
277 3300005530 Ga0070679_101045747 Ga0070679_1010457472 184
278 3300005535 Ga0070684_100031782 Ga0070684_1000317825 184
279 3300005535 Ga0070684_100145528 Ga0070684_1001455283 184
280 3300005535 Ga0070684_100334423 Ga0070684_1003344231 184
281 3300005535 Ga0070684_100967248 Ga0070684_1009672482 184
282 3300005539 Ga0068853_100002498 Ga0068853_10000249810 184
283 3300005539 Ga0068853_100006969 Ga0068853_1000069697 184
284 3300005539 Ga0068853_100009313 Ga0068853_1000093133 184
285 3300005539 Ga0068853_100025194 Ga0068853_1000251945 184
286 3300005539 Ga0068853_100200540 Ga0068853_1002005403 184
287 3300005539 Ga0068853_100334611 Ga0068853_1003346112 184
288 3300005539 Ga0068853_100391223 Ga0068853_1003912231 184
289 3300005539 Ga0068853_100999965 Ga0068853_1009999651 184
290 3300005543 Ga0070672_100013564 Ga0070672_1000135646 184
291 3300005543 Ga0070672_100041805 Ga0070672_1000418053 184
292 3300005543 Ga0070672_100267233 Ga0070672_1002672331 184
293 3300005544 Ga0070686_100086866 Ga0070686_1000868663 184
294 3300005546 Ga0070696_100105646 Ga0070696_1001056464 184
295 3300005547 Ga0070693_100003515 Ga0070693_1000035155 184
296 3300005547 Ga0070693_100083556 Ga0070693_1000835562 184
297 3300005548 Ga0070665_100017313 Ga0070665_1000173136 184
298 3300005548 Ga0070665_100028917 Ga0070665_1000289177 184
299 3300005548 Ga0070665_100110339 Ga0070665_1001103392 184
300 3300005548 Ga0070665_100183983 Ga0070665_1001839833 184
301 3300005548 Ga0070665_100224567 Ga0070665_1002245674 184
302 3300005563 Ga0068855_100001458 Ga0068855_10000145821 184
303 3300005563 Ga0068855_100019628 Ga0068855_10001962811 184
304 3300005563 Ga0068855_100040249 Ga0068855_1000402495 184
305 3300005563 Ga0068855_100053508 Ga0068855_1000535085 184
306 3300005563 Ga0068855_100073993 Ga0068855_1000739932 184
307 3300005563 Ga0068855_100087777 Ga0068855_1000877774 184
308 3300005563 Ga0068855_100117095 Ga0068855_1001170953 184
309 3300005563 Ga0068855_100139824 Ga0068855_1001398243 184
310 3300005563 Ga0068855_100208814 Ga0068855_1002088144 184
311 3300005563 Ga0068855_100586157 Ga0068855_1005861572 184
312 3300005563 Ga0068855_100810230 Ga0068855_1008102302 184
313 3300005563 Ga0068855_101277698 Ga0068855_1012776981 184
314 3300005564 Ga0070664_100000071 Ga0070664_10000007110 184
315 3300005564 Ga0070664_100022534 Ga0070664_1000225344 184
316 3300005564 Ga0070664_100024270 Ga0070664_1000242705 184
317 3300005564 Ga0070664_100045191 Ga0070664_1000451914 184
318 3300005564 Ga0070664_100057327 Ga0070664_1000573273 184
319 3300005564 Ga0070664_100135240 Ga0070664_1001352404 184
320 3300005564 Ga0070664_100173788 Ga0070664_1001737884 184
321 3300005564 Ga0070664_100194387 Ga0070664_1001943872 184
322 3300005564 Ga0070664_100244047 Ga0070664_1002440472 184
323 3300005564 Ga0070664_100435265 Ga0070664_1004352652 184
324 3300005577 Ga0068857_100000315 Ga0068857_1000003158 184
325 3300005577 Ga0068857_100015582 Ga0068857_1000155823 184
326 3300005577 Ga0068857_100021422 Ga0068857_1000214226 184
327 3300005577 Ga0068857_100025044 Ga0068857_1000250447 184
328 3300005577 Ga0068857_100060082 Ga0068857_1000600824 184
329 3300005577 Ga0068857_100164819 Ga0068857_1001648192 184
330 3300005577 Ga0068857_100212500 Ga0068857_1002125003 184
331 3300005577 Ga0068857_101060347 Ga0068857_1010603471 184
332 3300005578 Ga0068854_100017221 Ga0068854_1000172215 184
333 3300005578 Ga0068854_100026711 Ga0068854_1000267113 184
334 3300005578 Ga0068854_100027252 Ga0068854_1000272525 184
335 3300005578 Ga0068854_100042894 Ga0068854_1000428944 184
336 3300005578 Ga0068854_100050371 Ga0068854_1000503712 184
337 3300005578 Ga0068854_100059619 Ga0068854_1000596193 184
338 3300005578 Ga0068854_100072460 Ga0068854_1000724603 184
339 3300005578 Ga0068854_100146769 Ga0068854_1001467694 184
340 3300005578 Ga0068854_100308928 Ga0068854_1003089283 184
341 3300005614 Ga0068856_100000244 Ga0068856_10000024457 184
342 3300005614 Ga0068856_100008866 Ga0068856_1000088668 184
343 3300005614 Ga0068856_100044318 Ga0068856_1000443185 184
344 3300005614 Ga0068856_100086575 Ga0068856_1000865754 184
345 3300005614 Ga0068856_100163613 Ga0068856_1001636134 184
346 3300005614 Ga0068856_100253494 Ga0068856_1002534942 184
347 3300005614 Ga0068856_100565383 Ga0068856_1005653832 184
348 3300005614 Ga0068856_101183286 Ga0068856_1011832862 184
349 3300005615 Ga0070702_100056758 Ga0070702_1000567583 184
350 3300005616 Ga0068852_100001863 Ga0068852_1000018634 184
351 3300005616 Ga0068852_100003541 Ga0068852_1000035414 184
352 3300005616 Ga0068852_100006623 Ga0068852_1000066234 184
353 3300005616 Ga0068852_100017325 Ga0068852_1000173256 184
354 3300005616 Ga0068852_100021794 Ga0068852_1000217945 184
355 3300005616 Ga0068852_100046115 Ga0068852_1000461154 184
356 3300005616 Ga0068852_100051544 Ga0068852_1000515444 184
357 3300005616 Ga0068852_100060834 Ga0068852_1000608343 184
358 3300005616 Ga0068852_100418894 Ga0068852_1004188942 184
359 3300005616 Ga0068852_100726136 Ga0068852_1007261362 184
360 3300005617 Ga0068859_100000144 Ga0068859_10000014473 184
361 3300005617 Ga0068859_100209306 Ga0068859_1002093062 184
362 3300005617 Ga0068859_100214524 Ga0068859_1002145242 184
363 3300005617 Ga0068859_100801376 Ga0068859_1008013761 184
364 3300005617 Ga0068859_101221312 Ga0068859_1012213122 184
365 3300005618 Ga0068864_100000092 Ga0068864_10000009260 184
366 3300005618 Ga0068864_100016790 Ga0068864_1000167903 184
367 3300005618 Ga0068864_100091835 Ga0068864_1000918353 184
368 3300005618 Ga0068864_100098812 Ga0068864_1000988124 184
369 3300005718 Ga0068866_10047459 Ga0068866_100474594 184
370 3300005718 Ga0068866_10049083 Ga0068866_100490833 184
371 3300005718 Ga0068866_10183768 Ga0068866_101837682 184
372 3300005719 Ga0068861_100248325 Ga0068861_1002483252 184
373 3300005719 Ga0068861_100511998 Ga0068861_1005119982 184
374 3300005834 Ga0068851_10008092 Ga0068851_100080925 184
375 3300005834 Ga0068851_10045631 Ga0068851_100456312 184
376 3300005834 Ga0068851_10108806 Ga0068851_101088062 184
377 3300005834 Ga0068851_10170108 Ga0068851_101701082 184
378 3300005841 Ga0068863_100000222 Ga0068863_10000022226 184
379 3300005841 Ga0068863_100000670 Ga0068863_10000067029 184
380 3300005841 Ga0068863_100060705 Ga0068863_1000607054 184
381 3300005841 Ga0068863_100083690 Ga0068863_1000836904 184
382 3300005841 Ga0068863_100152176 Ga0068863_1001521762 184
383 3300005841 Ga0068863_100262058 Ga0068863_1002620584 184
384 3300005842 Ga0068858_100000256 Ga0068858_10000025657 184
385 3300005842 Ga0068858_100045258 Ga0068858_1000452584 184
386 3300005842 Ga0068858_100099331 Ga0068858_1000993314 184
387 3300005842 Ga0068858_100342760 Ga0068858_1003427602 184
388 3300005842 Ga0068858_101536777 Ga0068858_1015367771 184
389 3300005843 Ga0068860_100000007 Ga0068860_100000007284 184
390 3300005843 Ga0068860_100002571 Ga0068860_1000025715 184
391 3300005843 Ga0068860_100101492 Ga0068860_1001014922 184
392 3300005843 Ga0068860_100315968 Ga0068860_1003159682 184
393 3300005843 Ga0068860_101257869 Ga0068860_1012578692 184
394 3300005844 Ga0068862_100005331 Ga0068862_1000053313 184
395 3300005844 Ga0068862_100011848 Ga0068862_1000118487 184
396 3300005844 Ga0068862_100412659 Ga0068862_1004126592 184
397 3300005844 Ga0068862_101495505 Ga0068862_1014955051 184
398 3300005844 Ga0068862_101753794 Ga0068862_1017537941 184
399 3300005983 Ga0081540_1074990 Ga0081540_10749902 184
400 3300005985 Ga0081539_10018771 Ga0081539_100187714 184
401 3300005985 Ga0081539_10052286 Ga0081539_100522864 184
402 3300006028 Ga0070717_10051068 Ga0070717_100510683 184
403 3300006028 Ga0070717_10924860 Ga0070717_109248602 184
404 3300006175 Ga0070712_100002819 Ga0070712_1000028197 184
405 3300006175 Ga0070712_100543031 Ga0070712_1005430312 184
406 3300006237 Ga0097621_100128905 Ga0097621_1001289052 184
407 3300006237 Ga0097621_100537062 Ga0097621_1005370622 184
408 3300006358 Ga0068871_100175920 Ga0068871_1001759202 184
409 3300006358 Ga0068871_100253940 Ga0068871_1002539402 184
410 3300006358 Ga0068871_101018643 Ga0068871_1010186432 184
411 3300006847 Ga0075431_100008702 Ga0075431_10000870211 184
412 3300006847 Ga0075431_100593629 Ga0075431_1005936293 184
413 3300006871 Ga0075434_100097001 Ga0075434_1000970012 184
414 3300006880 Ga0075429_100200592 Ga0075429_1002005924 184
415 3300006880 Ga0075429_100332451 Ga0075429_1003324512 184
416 3300006881 Ga0068865_100002706 Ga0068865_10000270610 184
417 3300006881 Ga0068865_100013435 Ga0068865_1000134354 184
418 3300006881 Ga0068865_100103578 Ga0068865_1001035783 184
419 3300006881 Ga0068865_100624595 Ga0068865_1006245952 184
420 3300006931 Ga0097620_100000144 Ga0097620_1000001445 184
421 3300006931 Ga0097620_100209290 Ga0097620_1002092902 184
422 3300006931 Ga0097620_100214526 Ga0097620_1002145262 184
423 3300006931 Ga0097620_100801412 Ga0097620_1008014122 184
424 3300006931 Ga0097620_101221403 Ga0097620_1012214032 184
425 3300007076 Ga0075435_100356215 Ga0075435_1003562152 184
426 3300009092 Ga0105250_10017542 Ga0105250_100175424 184
427 3300009093 Ga0105240_10014684 Ga0105240_100146846 184
428 3300009093 Ga0105240_10094931 Ga0105240_100949314 184
429 3300009093 Ga0105240_10427397 Ga0105240_104273971 184
430 3300009093 Ga0105240_10497236 Ga0105240_104972363 184
431 3300009093 Ga0105240_10519508 Ga0105240_105195082 184
432 3300009094 Ga0111539_10471626 Ga0111539_104716263 184
433 3300009098 Ga0105245_10007077 Ga0105245_1000707711 184
434 3300009101 Ga0105247_10460311 Ga0105247_104603112 184
435 3300009148 Ga0105243_10040963 Ga0105243_100409634 184
436 3300009148 Ga0105243_10073164 Ga0105243_100731642 184
437 3300009148 Ga0105243_10118799 Ga0105243_101187991 184
438 3300009148 Ga0105243_10285746 Ga0105243_102857462 184
439 3300009148 Ga0105243_10368276 Ga0105243_103682763 184
440 3300009148 Ga0105243_10396607 Ga0105243_103966072 184
441 3300009174 Ga0105241_10054250 Ga0105241_100542504 184
442 3300009174 Ga0105241_10071184 Ga0105241_100711843 184
443 3300009174 Ga0105241_10126124 Ga0105241_101261242 184
444 3300009176 Ga0105242_10101955 Ga0105242_101019554 184
445 3300009176 Ga0105242_10129373 Ga0105242_101293733 184
446 3300009177 Ga0105248_10000587 Ga0105248_100005877 184
447 3300009177 Ga0105248_10000773 Ga0105248_1000077326 184
448 3300009177 Ga0105248_10002607 Ga0105248_100026078 184
449 3300009177 Ga0105248_10694599 Ga0105248_106945993 184
450 3300009177 Ga0105248_11123092 Ga0105248_111230922 184
451 3300009545 Ga0105237_10012608 Ga0105237_100126085 184
452 3300009551 Ga0105238_10029976 Ga0105238_100299767 184
453 3300009551 Ga0105238_10133037 Ga0105238_101330372 184
454 3300009551 Ga0105238_10266847 Ga0105238_102668472 184
455 3300009551 Ga0105238_10373171 Ga0105238_103731712 184
456 3300009553 Ga0105249_10009482 Ga0105249_100094826 184
457 3300009553 Ga0105249_10367064 Ga0105249_103670643 184
458 3300009553 Ga0105249_11070196 Ga0105249_110701961 184
459 3300010375 Ga0105239_10011604 Ga0105239_100116047 184
460 3300010375 Ga0105239_10803137 Ga0105239_108031372 184
461 3300013100 Ga0157373_10003467 Ga0157373_100034675 184
462 3300013100 Ga0157373_10010060 Ga0157373_100100603 184
463 3300013100 Ga0157373_10017414 Ga0157373_100174142 184
464 3300013100 Ga0157373_10054170 Ga0157373_100541704 184
465 3300013100 Ga0157373_10080578 Ga0157373_100805782 184
466 3300013100 Ga0157373_10087200 Ga0157373_100872003 184
467 3300013100 Ga0157373_10136161 Ga0157373_101361612 184
468 3300013100 Ga0157373_10297508 Ga0157373_102975082 184
469 3300013102 Ga0157371_10008769 Ga0157371_100087697 184
470 3300013102 Ga0157371_10010092 Ga0157371_100100927 184
471 3300013102 Ga0157371_10011964 Ga0157371_100119643 184
472 3300013102 Ga0157371_10023626 Ga0157371_100236264 184
473 3300013102 Ga0157371_10044688 Ga0157371_100446883 184
474 3300013102 Ga0157371_10051615 Ga0157371_100516153 184
475 3300013102 Ga0157371_10277695 Ga0157371_102776951 184
476 3300013102 Ga0157371_10278832 Ga0157371_102788322 184
477 3300013102 Ga0157371_10451344 Ga0157371_104513442 184
478 3300013102 Ga0157371_10557174 Ga0157371_105571741 184
479 3300013104 Ga0157370_10001722 Ga0157370_1000172223 184
480 3300013104 Ga0157370_10053809 Ga0157370_100538093 184
481 3300013104 Ga0157370_10073909 Ga0157370_100739094 184
482 3300013104 Ga0157370_10209345 Ga0157370_102093454 184
483 3300013105 Ga0157369_10019901 Ga0157369_100199014 184
484 3300013105 Ga0157369_10030659 Ga0157369_100306595 184
485 3300013105 Ga0157369_10041088 Ga0157369_100410885 184
486 3300013105 Ga0157369_10069347 Ga0157369_100693473 184
487 3300013105 Ga0157369_10090164 Ga0157369_100901644 184
488 3300013105 Ga0157369_10102999 Ga0157369_101029992 184
489 3300013105 Ga0157369_10140237 Ga0157369_101402374 184
490 3300013105 Ga0157369_10154395 Ga0157369_101543952 184
491 3300013105 Ga0157369_10692999 Ga0157369_106929991 184
492 3300013296 Ga0157374_10034037 Ga0157374_100340375 184
493 3300013296 Ga0157374_10178516 Ga0157374_101785163 184
494 3300013296 Ga0157374_10904870 Ga0157374_109048702 184
495 3300013297 Ga0157378_10015380 Ga0157378_100153804 184
496 3300013306 Ga0163162_10014733 Ga0163162_100147332 184
497 3300013306 Ga0163162_10032821 Ga0163162_100328215 184
498 3300013306 Ga0163162_10190474 Ga0163162_101904744 184
499 3300013306 Ga0163162_10255852 Ga0163162_102558522 184
500 3300013306 Ga0163162_10579789 Ga0163162_105797892 184
501 3300013307 Ga0157372_10006954 Ga0157372_1000695412 184
502 3300013307 Ga0157372_10050035 Ga0157372_100500352 184
503 3300013307 Ga0157372_10076696 Ga0157372_100766964 184
504 3300013307 Ga0157372_10086690 Ga0157372_100866903 184
505 3300013307 Ga0157372_10469849 Ga0157372_104698492 184
506 3300013307 Ga0157372_10912118 Ga0157372_109121183 184
507 3300013308 Ga0157375_10006908 Ga0157375_100069083 184
508 3300013308 Ga0157375_10125933 Ga0157375_101259334 184
509 3300013308 Ga0157375_10396567 Ga0157375_103965672 184
510 3300013308 Ga0157375_10540420 Ga0157375_105404202 184
511 3300013308 Ga0157375_10744076 Ga0157375_107440762 184
512 3300013308 Ga0157375_10885841 Ga0157375_108858412 184
513 3300014325 Ga0163163_10000080 Ga0163163_1000008058 184
514 3300014325 Ga0163163_10000464 Ga0163163_1000046414 184
515 3300014325 Ga0163163_10004007 Ga0163163_1000400713 184
516 3300014325 Ga0163163_10068640 Ga0163163_100686405 184
517 3300014325 Ga0163163_10121453 Ga0163163_101214533 184
518 3300014325 Ga0163163_10304986 Ga0163163_103049862 184
519 3300014326 Ga0157380_10098592 Ga0157380_100985924 184
520 3300014745 Ga0157377_10065466 Ga0157377_100654662 184
521 3300014745 Ga0157377_10108916 Ga0157377_101089162 184
522 3300014745 Ga0157377_10240534 Ga0157377_102405342 184
523 3300014968 Ga0157379_10005589 Ga0157379_100055896 184
524 3300014968 Ga0157379_10043381 Ga0157379_100433813 184
525 3300014969 Ga0157376_10005211 Ga0157376_100052116 184
526 3300014969 Ga0157376_10823582 Ga0157376_108235822 184
527 3300014969 Ga0157376_11020990 Ga0157376_110209902 184
528 3300017792 Ga0163161_10291021 Ga0163161_102910213 184
529 3300017792 Ga0163161_10394567 Ga0163161_103945672 184
530 3300020070 Ga0206356_10945929 Ga0206356_109459292 184
531 3300020081 Ga0206354_10231885 Ga0206354_102318854 184
532 3300020081 Ga0206354_10912860 Ga0206354_109128603 184
533 3300020082 Ga0206353_11476642 Ga0206353_114766422 184
534 3300020082 Ga0206353_11915595 Ga0206353_119155953 184
535 3300021384 Ga0213876_10007945 Ga0213876_100079453 184
536 3300025315 Ga0207697_10023020 Ga0207697_100230202 184
537 3300025321 Ga0207656_10002365 Ga0207656_100023656 184
538 3300025321 Ga0207656_10003463 Ga0207656_100034637 184
539 3300025321 Ga0207656_10013260 Ga0207656_100132602 184
540 3300025321 Ga0207656_10108559 Ga0207656_101085592 184
541 3300025893 Ga0207682_10005329 Ga0207682_100053294 184
542 3300025899 Ga0207642_10015428 Ga0207642_100154282 184
543 3300025899 Ga0207642_10105864 Ga0207642_101058642 184
544 3300025900 Ga0207710_10234230 Ga0207710_102342302 184
545 3300025901 Ga0207688_10008353 Ga0207688_100083536 184
546 3300025903 Ga0207680_10002081 Ga0207680_100020813 184
547 3300025903 Ga0207680_10006822 Ga0207680_100068224 184
548 3300025903 Ga0207680_10321898 Ga0207680_103218982 184
549 3300025903 Ga0207680_10687556 Ga0207680_106875562 184
550 3300025904 Ga0207647_10001153 Ga0207647_1000115319 184
551 3300025904 Ga0207647_10001911 Ga0207647_1000191113 184
552 3300025904 Ga0207647_10002139 Ga0207647_100021394 184
553 3300025904 Ga0207647_10009442 Ga0207647_100094424 184
554 3300025904 Ga0207647_10027393 Ga0207647_100273934 184
555 3300025904 Ga0207647_10055099 Ga0207647_100550994 184
556 3300025904 Ga0207647_10066878 Ga0207647_100668784 184
557 3300025904 Ga0207647_10067402 Ga0207647_100674022 184
558 3300025904 Ga0207647_10093715 Ga0207647_100937151 184
559 3300025904 Ga0207647_10297439 Ga0207647_102974392 184
560 3300025906 Ga0207699_10228477 Ga0207699_102284772 184
561 3300025907 Ga0207645_10016295 Ga0207645_100162953 184
562 3300025907 Ga0207645_10021097 Ga0207645_100210974 184
563 3300025907 Ga0207645_10098361 Ga0207645_100983612 184
564 3300025909 Ga0207705_10000764 Ga0207705_1000076410 184
565 3300025909 Ga0207705_10002589 Ga0207705_1000258910 184
566 3300025909 Ga0207705_10006049 Ga0207705_1000604910 184
567 3300025909 Ga0207705_10006095 Ga0207705_100060953 184
568 3300025909 Ga0207705_10013901 Ga0207705_100139012 184
569 3300025909 Ga0207705_10022048 Ga0207705_100220484 184
570 3300025909 Ga0207705_10027109 Ga0207705_100271094 184
571 3300025909 Ga0207705_10029746 Ga0207705_100297463 184
572 3300025909 Ga0207705_10044605 Ga0207705_100446052 184
573 3300025909 Ga0207705_10050213 Ga0207705_100502134 184
574 3300025909 Ga0207705_10066815 Ga0207705_100668152 184
575 3300025909 Ga0207705_10122948 Ga0207705_101229484 184
576 3300025909 Ga0207705_10131046 Ga0207705_101310463 184
577 3300025909 Ga0207705_10243266 Ga0207705_102432662 184
578 3300025909 Ga0207705_10339059 Ga0207705_103390591 184
579 3300025911 Ga0207654_10238977 Ga0207654_102389771 184
580 3300025912 Ga0207707_10004365 Ga0207707_1000436511 184
581 3300025912 Ga0207707_10012875 Ga0207707_100128754 184
582 3300025912 Ga0207707_10094729 Ga0207707_100947293 184
583 3300025913 Ga0207695_10011701 Ga0207695_100117015 184
584 3300025913 Ga0207695_10070537 Ga0207695_100705372 184
585 3300025913 Ga0207695_10135847 Ga0207695_101358474 184
586 3300025913 Ga0207695_10260755 Ga0207695_102607554 184
587 3300025914 Ga0207671_10011347 Ga0207671_100113474 184
588 3300025914 Ga0207671_10017230 Ga0207671_100172304 184
589 3300025917 Ga0207660_10000472 Ga0207660_1000047223 184
590 3300025917 Ga0207660_10001812 Ga0207660_100018126 184
591 3300025917 Ga0207660_10001982 Ga0207660_100019823 184
592 3300025917 Ga0207660_10006179 Ga0207660_100061795 184
593 3300025917 Ga0207660_10018348 Ga0207660_100183483 184
594 3300025917 Ga0207660_10329321 Ga0207660_103293212 184
595 3300025918 Ga0207662_10149389 Ga0207662_101493893 184
596 3300025919 Ga0207657_10003876 Ga0207657_100038769 184
597 3300025919 Ga0207657_10008302 Ga0207657_100083024 184
598 3300025919 Ga0207657_10010390 Ga0207657_100103908 184
599 3300025919 Ga0207657_10031358 Ga0207657_100313584 184
600 3300025919 Ga0207657_10032063 Ga0207657_100320634 184
601 3300025919 Ga0207657_10035190 Ga0207657_100351904 184
602 3300025919 Ga0207657_10042285 Ga0207657_100422853 184
603 3300025919 Ga0207657_10044544 Ga0207657_100445444 184
604 3300025919 Ga0207657_10046598 Ga0207657_100465984 184
605 3300025919 Ga0207657_10056166 Ga0207657_100561663 184
606 3300025919 Ga0207657_10103917 Ga0207657_101039172 184
607 3300025919 Ga0207657_10329181 Ga0207657_103291813 184
608 3300025920 Ga0207649_10000559 Ga0207649_1000055921 184
609 3300025920 Ga0207649_10002603 Ga0207649_100026035 184
610 3300025920 Ga0207649_10005077 Ga0207649_100050776 184
611 3300025920 Ga0207649_10005743 Ga0207649_100057437 184
612 3300025920 Ga0207649_10025946 Ga0207649_100259464 184
613 3300025920 Ga0207649_10052276 Ga0207649_100522762 184
614 3300025920 Ga0207649_10053636 Ga0207649_100536364 184
615 3300025920 Ga0207649_10072942 Ga0207649_100729423 184
616 3300025921 Ga0207652_10003434 Ga0207652_100034346 184
617 3300025921 Ga0207652_10019293 Ga0207652_100192932 184
618 3300025923 Ga0207681_10042851 Ga0207681_100428511 184
619 3300025923 Ga0207681_10083561 Ga0207681_100835612 184
620 3300025923 Ga0207681_10139611 Ga0207681_101396112 184
621 3300025923 Ga0207681_10164182 Ga0207681_101641824 184
622 3300025923 Ga0207681_10681715 Ga0207681_106817152 184
623 3300025923 Ga0207681_10715208 Ga0207681_107152082 184
624 3300025924 Ga0207694_10002972 Ga0207694_100029724 184
625 3300025924 Ga0207694_10009944 Ga0207694_100099447 184
626 3300025924 Ga0207694_10558072 Ga0207694_105580722 184
627 3300025925 Ga0207650_10036227 Ga0207650_100362274 184
628 3300025925 Ga0207650_10044704 Ga0207650_100447045 184
629 3300025925 Ga0207650_10066371 Ga0207650_100663713 184
630 3300025925 Ga0207650_10092802 Ga0207650_100928024 184
631 3300025925 Ga0207650_10129863 Ga0207650_101298632 184
632 3300025925 Ga0207650_10235533 Ga0207650_102355333 184
633 3300025925 Ga0207650_10596999 Ga0207650_105969992 184
634 3300025925 Ga0207650_10782660 Ga0207650_107826602 184
635 3300025925 Ga0207650_10976780 Ga0207650_109767802 184
636 3300025926 Ga0207659_10002296 Ga0207659_100022968 184
637 3300025926 Ga0207659_10040194 Ga0207659_100401942 184
638 3300025926 Ga0207659_10064439 Ga0207659_100644392 184
639 3300025926 Ga0207659_10209968 Ga0207659_102099683 184
640 3300025926 Ga0207659_10349452 Ga0207659_103494523 184
641 3300025926 Ga0207659_10413205 Ga0207659_104132052 184
642 3300025926 Ga0207659_11087949 Ga0207659_110879491 184
643 3300025927 Ga0207687_10096833 Ga0207687_100968334 184
644 3300025928 Ga0207700_10281486 Ga0207700_102814862 184
645 3300025928 Ga0207700_10311330 Ga0207700_103113302 184
646 3300025929 Ga0207664_10048758 Ga0207664_100487584 184
647 3300025929 Ga0207664_10053650 Ga0207664_100536504 184
648 3300025929 Ga0207664_10169243 Ga0207664_101692432 184
649 3300025929 Ga0207664_10183898 Ga0207664_101838982 184
650 3300025931 Ga0207644_10001095 Ga0207644_100010953 184
651 3300025931 Ga0207644_10011130 Ga0207644_100111302 184
652 3300025931 Ga0207644_10024128 Ga0207644_100241284 184
653 3300025931 Ga0207644_10042480 Ga0207644_100424803 184
654 3300025931 Ga0207644_10065496 Ga0207644_100654964 184
655 3300025931 Ga0207644_10104742 Ga0207644_101047423 184
656 3300025931 Ga0207644_10114877 Ga0207644_101148773 184
657 3300025931 Ga0207644_10146890 Ga0207644_101468902 184
658 3300025931 Ga0207644_10231247 Ga0207644_102312472 184
659 3300025932 Ga0207690_10000204 Ga0207690_1000020410 184
660 3300025932 Ga0207690_10001036 Ga0207690_100010369 184
661 3300025932 Ga0207690_10001200 Ga0207690_1000120010 184
662 3300025932 Ga0207690_10004620 Ga0207690_100046204 184
663 3300025932 Ga0207690_10004691 Ga0207690_100046914 184
664 3300025932 Ga0207690_10006234 Ga0207690_100062344 184
665 3300025932 Ga0207690_10009194 Ga0207690_100091946 184
666 3300025932 Ga0207690_10045080 Ga0207690_100450802 184
667 3300025932 Ga0207690_10082255 Ga0207690_100822553 184
668 3300025932 Ga0207690_10124682 Ga0207690_101246821 184
669 3300025932 Ga0207690_10140683 Ga0207690_101406832 184
670 3300025932 Ga0207690_10240677 Ga0207690_102406772 184
671 3300025932 Ga0207690_10247024 Ga0207690_102470242 184
672 3300025932 Ga0207690_10639104 Ga0207690_106391042 184
673 3300025933 Ga0207706_10001066 Ga0207706_1000106610 184
674 3300025933 Ga0207706_10003811 Ga0207706_100038113 184
675 3300025933 Ga0207706_10011697 Ga0207706_100116979 184
676 3300025933 Ga0207706_10013529 Ga0207706_100135296 184
677 3300025933 Ga0207706_10014742 Ga0207706_100147426 184
678 3300025933 Ga0207706_10020950 Ga0207706_100209506 184
679 3300025933 Ga0207706_10027801 Ga0207706_100278014 184
680 3300025933 Ga0207706_10049237 Ga0207706_100492373 184
681 3300025933 Ga0207706_10057218 Ga0207706_100572184 184
682 3300025933 Ga0207706_10067721 Ga0207706_100677213 184
683 3300025933 Ga0207706_10128390 Ga0207706_101283902 184
684 3300025933 Ga0207706_10313763 Ga0207706_103137634 184
685 3300025933 Ga0207706_10709315 Ga0207706_107093151 184
686 3300025933 Ga0207706_11128540 Ga0207706_111285401 184
687 3300025934 Ga0207686_10261934 Ga0207686_102619343 184
688 3300025935 Ga0207709_10057435 Ga0207709_100574351 184
689 3300025935 Ga0207709_10075505 Ga0207709_100755053 184
690 3300025935 Ga0207709_10259946 Ga0207709_102599462 184
691 3300025935 Ga0207709_10863405 Ga0207709_108634051 184
692 3300025937 Ga0207669_10223998 Ga0207669_102239981 184
693 3300025937 Ga0207669_10247392 Ga0207669_102473922 184
694 3300025937 Ga0207669_10311684 Ga0207669_103116842 184
695 3300025938 Ga0207704_10172163 Ga0207704_101721633 184
696 3300025938 Ga0207704_10225745 Ga0207704_102257451 184
697 3300025939 Ga0207665_10076169 Ga0207665_100761692 184
698 3300025940 Ga0207691_10006235 Ga0207691_100062354 184
699 3300025940 Ga0207691_10017231 Ga0207691_100172314 184
700 3300025940 Ga0207691_10049185 Ga0207691_100491854 184
701 3300025940 Ga0207691_10054088 Ga0207691_100540881 184
702 3300025940 Ga0207691_10112350 Ga0207691_101123504 184
703 3300025940 Ga0207691_10309335 Ga0207691_103093353 184
704 3300025940 Ga0207691_10366380 Ga0207691_103663802 184
705 3300025941 Ga0207711_10000423 Ga0207711_1000042339 184
706 3300025941 Ga0207711_10000510 Ga0207711_1000051014 184
707 3300025941 Ga0207711_10001789 Ga0207711_1000178911 184
708 3300025941 Ga0207711_10003889 Ga0207711_100038896 184
709 3300025941 Ga0207711_10004718 Ga0207711_100047188 184
710 3300025941 Ga0207711_10005386 Ga0207711_100053865 184
711 3300025941 Ga0207711_10054943 Ga0207711_100549432 184
712 3300025941 Ga0207711_10073390 Ga0207711_100733904 184
713 3300025942 Ga0207689_10006231 Ga0207689_100062316 184
714 3300025942 Ga0207689_10006847 Ga0207689_100068474 184
715 3300025944 Ga0207661_10002283 Ga0207661_100022834 184
716 3300025944 Ga0207661_10005249 Ga0207661_100052497 184
717 3300025944 Ga0207661_10005485 Ga0207661_100054858 184
718 3300025944 Ga0207661_10025939 Ga0207661_100259394 184
719 3300025944 Ga0207661_10034241 Ga0207661_100342412 184
720 3300025944 Ga0207661_10286216 Ga0207661_102862162 184
721 3300025945 Ga0207679_10000147 Ga0207679_100001475 184
722 3300025945 Ga0207679_10001091 Ga0207679_1000109117 184
723 3300025945 Ga0207679_10010926 Ga0207679_100109262 184
724 3300025945 Ga0207679_10013308 Ga0207679_100133083 184
725 3300025945 Ga0207679_10021091 Ga0207679_100210913 184
726 3300025945 Ga0207679_10042476 Ga0207679_100424763 184
727 3300025945 Ga0207679_10078653 Ga0207679_100786533 184
728 3300025945 Ga0207679_10102645 Ga0207679_101026454 184
729 3300025945 Ga0207679_10112165 Ga0207679_101121654 184
730 3300025945 Ga0207679_10113610 Ga0207679_101136102 184
731 3300025945 Ga0207679_10129648 Ga0207679_101296483 184
732 3300025949 Ga0207667_10002809 Ga0207667_1000280910 184
733 3300025949 Ga0207667_10004972 Ga0207667_1000497210 184
734 3300025949 Ga0207667_10018739 Ga0207667_100187393 184
735 3300025949 Ga0207667_10018797 Ga0207667_100187975 184
736 3300025949 Ga0207667_10038296 Ga0207667_100382965 184
737 3300025949 Ga0207667_10075733 Ga0207667_100757334 184
738 3300025949 Ga0207667_10091066 Ga0207667_100910664 184
739 3300025949 Ga0207667_10141128 Ga0207667_101411282 184
740 3300025949 Ga0207667_10219386 Ga0207667_102193863 184
741 3300025949 Ga0207667_10395869 Ga0207667_103958693 184
742 3300025949 Ga0207667_10490549 Ga0207667_104905493 184
743 3300025949 Ga0207667_10522757 Ga0207667_105227573 184
744 3300025949 Ga0207667_11244095 Ga0207667_112440952 184
745 3300025960 Ga0207651_10004876 Ga0207651_100048764 184
746 3300025960 Ga0207651_10009499 Ga0207651_100094995 184
747 3300025960 Ga0207651_10061945 Ga0207651_100619453 184
748 3300025960 Ga0207651_10077547 Ga0207651_100775474 184
749 3300025960 Ga0207651_10316302 Ga0207651_103163022 184
750 3300025960 Ga0207651_10347443 Ga0207651_103474431 184
751 3300025960 Ga0207651_11012785 Ga0207651_110127851 184
752 3300025961 Ga0207712_10001340 Ga0207712_1000134011 184
753 3300025972 Ga0207668_10170457 Ga0207668_101704572 184
754 3300025972 Ga0207668_10218701 Ga0207668_102187012 184
755 3300025972 Ga0207668_10259968 Ga0207668_102599682 184
756 3300025972 Ga0207668_10566624 Ga0207668_105666242 184
757 3300025981 Ga0207640_10003858 Ga0207640_100038583 184
758 3300025981 Ga0207640_10004839 Ga0207640_100048398 184
759 3300025981 Ga0207640_10006312 Ga0207640_100063123 184
760 3300025981 Ga0207640_10015386 Ga0207640_100153864 184
761 3300025981 Ga0207640_10291996 Ga0207640_102919961 184
762 3300025981 Ga0207640_10358322 Ga0207640_103583222 184
763 3300025981 Ga0207640_10384397 Ga0207640_103843972 184
764 3300025981 Ga0207640_10399029 Ga0207640_103990292 184
765 3300025981 Ga0207640_10404201 Ga0207640_104042012 184
766 3300025986 Ga0207658_10006795 Ga0207658_100067956 184
767 3300025986 Ga0207658_10008361 Ga0207658_100083614 184
768 3300025986 Ga0207658_10020502 Ga0207658_100205024 184
769 3300025986 Ga0207658_10030809 Ga0207658_100308094 184
770 3300025986 Ga0207658_10057243 Ga0207658_100572433 184
771 3300025986 Ga0207658_10100890 Ga0207658_101008904 184
772 3300025986 Ga0207658_10198113 Ga0207658_101981133 184
773 3300025986 Ga0207658_10206692 Ga0207658_102066922 184
774 3300026023 Ga0207677_10001998 Ga0207677_1000199810 184
775 3300026023 Ga0207677_10054251 Ga0207677_100542512 184
776 3300026023 Ga0207677_10283264 Ga0207677_102832642 184
777 3300026023 Ga0207677_10285672 Ga0207677_102856722 184
778 3300026035 Ga0207703_10002144 Ga0207703_1000214415 184
779 3300026035 Ga0207703_10008978 Ga0207703_100089786 184
780 3300026035 Ga0207703_10026918 Ga0207703_100269184 184
781 3300026035 Ga0207703_10033974 Ga0207703_100339743 184
782 3300026035 Ga0207703_10055543 Ga0207703_100555435 184
783 3300026035 Ga0207703_10076090 Ga0207703_100760904 184
784 3300026035 Ga0207703_10098941 Ga0207703_100989414 184
785 3300026035 Ga0207703_10202561 Ga0207703_102025613 184
786 3300026041 Ga0207639_10000961 Ga0207639_1000096111 184
787 3300026041 Ga0207639_10002346 Ga0207639_100023465 184
788 3300026041 Ga0207639_10002382 Ga0207639_100023827 184
789 3300026041 Ga0207639_10032844 Ga0207639_100328444 184
790 3300026041 Ga0207639_10075393 Ga0207639_100753932 184
791 3300026041 Ga0207639_10149900 Ga0207639_101499003 184
792 3300026041 Ga0207639_10244977 Ga0207639_102449773 184
793 3300026041 Ga0207639_10260154 Ga0207639_102601543 184
794 3300026041 Ga0207639_10342251 Ga0207639_103422513 184
795 3300026041 Ga0207639_10485171 Ga0207639_104851712 184
796 3300026067 Ga0207678_10021310 Ga0207678_100213107 184
797 3300026067 Ga0207678_10027495 Ga0207678_100274954 184
798 3300026067 Ga0207678_10032729 Ga0207678_100327294 184
799 3300026067 Ga0207678_10055740 Ga0207678_100557403 184
800 3300026067 Ga0207678_10116562 Ga0207678_101165622 184
801 3300026067 Ga0207678_10392819 Ga0207678_103928192 184
802 3300026067 Ga0207678_10573065 Ga0207678_105730652 184
803 3300026078 Ga0207702_10000892 Ga0207702_1000089221 184
804 3300026078 Ga0207702_10013813 Ga0207702_100138138 184
805 3300026078 Ga0207702_10026871 Ga0207702_100268714 184
806 3300026078 Ga0207702_10094961 Ga0207702_100949614 184
807 3300026078 Ga0207702_11011785 Ga0207702_110117851 184
808 3300026078 Ga0207702_11080281 Ga0207702_110802812 184
809 3300026088 Ga0207641_10000042 Ga0207641_10000042137 184
810 3300026088 Ga0207641_10000175 Ga0207641_1000017539 184
811 3300026088 Ga0207641_10003100 Ga0207641_100031004 184
812 3300026088 Ga0207641_10089057 Ga0207641_100890574 184
813 3300026088 Ga0207641_10104150 Ga0207641_101041504 184
814 3300026088 Ga0207641_10133149 Ga0207641_101331494 184
815 3300026088 Ga0207641_10925185 Ga0207641_109251852 184
816 3300026089 Ga0207648_10039415 Ga0207648_100394152 184
817 3300026089 Ga0207648_10216962 Ga0207648_102169622 184
818 3300026089 Ga0207648_10254090 Ga0207648_102540902 184
819 3300026089 Ga0207648_10337437 Ga0207648_103374372 184
820 3300026089 Ga0207648_10367568 Ga0207648_103675682 184
821 3300026095 Ga0207676_10000138 Ga0207676_1000013839 184
822 3300026095 Ga0207676_10124656 Ga0207676_101246564 184
823 3300026095 Ga0207676_10129744 Ga0207676_101297442 184
824 3300026095 Ga0207676_10278613 Ga0207676_102786132 184
825 3300026116 Ga0207674_10000082 Ga0207674_100000824 184
826 3300026116 Ga0207674_10005334 Ga0207674_1000533413 184
827 3300026116 Ga0207674_10005456 Ga0207674_100054564 184
828 3300026116 Ga0207674_10007818 Ga0207674_1000781810 184
829 3300026116 Ga0207674_10020368 Ga0207674_100203686 184
830 3300026116 Ga0207674_10024437 Ga0207674_100244377 184
831 3300026116 Ga0207674_10088867 Ga0207674_100888672 184
832 3300026116 Ga0207674_10355587 Ga0207674_103555872 184
833 3300026118 Ga0207675_100143816 Ga0207675_1001438162 184
834 3300026118 Ga0207675_100808542 Ga0207675_1008085422 184
835 3300026121 Ga0207683_10005277 Ga0207683_1000527710 184
836 3300026121 Ga0207683_10028509 Ga0207683_100285094 184
837 3300026121 Ga0207683_10038452 Ga0207683_100384522 184
838 3300026121 Ga0207683_10190588 Ga0207683_101905884 184
839 3300026121 Ga0207683_10423542 Ga0207683_104235423 184
840 3300026142 Ga0207698_10000706 Ga0207698_1000070621 184
841 3300026142 Ga0207698_10000785 Ga0207698_100007858 184
842 3300026142 Ga0207698_10002760 Ga0207698_100027608 184
843 3300026142 Ga0207698_10004846 Ga0207698_100048464 184
844 3300026142 Ga0207698_10007271 Ga0207698_100072717 184
845 3300026142 Ga0207698_10020309 Ga0207698_100203094 184
846 3300026142 Ga0207698_10078952 Ga0207698_100789523 184
847 3300026142 Ga0207698_10145574 Ga0207698_101455742 184
848 3300026142 Ga0207698_10621439 Ga0207698_106214392 184
849 3300026142 Ga0207698_10863475 Ga0207698_108634752 184
850 3300028379 Ga0268266_10002247 Ga0268266_1000224721 184
851 3300028379 Ga0268266_10011079 Ga0268266_1001107910 184
852 3300028379 Ga0268266_10012344 Ga0268266_100123448 184
853 3300028379 Ga0268266_10045675 Ga0268266_100456752 184
854 3300028380 Ga0268265_10001694 Ga0268265_1000169410 184
855 3300028380 Ga0268265_10006936 Ga0268265_100069364 184
856 3300028380 Ga0268265_10435342 Ga0268265_104353422 184
857 3300028380 Ga0268265_11149006 Ga0268265_111490061 184
858 3300028381 Ga0268264_10000134 Ga0268264_10000134131 184
859 3300028381 Ga0268264_10000932 Ga0268264_1000093212 184
860 3300028381 Ga0268264_10001130 Ga0268264_1000113011 184
861 3300028381 Ga0268264_10033615 Ga0268264_100336151 184
862 3300031456 Ga0307513_10073272 Ga0307513_100732724 184
863 3300031548 Ga0307408_100008664 Ga0307408_1000086646 184
864 3300031548 Ga0307408_100011392 Ga0307408_1000113926 184
865 3300031548 Ga0307408_100015638 Ga0307408_1000156383 184
866 3300031548 Ga0307408_100154998 Ga0307408_1001549981 184
867 3300031731 Ga0307405_10011297 Ga0307405_100112976 184
868 3300031731 Ga0307405_10028240 Ga0307405_100282402 184
869 3300031731 Ga0307405_10072549 Ga0307405_100725494 184
870 3300031731 Ga0307405_10108974 Ga0307405_101089742 184
871 3300031731 Ga0307405_10135162 Ga0307405_101351622 184
872 3300031731 Ga0307405_10663118 Ga0307405_106631181 184
873 3300031824 Ga0307413_10000908 Ga0307413_100009086 184
874 3300031824 Ga0307413_10003272 Ga0307413_100032726 184
875 3300031824 Ga0307413_10029705 Ga0307413_100297053 184
876 3300031824 Ga0307413_10045246 Ga0307413_100452462 184
877 3300031824 Ga0307413_10060865 Ga0307413_100608652 184
878 3300031824 Ga0307413_10093028 Ga0307413_100930283 184
879 3300031824 Ga0307413_10210556 Ga0307413_102105564 184
880 3300031824 Ga0307413_10322457 Ga0307413_103224572 184
881 3300031824 Ga0307413_10575750 Ga0307413_105757501 184
882 3300031852 Ga0307410_10001686 Ga0307410_100016865 184
883 3300031852 Ga0307410_10005106 Ga0307410_100051069 184
884 3300031852 Ga0307410_10006358 Ga0307410_100063584 184
885 3300031852 Ga0307410_10007053 Ga0307410_100070536 184
886 3300031852 Ga0307410_10009075 Ga0307410_100090754 184
887 3300031852 Ga0307410_10049525 Ga0307410_100495254 184
888 3300031852 Ga0307410_10054949 Ga0307410_100549493 184
889 3300031852 Ga0307410_10094154 Ga0307410_100941543 184
890 3300031852 Ga0307410_10213053 Ga0307410_102130532 184
891 3300031852 Ga0307410_10316899 Ga0307410_103168993 184
892 3300031852 Ga0307410_10353767 Ga0307410_103537673 184
893 3300031852 Ga0307410_10765455 Ga0307410_107654551 184
894 3300031901 Ga0307406_10021176 Ga0307406_100211763 184
895 3300031901 Ga0307406_10025265 Ga0307406_100252654 184
896 3300031901 Ga0307406_10050341 Ga0307406_100503412 184
897 3300031901 Ga0307406_10121906 Ga0307406_101219062 184
898 3300031901 Ga0307406_10182814 Ga0307406_101828143 184
899 3300031901 Ga0307406_10266238 Ga0307406_102662382 184
900 3300031903 Ga0307407_10004156 Ga0307407_100041566 184
901 3300031903 Ga0307407_10014436 Ga0307407_100144364 184
902 3300031903 Ga0307407_10083078 Ga0307407_100830783 184
903 3300031903 Ga0307407_10085581 Ga0307407_100855814 184
904 3300031903 Ga0307407_10212044 Ga0307407_102120442 184
905 3300031911 Ga0307412_10013460 Ga0307412_100134602 184
906 3300031911 Ga0307412_10026247 Ga0307412_100262473 184
907 3300031911 Ga0307412_10077657 Ga0307412_100776573 184
908 3300031911 Ga0307412_10406584 Ga0307412_104065842 184
909 3300031911 Ga0307412_10416414 Ga0307412_104164143 184
910 3300031911 Ga0307412_10772358 Ga0307412_107723582 184
911 3300031911 Ga0307412_10900016 Ga0307412_109000161 184
912 3300031995 Ga0307409_100002023 Ga0307409_1000020235 184
913 3300031995 Ga0307409_100010697 Ga0307409_1000106975 184
914 3300031995 Ga0307409_100019598 Ga0307409_1000195983 184
915 3300031995 Ga0307409_100037622 Ga0307409_1000376224 184
916 3300031995 Ga0307409_100052196 Ga0307409_1000521963 184
917 3300031995 Ga0307409_100058181 Ga0307409_1000581813 184
918 3300031995 Ga0307409_100072897 Ga0307409_1000728974 184
919 3300031995 Ga0307409_100089539 Ga0307409_1000895394 184
920 3300031995 Ga0307409_100102910 Ga0307409_1001029102 184
921 3300031995 Ga0307409_100205677 Ga0307409_1002056774 184
922 3300031995 Ga0307409_100264499 Ga0307409_1002644992 184
923 3300031995 Ga0307409_100335513 Ga0307409_1003355132 184
924 3300031995 Ga0307409_100398217 Ga0307409_1003982172 184
925 3300031995 Ga0307409_100563513 Ga0307409_1005635132 184
926 3300031995 Ga0307409_100656167 Ga0307409_1006561672 184
927 3300032002 Ga0307416_100033185 Ga0307416_1000331855 184
928 3300032002 Ga0307416_100076914 Ga0307416_1000769143 184
929 3300032002 Ga0307416_100077141 Ga0307416_1000771414 184
930 3300032002 Ga0307416_100154497 Ga0307416_1001544973 184
931 3300032002 Ga0307416_100542795 Ga0307416_1005427952 184
932 3300032004 Ga0307414_10014872 Ga0307414_100148724 184
933 3300032004 Ga0307414_10022301 Ga0307414_100223014 184
934 3300032004 Ga0307414_10022482 Ga0307414_100224824 184
935 3300032004 Ga0307414_10029969 Ga0307414_100299693 184
936 3300032004 Ga0307414_10046272 Ga0307414_100462723 184
937 3300032004 Ga0307414_10063291 Ga0307414_100632911 184
938 3300032004 Ga0307414_10234686 Ga0307414_102346863 184
939 3300032004 Ga0307414_10303597 Ga0307414_103035972 184
940 3300032004 Ga0307414_10638649 Ga0307414_106386492 184
941 3300032005 Ga0307411_10001268 Ga0307411_100012686 184
942 3300032005 Ga0307411_10002560 Ga0307411_100025604 184
943 3300032005 Ga0307411_10020983 Ga0307411_100209833 184
944 3300032005 Ga0307411_10024507 Ga0307411_100245075 184
945 3300032005 Ga0307411_10029823 Ga0307411_100298233 184
946 3300032005 Ga0307411_10039321 Ga0307411_100393211 184
947 3300032005 Ga0307411_10054003 Ga0307411_100540034 184
948 3300032005 Ga0307411_10065030 Ga0307411_100650301 184
949 3300032005 Ga0307411_10101065 Ga0307411_101010654 184
950 3300032005 Ga0307411_10107929 Ga0307411_101079292 184
951 3300032005 Ga0307411_10164379 Ga0307411_101643792 184
952 3300032005 Ga0307411_10486228 Ga0307411_104862281 184
953 3300032126 Ga0307415_100009209 Ga0307415_1000092095 184
954 3300032126 Ga0307415_100027343 Ga0307415_1000273435 184
955 3300032126 Ga0307415_100144428 Ga0307415_1001444282 184
956 3300032126 Ga0307415_100385488 Ga0307415_1003854882 184
957 3300032126 Ga0307415_100592962 Ga0307415_1005929622 184
958 3300032126 Ga0307415_100963601 Ga0307415_1009636012 184
959 3300032126 Ga0307415_101044604 Ga0307415_1010446042 184
960 3300035088 Ga0373940_0034525 Ga0373940_0034525_631_1197 184
961 3300035115 Ga0373941_0115583 Ga0373941_0115583_363_929 184
962 3300035121 Ga0373960_0187544 Ga0373960_0187544_116_694 184
963 3300035170 Ga0373943_0251355 Ga0373943_0251355_294_860 184
964 3300035207 Ga0373942_0058358 Ga0373942_0058358_411_977 184
965 3300035242 Ga0373962_0022501 Ga0373962_0022501_973_1539 184
966 3300035691 Ga0373931_0020477 Ga0373931_0020477_169_735 184
967 3300037312 Ga0395899_0000684 Ga0395899_0000684_30237_30803 184
968 3300037312 Ga0395899_0002069 Ga0395899_0002069_2222_2788 184
969 3300037312 Ga0395899_0005031 Ga0395899_0005031_4198_4764 184
970 3300037312 Ga0395899_0007075 Ga0395899_0007075_6748_7314 184
971 3300037312 Ga0395899_0016419 Ga0395899_0016419_1142_1708 184
972 3300037312 Ga0395899_0026380 Ga0395899_0026380_475_1041 184
973 3300037312 Ga0395899_0066576 Ga0395899_0066576_600_1166 184
974 3300037312 Ga0395899_0066592 Ga0395899_0066592_572_1138 184
975 3300037312 Ga0395899_0081542 Ga0395899_0081542_1372_1938 184
976 3300037312 Ga0395899_0112997 Ga0395899_0112997_1032_1598 184
977 3300037312 Ga0395899_0161007 Ga0395899_0161007_903_1469 184
978 3300037312 Ga0395899_0175615 Ga0395899_0175615_816_1382 184
979 3300037312 Ga0395899_0258777 Ga0395899_0258777_200_766 184
980 3300037312 Ga0395899_0301197 Ga0395899_0301197_100_666 184
981 3300037312 Ga0395899_0305868 Ga0395899_0305868_437_1003 184
982 3300037312 Ga0395899_0338546 Ga0395899_0338546_313_879 184
983 3300037312 Ga0395899_0365777 Ga0395899_0365777_30_596 184
984 3300037312 Ga0395899_0419276 Ga0395899_0419276_124_690 184
985 3300037418 Ga0395900_0000405 Ga0395900_0000405_48588_49154 184
986 3300037418 Ga0395900_0001333 Ga0395900_0001333_5904_6470 184
987 3300037418 Ga0395900_0003891 Ga0395900_0003891_5796_6362 184
988 3300037418 Ga0395900_0010189 Ga0395900_0010189_3295_3861 184
989 3300037418 Ga0395900_0011820 Ga0395900_0011820_6823_7389 184
990 3300037418 Ga0395900_0015989 Ga0395900_0015989_6384_6950 184
991 3300037418 Ga0395900_0025818 Ga0395900_0025818_3866_4432 184
992 3300037418 Ga0395900_0031705 Ga0395900_0031705_1581_2147 184
993 3300037418 Ga0395900_0046010 Ga0395900_0046010_2489_3055 184
994 3300037418 Ga0395900_0056076 Ga0395900_0056076_1991_2557 184
995 3300037418 Ga0395900_0069396 Ga0395900_0069396_2666_3232 184
996 3300037418 Ga0395900_0086363 Ga0395900_0086363_1236_1802 184
997 3300037418 Ga0395900_0091220 Ga0395900_0091220_1074_1640 184
998 3300037418 Ga0395900_0192240 Ga0395900_0192240_1454_2020 184
999 3300037418 Ga0395900_0212398 Ga0395900_0212398_511_1077 184
1000 3300037418 Ga0395900_0305529 Ga0395900_0305529_573_1139 184
1001 3300037418 Ga0395900_0337303 Ga0395900_0337303_885_1451 184
1002 3300037418 Ga0395900_0416677 Ga0395900_0416677_452_1018 184
1003 3300037418 Ga0395900_0709102 Ga0395900_0709102_274_840 184
1004 3300037418 Ga0395900_0816089 Ga0395900_0816089_46_624 184
1005 3300037418 Ga0395900_0896221 Ga0395900_0896221_198_764 184
1006 3300037418 Ga0395900_1073621 Ga0395900_1073621_73_639 184
1007 3300037418 Ga0395900_1315721 Ga0395900_1315721_49_615 184
1008 3300037466 Ga0395898_0000856 Ga0395898_0000856_12162_12728 184
1009 3300037466 Ga0395898_0003285 Ga0395898_0003285_7527_8093 184
1010 3300037466 Ga0395898_0005062 Ga0395898_0005062_2638_3204 184
1011 3300037466 Ga0395898_0010431 Ga0395898_0010431_4103_4669 184
1012 3300037466 Ga0395898_0015591 Ga0395898_0015591_6744_7310 184
1013 3300037466 Ga0395898_0023812 Ga0395898_0023812_1619_2185 184
1014 3300037466 Ga0395898_0088780 Ga0395898_0088780_800_1366 184
1015 3300037466 Ga0395898_0097474 Ga0395898_0097474_556_1122 184
1016 3300037466 Ga0395898_0121323 Ga0395898_0121323_404_970 184
1017 3300037466 Ga0395898_0157439 Ga0395898_0157439_72_638 184
1018 3300037466 Ga0395898_0222645 Ga0395898_0222645_623_1189 184
1019 3300037466 Ga0395898_0377267 Ga0395898_0377267_53_619 184
1020 3300037466 Ga0395898_0392308 Ga0395898_0392308_225_791 184
1021 3300037471 Ga0395905_0000756 Ga0395905_0000756_6336_6902 184
1022 3300037471 Ga0395905_0001965 Ga0395905_0001965_16566_17132 184
1023 3300037471 Ga0395905_0002309 Ga0395905_0002309_8677_9243 184
1024 3300037471 Ga0395905_0006834 Ga0395905_0006834_5113_5679 184
1025 3300037471 Ga0395905_0012503 Ga0395905_0012503_5751_6317 184
1026 3300037471 Ga0395905_0018156 Ga0395905_0018156_2100_2666 184
1027 3300037471 Ga0395905_0037822 Ga0395905_0037822_2516_3082 184
1028 3300037471 Ga0395905_0047727 Ga0395905_0047727_1913_2479 184
1029 3300037471 Ga0395905_0076689 Ga0395905_0076689_2304_2870 184
1030 3300037471 Ga0395905_0080402 Ga0395905_0080402_1429_2007 184
1031 3300037471 Ga0395905_0097433 Ga0395905_0097433_1517_2083 184
1032 3300037471 Ga0395905_0115842 Ga0395905_0115842_680_1246 184
1033 3300037471 Ga0395905_0123520 Ga0395905_0123520_512_1078 184
1034 3300037471 Ga0395905_0133946 Ga0395905_0133946_61_627 184
1035 3300037471 Ga0395905_0167702 Ga0395905_0167702_874_1440 184
1036 3300037471 Ga0395905_0189282 Ga0395905_0189282_294_860 184
1037 3300037471 Ga0395905_0210288 Ga0395905_0210288_72_638 184
1038 3300037471 Ga0395905_0236454 Ga0395905_0236454_572_1138 184
1039 3300037471 Ga0395905_0246686 Ga0395905_0246686_742_1308 184
1040 3300037471 Ga0395905_0246886 Ga0395905_0246886_85_663 184
1041 3300037471 Ga0395905_0279511 Ga0395905_0279511_361_927 184
1042 3300037471 Ga0395905_0396025 Ga0395905_0396025_224_790 184
1043 3300037471 Ga0395905_0398312 Ga0395905_0398312_438_1004 184
1044 3300037471 Ga0395905_0402165 Ga0395905_0402165_364_930 184
1045 3300037471 Ga0395905_0481420 Ga0395905_0481420_399_965 184
1046 3300037471 Ga0395905_0493154 Ga0395905_0493154_127_693 184
1047 3300037471 Ga0395905_0541176 Ga0395905_0541176_116_682 184
1048 3300037471 Ga0395905_1040617 Ga0395905_1040617_107_685 184
1049 3300038443 Ga0395901_0000168 Ga0395901_0000168_81963_82529 184
1050 3300038443 Ga0395901_0001266 Ga0395901_0001266_21685_22251 184
1051 3300038443 Ga0395901_0003939 Ga0395901_0003939_3503_4069 184
1052 3300038443 Ga0395901_0010867 Ga0395901_0010867_59_625 184
1053 3300038443 Ga0395901_0014130 Ga0395901_0014130_1670_2236 184
1054 3300038443 Ga0395901_0021538 Ga0395901_0021538_5774_6340 184
1055 3300038443 Ga0395901_0024789 Ga0395901_0024789_3321_3887 184
1056 3300038443 Ga0395901_0027469 Ga0395901_0027469_2061_2627 184
1057 3300038443 Ga0395901_0051634 Ga0395901_0051634_354_920 184
1058 3300038443 Ga0395901_0057401 Ga0395901_0057401_50_616 184
1059 3300038443 Ga0395901_0085952 Ga0395901_0085952_1712_2278 184
1060 3300038443 Ga0395901_0088711 Ga0395901_0088711_1095_1661 184
1061 3300038443 Ga0395901_0222910 Ga0395901_0222910_266_832 184
1062 3300038443 Ga0395901_0232935 Ga0395901_0232935_1094_1660 184
1063 3300038443 Ga0395901_0348916 Ga0395901_0348916_204_770 184
1064 3300038443 Ga0395901_0365333 Ga0395901_0365333_526_1092 184
1065 3300038443 Ga0395901_0369545 Ga0395901_0369545_133_699 184
1066 3300038443 Ga0395901_0535849 Ga0395901_0535849_456_1022 184
1067 3300038443 Ga0395901_0551573 Ga0395901_0551573_571_1149 184
1068 3300038443 Ga0395901_0554923 Ga0395901_0554923_577_1143 184
1069 3300038443 Ga0395901_0609519 Ga0395901_0609519_124_690 184
1070 3300038443 Ga0395901_0633558 Ga0395901_0633558_72_638 184
1071 3300038443 Ga0395901_0716914 Ga0395901_0716914_308_874 184
1072 3300038443 Ga0395901_0819126 Ga0395901_0819126_82_648 184
1073 3300038443 Ga0395901_1611338 Ga0395901_1611338_22_588 184
1074 3300039437 Ga0436365_0440923 Ga0436365_0440923_12506_13084 184
1075 3300041501 Ga0451845_0434811 Ga0451845_0434811_41_646 184
1076 3300042005 Ga0439448_0060260 Ga0439448_0060260_524_1090 184
1077 3300042006 Ga0439432_090244 Ga0439432_090244_64_630 184
1078 3300042157 Ga0439458_0002529 Ga0439458_0002529_3323_3889 184
1079 3300042157 Ga0439458_0013319 Ga0439458_0013319_1099_1665 184
1080 3300042439 Ga0439464_0000045 Ga0439464_0000045_3321_3887 184
1081 3300042461 Ga0439460_0062825 Ga0439460_0062825_11_577 184
1082 3300042876 Ga0451577_0362075 Ga0451577_0362075_322_900 184
1083 3300044656 Ga0466969_0139186 Ga0466969_0139186_69_635 184
1084 3300044658 Ga0466972_0037839 Ga0466972_0037839_1002_1568 184
1085 3300044658 Ga0466972_0056145 Ga0466972_0056145_770_1336 184
1086 3300044658 Ga0466972_0119071 Ga0466972_0119071_271_837 184
1087 3300044683 Ga0466965_0193078 Ga0466965_0193078_185_751 184
1088 3300044684 Ga0466966_0040985 Ga0466966_0040985_1507_2073 184
1089 3300044684 Ga0466966_0054688 Ga0466966_0054688_1156_1722 184
1090 3300044684 Ga0466966_0086845 Ga0466966_0086845_196_762 184
1091 3300044693 Ga0466961_0049227 Ga0466961_0049227_993_1559 184
1092 3300044694 Ga0466963_0011241 Ga0466963_0011241_4396_4974 184
1093 3300044694 Ga0466963_0021746 Ga0466963_0021746_802_1368 184
1094 3300044694 Ga0466963_0025341 Ga0466963_0025341_2658_3224 184
1095 3300044694 Ga0466963_0034639 Ga0466963_0034639_2688_3254 184
1096 3300044694 Ga0466963_0055329 Ga0466963_0055329_1220_1786 184
1097 3300044694 Ga0466963_0063809 Ga0466963_0063809_479_1045 184
1098 3300044694 Ga0466963_0193726 Ga0466963_0193726_414_980 184
1099 3300044706 Ga0466964_0160837 Ga0466964_0160837_471_1037 184
1100 3300044706 Ga0466964_0196738 Ga0466964_0196738_119_685 184
1101 3300044712 Ga0453684_0934325 Ga0453684_0934325_61_639 184
1102 3300044719 Ga0466971_0006570 Ga0466971_0006570_705_1283 184
1103 3300044719 Ga0466971_0099490 Ga0466971_0099490_70_636 184
1104 3300044765 Ga0466970_0039464 Ga0466970_0039464_1912_2478 184
1105 3300044765 Ga0466970_0070703 Ga0466970_0070703_611_1177 184
1106 3300044842 Ga0466957_0002638 Ga0466957_0002638_3379_3957 184
1107 3300044842 Ga0466957_0020439 Ga0466957_0020439_2006_2572 184
1108 3300044842 Ga0466957_0039933 Ga0466957_0039933_1328_1894 184
1109 3300044842 Ga0466957_0077721 Ga0466957_0077721_705_1271 184
1110 3300044842 Ga0466957_0341808 Ga0466957_0341808_23_589 184
1111 3300044842 Ga0466957_0489300 Ga0466957_0489300_128_694 184
1112 3300044901 Ga0466960_0078573 Ga0466960_0078573_139_705 184
1113 3300044901 Ga0466960_0091205 Ga0466960_0091205_620_1186 184
1114 3300045049 Ga0466959_0034665 Ga0466959_0034665_2526_3092 184
1115 3300045049 Ga0466959_0041415 Ga0466959_0041415_1587_2153 184
1116 3300045049 Ga0466959_0263373 Ga0466959_0263373_236_802 184
1117 3300045049 Ga0466959_0507577 Ga0466959_0507577_217_783 184
1118 3300045049 Ga0466959_0531777 Ga0466959_0531777_32_598 184
1119 3300045836 Ga0466958_0008889 Ga0466958_0008889_448_1014 184
1120 3300045836 Ga0466958_0011120 Ga0466958_0011120_474_1052 184
1121 3300045836 Ga0466958_0066831 Ga0466958_0066831_988_1554 184
1122 3300045836 Ga0466958_0436178 Ga0466958_0436178_213_791 184
1123 3300045836 Ga0466958_0565120 Ga0466958_0565120_20_586 184
1124 3300045976 Ga0466967_0013943 Ga0466967_0013943_1263_1841 184
1125 3300045976 Ga0466967_0026203 Ga0466967_0026203_806_1372 184
1126 3300045976 Ga0466967_0046618 Ga0466967_0046618_2666_3232 184
1127 3300045976 Ga0466967_0047532 Ga0466967_0047532_631_1197 184
1128 3300045976 Ga0466967_0057413 Ga0466967_0057413_2114_2680 184
1129 3300045976 Ga0466967_0072683 Ga0466967_0072683_1112_1678 184
1130 3300045976 Ga0466967_0303202 Ga0466967_0303202_516_1082 184
1131 3300045976 Ga0466967_0512433 Ga0466967_0512433_29_595 184
1132 3300045976 Ga0466967_0586350 Ga0466967_0586350_392_958 184
1133 3300045976 Ga0466967_1096626 Ga0466967_1096626_191_757 184
1134 3300045976 Ga0466967_1371498 Ga0466967_1371498_44_610 184
1135 3300046473 Ga0495582_0159187 Ga0495582_0159187_102_668 184
1136 3300046492 Ga0495585_0066722 Ga0495585_0066722_237_803 184
1137 3300046500 Ga0495596_0081306 Ga0495596_0081306_421_987 184
1138 3300046519 Ga0495632_0365567 Ga0495632_0365567_37_603 184
1139 3300046522 Ga0495643_0136097 Ga0495643_0136097_540_1106 184
1140 3300046525 Ga0495663_0091895 Ga0495663_0091895_320_886 184
1141 3300046528 Ga0495642_0052850 Ga0495642_0052850_922_1488 184
1142 3300046537 Ga0495598_0212246 Ga0495598_0212246_42_620 184
1143 3300046539 Ga0495621_0066705 Ga0495621_0066705_196_762 184
1144 3300046539 Ga0495621_0116168 Ga0495621_0116168_104_670 184
1145 3300046557 Ga0495622_0033798 Ga0495622_0033798_1666_2253 184
1146 3300046558 Ga0495633_0056823 Ga0495633_0056823_299_865 184
1147 3300046616 Ga0495668_0008633 Ga0495668_0008633_229_795 184
1148 3300046616 Ga0495668_0030101 Ga0495668_0030101_1786_2352 184
1149 3300046684 Ga0495669_0000354 Ga0495669_0000354_19592_20158 184
1150 3300046684 Ga0495669_0033958 Ga0495669_0033958_1125_1703 184
1151 3300046684 Ga0495669_0111038 Ga0495669_0111038_130_708 184
1152 3300046684 Ga0495669_0211208 Ga0495669_0211208_294_872 184
1153 3300046691 Ga0495670_0162918 Ga0495670_0162918_201_767 184
1154 3300046691 Ga0495670_0195507 Ga0495670_0195507_458_1024 184
1155 3300046692 Ga0495671_0010652 Ga0495671_0010652_3140_3727 184
1156 3300047445 Ga0495677_0020757 Ga0495677_0020757_1346_1912 184
1157 3300047445 Ga0495677_0045608 Ga0495677_0045608_490_1056 184
1158 3300047445 Ga0495677_0082249 Ga0495677_0082249_546_1112 184
1159 3300048090 Ga0495615_0012080 Ga0495615_0012080_901_1467 184
1160 3300048903 Ga0496100_0206331 Ga0496100_0206331_466_1032 184
1161 3300048904 Ga0496101_0022205 Ga0496101_0022205_904_1470 184
1162 3300048904 Ga0496101_0040490 Ga0496101_0040490_1492_2058 184
1163 3300048906 Ga0496103_0219780 Ga0496103_0219780_628_1194 184
1164 3300048906 Ga0496103_0234449 Ga0496103_0234449_92_679 184
1165 3300048908 Ga0496105_0000435 Ga0496105_0000435_7840_8430 184
1166 3300048908 Ga0496105_0097313 Ga0496105_0097313_1140_1706 184
1167 3300048908 Ga0496105_0237458 Ga0496105_0237458_534_1100 184
1168 3300048909 Ga0496106_0096024 Ga0496106_0096024_238_804 184
1169 3300048909 Ga0496106_0192080 Ga0496106_0192080_151_729 184
1170 3300048909 Ga0496106_0199859 Ga0496106_0199859_531_1097 184
1171 3300048910 Ga0496107_0000263 Ga0496107_0000263_13155_13721 184
1172 3300048910 Ga0496107_0008273 Ga0496107_0008273_923_1489 184
1173 3300048910 Ga0496107_0068237 Ga0496107_0068237_408_974 184
1174 3300048910 Ga0496107_0160890 Ga0496107_0160890_663_1229 184
1175 3300048910 Ga0496107_0179914 Ga0496107_0179914_517_1083 184
1176 3300048911 Ga0496108_0014814 Ga0496108_0014814_4340_4906 184
1177 3300048911 Ga0496108_0062546 Ga0496108_0062546_2466_3032 184
1178 3300048911 Ga0496108_0102507 Ga0496108_0102507_1275_1853 184
1179 3300048911 Ga0496108_0151901 Ga0496108_0151901_877_1443 184
1180 3300048912 Ga0496109_0004961 Ga0496109_0004961_2899_3465 184
1181 3300048912 Ga0496109_0239742 Ga0496109_0239742_501_1067 184
1182 3300048912 Ga0496109_0264122 Ga0496109_0264122_757_1323 184
1183 3300048913 Ga0496110_0001595 Ga0496110_0001595_14523_15101 184
1184 3300048913 Ga0496110_0015522 Ga0496110_0015522_198_764 184
1185 3300048913 Ga0496110_0142533 Ga0496110_0142533_1515_2081 184
1186 3300048913 Ga0496110_0157969 Ga0496110_0157969_556_1122 184
1187 3300048913 Ga0496110_0503416 Ga0496110_0503416_92_670 184
1188 3300048914 Ga0496111_0009204 Ga0496111_0009204_4822_5400 184
1189 3300048914 Ga0496111_0025156 Ga0496111_0025156_1565_2131 184
1190 3300048914 Ga0496111_0100321 Ga0496111_0100321_325_891 184
1191 3300048914 Ga0496111_0358757 Ga0496111_0358757_66_632 184
1192 3300048914 Ga0496111_0608774 Ga0496111_0608774_42_620 184
1193 3300048914 Ga0496111_0663225 Ga0496111_0663225_89_655 184
1194 3300048915 Ga0496112_0008615 Ga0496112_0008615_7316_7882 184
1195 3300048915 Ga0496112_0033735 Ga0496112_0033735_3057_3623 184
1196 3300048916 Ga0496113_0040760 Ga0496113_0040760_790_1356 184
1197 3300048916 Ga0496113_0065433 Ga0496113_0065433_1397_1963 184
1198 3300048916 Ga0496113_0112679 Ga0496113_0112679_1111_1677 184
1199 3300048917 Ga0496114_0000033 Ga0496114_0000033_61507_62073 184
1200 3300048917 Ga0496114_0034740 Ga0496114_0034740_2301_2867 184
1201 3300048920 Ga0496117_0273247 Ga0496117_0273247_212_802 184
1202 3300048921 Ga0496118_0112492 Ga0496118_0112492_55_645 184
1203 3300048924 Ga0496121_0000740 Ga0496121_0000740_44789_45379 184
1204 3300048928 Ga0496125_0219312 Ga0496125_0219312_535_1125 184
1205 3300049583 Ga0501067_0172796 Ga0501067_0172796_588_1154 184
1206 3300049587 Ga0501071_0060775 Ga0501071_0060775_1503_2069 184
1207 3300049590 Ga0501074_0008468 Ga0501074_0008468_1988_2554 184
1208 3300049661 Ga0501217_003013 Ga0501217_003013_2268_2834 184
1209 3300049664 Ga0501224_019296 Ga0501224_019296_31_597 184
1210 3300049665 Ga0501227_074734 Ga0501227_074734_113_679 184
1211 3300049668 Ga0501233_054676 Ga0501233_054676_156_722 184
1212 3300049674 Ga0501242_023740 Ga0501242_023740_170_736 184
1213 3300049679 Ga0501249_010567 Ga0501249_010567_903_1469 184
1214 3300049741 Ga0501079_0825967 Ga0501079_0825967_82_648 184
1215 3300049760 Ga0501263_007560 Ga0501263_007560_571_1137 184
1216 3300049767 Ga0501270_055016 Ga0501270_055016_38_604 184
1217 3300050491 nmdc:mga00v17_297873_c1 nmdc:mga00v17_297873_c1_366_932 184
1218 3300050510 nmdc:mga06r32_3622_c1 nmdc:mga06r32_3622_c1_9852_10418 184
1219 3300050513 nmdc:mga0rr50_82788_c1 nmdc:mga0rr50_82788_c1_223_789 184
1220 3300050515 nmdc:mga0a205_18103_c1 nmdc:mga0a205_18103_c1_128_694 184
1221 3300053083 Ga0495655_0118829 Ga0495655_0118829_17_583 184
1222 3300053134 Ga0500658_0000149 Ga0500658_0000149_26724_27290 184
1223 3300061719 Ga0466962_0006218 Ga0466962_0006218_2494_3060 184
1224 3300061719 Ga0466962_0009510 Ga0466962_0009510_1846_2412 184
1225 3300061719 Ga0466962_0164138 Ga0466962_0164138_400_978 184
1226 3300061719 Ga0466962_0244560 Ga0466962_0244560_248_814 184
1227 3300002067 JGI24735J21928_10010445 JGI24735J21928_100104455 185
1228 3300005327 Ga0070658_10693961 Ga0070658_106939611 185
1229 3300005329 Ga0070683_100024181 Ga0070683_1000241812 185
1230 3300005335 Ga0070666_10307055 Ga0070666_103070552 185
1231 3300005336 Ga0070680_100080932 Ga0070680_1000809325 185
1232 3300005339 Ga0070660_100080426 Ga0070660_1000804264 185
1233 3300005343 Ga0070687_100070364 Ga0070687_1000703643 185
1234 3300005344 Ga0070661_100184037 Ga0070661_1001840372 185
1235 3300005354 Ga0070675_100272924 Ga0070675_1002729242 185
1236 3300005354 Ga0070675_101148383 Ga0070675_1011483832 185
1237 3300005356 Ga0070674_100272652 Ga0070674_1002726521 185
1238 3300005434 Ga0070709_10071522 Ga0070709_100715222 185
1239 3300005435 Ga0070714_100005271 Ga0070714_10000527111 185
1240 3300005435 Ga0070714_100099909 Ga0070714_1000999092 185
1241 3300005455 Ga0070663_100160625 Ga0070663_1001606254 185
1242 3300005456 Ga0070678_100066889 Ga0070678_1000668892 185
1243 3300005457 Ga0070662_100056744 Ga0070662_1000567443 185
1244 3300005458 Ga0070681_10356227 Ga0070681_103562272 185
1245 3300005459 Ga0068867_100195273 Ga0068867_1001952733 185
1246 3300005530 Ga0070679_100182710 Ga0070679_1001827102 185
1247 3300005535 Ga0070684_100204392 Ga0070684_1002043924 185
1248 3300005535 Ga0070684_100349153 Ga0070684_1003491532 185
1249 3300005543 Ga0070672_100081851 Ga0070672_1000818514 185
1250 3300005545 Ga0070695_100086771 Ga0070695_1000867714 185
1251 3300005546 Ga0070696_100061030 Ga0070696_1000610302 185
1252 3300005564 Ga0070664_100041656 Ga0070664_1000416565 185
1253 3300005578 Ga0068854_100023236 Ga0068854_1000232366 185
1254 3300005616 Ga0068852_100161030 Ga0068852_1001610302 185
1255 3300005616 Ga0068852_101999943 Ga0068852_1019999431 185
1256 3300005834 Ga0068851_10076713 Ga0068851_100767132 185
1257 3300005841 Ga0068863_100176435 Ga0068863_1001764354 185
1258 3300005843 Ga0068860_100302584 Ga0068860_1003025842 185
1259 3300006028 Ga0070717_10188847 Ga0070717_101888472 185
1260 3300006173 Ga0070716_100165213 Ga0070716_1001652132 185
1261 3300006175 Ga0070712_100075616 Ga0070712_1000756162 185
1262 3300009094 Ga0111539_10023713 Ga0111539_100237134 185
1263 3300009551 Ga0105238_10931830 Ga0105238_109318302 185
1264 3300013100 Ga0157373_10082891 Ga0157373_100828914 185
1265 3300013102 Ga0157371_10332646 Ga0157371_103326462 185
1266 3300013102 Ga0157371_10365196 Ga0157371_103651962 185
1267 3300013104 Ga0157370_10275276 Ga0157370_102752763 185
1268 3300013105 Ga0157369_11353032 Ga0157369_113530321 185
1269 3300013307 Ga0157372_10429185 Ga0157372_104291852 185
1270 3300025893 Ga0207682_10008330 Ga0207682_100083304 185
1271 3300025904 Ga0207647_10007197 Ga0207647_100071977 185
1272 3300025909 Ga0207705_10047346 Ga0207705_100473464 185
1273 3300025912 Ga0207707_10719424 Ga0207707_107194241 185
1274 3300025915 Ga0207693_10158781 Ga0207693_101587812 185
1275 3300025917 Ga0207660_10119892 Ga0207660_101198922 185
1276 3300025917 Ga0207660_10591822 Ga0207660_105918222 185
1277 3300025919 Ga0207657_10028000 Ga0207657_100280005 185
1278 3300025919 Ga0207657_10056126 Ga0207657_100561263 185
1279 3300025919 Ga0207657_10058172 Ga0207657_100581724 185
1280 3300025929 Ga0207664_10145494 Ga0207664_101454943 185
1281 3300025929 Ga0207664_10635230 Ga0207664_106352302 185
1282 3300025931 Ga0207644_10000558 Ga0207644_100005582 185
1283 3300025931 Ga0207644_10004060 Ga0207644_100040609 185
1284 3300025932 Ga0207690_10268518 Ga0207690_102685181 185
1285 3300025933 Ga0207706_10062662 Ga0207706_100626623 185
1286 3300025937 Ga0207669_10075077 Ga0207669_100750773 185
1287 3300025939 Ga0207665_10029410 Ga0207665_100294104 185
1288 3300025941 Ga0207711_10000772 Ga0207711_1000077210 185
1289 3300025941 Ga0207711_10035624 Ga0207711_100356244 185
1290 3300025981 Ga0207640_10075918 Ga0207640_100759182 185
1291 3300026067 Ga0207678_10229361 Ga0207678_102293611 185
1292 3300026067 Ga0207678_10746110 Ga0207678_107461102 185
1293 3300026078 Ga0207702_10586322 Ga0207702_105863221 185
1294 3300026089 Ga0207648_10009361 Ga0207648_1000936111 185
1295 3300026116 Ga0207674_10079070 Ga0207674_100790703 185
1296 3300026142 Ga0207698_10397983 Ga0207698_103979832 185
1297 3300026142 Ga0207698_11342160 Ga0207698_113421602 185
1298 3300027907 Ga0207428_10409762 Ga0207428_104097622 185
1299 3300028380 Ga0268265_10033660 Ga0268265_100336602 185
1300 3300028381 Ga0268264_10051497 Ga0268264_100514975 185
1301 3300028381 Ga0268264_11113980 Ga0268264_111139801 185
1302 3300031548 Ga0307408_100358200 Ga0307408_1003582003 185
1303 3300031852 Ga0307410_10011831 Ga0307410_100118311 185
1304 3300031852 Ga0307410_11010455 Ga0307410_110104551 185
1305 3300031901 Ga0307406_10310439 Ga0307406_103104392 185
1306 3300031911 Ga0307412_10073188 Ga0307412_100731884 185
1307 3300031995 Ga0307409_100115351 Ga0307409_1001153512 185
1308 3300032004 Ga0307414_10450484 Ga0307414_104504843 185
1309 3300032005 Ga0307411_10011601 Ga0307411_100116013 185
1310 3300032005 Ga0307411_10061435 Ga0307411_100614353 185
1311 3300032005 Ga0307411_10130644 Ga0307411_101306444 185
1312 3300032126 Ga0307415_100196480 Ga0307415_1001964804 185
1313 3300032126 Ga0307415_100198219 Ga0307415_1001982192 185
1314 3300037068 Ga0373925_0290706 Ga0373925_0290706_288_857 185
1315 3300037418 Ga0395900_0103626 Ga0395900_0103626_1141_1710 185
1316 3300037471 Ga0395905_0004552 Ga0395905_0004552_799_1368 185
1317 3300037471 Ga0395905_0013837 Ga0395905_0013837_4794_5363 185
1318 3300037471 Ga0395905_1037034 Ga0395905_1037034_141_710 185
1319 3300038443 Ga0395901_0441341 Ga0395901_0441341_310_879 185
1320 3300042127 Ga0450890_002474 Ga0450890_002474_1807_2385 185
1321 3300042142 Ga0450905_000267 Ga0450905_000267_5106_5684 185
1322 3300042144 Ga0450889_000142 Ga0450889_000142_5242_5820 185
1323 3300044683 Ga0466965_0427902 Ga0466965_0427902_68_637 185
1324 3300044684 Ga0466966_0062865 Ga0466966_0062865_1034_1603 185
1325 3300045976 Ga0466967_0389109 Ga0466967_0389109_738_1307 185
1326 3300046537 Ga0495598_0000660 Ga0495598_0000660_5892_6473 185
1327 3300046539 Ga0495621_0004874 Ga0495621_0004874_149_730 185
1328 3300046684 Ga0495669_0014128 Ga0495669_0014128_2441_3022 185
1329 3300046691 Ga0495670_0001425 Ga0495670_0001425_8107_8688 185
1330 3300048905 Ga0496102_0122899 Ga0496102_0122899_82_651 185
1331 3300048906 Ga0496103_0079072 Ga0496103_0079072_1257_1826 185
1332 3300048910 Ga0496107_0271962 Ga0496107_0271962_544_1113 185
1333 3300048911 Ga0496108_0697408 Ga0496108_0697408_247_816 185
1334 3300048913 Ga0496110_0082787 Ga0496110_0082787_167_736 185
1335 3300048915 Ga0496112_0017222 Ga0496112_0017222_4740_5309 185
1336 3300048916 Ga0496113_0376635 Ga0496113_0376635_526_1095 185
1337 3300049675 Ga0501243_031240 Ga0501243_031240_135_704 185
1338 3300049704 Ga0501221_141452 Ga0501221_141452_14_583 185
1339 3300049770 Ga0501273_017659 Ga0501273_017659_169_738 185
1340 3300050511 nmdc:mga08y16_201554_c1 nmdc:mga08y16_201554_c1_703_1281 185
1341 3300053136 Ga0500559_0070886 Ga0500559_0070886_905_1504 185
1342 iso_pu_bacteria 2643221541 2643728160 185
1343 iso_pu_bacteria 2643221605 2644038871 185
1344 iso_pu_bacteria 2643221606 2644042891 185
1345 iso_pu_bacteria 2643221671 2644395678 185
1346 iso_pu_bacteria 2818991466 2819714274 185
1347 3300003215 JGI25153J46596_10004533 JGI25153J46596_1000453312 186
1348 3300003773 Ga0055537_1006712 Ga0055537_10067122 186
1349 3300003775 Ga0055524_1000030 Ga0055524_10000306 186
1350 3300003791 Ga0055530_10028094 Ga0055530_100280942 186
1351 3300003794 Ga0055531_10001371 Ga0055531_1000137112 186
1352 3300005262 Ga0065165_1002945 Ga0065165_10029456 186
1353 3300009101 Ga0105247_10278385 Ga0105247_102783852 186
1354 3300009148 Ga0105243_11287424 Ga0105243_112874241 186
1355 3300025245 Ga0207425_1018044 Ga0207425_10180442 186
1356 3300025263 Ga0209565_1000012 Ga0209565_1000012432 186
1357 3300025273 Ga0209673_1001810 Ga0209673_100181012 186
1358 3300025297 Ga0209758_1004619 Ga0209758_100461914 186
1359 3300025298 Ga0209050_1008559 Ga0209050_10085598 186
1360 3300025299 Ga0209256_1000012 Ga0209256_1000012623 186
1361 3300025304 Ga0209257_1003549 Ga0209257_10035494 186
1362 3300026075 Ga0207708_10348463 Ga0207708_103484632 186
1363 3300030733 Ga0314311_1260554 Ga0314311_12605542 186
1364 3300030745 Ga0316182_1276230 Ga0316182_12762301 186
1365 3300031901 Ga0307406_10121526 Ga0307406_101215262 186
1366 3300032004 Ga0307414_10000296 Ga0307414_100002964 186
1367 3300039437 Ga0436365_0522706 Ga0436365_0522706_379_966 186
1368 3300041410 Ga0439461_0000271 Ga0439461_0000271_3978_4556 186
1369 3300041413 Ga0439465_0001054 Ga0439465_0001054_3418_3996 186
1370 3300041997 Ga0439431_0000566 Ga0439431_0000566_4859_5437 186
1371 3300042002 Ga0439442_009713 Ga0439442_009713_782_1360 186
1372 3300042004 Ga0439445_0000821 Ga0439445_0000821_4762_5340 186
1373 3300042006 Ga0439432_000787 Ga0439432_000787_5333_5911 186
1374 3300042015 Ga0439462_0000698 Ga0439462_0000698_4885_5463 186
1375 3300042156 Ga0439446_0011872 Ga0439446_0011872_378_956 186
1376 3300042435 Ga0439434_0000746 Ga0439434_0000746_2673_3251 186
1377 3300045051 Ga0451576_0000041 Ga0451576_0000041_322525_323139 186
1378 3300047470 Ga0495681_0014947 Ga0495681_0014947_3005_3583 186
1379 3300053104 Ga0500556_0000076 Ga0500556_0000076_41332_41931 186
1380 3300053130 Ga0500642_0000001 Ga0500642_0000001_1342547_1343146 186
1381 3300053134 Ga0500658_0008240 Ga0500658_0008240_2968_3546 186
1382 3300053139 Ga0500568_0032622 Ga0500568_0032622_864_1442 186
1383 3300053151 Ga0500604_0058973 Ga0500604_0058973_177_824 186
1384 iso_pu_bacteria 2510917021 2511129292 186
1385 3300005338 Ga0068868_100000503 Ga0068868_1000005038 187
1386 3300005339 Ga0070660_100000856 Ga0070660_1000008568 187
1387 3300005347 Ga0070668_100039704 Ga0070668_1000397042 187
1388 3300005347 Ga0070668_100291645 Ga0070668_1002916452 187
1389 3300005353 Ga0070669_100999425 Ga0070669_1009994251 187
1390 3300005364 Ga0070673_100250744 Ga0070673_1002507442 187
1391 3300005366 Ga0070659_100000159 Ga0070659_10000015911 187
1392 3300005548 Ga0070665_100001688 Ga0070665_1000016882 187
1393 3300005844 Ga0068862_100005835 Ga0068862_1000058359 187
1394 3300009098 Ga0105245_10161479 Ga0105245_101614794 187
1395 3300014968 Ga0157379_10163230 Ga0157379_101632304 187
1396 3300025919 Ga0207657_10006128 Ga0207657_1000612813 187
1397 3300025920 Ga0207649_10414884 Ga0207649_104148841 187
1398 3300025927 Ga0207687_10130685 Ga0207687_101306852 187
1399 3300025932 Ga0207690_10000177 Ga0207690_1000017760 187
1400 3300025935 Ga0207709_10217698 Ga0207709_102176982 187
1401 3300025941 Ga0207711_10135504 Ga0207711_101355042 187
1402 3300025960 Ga0207651_10267283 Ga0207651_102672832 187
1403 3300025972 Ga0207668_10008280 Ga0207668_100082808 187
1404 3300025972 Ga0207668_10410332 Ga0207668_104103322 187
1405 3300026023 Ga0207677_10001450 Ga0207677_100014508 187
1406 3300028379 Ga0268266_10000432 Ga0268266_1000043263 187
1407 3300028380 Ga0268265_10039089 Ga0268265_100390893 187
1408 3300031548 Ga0307408_100263105 Ga0307408_1002631052 187
1409 3300031731 Ga0307405_10034872 Ga0307405_100348724 187
1410 3300031824 Ga0307413_10022088 Ga0307413_100220881 187
1411 3300031852 Ga0307410_10166789 Ga0307410_101667892 187
1412 3300031901 Ga0307406_10149543 Ga0307406_101495432 187
1413 3300031903 Ga0307407_10064377 Ga0307407_100643773 187
1414 3300031995 Ga0307409_100168007 Ga0307409_1001680072 187
1415 3300032002 Ga0307416_100102324 Ga0307416_1001023241 187
1416 3300032002 Ga0307416_100471123 Ga0307416_1004711232 187
1417 3300032005 Ga0307411_10035342 Ga0307411_100353424 187
1418 3300032005 Ga0307411_10087538 Ga0307411_100875383 187
1419 3300038443 Ga0395901_0068076 Ga0395901_0068076_1766_2344 187
1420 3300048920 Ga0496117_0009462 Ga0496117_0009462_2929_3528 187
1421 3300048921 Ga0496118_0000811 Ga0496118_0000811_28792_29391 187
1422 3300048924 Ga0496121_0033968 Ga0496121_0033968_844_1443 187
1423 3300053120 Ga0500597_001461 Ga0500597_001461_1801_2403 187
1424 3300053151 Ga0500604_0000017 Ga0500604_0000017_32514_33128 187
1425 3300053157 Ga0500624_000023 Ga0500624_000023_75087_75689 187
1426 3300053178 Ga0500637_0000013 Ga0500637_0000013_12732_13334 187
1427 iso_pu_bacteria 2582581305 2585261204 187
1428 3300001976 JGI24752J21851_1016998 JGI24752J21851_10169982 188
1429 3300005327 Ga0070658_10014066 Ga0070658_100140664 188
1430 3300005327 Ga0070658_10182655 Ga0070658_101826552 188
1431 3300005331 Ga0070670_100030696 Ga0070670_1000306967 188
1432 3300005333 Ga0070677_10000842 Ga0070677_100008424 188
1433 3300005335 Ga0070666_10000129 Ga0070666_1000012939 188
1434 3300005336 Ga0070680_100244140 Ga0070680_1002441403 188
1435 3300005339 Ga0070660_100006020 Ga0070660_1000060203 188
1436 3300005339 Ga0070660_100121943 Ga0070660_1001219432 188
1437 3300005344 Ga0070661_100263928 Ga0070661_1002639282 188
1438 3300005347 Ga0070668_100005753 Ga0070668_10000575312 188
1439 3300005353 Ga0070669_100000004 Ga0070669_100000004205 188
1440 3300005366 Ga0070659_100440445 Ga0070659_1004404452 188
1441 3300005367 Ga0070667_100192262 Ga0070667_1001922623 188
1442 3300005440 Ga0070705_100014085 Ga0070705_1000140856 188
1443 3300005445 Ga0070708_100210362 Ga0070708_1002103623 188
1444 3300005457 Ga0070662_100001750 Ga0070662_10000175011 188
1445 3300005539 Ga0068853_100006476 Ga0068853_1000064765 188
1446 3300005548 Ga0070665_100034565 Ga0070665_1000345653 188
1447 3300005563 Ga0068855_100204124 Ga0068855_1002041243 188
1448 3300005563 Ga0068855_101232450 Ga0068855_1012324502 188
1449 3300005577 Ga0068857_100121742 Ga0068857_1001217422 188
1450 3300005577 Ga0068857_100267652 Ga0068857_1002676522 188
1451 3300005617 Ga0068859_100001818 Ga0068859_1000018184 188
1452 3300005617 Ga0068859_100384456 Ga0068859_1003844563 188
1453 3300005834 Ga0068851_10138542 Ga0068851_101385422 188
1454 3300005842 Ga0068858_100003763 Ga0068858_10000376313 188
1455 3300005843 Ga0068860_100449273 Ga0068860_1004492732 188
1456 3300005844 Ga0068862_100001195 Ga0068862_10000119517 188
1457 3300006931 Ga0097620_100001818 Ga0097620_10000181821 188
1458 3300006931 Ga0097620_100384436 Ga0097620_1003844363 188
1459 3300009093 Ga0105240_10557693 Ga0105240_105576932 188
1460 3300009101 Ga0105247_10005192 Ga0105247_100051922 188
1461 3300009177 Ga0105248_10218960 Ga0105248_102189603 188
1462 3300013100 Ga0157373_10023626 Ga0157373_100236264 188
1463 3300013100 Ga0157373_10048609 Ga0157373_100486093 188
1464 3300013102 Ga0157371_10213428 Ga0157371_102134281 188
1465 3300013104 Ga0157370_10096001 Ga0157370_100960013 188
1466 3300013104 Ga0157370_10257419 Ga0157370_102574192 188
1467 3300013307 Ga0157372_10401395 Ga0157372_104013952 188
1468 3300014326 Ga0157380_10097219 Ga0157380_100972194 188
1469 3300021358 Ga0213873_10000042 Ga0213873_1000004211 188
1470 3300021384 Ga0213876_10000050 Ga0213876_10000050156 188
1471 3300021384 Ga0213876_10023182 Ga0213876_100231824 188
1472 3300025315 Ga0207697_10000502 Ga0207697_1000050220 188
1473 3300025321 Ga0207656_10029225 Ga0207656_100292252 188
1474 3300025893 Ga0207682_10001153 Ga0207682_1000115314 188
1475 3300025893 Ga0207682_10011031 Ga0207682_100110313 188
1476 3300025900 Ga0207710_10007596 Ga0207710_100075962 188
1477 3300025903 Ga0207680_10000106 Ga0207680_1000010627 188
1478 3300025909 Ga0207705_10000469 Ga0207705_100004694 188
1479 3300025909 Ga0207705_10051887 Ga0207705_100518873 188
1480 3300025917 Ga0207660_10337384 Ga0207660_103373842 188
1481 3300025919 Ga0207657_10000864 Ga0207657_100008644 188
1482 3300025919 Ga0207657_10008634 Ga0207657_100086347 188
1483 3300025919 Ga0207657_10219712 Ga0207657_102197124 188
1484 3300025920 Ga0207649_10321341 Ga0207649_103213412 188
1485 3300025921 Ga0207652_10219160 Ga0207652_102191602 188
1486 3300025923 Ga0207681_10000010 Ga0207681_10000010202 188
1487 3300025932 Ga0207690_10017979 Ga0207690_100179793 188
1488 3300025932 Ga0207690_10373690 Ga0207690_103736902 188
1489 3300025933 Ga0207706_10025486 Ga0207706_100254864 188
1490 3300025941 Ga0207711_10145251 Ga0207711_101452513 188
1491 3300025942 Ga0207689_10117126 Ga0207689_101171262 188
1492 3300025949 Ga0207667_10697042 Ga0207667_106970422 188
1493 3300025961 Ga0207712_10071807 Ga0207712_100718075 188
1494 3300025972 Ga0207668_10000156 Ga0207668_1000015621 188
1495 3300025986 Ga0207658_10001665 Ga0207658_1000166510 188
1496 3300026035 Ga0207703_10094183 Ga0207703_100941832 188
1497 3300026041 Ga0207639_10020560 Ga0207639_100205604 188
1498 3300026116 Ga0207674_10116178 Ga0207674_101161783 188
1499 3300026118 Ga0207675_100000075 Ga0207675_10000007526 188
1500 3300026142 Ga0207698_10241236 Ga0207698_102412362 188
1501 3300027665 Ga0209983_1076041 Ga0209983_10760412 188
1502 3300028379 Ga0268266_10006558 Ga0268266_100065586 188
1503 3300028380 Ga0268265_10001179 Ga0268265_1000117919 188
1504 3300028381 Ga0268264_10000106 Ga0268264_10000106103 188
1505 3300031250 Ga0265331_10009784 Ga0265331_100097845 188
1506 3300031731 Ga0307405_10012331 Ga0307405_100123315 188
1507 3300031901 Ga0307406_10001642 Ga0307406_100016422 188
1508 3300031911 Ga0307412_10001919 Ga0307412_100019195 188
1509 3300032002 Ga0307416_100021750 Ga0307416_1000217507 188
1510 3300032004 Ga0307414_10473713 Ga0307414_104737132 188
1511 3300037312 Ga0395899_0000352 Ga0395899_0000352_54198_54788 188
1512 3300037418 Ga0395900_0001013 Ga0395900_0001013_2736_3326 188
1513 3300037418 Ga0395900_0278219 Ga0395900_0278219_648_1238 188
1514 3300037466 Ga0395898_0008246 Ga0395898_0008246_8933_9523 188
1515 3300037466 Ga0395898_0117063 Ga0395898_0117063_922_1512 188
1516 3300038443 Ga0395901_0000047 Ga0395901_0000047_85601_86191 188
1517 3300038443 Ga0395901_0204920 Ga0395901_0204920_834_1424 188
1518 3300038443 Ga0395901_0212823 Ga0395901_0212823_1067_1657 188
1519 3300039437 Ga0436365_1697258 Ga0436365_1697258_7652_8230 188
1520 3300039453 Ga0436362_1132945 Ga0436362_1132945_7652_8230 188
1521 3300042116 Ga0450912_003240 Ga0450912_003240_37_615 188
1522 3300046453 Ga0495627_047853 Ga0495627_047853_607_1224 188
1523 3300046460 Ga0495638_0081301 Ga0495638_0081301_575_1177 188
1524 3300049778 Ga0501282_006804 Ga0501282_006804_477_1055 188
1525 3300053087 Ga0500643_008873 Ga0500643_008873_1887_2504 188
1526 3300053157 Ga0500624_000055 Ga0500624_000055_40164_40781 188
1527 3300053177 Ga0500636_0014570 Ga0500636_0014570_464_1081 188
1528 3300002076 JGI24749J21850_1000027 JGI24749J21850_100002724 189
1529 3300002459 JGI24751J29686_10000089 JGI24751J29686_1000008933 189
1530 3300002459 JGI24751J29686_10039306 JGI24751J29686_100393062 189
1531 3300005262 Ga0065165_1006364 Ga0065165_10063645 189
1532 3300005331 Ga0070670_100000028 Ga0070670_100000028153 189
1533 3300005331 Ga0070670_100000814 Ga0070670_1000008149 189
1534 3300005335 Ga0070666_10047456 Ga0070666_100474562 189
1535 3300005347 Ga0070668_100000030 Ga0070668_10000003079 189
1536 3300005347 Ga0070668_100013578 Ga0070668_1000135785 189
1537 3300005347 Ga0070668_100075026 Ga0070668_1000750262 189
1538 3300005353 Ga0070669_100000005 Ga0070669_100000005158 189
1539 3300005353 Ga0070669_100065731 Ga0070669_1000657314 189
1540 3300005355 Ga0070671_100000125 Ga0070671_10000012510 189
1541 3300005367 Ga0070667_100000036 Ga0070667_100000036144 189
1542 3300005367 Ga0070667_100000071 Ga0070667_10000007173 189
1543 3300005367 Ga0070667_100001055 Ga0070667_1000010552 189
1544 3300005577 Ga0068857_100194341 Ga0068857_1001943414 189
1545 3300005577 Ga0068857_100353499 Ga0068857_1003534992 189
1546 3300005578 Ga0068854_100001206 Ga0068854_1000012065 189
1547 3300005578 Ga0068854_100111719 Ga0068854_1001117192 189
1548 3300005617 Ga0068859_100001288 Ga0068859_10000128814 189
1549 3300005617 Ga0068859_100156542 Ga0068859_1001565425 189
1550 3300005618 Ga0068864_100000336 Ga0068864_10000033634 189
1551 3300005618 Ga0068864_100007503 Ga0068864_10000750310 189
1552 3300005719 Ga0068861_100101837 Ga0068861_1001018373 189
1553 3300005719 Ga0068861_100196297 Ga0068861_1001962972 189
1554 3300005841 Ga0068863_100003355 Ga0068863_10000335513 189
1555 3300005841 Ga0068863_100060175 Ga0068863_1000601754 189
1556 3300005841 Ga0068863_100069721 Ga0068863_1000697213 189
1557 3300005842 Ga0068858_100002663 Ga0068858_10000266313 189
1558 3300005843 Ga0068860_100000049 Ga0068860_100000049144 189
1559 3300005843 Ga0068860_100000063 Ga0068860_10000006321 189
1560 3300005844 Ga0068862_100000005 Ga0068862_100000005234 189
1561 3300005844 Ga0068862_100000134 Ga0068862_10000013422 189
1562 3300006048 Ga0075363_100220732 Ga0075363_1002207322 189
1563 3300006195 Ga0075366_10003787 Ga0075366_100037875 189
1564 3300006931 Ga0097620_100001288 Ga0097620_10000128811 189
1565 3300006931 Ga0097620_100156538 Ga0097620_1001565385 189
1566 3300009177 Ga0105248_10000218 Ga0105248_1000021814 189
1567 3300009177 Ga0105248_10028414 Ga0105248_100284149 189
1568 3300009553 Ga0105249_10362097 Ga0105249_103620972 189
1569 3300012513 Ga0157326_1000266 Ga0157326_10002663 189
1570 3300014326 Ga0157380_10000023 Ga0157380_1000002395 189
1571 3300025903 Ga0207680_10071197 Ga0207680_100711972 189
1572 3300025923 Ga0207681_10000003 Ga0207681_10000003154 189
1573 3300025923 Ga0207681_10027099 Ga0207681_100270992 189
1574 3300025925 Ga0207650_10000012 Ga0207650_10000012161 189
1575 3300025925 Ga0207650_10006506 Ga0207650_100065066 189
1576 3300025931 Ga0207644_10000355 Ga0207644_1000035524 189
1577 3300025941 Ga0207711_10002781 Ga0207711_100027813 189
1578 3300025941 Ga0207711_10043762 Ga0207711_100437626 189
1579 3300025972 Ga0207668_10000011 Ga0207668_1000001176 189
1580 3300025972 Ga0207668_10013409 Ga0207668_100134095 189
1581 3300025972 Ga0207668_10064477 Ga0207668_100644772 189
1582 3300025981 Ga0207640_10006844 Ga0207640_100068448 189
1583 3300025986 Ga0207658_10000014 Ga0207658_10000014151 189
1584 3300026035 Ga0207703_10003264 Ga0207703_1000326412 189
1585 3300026088 Ga0207641_10000292 Ga0207641_1000029222 189
1586 3300026088 Ga0207641_10084077 Ga0207641_100840774 189
1587 3300026095 Ga0207676_10000009 Ga0207676_10000009150 189
1588 3300026095 Ga0207676_10004107 Ga0207676_100041075 189
1589 3300026116 Ga0207674_10067005 Ga0207674_100670051 189
1590 3300026116 Ga0207674_10369917 Ga0207674_103699172 189
1591 3300026118 Ga0207675_100000350 Ga0207675_10000035025 189
1592 3300028380 Ga0268265_10000001 Ga0268265_10000001323 189
1593 3300028380 Ga0268265_10006460 Ga0268265_100064605 189
1594 3300028381 Ga0268264_10000121 Ga0268264_10000121130 189
1595 3300031548 Ga0307408_100159743 Ga0307408_1001597433 189
1596 3300031824 Ga0307413_10849631 Ga0307413_108496311 189
1597 3300031911 Ga0307412_10083205 Ga0307412_100832052 189
1598 3300031911 Ga0307412_10287072 Ga0307412_102870721 189
1599 3300037068 Ga0373925_0123142 Ga0373925_0123142_986_1570 189
1600 3300046520 Ga0495637_0031015 Ga0495637_0031015_572_1156 189
1601 3300046522 Ga0495643_0135020 Ga0495643_0135020_172_756 189
1602 3300046542 Ga0495597_0015961 Ga0495597_0015961_1227_1811 189
1603 3300046616 Ga0495668_0007073 Ga0495668_0007073_633_1217 189
1604 3300048090 Ga0495615_0064477 Ga0495615_0064477_253_837 189
1605 3300048926 Ga0496123_0020086 Ga0496123_0020086_4333_4932 189
1606 3300048926 Ga0496123_0062355 Ga0496123_0062355_1710_2309 189
1607 3300048927 Ga0496124_0020089 Ga0496124_0020089_2084_2683 189
1608 3300048928 Ga0496125_0015869 Ga0496125_0015869_4078_4662 189
1609 3300048929 Ga0496126_0055405 Ga0496126_0055405_1210_1812 189
1610 3300049569 Ga0501032_0019795 Ga0501032_0019795_1918_2505 189
1611 3300049579 Ga0501043_0019704 Ga0501043_0019704_2966_3553 189
1612 3300049580 Ga0501046_0142927 Ga0501046_0142927_784_1371 189
1613 3300049581 Ga0501047_0000447 Ga0501047_0000447_34579_35166 189
1614 3300049582 Ga0501048_0471752 Ga0501048_0471752_174_761 189
1615 3300049679 Ga0501249_001062 Ga0501249_001062_2983_3588 189
1616 3300049758 Ga0501241_029760 Ga0501241_029760_324_914 189
1617 3300049823 Ga0501044_0054710 Ga0501044_0054710_1778_2365 189
1618 3300050493 nmdc:mga0k408_9751_c1 nmdc:mga0k408_9751_c1_4285_4941 189
1619 3300053087 Ga0500643_002542 Ga0500643_002542_8587_9171 189
1620 3300053093 Ga0500651_0078586 Ga0500651_0078586_1436_2020 189
1621 3300053094 Ga0500566_0005929 Ga0500566_0005929_2106_2696 189
1622 3300053116 Ga0500592_022391 Ga0500592_022391_252_836 189
1623 3300053123 Ga0500614_064079 Ga0500614_064079_346_930 189
1624 3300053130 Ga0500642_0003102 Ga0500642_0003102_2593_3177 189
1625 3300053133 Ga0500655_000063 Ga0500655_000063_6173_6757 189
1626 3300053136 Ga0500559_0144001 Ga0500559_0144001_299_883 189
1627 3300053148 Ga0500590_006648 Ga0500590_006648_2408_2992 189
1628 3300053156 Ga0500622_0054556 Ga0500622_0054556_1050_1634 189
1629 3300053163 Ga0500639_099290 Ga0500639_099290_744_1328 189
1630 3300053724 Ga0500570_000050 Ga0500570_000050_22345_22929 189
1631 3300053730 Ga0500645_000555 Ga0500645_000555_17280_17876 189
1632 3300005617 Ga0068859_100026991 Ga0068859_1000269917 190
1633 3300005841 Ga0068863_100004067 Ga0068863_10000406715 190
1634 3300005843 Ga0068860_100002979 Ga0068860_10000297922 190
1635 3300005844 Ga0068862_100000067 Ga0068862_1000000676 190
1636 3300006931 Ga0097620_100026991 Ga0097620_1000269917 190
1637 3300009553 Ga0105249_10000105 Ga0105249_100001054 190
1638 3300025900 Ga0207710_10002821 Ga0207710_100028217 190
1639 3300025961 Ga0207712_10000015 Ga0207712_100000154 190
1640 3300026088 Ga0207641_10004799 Ga0207641_100047996 190
1641 3300028380 Ga0268265_10000021 Ga0268265_10000021225 190
1642 3300028381 Ga0268264_10003943 Ga0268264_100039434 190
1643 3300031824 Ga0307413_10677503 Ga0307413_106775031 190
1644 3300032002 Ga0307416_100085909 Ga0307416_1000859093 190
1645 3300032002 Ga0307416_100775092 Ga0307416_1007750922 190
1646 3300032126 Ga0307415_100311344 Ga0307415_1003113442 190
1647 3300050489 nmdc:mga03683_192869_c1 nmdc:mga03683_192869_c1_50_673 190
1648 3300053087 Ga0500643_000135 Ga0500643_000135_70830_71414 190
1649 3300005843 Ga0068860_100592134 Ga0068860_1005921341 191
1650 3300006048 Ga0075363_100002604 Ga0075363_1000026045 191
1651 3300006051 Ga0075364_10037942 Ga0075364_100379424 191
1652 3300006177 Ga0075362_10000119 Ga0075362_1000011910 191
1653 3300006186 Ga0075369_10001089 Ga0075369_100010894 191
1654 3300006195 Ga0075366_10000014 Ga0075366_1000001436 191
1655 3300006353 Ga0075370_10000141 Ga0075370_100001415 191
1656 3300050489 nmdc:mga03683_32_c1 nmdc:mga03683_32_c1_7951_8568 191
1657 3300050490 nmdc:mga03n38_1854_c1 nmdc:mga03n38_1854_c1_1909_2526 191
1658 3300050491 nmdc:mga00v17_33433_c1 nmdc:mga00v17_33433_c1_103_720 191
1659 3300050493 nmdc:mga0k408_7_c1 nmdc:mga0k408_7_c1_93205_93822 191
1660 3300050496 nmdc:mga07m45_3_c1 nmdc:mga07m45_3_c1_106681_107298 191
1661 3300050516 nmdc:mga0sz30_788_c1 nmdc:mga0sz30_788_c1_8053_8670 191
1662 iso_pu_bacteria 2512564014 2512644567 193
1663 iso_pu_bacteria 2808606401 2809062469 193
1664 iso_pu_bacteria 2808606404 2809078191 193
1665 iso_pu_bacteria 2808606405 2809082858 193
1666 iso_pu_bacteria 2880518877 2880522270 193
1667 3300005335 Ga0070666_10174304 Ga0070666_101743041 196
1668 3300005347 Ga0070668_100032725 Ga0070668_1000327254 196
1669 3300005347 Ga0070668_100339607 Ga0070668_1003396072 196
1670 3300005355 Ga0070671_100110232 Ga0070671_1001102321 196
1671 3300005367 Ga0070667_100000024 Ga0070667_100000024178 196
1672 3300005841 Ga0068863_100000082 Ga0068863_100000082102 196
1673 3300005843 Ga0068860_100001415 Ga0068860_1000014153 196
1674 3300009553 Ga0105249_10349008 Ga0105249_103490081 196
1675 3300025903 Ga0207680_10142945 Ga0207680_101429454 196
1676 3300025972 Ga0207668_10000405 Ga0207668_100004055 196
1677 3300025986 Ga0207658_10000022 Ga0207658_100000223 196
1678 3300026088 Ga0207641_10000139 Ga0207641_100001393 196
1679 3300046471 Ga0495650_0001141 Ga0495650_0001141_12393_12983 196
1680 3300046513 Ga0495616_0000017 Ga0495616_0000017_69591_70181 196
1681 3300046616 Ga0495668_0007147 Ga0495668_0007147_4906_5496 196
1682 3300048916 Ga0496113_0044945 Ga0496113_0044945_12_602 196
1683 3300049663 Ga0501223_000010 Ga0501223_000010_72887_73477 196
1684 3300049705 Ga0501225_0000008 Ga0501225_0000008_61256_61846 196
1685 3300049705 Ga0501225_0000114 Ga0501225_0000114_23130_23720 196
1686 3300053087 Ga0500643_000137 Ga0500643_000137_31012_31602 196
1687 3300053151 Ga0500604_0001253 Ga0500604_0001253_516_1106 196
1688 3300055283 Ga0500661_000754 Ga0500661_000754_3951_4541 196
1689 2162886007 SwRhRL2b_contig_3274429 SwRhRL2b_0064.00004750 197
1690 3300001915 JGI24741J21665_1000145 JGI24741J21665_100014515 197
1691 3300001979 JGI24740J21852_10002079 JGI24740J21852_100020793 197
1692 3300001989 JGI24739J22299_10009764 JGI24739J22299_100097644 197
1693 3300001990 JGI24737J22298_10004139 JGI24737J22298_100041395 197
1694 3300002067 JGI24735J21928_10004453 JGI24735J21928_100044534 197
1695 3300005289 Ga0065704_10001076 Ga0065704_1000107611 197
1696 3300005289 Ga0065704_10071428 Ga0065704_100714287 197
1697 3300005295 Ga0065707_10203355 Ga0065707_102033551 197
1698 3300005327 Ga0070658_10312087 Ga0070658_103120871 197
1699 3300005339 Ga0070660_100030336 Ga0070660_1000303364 197
1700 3300005344 Ga0070661_100198666 Ga0070661_1001986662 197
1701 3300005347 Ga0070668_100018876 Ga0070668_1000188765 197
1702 3300005353 Ga0070669_100012657 Ga0070669_1000126573 197
1703 3300005366 Ga0070659_100033112 Ga0070659_1000331124 197
1704 3300005455 Ga0070663_100037816 Ga0070663_1000378163 197
1705 3300005457 Ga0070662_100110619 Ga0070662_1001106192 197
1706 3300005548 Ga0070665_100279835 Ga0070665_1002798354 197
1707 3300005564 Ga0070664_100039394 Ga0070664_1000393944 197
1708 3300005614 Ga0068856_100021889 Ga0068856_1000218892 197
1709 3300005834 Ga0068851_10064730 Ga0068851_100647302 197
1710 3300006042 Ga0075368_10001345 Ga0075368_100013453 197
1711 3300006178 Ga0075367_10010071 Ga0075367_100100718 197
1712 3300009011 Ga0105251_10016546 Ga0105251_100165466 197
1713 3300009093 Ga0105240_10628205 Ga0105240_106282052 197
1714 3300009174 Ga0105241_10035184 Ga0105241_100351842 197
1715 3300009545 Ga0105237_10042186 Ga0105237_100421862 197
1716 3300009553 Ga0105249_10208405 Ga0105249_102084054 197
1717 3300013100 Ga0157373_10173200 Ga0157373_101732003 197
1718 3300013104 Ga0157370_10055445 Ga0157370_100554454 197
1719 3300013105 Ga0157369_10213614 Ga0157369_102136144 197
1720 3300013307 Ga0157372_10275604 Ga0157372_102756042 197
1721 3300014326 Ga0157380_10067913 Ga0157380_100679132 197
1722 3300025321 Ga0207656_10076375 Ga0207656_100763752 197
1723 3300025735 Ga0207713_1037137 Ga0207713_10371374 197
1724 3300025904 Ga0207647_10008602 Ga0207647_100086027 197
1725 3300025909 Ga0207705_10238950 Ga0207705_102389502 197
1726 3300025911 Ga0207654_10043156 Ga0207654_100431562 197
1727 3300025913 Ga0207695_10214215 Ga0207695_102142152 197
1728 3300025914 Ga0207671_10146978 Ga0207671_101469781 197
1729 3300025919 Ga0207657_10036492 Ga0207657_100364924 197
1730 3300025923 Ga0207681_10042889 Ga0207681_100428892 197
1731 3300025924 Ga0207694_10156899 Ga0207694_101568992 197
1732 3300025933 Ga0207706_10046579 Ga0207706_100465794 197
1733 3300025949 Ga0207667_10206659 Ga0207667_102066594 197
1734 3300025961 Ga0207712_10416406 Ga0207712_104164062 197
1735 3300025981 Ga0207640_10119140 Ga0207640_101191403 197
1736 3300026041 Ga0207639_10000213 Ga0207639_1000021326 197
1737 3300026067 Ga0207678_10000726 Ga0207678_1000072624 197
1738 3300026078 Ga0207702_10006555 Ga0207702_100065556 197
1739 3300026095 Ga0207676_10190074 Ga0207676_101900743 197
1740 3300026116 Ga0207674_10295736 Ga0207674_102957362 197
1741 3300026142 Ga0207698_10246716 Ga0207698_102467162 197
1742 3300027866 Ga0209813_10000072 Ga0209813_1000007229 197
1743 3300028379 Ga0268266_10263015 Ga0268266_102630152 197
1744 3300031548 Ga0307408_100017392 Ga0307408_1000173923 197
1745 3300031852 Ga0307410_10143296 Ga0307410_101432962 197
1746 3300031911 Ga0307412_10023327 Ga0307412_100233274 197
1747 3300031995 Ga0307409_100226461 Ga0307409_1002264612 197
1748 3300032004 Ga0307414_10476916 Ga0307414_104769161 197
1749 3300032005 Ga0307411_10113796 Ga0307411_101137962 197
1750 3300046453 Ga0495627_000094 Ga0495627_000094_11960_12553 197
1751 3300046453 Ga0495627_000229 Ga0495627_000229_33353_33946 197
1752 3300046512 Ga0495610_0000043 Ga0495610_0000043_112024_112617 197
1753 3300046519 Ga0495632_0195351 Ga0495632_0195351_187_780 197
1754 3300046558 Ga0495633_0098396 Ga0495633_0098396_564_1157 197
1755 3300046810 Ga0495660_0256050 Ga0495660_0256050_205_798 197
1756 3300047470 Ga0495681_0000025 Ga0495681_0000025_35633_36226 197
1757 3300047472 Ga0495686_0024726 Ga0495686_0024726_175_768 197
1758 3300048905 Ga0496102_0485640 Ga0496102_0485640_476_1078 197
1759 3300048911 Ga0496108_0074296 Ga0496108_0074296_1273_1875 197
1760 3300048911 Ga0496108_0074981 Ga0496108_0074981_1789_2382 197
1761 3300048912 Ga0496109_0064607 Ga0496109_0064607_2205_2807 197
1762 3300048913 Ga0496110_0112879 Ga0496110_0112879_877_1479 197
1763 3300048913 Ga0496110_0443462 Ga0496110_0443462_548_1141 197
1764 3300048914 Ga0496111_0209438 Ga0496111_0209438_693_1295 197
1765 3300048919 Ga0496116_0009059 Ga0496116_0009059_6459_7052 197
1766 3300048920 Ga0496117_0024081 Ga0496117_0024081_1868_2461 197
1767 3300048921 Ga0496118_0023763 Ga0496118_0023763_2976_3569 197
1768 3300048924 Ga0496121_0000454 Ga0496121_0000454_66705_67298 197
1769 3300048924 Ga0496121_0085336 Ga0496121_0085336_190_783 197
1770 3300048925 Ga0496122_0031024 Ga0496122_0031024_2434_3027 197
1771 3300048925 Ga0496122_0119036 Ga0496122_0119036_1003_1605 197
1772 3300048927 Ga0496124_0016408 Ga0496124_0016408_2484_3077 197
1773 3300048928 Ga0496125_0023712 Ga0496125_0023712_4166_4759 197
1774 3300048928 Ga0496125_0028980 Ga0496125_0028980_3773_4366 197
1775 3300048928 Ga0496125_0056823 Ga0496125_0056823_809_1411 197
1776 3300049459 Ga0495678_014767 Ga0495678_014767_952_1545 197
1777 3300049658 Ga0501211_000125 Ga0501211_000125_4962_5555 197
1778 3300050495 nmdc:mga04h51_60_c1 nmdc:mga04h51_60_c1_10226_10834 197
1779 3300053157 Ga0500624_000019 Ga0500624_000019_55775_56368 197

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04079

SMC_ScpB

Segregation and condensation complex subunit ScpB

7

161

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ija-assembly1.cif.gz_A structure of s. aureus methicillin resistance factor mecr2 0.8459 89 147
4wcg-assembly1.cif.gz_A the binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna 0.7887 88 146
2htj-assembly1.cif.gz_A nmr structure of e.coli papi 0.7721 89 146
1j75-assembly1.cif.gz_A-2 crystal structure of the dna-binding domain zalpha of dlm-1 bound to z-dna 0.7714 8 66
1r22-assembly1.cif.gz_B crystal structure of the cyanobacterial metallothionein repressor smtb (c14s/c61s/c121s mutant) in the zn2alpha5-form 0.7691 86 155
ID Description Score Start End Superfamily
af_Q2FY77_75_157_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8942 79 163 1.10.10.10
af_I6XCB2_106_189_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8894 84 163 1.10.10.10
2z99A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8647 84 157 1.10.10.10
af_Q2FY77_75_157_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8642 79 163 1.10.10.10
3w6jC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8562 78 163 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A382T380-F1-model_v4 SMC-Scp complex subunit ScpB 0.8649 75 171 GO:0005737
GO:0051301
GO:0051304
AF-A0A084XZ05-F1-model_v4 Segregation and condensation protein B 0.8535 90 171 GO:0005737
GO:0051301
GO:0051304
AF-A0A258SWS4-F1-model_v4 SMC-Scp complex subunit ScpB 0.8503 80 168 GO:0005737
GO:0051301
GO:0051304
AF-A0A434GEQ7-F1-model_v4 SMC-Scp complex subunit ScpB 0.8258 83 174 GO:0005737
GO:0051301
GO:0051304
AF-A0A382T380-F1-model_v4 SMC-Scp complex subunit ScpB 0.8086 75 171 GO:0005737
GO:0051301
GO:0051304

Feature Viewer

pLDDT pTM Quality
80.69 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map