F495577

General Info

Members Datasets Scaffolds Average Seq Length
1753 685 1442 306

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10001869|Ga0157371_1000186912
Length 366
Sequence MIITLDYRREKGNPREIRRTLILGASRGLHKGIKRMGGMSQTHAGKFLLTLCNCASGALPMSRRLPPLYALRAFEAAARHSSFTRAAEELSITQSAVSRHIRTLEEHFACRLFHRSGRNLQLTESARLILPGIRDGFTALERACNTLRAEDDILRMKAPSTLTMRWLLARLSRFRHLQPGNEVQLTSAWMDIDSVDFNQEPFDCAVILSNGHFPPDWEATLLFPEELIPVGAPNLLKDQPWDVARLASTELLHPTPDRRDWRTWLVRMGVDDQVSLKGGQVFDTLELGMIAAARGYGVSMGDLLMVAEDVAQGRLSLPWPTAVASGENYYLVWPKTRPGGERLRRLSDFLLGEVRAMDLPDVDHLS

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
4 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
5 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
6 2511231004 Pseudomonas sp. GM102 Isolate Nodule
7 2511231006 Pseudomonas sp. GM17 Isolate Nodule
8 2511231007 Pseudomonas sp. GM18 Isolate Nodule
9 2511231008 Pseudomonas sp. GM21 Isolate Nodule
10 2511231011 Pseudomonas sp. GM30 Isolate Nodule
11 2511231012 Pseudomonas sp. GM33 Isolate Nodule
12 2511231014 Pseudomonas sp. GM48 Isolate Nodule
13 2511231015 Pseudomonas sp. GM49 Isolate Nodule
14 2511231016 Pseudomonas sp. GM50 Isolate Nodule
15 2511231017 Pseudomonas sp. GM55 Isolate Nodule
16 2511231018 Pseudomonas sp. GM60 Isolate Nodule
17 2511231019 Pseudomonas sp. GM67 Isolate Nodule
18 2511231020 Pseudomonas sp. GM74 Isolate Nodule
19 2511231021 Pseudomonas sp. GM78 Isolate Nodule
20 2511231022 Pseudomonas sp. GM79 Isolate Nodule
21 2511231023 Pseudomonas sp. GM80 Isolate Nodule
22 2511231024 Pseudomonas sp. GM84 Isolate Nodule
23 2511231031 Pseudomonas sp. GM16 Isolate Nodule
24 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
25 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
26 2547132181 Kosakonia sacchari SP1 Isolate Stem
27 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
28 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
29 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
30 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
31 2561511199 Enterobacter sp. R4-368 Isolate Nodule
32 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
33 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
34 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
35 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
36 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
37 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
38 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
39 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
40 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
41 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
42 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
43 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
44 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
45 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
46 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
47 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
48 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
49 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
50 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
51 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
52 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
53 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
54 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
55 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
56 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
57 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
58 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
59 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
60 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
61 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
62 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
63 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
64 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
65 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
66 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
67 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
68 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
69 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
70 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
71 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
72 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
73 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
74 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
75 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
76 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
77 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
78 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
79 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
80 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
81 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
82 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
83 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
84 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
85 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
86 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
87 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
88 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
89 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
90 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
91 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
92 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
93 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
94 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
95 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
96 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
97 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
98 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
99 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
100 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
101 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
102 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
103 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
104 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
105 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
106 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
107 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
108 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
109 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
110 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
111 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
112 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
113 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
114 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
115 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
116 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
117 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
118 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
119 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
120 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
121 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
122 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
123 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
124 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
125 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
126 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
127 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
128 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
129 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
130 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
131 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
132 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
133 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
134 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
135 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
136 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
137 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
138 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
139 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
140 2751185917 Enterobacter sp. HK169 Isolate Unclassified
141 2765235841 Pseudomonas putida AA7 Isolate Unclassified
142 2773857670 Pseudomonas sp. 478 Isolate Unclassified
143 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
144 2773857673 Pseudomonas sp. 443 Isolate Unclassified
145 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
146 2784132063 Pseudomonas sp. 424 Isolate Unclassified
147 2784132072 Pseudomonas sp. 460 Isolate Unclassified
148 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
149 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
150 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
151 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
152 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
153 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
154 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
155 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
156 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
157 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
158 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
159 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
160 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
161 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
162 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
163 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
164 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
165 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
166 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
167 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
168 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
169 2821118458 Enterobacter asburiae 609 Isolate Unclassified
170 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
171 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
172 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
173 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
174 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
175 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
176 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
177 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
178 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
179 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
180 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
181 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
182 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
183 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
184 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
185 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
186 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
187 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
188 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
189 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
190 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
191 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
192 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
193 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
194 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
195 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
196 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
197 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
198 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
199 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
200 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
201 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
202 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
203 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
204 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
205 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
206 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
207 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
208 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
209 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
210 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
211 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
212 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
213 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
214 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
215 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
216 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
217 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
218 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
219 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
220 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
221 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
222 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
223 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
224 2937539931 Pantoea sp. LS15 Isolate Unclassified
225 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
226 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
227 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
228 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
229 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
230 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
231 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
232 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
233 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
234 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
235 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
236 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
237 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
238 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
239 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
240 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
241 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
242 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
243 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
244 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
245 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
246 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
247 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
248 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
249 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
250 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
251 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
252 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
253 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
254 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
255 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
256 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
257 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
258 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
259 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
260 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
261 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
262 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
263 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
264 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
265 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
266 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
267 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
268 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
269 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
270 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
271 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
272 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
273 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
274 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
275 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
276 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
277 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
278 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
279 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
280 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
281 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
282 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
283 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
284 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
285 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
286 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
287 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
288 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
289 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
290 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
291 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
292 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
293 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
294 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
295 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
296 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
297 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
298 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
299 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
300 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
301 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
302 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
303 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
304 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
305 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
306 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
307 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
308 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
309 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
310 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
311 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
312 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
313 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
314 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
315 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
316 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
317 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
318 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
319 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
320 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
321 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
322 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
323 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
324 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
325 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
326 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
327 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
328 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
329 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
330 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
331 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
332 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
333 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
334 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
335 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
336 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
337 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
338 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
339 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
340 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
341 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
342 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
343 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
344 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
345 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
346 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
347 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
348 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
349 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
350 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
351 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
352 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
353 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
354 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
355 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
356 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
357 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
358 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
359 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
360 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
361 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
362 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
363 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
364 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
365 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
366 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
367 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
368 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
369 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
370 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
371 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
372 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
373 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
374 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
375 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
376 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
377 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
378 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
379 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
380 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
381 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
382 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
383 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
384 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
385 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
386 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
387 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
388 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
389 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
390 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
391 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
392 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
393 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
423 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
424 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
425 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
426 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
428 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
429 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
430 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
431 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
432 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
433 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
434 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
435 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
436 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
437 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
438 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
440 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
441 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
442 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
443 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
444 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
445 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
446 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
447 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
448 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
449 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
450 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
451 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
452 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
453 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
454 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
455 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
456 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
457 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
458 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
459 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
460 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
461 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
462 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
463 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
464 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
465 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
466 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
467 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
468 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
469 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
470 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
471 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
472 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
473 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
474 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
475 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
476 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
477 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
478 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
479 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
480 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
481 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
482 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
483 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
484 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
485 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
486 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
487 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
488 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
489 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
490 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
491 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
492 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
493 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
494 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
495 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
496 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
497 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
498 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
499 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
500 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
501 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
502 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
503 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
504 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
505 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
506 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
507 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
508 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
509 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
510 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
511 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
512 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
513 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
514 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
515 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
516 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
517 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
518 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
519 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
520 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
521 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
522 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
523 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
524 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
525 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
526 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
527 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
528 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
529 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
530 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
531 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
532 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
533 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
534 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
535 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
536 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
537 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
538 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
539 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
540 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
541 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
542 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
543 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
544 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
545 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
546 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
547 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
548 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
549 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
550 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
551 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
552 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
553 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
554 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
555 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
556 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
557 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
558 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
559 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
560 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
561 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
562 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
563 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
564 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
565 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
566 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
567 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
568 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
569 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
570 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
571 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
572 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
573 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
574 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
575 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
576 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
577 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
578 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
579 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
580 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
581 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
582 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
583 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
584 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
585 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
586 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
587 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
588 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
589 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
590 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
591 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
592 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
593 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
594 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
595 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
596 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
597 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
598 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
599 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
600 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
601 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
602 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
603 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
604 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
605 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
606 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
607 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
608 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
609 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
610 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
611 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
612 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
613 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
614 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
615 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
616 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
617 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
618 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
619 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
620 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
621 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
622 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
623 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
624 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
625 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
626 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
627 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
628 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
629 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
630 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
631 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
632 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
633 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
634 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
635 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
636 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
637 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
638 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
639 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
640 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
641 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
642 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
643 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
644 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
645 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
646 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
647 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
648 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
649 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
650 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
651 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
652 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
653 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
654 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
655 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
656 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
657 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
658 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
659 8018221730 Enterobacter sp. CM29 Isolate Unclassified
660 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
661 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
662 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
663 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
664 8052494512 Pseudomonas putida LD6 Isolate Unclassified
665 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
666 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
667 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
668 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
669 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
670 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
671 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
672 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
673 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
674 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
675 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
676 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
677 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
678 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
679 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
680 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
681 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
682 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
683 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
684 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
685 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.26
Metatranscriptomes 0
Isolates 17.74

Biome Distribution

Category Percentage (%)
Aerial Root 0.17
Bulb 0
Endosphere 7.02
Nodule 2.17
Rhizoplane 5.88
Rhizosphere 69.25
Stem 0.06
Stem Tuber 0.06
Unclassified 15.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_60 2124908027 Bacteria 51048
2 SwRhRL2b_contig_1560538 2162886007 Bacteria 2034
3 SwRhRL2b_contig_3124744 2162886007 Bacteria 5541
4 JGI25162J39368_1000014 3300002737 Bacteria 328873
5 JGI25162J39368_1000455 3300002737 Bacteria 32067
6 JGI25162J39368_1000473 3300002737 Bacteria 30930
7 JGI25154J39366_1009942 3300002738 Bacteria 1147
8 JGI25163J39215_1000130 3300002771 Bacteria 30790
9 JGI25163J39215_1000425 3300002771 Bacteria 13096
10 JGI25163J39215_1000564 3300002771 Bacteria 10550
11 JGI25164J39214_1000015 3300002772 Bacteria 217395
12 JGI25164J39214_1000311 3300002772 Bacteria 32067
13 JGI25164J39214_1000323 3300002772 Bacteria 30930
14 JGI25151J46595_10000321 3300003187 Bacteria 51966
15 JGI25165J46597_1000027 3300003214 Bacteria 328873
16 JGI25165J46597_1000581 3300003214 Bacteria 32067
17 JGI25165J46597_1000599 3300003214 Bacteria 30930
18 rootH2_10011139 3300003320 Bacteria 48165
19 rootH2_10018913 3300003320 Bacteria 1964
20 rootL2_10224169 3300003322 Bacteria 4805
21 rootH1_10193555 3300003323 Bacteria 3027
22 Ga0055538_1000012 3300003751 Bacteria 353826
23 Ga0055539_1000017 3300003752 Bacteria 353873
24 Ga0055533_1000021 3300003756 Bacteria 353826
25 Ga0055532_1000119 3300003758 Bacteria 83382
26 Ga0055532_1000197 3300003758 Bacteria 50456
27 Ga0055525_1000255 3300003759 Bacteria 51028
28 Ga0055527_1000132 3300003760 Bacteria 52418
29 Ga0055535_1000199 3300003761 Bacteria 63798
30 Ga0055535_1005721 3300003761 Bacteria 2660
31 Ga0055542_1000235 3300003762 Bacteria 63798
32 Ga0055529_1000255 3300003763 Bacteria 63798
33 Ga0055536_1000081 3300003781 Bacteria 81966
34 Ga0055536_1002765 3300003781 Bacteria 9715
35 Ga0055528_1000645 3300003790 Bacteria 25493
36 Ga0055530_10001106 3300003791 Bacteria 21102
37 Ga0055530_10001116 3300003791 Bacteria 20999
38 Ga0055530_10001165 3300003791 Bacteria 20385
39 Ga0055540_1000304 3300003792 Bacteria 43625
40 Ga0055540_1000852 3300003792 Bacteria 20385
41 Ga0055540_1001731 3300003792 Bacteria 12546
42 Ga0055531_10001391 3300003794 Bacteria 17913
43 Ga0055541_1000012 3300003841 Bacteria 353826
44 Ga0058692_1000144 3300003856 Bacteria 45086
45 Ga0058692_1000248 3300003856 Bacteria 30057
46 Ga0058692_1007740 3300003856 Bacteria 2824
47 Ga0065714_10000008 3300005288 Bacteria 22256
48 Ga0065714_10002290 3300005288 Bacteria 27568
49 Ga0065714_10004542 3300005288 Bacteria 5061
50 Ga0065714_10006434 3300005288 Bacteria 4774
51 Ga0065714_10018229 3300005288 Bacteria 1773
52 Ga0065714_10066250 3300005288 Bacteria 7275
53 Ga0065714_10089821 3300005288 Bacteria 1966
54 Ga0065714_10091926 3300005288 Bacteria 1891
55 Ga0065704_10071914 3300005289 Bacteria 9619
56 Ga0065704_10076920 3300005289 Bacteria 4926
57 Ga0065704_10163967 3300005289 Bacteria 1335
58 Ga0065704_10186555 3300005289 Bacteria 1210
59 Ga0065712_10003071 3300005290 Bacteria 4592
60 Ga0065712_10068078 3300005290 Bacteria 15415
61 Ga0065712_10069883 3300005290 Bacteria 6577
62 Ga0065715_10021387 3300005293 Bacteria 2597
63 Ga0070658_10002808 3300005327 Bacteria 14470
64 Ga0070658_10096351 3300005327 Bacteria 2443
65 Ga0070683_100011003 3300005329 Bacteria 7797
66 Ga0070670_100002668 3300005331 Bacteria 14731
67 Ga0070670_100005686 3300005331 Bacteria 10531
68 Ga0070680_100008477 3300005336 Bacteria 7871
69 Ga0068868_100228084 3300005338 Bacteria 1562
70 Ga0068868_100436151 3300005338 Bacteria 1137
71 Ga0070660_100051364 3300005339 Bacteria 3175
72 Ga0070660_100166825 3300005339 Bacteria 1777
73 Ga0070691_10002276 3300005341 Bacteria 8495
74 Ga0070661_100001582 3300005344 Bacteria 15792
75 Ga0070661_100001872 3300005344 Bacteria 14557
76 Ga0070661_100071300 3300005344 Bacteria 2557
77 Ga0070661_100367454 3300005344 Bacteria 1132
78 Ga0070669_100000443 3300005353 Bacteria 31632
79 Ga0070669_100000444 3300005353 Bacteria 31573
80 Ga0070669_100045310 3300005353 Bacteria 3205
81 Ga0070669_100083723 3300005353 Bacteria 2379
82 Ga0070659_100033553 3300005366 Bacteria 3987
83 Ga0070659_100083163 3300005366 Bacteria 2558
84 Ga0070708_100099728 3300005445 Bacteria 2658
85 Ga0070678_100094306 3300005456 Bacteria 2304
86 Ga0070662_100000528 3300005457 Bacteria 23086
87 Ga0070681_10018158 3300005458 Bacteria 7031
88 Ga0070681_10026934 3300005458 Bacteria 5780
89 Ga0070681_10151166 3300005458 Bacteria 2248
90 Ga0070706_100063652 3300005467 Bacteria 3408
91 Ga0070698_100003213 3300005471 Bacteria 18005
92 Ga0070679_100134111 3300005530 Bacteria 2457
93 Ga0070684_100004661 3300005535 Bacteria 10467
94 Ga0070684_100107266 3300005535 Bacteria 2501
95 Ga0070684_100686356 3300005535 Bacteria 954
96 Ga0068853_100000031 3300005539 Bacteria 116269
97 Ga0068853_100040481 3300005539 Bacteria 3976
98 Ga0068853_100111544 3300005539 Bacteria 2430
99 Ga0070665_100018130 3300005548 Bacteria 7063
100 Ga0070665_100018865 3300005548 Bacteria 6916
101 Ga0070665_100071342 3300005548 Bacteria 3480
102 Ga0070665_100109082 3300005548 Bacteria 2770
103 Ga0070665_100389172 3300005548 Bacteria 1402
104 Ga0068855_100002880 3300005563 Bacteria 21097
105 Ga0068855_100041138 3300005563 Bacteria 5480
106 Ga0070664_100002881 3300005564 Bacteria 13939
107 Ga0070664_100011952 3300005564 Bacteria 7048
108 Ga0070664_100035365 3300005564 Bacteria 4193
109 Ga0068857_100000144 3300005577 Bacteria 43799
110 Ga0068857_100025370 3300005577 Bacteria 5219
111 Ga0068857_100437814 3300005577 Bacteria 1221
112 Ga0068854_100008049 3300005578 Bacteria 6756
113 Ga0068856_100001498 3300005614 Bacteria 24442
114 Ga0068856_100037831 3300005614 Bacteria 4735
115 Ga0068852_100001466 3300005616 Bacteria 15945
116 Ga0068852_100011372 3300005616 Bacteria 6697
117 Ga0068851_10000007 3300005834 Bacteria 244101
118 Ga0068851_10003178 3300005834 Bacteria 7280
119 Ga0068851_10060819 3300005834 Bacteria 1934
120 Ga0068862_100225380 3300005844 Bacteria 1699
121 Ga0081455_10001851 3300005937 Bacteria 25467
122 Ga0081455_10002478 3300005937 Bacteria 21945
123 Ga0081455_10007317 3300005937 Bacteria 11641
124 Ga0081455_10070944 3300005937 Bacteria 2890
125 Ga0081540_1096962 3300005983 Bacteria 1281
126 Ga0081539_10001293 3300005985 Bacteria 43956
127 Ga0075365_10058682 3300006038 Bacteria 2562
128 Ga0075365_10085414 3300006038 Bacteria 2143
129 Ga0075368_10084364 3300006042 Bacteria 1295
130 Ga0075364_10039244 3300006051 Bacteria 3069
131 Ga0075364_10081343 3300006051 Bacteria 2142
132 Ga0075364_10202325 3300006051 Bacteria 1346
133 Ga0075364_10299589 3300006051 Bacteria 1094
134 Ga0075432_10024396 3300006058 Bacteria 2072
135 Ga0075432_10025172 3300006058 Bacteria 2041
136 Ga0075432_10031235 3300006058 Bacteria 1843
137 Ga0075362_10001824 3300006177 Bacteria 6949
138 Ga0075362_10008747 3300006177 Bacteria 3890
139 Ga0075362_10110684 3300006177 Bacteria 1292
140 Ga0075367_10086307 3300006178 Bacteria 1905
141 Ga0075369_10021742 3300006186 Bacteria 2640
142 Ga0075369_10051060 3300006186 Bacteria 1790
143 Ga0075366_10005136 3300006195 Bacteria 7082
144 Ga0075370_10128420 3300006353 Bacteria 1478
145 Ga0075430_100080904 3300006846 Bacteria 2721
146 Ga0075431_100270441 3300006847 Unclassified 1722
147 Ga0075434_100605287 3300006871 Bacteria 1115
148 Ga0075429_100144120 3300006880 Unclassified 2085
149 Ga0075436_100147002 3300006914 Bacteria 1657
150 Ga0099823_1005494 3300006944 Bacteria 12665
151 Ga0099823_1035626 3300006944 Bacteria 3871
152 Ga0079104_1000344 3300006946 Bacteria 55781
153 Ga0079104_1000632 3300006946 Bacteria 34254
154 Ga0079104_1001022 3300006946 Bacteria 21557
155 Ga0079104_1004706 3300006946 Bacteria 5718
156 Ga0079104_1009810 3300006946 Bacteria 3214
157 Ga0099826_10005746 3300006948 Bacteria 8945
158 Ga0099794_10067924 3300007265 Bacteria 1742
159 Ga0105251_10000009 3300009011 Bacteria 192384
160 Ga0105251_10000033 3300009011 Bacteria 118905
161 Ga0105251_10000133 3300009011 Bacteria 74942
162 Ga0105251_10001647 3300009011 Bacteria 18903
163 Ga0105251_10003640 3300009011 Bacteria 11070
164 Ga0105251_10003744 3300009011 Bacteria 10888
165 Ga0105251_10005297 3300009011 Bacteria 8486
166 Ga0105251_10007830 3300009011 Bacteria 6505
167 Ga0105251_10011743 3300009011 Bacteria 4988
168 Ga0105251_10017218 3300009011 Bacteria 3880
169 Ga0105251_10020891 3300009011 Bacteria 3431
170 Ga0105251_10023119 3300009011 Bacteria 3214
171 Ga0105251_10035081 3300009011 Bacteria 2477
172 Ga0105251_10054776 3300009011 Bacteria 1893
173 Ga0105251_10055323 3300009011 Bacteria 1882
174 Ga0105251_10092596 3300009011 Bacteria 1387
175 Ga0105251_10108315 3300009011 Bacteria 1267
176 Ga0105251_10108525 3300009011 Bacteria 1265
177 Ga0105244_10003048 3300009036 Bacteria 12292
178 Ga0105244_10003452 3300009036 Bacteria 11272
179 Ga0105244_10005869 3300009036 Bacteria 8061
180 Ga0105244_10022548 3300009036 Bacteria 3465
181 Ga0105244_10024238 3300009036 Bacteria 3313
182 Ga0105244_10029705 3300009036 Bacteria 2917
183 Ga0105244_10029966 3300009036 Bacteria 2900
184 Ga0105244_10035250 3300009036 Bacteria 2629
185 Ga0105244_10035450 3300009036 Bacteria 2621
186 Ga0105244_10036556 3300009036 Bacteria 2572
187 Ga0105244_10044191 3300009036 Bacteria 2296
188 Ga0105244_10118523 3300009036 Bacteria 1283
189 Ga0105244_10123265 3300009036 Bacteria 1254
190 Ga0105244_10130193 3300009036 Bacteria 1214
191 Ga0105244_10136904 3300009036 Bacteria 1180
192 Ga0105250_10000561 3300009092 Bacteria 25059
193 Ga0105250_10000858 3300009092 Bacteria 17953
194 Ga0105250_10000911 3300009092 Bacteria 17391
195 Ga0105250_10001236 3300009092 Bacteria 14163
196 Ga0105250_10001898 3300009092 Bacteria 10843
197 Ga0105250_10012019 3300009092 Bacteria 3585
198 Ga0105250_10018754 3300009092 Bacteria 2800
199 Ga0105250_10018989 3300009092 Bacteria 2780
200 Ga0105250_10033340 3300009092 Bacteria 2068
201 Ga0105250_10034590 3300009092 Bacteria 2028
202 Ga0105250_10099541 3300009092 Bacteria 1186
203 Ga0105240_10007190 3300009093 Bacteria 16214
204 Ga0105240_10010321 3300009093 Bacteria 13142
205 Ga0105240_10158156 3300009093 Bacteria 2693
206 Ga0105245_10573556 3300009098 Bacteria 1152
207 Ga0114129_10139767 3300009147 Bacteria 3321
208 Ga0105243_10001569 3300009148 Bacteria 19970
209 Ga0105243_10003513 3300009148 Bacteria 12662
210 Ga0105243_10010213 3300009148 Bacteria 7136
211 Ga0105243_10014634 3300009148 Bacteria 5935
212 Ga0105243_10014954 3300009148 Bacteria 5874
213 Ga0105243_10029833 3300009148 Bacteria 4196
214 Ga0105243_10098759 3300009148 Bacteria 2419
215 Ga0105241_10071110 3300009174 Bacteria 2701
216 Ga0105241_10133494 3300009174 Bacteria 2012
217 Ga0105242_10004710 3300009176 Bacteria 10561
218 Ga0105242_10230729 3300009176 Bacteria 1659
219 Ga0105248_10480941 3300009177 Bacteria 1400
220 Ga0105237_10005959 3300009545 Bacteria 13658
221 Ga0105237_10166274 3300009545 Bacteria 2205
222 Ga0105237_10174357 3300009545 Bacteria 2151
223 Ga0105238_10001694 3300009551 Bacteria 22181
224 Ga0105249_10008191 3300009553 Bacteria 9110
225 Ga0099796_10020266 3300010159 Bacteria 2029
226 Ga0105246_10002168 3300011119 Bacteria 11855
227 Ga0105246_10015946 3300011119 Bacteria 4753
228 Ga0105246_10017211 3300011119 Bacteria 4593
229 Ga0105246_10023277 3300011119 Bacteria 4006
230 Ga0105246_10036391 3300011119 Bacteria 3297
231 Ga0157345_1000051 3300012498 Bacteria 25558
232 Ga0157373_10005026 3300013100 Bacteria 9934
233 Ga0157373_10006705 3300013100 Bacteria 8571
234 Ga0157373_10009024 3300013100 Bacteria 7378
235 Ga0157373_10010609 3300013100 Bacteria 6781
236 Ga0157373_10012301 3300013100 Bacteria 6292
237 Ga0157373_10014072 3300013100 Bacteria 5865
238 Ga0157373_10016622 3300013100 Bacteria 5364
239 Ga0157373_10017022 3300013100 Bacteria 5293
240 Ga0157373_10018309 3300013100 Bacteria 5102
241 Ga0157373_10025490 3300013100 Bacteria 4276
242 Ga0157373_10084697 3300013100 Bacteria 2234
243 Ga0157373_10112065 3300013100 Bacteria 1918
244 Ga0157373_10147076 3300013100 Bacteria 1657
245 Ga0157373_10210126 3300013100 Bacteria 1372
246 Ga0157371_10000147 3300013102 Bacteria 102369
247 Ga0157371_10001869 3300013102 Bacteria 21084
248 Ga0157371_10002249 3300013102 Bacteria 18639
249 Ga0157371_10003783 3300013102 Bacteria 13545
250 Ga0157371_10005611 3300013102 Bacteria 10550
251 Ga0157371_10010181 3300013102 Bacteria 7344
252 Ga0157371_10018665 3300013102 Bacteria 5124
253 Ga0157371_10021423 3300013102 Bacteria 4746
254 Ga0157371_10037860 3300013102 Bacteria 3451
255 Ga0157371_10300494 3300013102 Bacteria 1162
256 Ga0157370_10000265 3300013104 Bacteria 66558
257 Ga0157370_10008197 3300013104 Bacteria 11290
258 Ga0157370_10021128 3300013104 Bacteria 6491
259 Ga0157370_10023872 3300013104 Bacteria 6065
260 Ga0157370_10041422 3300013104 Bacteria 4443
261 Ga0157370_10194116 3300013104 Bacteria 1884
262 Ga0157370_10207502 3300013104 Bacteria 1816
263 Ga0157369_10001339 3300013105 Bacteria 30420
264 Ga0157369_10003275 3300013105 Bacteria 19285
265 Ga0157369_10004624 3300013105 Bacteria 16176
266 Ga0157369_10015293 3300013105 Bacteria 8654
267 Ga0157369_10016498 3300013105 Bacteria 8307
268 Ga0157369_10035235 3300013105 Bacteria 5488
269 Ga0157369_10044710 3300013105 Bacteria 4819
270 Ga0157369_10048379 3300013105 Bacteria 4614
271 Ga0157369_10159391 3300013105 Bacteria 2382
272 Ga0157369_10647962 3300013105 Bacteria 1089
273 Ga0157374_10122903 3300013296 Bacteria 2507
274 Ga0157378_10428942 3300013297 Bacteria 1308
275 Ga0163162_10006188 3300013306 Bacteria 11596
276 Ga0163162_10057186 3300013306 Bacteria 3928
277 Ga0163162_10157675 3300013306 Bacteria 2390
278 Ga0163162_10307648 3300013306 Bacteria 1717
279 Ga0157372_10000991 3300013307 Bacteria 31049
280 Ga0157372_10005148 3300013307 Bacteria 13899
281 Ga0157372_10008332 3300013307 Bacteria 11024
282 Ga0157372_10021449 3300013307 Bacteria 6979
283 Ga0157375_10004938 3300013308 Bacteria 11600
284 Ga0157375_10009034 3300013308 Bacteria 8725
285 Ga0157375_10023654 3300013308 Bacteria 5673
286 Ga0157375_10095333 3300013308 Bacteria 3046
287 Ga0182008_10001897 3300014497 Bacteria 13535
288 Ga0182008_10002044 3300014497 Bacteria 12949
289 Ga0182008_10002966 3300014497 Bacteria 10443
290 Ga0182008_10003039 3300014497 Bacteria 10297
291 Ga0182008_10003146 3300014497 Bacteria 10101
292 Ga0182008_10007265 3300014497 Bacteria 6125
293 Ga0182008_10013860 3300014497 Bacteria 4232
294 Ga0182008_10017701 3300014497 Bacteria 3694
295 Ga0182008_10028229 3300014497 Bacteria 2837
296 Ga0182008_10075576 3300014497 Bacteria 1657
297 Ga0182008_10078181 3300014497 Bacteria 1628
298 Ga0182008_10093275 3300014497 Bacteria 1485
299 Ga0182006_1002087 3300015261 Bacteria 11172
300 Ga0182006_1002357 3300015261 Bacteria 10372
301 Ga0182006_1002509 3300015261 Bacteria 9978
302 Ga0182006_1003702 3300015261 Bacteria 7736
303 Ga0182006_1003978 3300015261 Bacteria 7394
304 Ga0182006_1006022 3300015261 Bacteria 5679
305 Ga0182006_1006430 3300015261 Bacteria 5461
306 Ga0182006_1060433 3300015261 Bacteria 1432
307 Ga0182007_10000858 3300015262 Bacteria 16896
308 Ga0182007_10002483 3300015262 Bacteria 9143
309 Ga0182005_1001831 3300015265 Bacteria 8093
310 Ga0182005_1001921 3300015265 Bacteria 7874
311 Ga0182005_1008449 3300015265 Bacteria 3031
312 Ga0182005_1031916 3300015265 Bacteria 1434
313 Ga0183366_1001 3300015679 Bacteria 2743932
314 Ga0183370_1001 3300015680 Bacteria 2743932
315 Ga0183369_1001 3300015685 Bacteria 2743932
316 Ga0183368_1001 3300015687 Bacteria 2743932
317 Ga0163161_10003433 3300017792 Bacteria 11107
318 Ga0163161_10007206 3300017792 Bacteria 7687
319 Ga0163161_10007625 3300017792 Bacteria 7485
320 Ga0163161_10007868 3300017792 Bacteria 7372
321 Ga0163161_10011091 3300017792 Bacteria 6242
322 Ga0163161_10017166 3300017792 Bacteria 5062
323 Ga0163161_10082799 3300017792 Bacteria 2365
324 Ga0163161_10158020 3300017792 Bacteria 1727
325 Ga0163161_10202445 3300017792 Bacteria 1530
326 Ga0163161_10296376 3300017792 Bacteria 1272
327 Ga0213876_10039915 3300021384 Bacteria 2480
328 Ga0213871_10000355 3300021441 Bacteria 5925
329 Ga0209435_100796 3300025206 Bacteria 5062
330 Ga0209760_100027 3300025207 Bacteria 153290
331 Ga0209760_100116 3300025207 Bacteria 57253
332 Ga0209760_100119 3300025207 Bacteria 54278
333 Ga0209784_100007 3300025224 Bacteria 747715
334 Ga0209566_100009 3300025225 Bacteria 554018
335 Ga0209674_100021 3300025226 Bacteria 629811
336 Ga0209672_100025 3300025228 Bacteria 350006
337 Ga0209147_100009 3300025229 Bacteria 747409
338 Ga0209147_100032 3300025229 Bacteria 350006
339 Ga0209563_100018 3300025230 Bacteria 747850
340 Ga0209563_107683 3300025230 Bacteria 1753
341 Ga0207427_100003 3300025231 Bacteria 1035004
342 Ga0207427_100005 3300025231 Bacteria 797999
343 Ga0207427_100006 3300025231 Bacteria 785415
344 Ga0209437_100002 3300025233 Bacteria 1574801
345 Ga0209437_100013 3300025233 Bacteria 785457
346 Ga0209437_100018 3300025233 Bacteria 694400
347 Ga0209258_100050 3300025242 Bacteria 350006
348 Ga0209258_100249 3300025242 Bacteria 98135
349 Ga0209646_1001197 3300025246 Bacteria 7493
350 Ga0209677_100012 3300025253 Bacteria 554018
351 Ga0209148_1000060 3300025254 Bacteria 350006
352 Ga0209233_1000004 3300025261 Bacteria 1574798
353 Ga0209233_1000021 3300025261 Bacteria 798078
354 Ga0209233_1000022 3300025261 Bacteria 785415
355 Ga0209455_1000055 3300025272 Bacteria 350006
356 Ga0209673_1000513 3300025273 Bacteria 63654
357 Ga0209130_1000403 3300025284 Bacteria 47298
358 Ga0209676_1000015 3300025292 Bacteria 784458
359 Ga0209676_1000030 3300025292 Bacteria 506421
360 Ga0209676_1000041 3300025292 Bacteria 424583
361 Ga0209676_1003229 3300025292 Bacteria 10291
362 Ga0209676_1006073 3300025292 Bacteria 6080
363 Ga0209025_1000224 3300025294 Bacteria 133328
364 Ga0209564_1006950 3300025295 Bacteria 5944
365 Ga0209758_1000350 3300025297 Bacteria 84141
366 Ga0209758_1001111 3300025297 Bacteria 34637
367 Ga0209050_1000024 3300025298 Bacteria 533389
368 Ga0209050_1000030 3300025298 Bacteria 463381
369 Ga0209050_1000332 3300025298 Bacteria 94224
370 Ga0209050_1001625 3300025298 Bacteria 23066
371 Ga0207426_1000151 3300025302 Bacteria 185103
372 Ga0207426_1004145 3300025302 Bacteria 7264
373 Ga0209051_1000012 3300025303 Bacteria 595474
374 Ga0209051_1000660 3300025303 Bacteria 38923
375 Ga0209051_1000672 3300025303 Bacteria 38341
376 Ga0209257_1000262 3300025304 Bacteria 121021
377 Ga0209257_1011361 3300025304 Bacteria 4298
378 Ga0207656_10000015 3300025321 Bacteria 125447
379 Ga0207696_1000020 3300025711 Bacteria 434998
380 Ga0207696_1000031 3300025711 Bacteria 384169
381 Ga0207696_1000050 3300025711 Bacteria 276983
382 Ga0207696_1000080 3300025711 Bacteria 199217
383 Ga0207696_1000127 3300025711 Bacteria 135531
384 Ga0207696_1001769 3300025711 Bacteria 11139
385 Ga0207696_1005733 3300025711 Bacteria 5107
386 Ga0207696_1006450 3300025711 Bacteria 4725
387 Ga0207696_1007083 3300025711 Bacteria 4433
388 Ga0207696_1008117 3300025711 Bacteria 4048
389 Ga0207696_1012374 3300025711 Bacteria 3019
390 Ga0207655_1000100 3300025728 Bacteria 186348
391 Ga0207655_1000401 3300025728 Bacteria 60151
392 Ga0207655_1000446 3300025728 Bacteria 54520
393 Ga0207655_1000597 3300025728 Bacteria 44104
394 Ga0207655_1000868 3300025728 Bacteria 32083
395 Ga0207655_1001125 3300025728 Bacteria 26127
396 Ga0207655_1003650 3300025728 Bacteria 11358
397 Ga0207655_1004572 3300025728 Bacteria 9747
398 Ga0207655_1010623 3300025728 Bacteria 5567
399 Ga0207655_1013085 3300025728 Bacteria 4788
400 Ga0207655_1021403 3300025728 Bacteria 3283
401 Ga0207655_1022092 3300025728 Bacteria 3203
402 Ga0207655_1022496 3300025728 Bacteria 3158
403 Ga0207655_1023041 3300025728 Bacteria 3101
404 Ga0207655_1028590 3300025728 Bacteria 2627
405 Ga0207655_1032011 3300025728 Bacteria 2411
406 Ga0207655_1033325 3300025728 Bacteria 2337
407 Ga0207655_1075772 3300025728 Bacteria 1233
408 Ga0207713_1000029 3300025735 Bacteria 285054
409 Ga0207713_1000032 3300025735 Bacteria 276465
410 Ga0207713_1000079 3300025735 Bacteria 172274
411 Ga0207713_1000126 3300025735 Bacteria 118913
412 Ga0207713_1000249 3300025735 Bacteria 68771
413 Ga0207713_1000427 3300025735 Bacteria 44600
414 Ga0207713_1000784 3300025735 Bacteria 29393
415 Ga0207713_1001471 3300025735 Bacteria 18667
416 Ga0207713_1001907 3300025735 Bacteria 15792
417 Ga0207713_1001912 3300025735 Bacteria 15776
418 Ga0207713_1001947 3300025735 Bacteria 15618
419 Ga0207713_1002962 3300025735 Bacteria 11864
420 Ga0207713_1002963 3300025735 Bacteria 11864
421 Ga0207713_1007222 3300025735 Bacteria 6607
422 Ga0207713_1007514 3300025735 Bacteria 6413
423 Ga0207713_1007642 3300025735 Bacteria 6331
424 Ga0207713_1009464 3300025735 Bacteria 5488
425 Ga0207713_1009897 3300025735 Bacteria 5331
426 Ga0207713_1013460 3300025735 Bacteria 4308
427 Ga0207713_1026892 3300025735 Bacteria 2624
428 Ga0207713_1038663 3300025735 Bacteria 2022
429 Ga0207713_1066692 3300025735 Bacteria 1346
430 Ga0207705_10007165 3300025909 Bacteria 8214
431 Ga0207684_10041459 3300025910 Bacteria 3903
432 Ga0207707_10003527 3300025912 Bacteria 13853
433 Ga0207707_10040573 3300025912 Bacteria 4065
434 Ga0207695_10012606 3300025913 Bacteria 10130
435 Ga0207695_10016461 3300025913 Bacteria 8650
436 Ga0207671_10000027 3300025914 Bacteria 264907
437 Ga0207671_10108225 3300025914 Bacteria 2112
438 Ga0207693_10150129 3300025915 Bacteria 1833
439 Ga0207660_10032043 3300025917 Bacteria 3625
440 Ga0207657_10077024 3300025919 Bacteria 2812
441 Ga0207657_10155854 3300025919 Bacteria 1857
442 Ga0207649_10000012 3300025920 Bacteria 265674
443 Ga0207652_10234386 3300025921 Bacteria 1654
444 Ga0207646_10376656 3300025922 Bacteria 1282
445 Ga0207681_10000138 3300025923 Bacteria 60354
446 Ga0207681_10001239 3300025923 Bacteria 16453
447 Ga0207681_10001902 3300025923 Bacteria 13368
448 Ga0207681_10109133 3300025923 Bacteria 2010
449 Ga0207694_10033017 3300025924 Bacteria 3964
450 Ga0207650_10000639 3300025925 Bacteria 27847
451 Ga0207650_10000642 3300025925 Bacteria 27786
452 Ga0207650_10158995 3300025925 Bacteria 1789
453 Ga0207664_10012275 3300025929 Bacteria 6122
454 Ga0207644_10209736 3300025931 Bacteria 1540
455 Ga0207690_10063361 3300025932 Bacteria 2520
456 Ga0207690_10137821 3300025932 Bacteria 1794
457 Ga0207706_10000312 3300025933 Bacteria 52431
458 Ga0207706_10004172 3300025933 Bacteria 13606
459 Ga0207686_10002070 3300025934 Bacteria 11056
460 Ga0207686_10014355 3300025934 Bacteria 4406
461 Ga0207709_10000061 3300025935 Bacteria 199097
462 Ga0207709_10000558 3300025935 Bacteria 31766
463 Ga0207709_10003388 3300025935 Bacteria 9524
464 Ga0207709_10004027 3300025935 Bacteria 8563
465 Ga0207709_10006308 3300025935 Bacteria 6657
466 Ga0207709_10006878 3300025935 Bacteria 6367
467 Ga0207709_10027783 3300025935 Bacteria 3264
468 Ga0207709_10043174 3300025935 Bacteria 2716
469 Ga0207665_10138416 3300025939 Bacteria 1734
470 Ga0207661_10223628 3300025944 Bacteria 1664
471 Ga0207679_10000015 3300025945 Bacteria 265674
472 Ga0207679_10071473 3300025945 Bacteria 2618
473 Ga0207679_10155013 3300025945 Bacteria 1869
474 Ga0207667_10002821 3300025949 Bacteria 21552
475 Ga0207667_10004426 3300025949 Bacteria 17199
476 Ga0207712_10014098 3300025961 Bacteria 5130
477 Ga0207712_10299890 3300025961 Bacteria 1318
478 Ga0207640_10011607 3300025981 Bacteria 4992
479 Ga0207640_10013478 3300025981 Bacteria 4688
480 Ga0207639_10000146 3300026041 Bacteria 53109
481 Ga0207702_10012298 3300026078 Bacteria 7124
482 Ga0207674_10000020 3300026116 Bacteria 162474
483 Ga0207674_10076058 3300026116 Bacteria 3366
484 Ga0207674_10144440 3300026116 Bacteria 2338
485 Ga0207683_10010692 3300026121 Bacteria 7822
486 Ga0207698_10005091 3300026142 Bacteria 8069
487 Ga0209281_1000016 3300027111 Bacteria 588107
488 Ga0209281_1000019 3300027111 Bacteria 576164
489 Ga0209281_1000605 3300027111 Bacteria 40613
490 Ga0209281_1000611 3300027111 Bacteria 40256
491 Ga0209281_1004592 3300027111 Bacteria 4093
492 Ga0209281_1022105 3300027111 Bacteria 1222
493 Ga0209389_1000213 3300027296 Bacteria 40739
494 Ga0209389_1080368 3300027296 Bacteria 1576
495 Ga0209371_1000001 3300027312 Bacteria 2771503
496 Ga0209371_1000228 3300027312 Bacteria 72315
497 Ga0209371_1000278 3300027312 Bacteria 59137
498 Ga0209371_1000311 3300027312 Bacteria 54076
499 Ga0209371_1000551 3300027312 Bacteria 34703
500 Ga0209371_1004717 3300027312 Bacteria 5779
501 Ga0209371_1013051 3300027312 Bacteria 2362
502 Ga0209371_1016217 3300027312 Bacteria 1973
503 Ga0209996_1002056 3300027395 Bacteria 2481
504 Ga0209995_1001892 3300027471 Bacteria 3277
505 Ga0209999_1004224 3300027543 Bacteria 2584
506 Ga0209282_1026535 3300027666 Bacteria 3607
507 Ga0209971_1001201 3300027682 Bacteria 6510
508 Ga0209974_10003879 3300027876 Bacteria 5355
509 Ga0207428_10026090 3300027907 Bacteria 4881
510 Ga0207428_10073628 3300027907 Bacteria 2679
511 Ga0207428_10083525 3300027907 Bacteria 2491
512 Ga0207428_10138007 3300027907 Bacteria 1864
513 Ga0268266_10004061 3300028379 Bacteria 14147
514 Ga0268266_10040487 3300028379 Bacteria 3971
515 Ga0268266_10084353 3300028379 Bacteria 2774
516 Ga0268266_10108917 3300028379 Bacteria 2452
517 Ga0268266_10352517 3300028379 Bacteria 1383
518 Ga0307517_10051807 3300028786 Bacteria 4131
519 Ga0307517_10090210 3300028786 Bacteria 2517
520 Ga0307515_10008688 3300028794 Bacteria 19755
521 Ga0268256_1000001 3300030500 Bacteria 2771065
522 Ga0268256_1000188 3300030500 Bacteria 72315
523 Ga0268256_1000231 3300030500 Bacteria 59137
524 Ga0268256_1000268 3300030500 Bacteria 54076
525 Ga0268256_1000872 3300030500 Bacteria 21032
526 Ga0268256_1004514 3300030500 Bacteria 5757
527 Ga0268256_1014305 3300030500 Bacteria 2362
528 Ga0268256_1018298 3300030500 Bacteria 1948
529 Ga0307511_10004225 3300030521 Bacteria 14660
530 Ga0307511_10050445 3300030521 Bacteria 3351
531 Ga0307511_10061190 3300030521 Bacteria 2872
532 Ga0314311_1154416 3300030733 Bacteria 7453
533 Ga0316178_1002751 3300030735 Bacteria 21497
534 Ga0316183_1078778 3300030742 Bacteria 1422
535 Ga0316183_1126843 3300030742 Bacteria 3309
536 Ga0316181_1041594 3300030744 Bacteria 6727
537 Ga0265332_10067104 3300031238 Bacteria 1530
538 Ga0265340_10025165 3300031247 Bacteria 3018
539 Ga0265340_10091773 3300031247 Bacteria 1419
540 Ga0307509_10010578 3300031507 Bacteria 11281
541 Ga0307408_100000002 3300031548 Bacteria 827227
542 Ga0307408_100002873 3300031548 Bacteria 11934
543 Ga0307408_100004562 3300031548 Bacteria 9380
544 Ga0307408_100005109 3300031548 Bacteria 8809
545 Ga0307508_10001872 3300031616 Bacteria 23175
546 Ga0307514_10214367 3300031649 Bacteria 1190
547 Ga0316576_10092861 3300031727 Bacteria 2249
548 Ga0307405_10000832 3300031731 Bacteria 12143
549 Ga0307405_10001657 3300031731 Bacteria 9484
550 Ga0307405_10004020 3300031731 Bacteria 6900
551 Ga0307413_10091461 3300031824 Bacteria 1982
552 Ga0307406_10001920 3300031901 Bacteria 11320
553 Ga0307407_10013462 3300031903 Bacteria 3971
554 Ga0307407_10110500 3300031903 Bacteria 1724
555 Ga0307412_10001709 3300031911 Bacteria 12140
556 Ga0307412_10002078 3300031911 Bacteria 11116
557 Ga0307412_10011163 3300031911 Bacteria 5196
558 Ga0307412_10032217 3300031911 Bacteria 3318
559 Ga0307412_10082649 3300031911 Bacteria 2224
560 Ga0307412_10449187 3300031911 Bacteria 1061
561 Ga0307409_100025721 3300031995 Bacteria 4135
562 Ga0307409_100218574 3300031995 Bacteria 1718
563 Ga0307416_100051550 3300032002 Bacteria 3288
564 Ga0307414_10004509 3300032004 Bacteria 7570
565 Ga0307414_10027220 3300032004 Bacteria 3691
566 Ga0307411_10018627 3300032005 Bacteria 3988
567 Ga0307411_10057514 3300032005 Bacteria 2569
568 Ga0307507_10118549 3300033179 Bacteria 2127
569 Ga0307510_10000983 3300033180 Bacteria 30234
570 Ga0373930_0019898 3300034816 Bacteria 1303
571 Ga0373928_0033584 3300035084 Bacteria 1148
572 Ga0373941_0035837 3300035115 Bacteria 1505
573 Ga0316574_0038056 3300035398 Bacteria 2952
574 Ga0373931_0022171 3300035691 Bacteria 3194
575 Ga0373931_0324504 3300035691 Bacteria 957
576 Ga0373927_0265013 3300035695 Bacteria 1130
577 Ga0373947_0142170 3300035725 Bacteria 1540
578 Ga0373947_0228903 3300035725 Bacteria 1224
579 Ga0373937_0186180 3300036401 Bacteria 1950
580 Ga0373925_0368132 3300037068 Bacteria 1169
581 Ga0395899_0042131 3300037312 Bacteria 3409
582 Ga0395899_0059184 3300037312 Bacteria 2824
583 Ga0395900_0021617 3300037418 Bacteria 6577
584 Ga0395900_0097455 3300037418 Bacteria 3021
585 Ga0395900_0099955 3300037418 Bacteria 2979
586 Ga0395905_0315726 3300037471 Bacteria 1452
587 Ga0395901_0007074 3300038443 Bacteria 11341
588 Ga0395901_0017073 3300038443 Bacteria 7399
589 Ga0395901_0113195 3300038443 Bacteria 2849
590 Ga0395901_0156410 3300038443 Bacteria 2394
591 Ga0436365_0298705 3300039437 Bacteria 4893
592 Ga0436360_1076911 3300039438 Bacteria 12198
593 Ga0436361_0167998 3300039447 Bacteria 2317
594 Ga0439436_0000080 3300041404 Bacteria 23957
595 Ga0439438_000310 3300041405 Bacteria 21984
596 Ga0439438_000765 3300041405 Bacteria 14408
597 Ga0439438_000839 3300041405 Bacteria 13701
598 Ga0439438_001494 3300041405 Bacteria 10306
599 Ga0439438_002207 3300041405 Bacteria 8376
600 Ga0439438_002474 3300041405 Bacteria 7860
601 Ga0439438_002800 3300041405 Bacteria 7289
602 Ga0439438_009946 3300041405 Bacteria 3048
603 Ga0439438_010767 3300041405 Bacteria 2878
604 Ga0439438_026223 3300041405 Bacteria 1581
605 Ga0439438_029770 3300041405 Bacteria 1460
606 Ga0439438_037247 3300041405 Bacteria 1272
607 Ga0439447_000170 3300041407 Bacteria 22498
608 Ga0439447_000907 3300041407 Bacteria 10825
609 Ga0439447_001590 3300041407 Bacteria 8316
610 Ga0439447_003261 3300041407 Bacteria 5770
611 Ga0439447_010575 3300041407 Bacteria 2733
612 Ga0439447_015423 3300041407 Bacteria 2119
613 Ga0439447_021990 3300041407 Bacteria 1674
614 Ga0439447_022880 3300041407 Bacteria 1632
615 Ga0439466_0000196 3300041411 Bacteria 24028
616 Ga0439466_0000328 3300041411 Bacteria 18268
617 Ga0439466_0002642 3300041411 Bacteria 7009
618 Ga0439466_0005127 3300041411 Bacteria 5022
619 Ga0439466_0005174 3300041411 Bacteria 4995
620 Ga0439466_0006040 3300041411 Bacteria 4611
621 Ga0439466_0012147 3300041411 Bacteria 3178
622 Ga0439466_0018940 3300041411 Bacteria 2465
623 Ga0439466_0020579 3300041411 Bacteria 2349
624 Ga0439466_0022043 3300041411 Bacteria 2251
625 Ga0439466_0038308 3300041411 Bacteria 1610
626 Ga0439466_0043873 3300041411 Bacteria 1483
627 Ga0439431_0002297 3300041997 Bacteria 4220
628 Ga0439431_0046729 3300041997 Bacteria 1114
629 Ga0439441_033552 3300042001 Bacteria 1005
630 Ga0439445_0004179 3300042004 Bacteria 3263
631 Ga0439445_0011138 3300042004 Bacteria 2139
632 Ga0439445_0043117 3300042004 Bacteria 1203
633 Ga0439448_0012071 3300042005 Bacteria 2580
634 Ga0439432_000538 3300042006 Bacteria 14099
635 Ga0439432_002588 3300042006 Bacteria 6812
636 Ga0439432_004306 3300042006 Bacteria 5203
637 Ga0439432_006289 3300042006 Bacteria 4247
638 Ga0439432_018381 3300042006 Bacteria 2336
639 Ga0439432_031848 3300042006 Bacteria 1703
640 Ga0439451_004895 3300042009 Bacteria 2726
641 Ga0439451_007159 3300042009 Bacteria 2278
642 Ga0439451_007238 3300042009 Bacteria 2264
643 Ga0439451_011057 3300042009 Bacteria 1820
644 Ga0439451_013214 3300042009 Bacteria 1668
645 Ga0439451_017117 3300042009 Bacteria 1460
646 Ga0439452_000432 3300042010 Bacteria 24103
647 Ga0439452_000464 3300042010 Bacteria 22740
648 Ga0439452_000633 3300042010 Bacteria 17718
649 Ga0439452_000662 3300042010 Bacteria 17058
650 Ga0439452_001172 3300042010 Bacteria 11310
651 Ga0439452_004938 3300042010 Bacteria 4375
652 Ga0439452_006149 3300042010 Bacteria 3787
653 Ga0439452_012245 3300042010 Bacteria 2446
654 Ga0439456_000017 3300042013 Bacteria 62739
655 Ga0439456_000188 3300042013 Bacteria 17934
656 Ga0439456_001652 3300042013 Bacteria 4504
657 Ga0439456_008813 3300042013 Bacteria 2085
658 Ga0439456_024458 3300042013 Bacteria 1281
659 Ga0439463_000210 3300042016 Bacteria 15845
660 Ga0439463_000660 3300042016 Bacteria 9566
661 Ga0439463_023473 3300042016 Bacteria 1544
662 Ga0450911_000697 3300042115 Bacteria 9841
663 Ga0450911_001680 3300042115 Bacteria 4887
664 Ga0450911_003197 3300042115 Bacteria 2950
665 Ga0450890_000886 3300042127 Bacteria 4337
666 Ga0450902_001321 3300042137 Bacteria 3349
667 Ga0450902_001631 3300042137 Bacteria 3089
668 Ga0450902_004930 3300042137 Bacteria 2002
669 Ga0450902_009790 3300042137 Bacteria 1512
670 Ga0450903_009094 3300042138 Bacteria 1622
671 Ga0450904_000089 3300042139 Bacteria 20675
672 Ga0450904_001216 3300042139 Bacteria 3876
673 Ga0450905_000239 3300042142 Bacteria 6370
674 Ga0450905_000332 3300042142 Bacteria 5648
675 Ga0450905_002238 3300042142 Bacteria 2475
676 Ga0450889_006147 3300042144 Bacteria 1203
677 Ga0450906_000485 3300042145 Bacteria 8379
678 Ga0450906_001940 3300042145 Bacteria 4523
679 Ga0450907_000099 3300042146 Bacteria 33397
680 Ga0450907_000147 3300042146 Bacteria 26825
681 Ga0450907_001664 3300042146 Bacteria 4652
682 Ga0450907_007701 3300042146 Bacteria 1796
683 Ga0450910_000048 3300042147 Bacteria 12313
684 Ga0450910_002333 3300042147 Bacteria 2485
685 Ga0439446_0003869 3300042156 Bacteria 3755
686 Ga0439446_0007125 3300042156 Bacteria 2933
687 Ga0439446_0009441 3300042156 Bacteria 2611
688 Ga0450909_012498 3300042185 Bacteria 1245
689 Ga0439434_0000163 3300042435 Bacteria 17958
690 Ga0439434_0001007 3300042435 Bacteria 8144
691 Ga0439459_0006721 3300042438 Bacteria 1926
692 Ga0439464_0002644 3300042439 Bacteria 4435
693 Ga0439464_0006320 3300042439 Bacteria 3082
694 Ga0439464_0008879 3300042439 Bacteria 2635
695 Ga0439460_0006235 3300042461 Bacteria 2952
696 Ga0439460_0013674 3300042461 Bacteria 2126
697 Ga0450918_006396 3300042531 Bacteria 2102
698 Ga0450893_0010474 3300042532 Bacteria 1524
699 Ga0450901_000260 3300042533 Bacteria 6404
700 Ga0450901_001058 3300042533 Bacteria 3189
701 Ga0439440_0000517 3300042993 Bacteria 6499
702 Ga0439440_0036592 3300042993 Bacteria 1181
703 Ga0466981_0000027 3300044669 Bacteria 71694
704 Ga0466963_0033206 3300044694 Bacteria 3348
705 Ga0466967_0122982 3300045976 Bacteria 2400
706 Ga0495617_002385 3300046452 Bacteria 7487
707 Ga0495617_003484 3300046452 Bacteria 5906
708 Ga0495617_004037 3300046452 Bacteria 5393
709 Ga0495617_006943 3300046452 Bacteria 3952
710 Ga0495617_008364 3300046452 Bacteria 3569
711 Ga0495617_015221 3300046452 Bacteria 2609
712 Ga0495617_065761 3300046452 Bacteria 1195
713 Ga0495617_071449 3300046452 Bacteria 1141
714 Ga0495627_000095 3300046453 Bacteria 108094
715 Ga0495627_000368 3300046453 Bacteria 41878
716 Ga0495627_001110 3300046453 Bacteria 17534
717 Ga0495627_001419 3300046453 Bacteria 14103
718 Ga0495627_001460 3300046453 Bacteria 13843
719 Ga0495627_002741 3300046453 Bacteria 8204
720 Ga0495627_005774 3300046453 Bacteria 4930
721 Ga0495627_008441 3300046453 Bacteria 3863
722 Ga0495627_013660 3300046453 Bacteria 2854
723 Ga0495627_030802 3300046453 Bacteria 1699
724 Ga0495603_0023413 3300046455 Bacteria 3737
725 Ga0495603_0060632 3300046455 Bacteria 2235
726 Ga0495590_0000880 3300046457 Bacteria 13468
727 Ga0495590_0002408 3300046457 Bacteria 7741
728 Ga0495590_0036700 3300046457 Bacteria 1709
729 Ga0495590_0037124 3300046457 Bacteria 1699
730 Ga0495591_000198 3300046458 Bacteria 61546
731 Ga0495591_000279 3300046458 Bacteria 47697
732 Ga0495591_000546 3300046458 Bacteria 28853
733 Ga0495591_000561 3300046458 Bacteria 28513
734 Ga0495591_001131 3300046458 Bacteria 17598
735 Ga0495591_002349 3300046458 Bacteria 10635
736 Ga0495591_003158 3300046458 Bacteria 8697
737 Ga0495591_003739 3300046458 Bacteria 7703
738 Ga0495591_003991 3300046458 Bacteria 7389
739 Ga0495591_012056 3300046458 Bacteria 3239
740 Ga0495591_012169 3300046458 Bacteria 3214
741 Ga0495591_017701 3300046458 Bacteria 2438
742 Ga0495591_022010 3300046458 Bacteria 2068
743 Ga0495591_036100 3300046458 Bacteria 1441
744 Ga0495629_0106456 3300046459 Bacteria 1956
745 Ga0495638_0002209 3300046460 Bacteria 16237
746 Ga0495638_0003242 3300046460 Bacteria 12863
747 Ga0495638_0006351 3300046460 Bacteria 8608
748 Ga0495638_0021214 3300046460 Bacteria 4284
749 Ga0495638_0033608 3300046460 Bacteria 3279
750 Ga0495638_0034788 3300046460 Bacteria 3215
751 Ga0495638_0045614 3300046460 Bacteria 2756
752 Ga0495638_0055513 3300046460 Bacteria 2459
753 Ga0495638_0058515 3300046460 Bacteria 2388
754 Ga0495653_0000344 3300046463 Bacteria 37880
755 Ga0495653_0008460 3300046463 Bacteria 8438
756 Ga0495653_0008904 3300046463 Bacteria 8206
757 Ga0495653_0017177 3300046463 Bacteria 5884
758 Ga0495653_0138468 3300046463 Bacteria 1714
759 Ga0495650_0002237 3300046471 Bacteria 16193
760 Ga0495650_0009166 3300046471 Bacteria 5667
761 Ga0495650_0009578 3300046471 Bacteria 5495
762 Ga0495650_0013441 3300046471 Bacteria 4326
763 Ga0495650_0015789 3300046471 Bacteria 3859
764 Ga0495650_0016789 3300046471 Bacteria 3691
765 Ga0495650_0021347 3300046471 Bacteria 3133
766 Ga0495650_0030767 3300046471 Bacteria 2425
767 Ga0495582_0008143 3300046473 Bacteria 5785
768 Ga0495605_0000122 3300046474 Bacteria 101994
769 Ga0495605_0000896 3300046474 Bacteria 20517
770 Ga0495605_0001053 3300046474 Bacteria 18414
771 Ga0495605_0001101 3300046474 Bacteria 17989
772 Ga0495605_0002412 3300046474 Bacteria 11554
773 Ga0495605_0009873 3300046474 Bacteria 5353
774 Ga0495605_0011563 3300046474 Bacteria 4916
775 Ga0495605_0018459 3300046474 Bacteria 3738
776 Ga0495605_0025408 3300046474 Bacteria 3086
777 Ga0495605_0026538 3300046474 Bacteria 3010
778 Ga0495605_0040927 3300046474 Bacteria 2310
779 Ga0495605_0094225 3300046474 Bacteria 1383
780 Ga0495639_0000213 3300046475 Bacteria 29960
781 Ga0495639_0005024 3300046475 Bacteria 5677
782 Ga0495584_0001705 3300046491 Bacteria 12886
783 Ga0495584_0001823 3300046491 Bacteria 12379
784 Ga0495584_0004226 3300046491 Bacteria 7747
785 Ga0495584_0004685 3300046491 Bacteria 7327
786 Ga0495584_0005757 3300046491 Bacteria 6539
787 Ga0495584_0007268 3300046491 Bacteria 5778
788 Ga0495584_0011782 3300046491 Bacteria 4471
789 Ga0495584_0022347 3300046491 Bacteria 3209
790 Ga0495584_0028584 3300046491 Bacteria 2826
791 Ga0495584_0060956 3300046491 Bacteria 1896
792 Ga0495584_0104851 3300046491 Bacteria 1429
793 Ga0495585_0001336 3300046492 Bacteria 19592
794 Ga0495585_0004194 3300046492 Bacteria 9411
795 Ga0495585_0005273 3300046492 Bacteria 8173
796 Ga0495585_0021927 3300046492 Bacteria 3666
797 Ga0495585_0022677 3300046492 Bacteria 3603
798 Ga0495585_0024877 3300046492 Bacteria 3432
799 Ga0495585_0027510 3300046492 Bacteria 3245
800 Ga0495585_0050756 3300046492 Bacteria 2300
801 Ga0495585_0101348 3300046492 Bacteria 1539
802 Ga0495585_0114374 3300046492 Bacteria 1432
803 Ga0495594_0020267 3300046499 Bacteria 3541
804 Ga0495594_0022200 3300046499 Bacteria 3393
805 Ga0495594_0040864 3300046499 Bacteria 2539
806 Ga0495594_0134006 3300046499 Bacteria 1403
807 Ga0495596_0002642 3300046500 Bacteria 9486
808 Ga0495596_0003684 3300046500 Bacteria 7663
809 Ga0495607_0000973 3300046501 Bacteria 26535
810 Ga0495607_0001789 3300046501 Bacteria 18343
811 Ga0495607_0005262 3300046501 Bacteria 9311
812 Ga0495607_0006894 3300046501 Bacteria 7922
813 Ga0495607_0008710 3300046501 Bacteria 6912
814 Ga0495607_0010249 3300046501 Bacteria 6304
815 Ga0495607_0013248 3300046501 Bacteria 5411
816 Ga0495607_0016933 3300046501 Bacteria 4693
817 Ga0495607_0018773 3300046501 Bacteria 4398
818 Ga0495607_0028985 3300046501 Bacteria 3409
819 Ga0495607_0038024 3300046501 Bacteria 2886
820 Ga0495607_0079219 3300046501 Bacteria 1810
821 Ga0495607_0090773 3300046501 Bacteria 1655
822 Ga0495607_0098176 3300046501 Bacteria 1573
823 Ga0495607_0108793 3300046501 Bacteria 1472
824 Ga0495607_0167122 3300046501 Bacteria 1113
825 Ga0495607_0196115 3300046501 Bacteria 1002
826 Ga0495607_0201490 3300046501 Bacteria 984
827 Ga0495583_0000086 3300046506 Bacteria 165176
828 Ga0495583_0000896 3300046506 Bacteria 35612
829 Ga0495583_0001193 3300046506 Bacteria 27944
830 Ga0495583_0002444 3300046506 Bacteria 15870
831 Ga0495583_0003659 3300046506 Bacteria 11461
832 Ga0495583_0005028 3300046506 Bacteria 9149
833 Ga0495583_0017212 3300046506 Bacteria 3849
834 Ga0495583_0031225 3300046506 Bacteria 2585
835 Ga0495606_0000246 3300046507 Bacteria 95318
836 Ga0495606_0000655 3300046507 Bacteria 54542
837 Ga0495606_0001126 3300046507 Bacteria 38118
838 Ga0495606_0002005 3300046507 Bacteria 25040
839 Ga0495606_0004844 3300046507 Bacteria 13211
840 Ga0495606_0005974 3300046507 Bacteria 11418
841 Ga0495606_0006517 3300046507 Bacteria 10742
842 Ga0495606_0008971 3300046507 Bacteria 8555
843 Ga0495606_0009111 3300046507 Bacteria 8452
844 Ga0495606_0010807 3300046507 Bacteria 7521
845 Ga0495606_0011996 3300046507 Bacteria 6998
846 Ga0495606_0040567 3300046507 Bacteria 3128
847 Ga0495606_0061387 3300046507 Bacteria 2404
848 Ga0495606_0071571 3300046507 Bacteria 2182
849 Ga0495606_0085085 3300046507 Bacteria 1956
850 Ga0495606_0100878 3300046507 Bacteria 1757
851 Ga0495610_0000834 3300046512 Bacteria 28839
852 Ga0495610_0004559 3300046512 Bacteria 10187
853 Ga0495610_0006237 3300046512 Bacteria 8265
854 Ga0495610_0009103 3300046512 Bacteria 6322
855 Ga0495610_0012535 3300046512 Bacteria 5095
856 Ga0495610_0021453 3300046512 Bacteria 3552
857 Ga0495610_0028426 3300046512 Bacteria 2957
858 Ga0495610_0029458 3300046512 Bacteria 2890
859 Ga0495610_0057280 3300046512 Bacteria 1869
860 Ga0495610_0061511 3300046512 Bacteria 1783
861 Ga0495610_0103760 3300046512 Bacteria 1269
862 Ga0495610_0105286 3300046512 Bacteria 1257
863 Ga0495616_0000415 3300046513 Bacteria 32872
864 Ga0495616_0000593 3300046513 Bacteria 27274
865 Ga0495616_0000721 3300046513 Bacteria 24436
866 Ga0495616_0001779 3300046513 Bacteria 14639
867 Ga0495616_0002078 3300046513 Bacteria 13456
868 Ga0495616_0052052 3300046513 Bacteria 2039
869 Ga0495616_0060209 3300046513 Bacteria 1866
870 Ga0495616_0069522 3300046513 Bacteria 1706
871 Ga0495616_0082575 3300046513 Bacteria 1534
872 Ga0495620_0000032 3300046515 Bacteria 119164
873 Ga0495620_0001145 3300046515 Bacteria 16206
874 Ga0495620_0003408 3300046515 Bacteria 9103
875 Ga0495620_0004173 3300046515 Bacteria 8184
876 Ga0495620_0004673 3300046515 Bacteria 7695
877 Ga0495620_0006753 3300046515 Bacteria 6275
878 Ga0495620_0010640 3300046515 Bacteria 4845
879 Ga0495620_0014925 3300046515 Bacteria 3934
880 Ga0495620_0051454 3300046515 Bacteria 1753
881 Ga0495630_0018276 3300046517 Bacteria 5147
882 Ga0495630_0019172 3300046517 Bacteria 5027
883 Ga0495630_0034636 3300046517 Bacteria 3771
884 Ga0495631_0000379 3300046518 Bacteria 30594
885 Ga0495631_0001488 3300046518 Bacteria 14174
886 Ga0495631_0003817 3300046518 Bacteria 8182
887 Ga0495631_0023466 3300046518 Bacteria 2858
888 Ga0495631_0045912 3300046518 Bacteria 1922
889 Ga0495631_0059933 3300046518 Bacteria 1652
890 Ga0495631_0068547 3300046518 Bacteria 1534
891 Ga0495632_0000254 3300046519 Bacteria 53005
892 Ga0495632_0000701 3300046519 Bacteria 30495
893 Ga0495632_0001184 3300046519 Bacteria 22208
894 Ga0495632_0001853 3300046519 Bacteria 17007
895 Ga0495632_0002400 3300046519 Bacteria 14284
896 Ga0495632_0003017 3300046519 Bacteria 12280
897 Ga0495632_0003929 3300046519 Bacteria 10322
898 Ga0495632_0006012 3300046519 Bacteria 7892
899 Ga0495632_0008276 3300046519 Bacteria 6405
900 Ga0495632_0008989 3300046519 Bacteria 6062
901 Ga0495632_0010837 3300046519 Bacteria 5362
902 Ga0495632_0051940 3300046519 Bacteria 2016
903 Ga0495632_0078626 3300046519 Bacteria 1575
904 Ga0495632_0090903 3300046519 Bacteria 1447
905 Ga0495637_0000234 3300046520 Bacteria 43108
906 Ga0495637_0003797 3300046520 Bacteria 7940
907 Ga0495637_0003950 3300046520 Bacteria 7765
908 Ga0495637_0004292 3300046520 Bacteria 7402
909 Ga0495637_0005498 3300046520 Bacteria 6441
910 Ga0495637_0005883 3300046520 Bacteria 6199
911 Ga0495637_0006242 3300046520 Bacteria 5992
912 Ga0495637_0008605 3300046520 Bacteria 5008
913 Ga0495637_0009494 3300046520 Bacteria 4741
914 Ga0495637_0010569 3300046520 Bacteria 4459
915 Ga0495637_0011701 3300046520 Bacteria 4210
916 Ga0495637_0038039 3300046520 Bacteria 2085
917 Ga0495637_0053818 3300046520 Bacteria 1674
918 Ga0495643_0000382 3300046522 Bacteria 58639
919 Ga0495643_0000773 3300046522 Bacteria 35740
920 Ga0495643_0001896 3300046522 Bacteria 17662
921 Ga0495643_0002500 3300046522 Bacteria 14450
922 Ga0495643_0007738 3300046522 Bacteria 6884
923 Ga0495643_0011179 3300046522 Bacteria 5485
924 Ga0495643_0012274 3300046522 Bacteria 5174
925 Ga0495643_0029896 3300046522 Bacteria 3045
926 Ga0495643_0060141 3300046522 Bacteria 2018
927 Ga0495643_0128094 3300046522 Bacteria 1276
928 Ga0495644_0000310 3300046523 Bacteria 22491
929 Ga0495644_0015706 3300046523 Bacteria 2902
930 Ga0495644_0016797 3300046523 Bacteria 2800
931 Ga0495644_0035088 3300046523 Bacteria 1893
932 Ga0495648_0002314 3300046524 Bacteria 17744
933 Ga0495648_0002485 3300046524 Bacteria 16923
934 Ga0495648_0005085 3300046524 Bacteria 11036
935 Ga0495648_0009405 3300046524 Bacteria 7582
936 Ga0495648_0011049 3300046524 Bacteria 6839
937 Ga0495648_0011702 3300046524 Bacteria 6586
938 Ga0495648_0019059 3300046524 Bacteria 4838
939 Ga0495648_0024396 3300046524 Bacteria 4120
940 Ga0495648_0027047 3300046524 Bacteria 3848
941 Ga0495648_0038087 3300046524 Bacteria 3081
942 Ga0495648_0055105 3300046524 Bacteria 2398
943 Ga0495648_0060364 3300046524 Bacteria 2256
944 Ga0495648_0197862 3300046524 Bacteria 1008
945 Ga0495666_0036734 3300046526 Bacteria 2385
946 Ga0495642_0000195 3300046528 Bacteria 35717
947 Ga0495642_0002236 3300046528 Bacteria 7927
948 Ga0495642_0007223 3300046528 Bacteria 4262
949 Ga0495642_0052368 3300046528 Bacteria 1681
950 Ga0495652_0312609 3300046529 Bacteria 1138
951 Ga0495654_0000117 3300046530 Bacteria 89307
952 Ga0495654_0000481 3300046530 Bacteria 32982
953 Ga0495654_0000689 3300046530 Bacteria 26439
954 Ga0495654_0000888 3300046530 Bacteria 22368
955 Ga0495654_0002087 3300046530 Bacteria 13089
956 Ga0495654_0003941 3300046530 Bacteria 8958
957 Ga0495654_0005000 3300046530 Bacteria 7788
958 Ga0495654_0005350 3300046530 Bacteria 7480
959 Ga0495654_0009036 3300046530 Bacteria 5469
960 Ga0495654_0009410 3300046530 Bacteria 5357
961 Ga0495654_0009532 3300046530 Bacteria 5322
962 Ga0495654_0009719 3300046530 Bacteria 5265
963 Ga0495654_0012976 3300046530 Bacteria 4465
964 Ga0495654_0019277 3300046530 Bacteria 3569
965 Ga0495654_0027966 3300046530 Bacteria 2886
966 Ga0495654_0031359 3300046530 Bacteria 2698
967 Ga0495654_0070847 3300046530 Bacteria 1652
968 Ga0495654_0077764 3300046530 Bacteria 1561
969 Ga0495654_0082581 3300046530 Bacteria 1503
970 Ga0495654_0091344 3300046530 Bacteria 1412
971 Ga0495654_0096431 3300046530 Bacteria 1366
972 Ga0495654_0130938 3300046530 Bacteria 1126
973 Ga0495587_0014226 3300046536 Bacteria 4993
974 Ga0495587_0017152 3300046536 Bacteria 4502
975 Ga0495609_0000453 3300046538 Bacteria 33476
976 Ga0495609_0005649 3300046538 Bacteria 6518
977 Ga0495609_0014388 3300046538 Bacteria 3719
978 Ga0495609_0015335 3300046538 Bacteria 3588
979 Ga0495609_0015576 3300046538 Bacteria 3556
980 Ga0495609_0028984 3300046538 Bacteria 2523
981 Ga0495609_0075332 3300046538 Bacteria 1479
982 Ga0495597_0000033 3300046542 Bacteria 126661
983 Ga0495597_0001110 3300046542 Bacteria 20362
984 Ga0495597_0001821 3300046542 Bacteria 14587
985 Ga0495597_0030883 3300046542 Bacteria 2439
986 Ga0495597_0033425 3300046542 Bacteria 2328
987 Ga0495597_0084285 3300046542 Bacteria 1355
988 Ga0495645_0050226 3300046543 Bacteria 3037
989 Ga0495622_0001083 3300046557 Bacteria 14238
990 Ga0495622_0001716 3300046557 Bacteria 10829
991 Ga0495622_0012257 3300046557 Bacteria 3965
992 Ga0495622_0019340 3300046557 Bacteria 3170
993 Ga0495622_0048401 3300046557 Bacteria 1975
994 Ga0495633_0000778 3300046558 Bacteria 28522
995 Ga0495633_0002090 3300046558 Bacteria 14348
996 Ga0495633_0009352 3300046558 Bacteria 5421
997 Ga0495633_0098899 3300046558 Bacteria 1354
998 Ga0495668_0004858 3300046616 Bacteria 9342
999 Ga0495668_0012425 3300046616 Bacteria 5048
1000 Ga0495668_0061889 3300046616 Bacteria 2063
1001 Ga0495668_0065962 3300046616 Bacteria 1992
1002 Ga0495668_0166705 3300046616 Bacteria 1206
1003 Ga0495634_0001159 3300046642 Bacteria 24365
1004 Ga0495634_0145233 3300046642 Bacteria 1503
1005 Ga0495611_0000413 3300046648 Bacteria 26497
1006 Ga0495611_0009086 3300046648 Bacteria 4202
1007 Ga0495611_0019925 3300046648 Bacteria 2884
1008 Ga0495625_0000061 3300046660 Bacteria 179140
1009 Ga0495625_0001582 3300046660 Bacteria 27055
1010 Ga0495625_0005058 3300046660 Bacteria 12209
1011 Ga0495625_0008072 3300046660 Bacteria 9027
1012 Ga0495625_0010914 3300046660 Bacteria 7463
1013 Ga0495625_0014449 3300046660 Bacteria 6301
1014 Ga0495625_0025653 3300046660 Bacteria 4467
1015 Ga0495625_0031606 3300046660 Bacteria 3934
1016 Ga0495625_0072822 3300046660 Bacteria 2409
1017 Ga0495625_0076556 3300046660 Bacteria 2339
1018 Ga0495625_0098949 3300046660 Bacteria 2006
1019 Ga0495625_0121780 3300046660 Bacteria 1774
1020 Ga0495625_0129115 3300046660 Bacteria 1713
1021 Ga0495635_0000351 3300046663 Bacteria 29298
1022 Ga0495635_0006687 3300046663 Bacteria 8056
1023 Ga0495659_0001364 3300046664 Bacteria 8350
1024 Ga0495661_0000036 3300046665 Bacteria 164694
1025 Ga0495661_0000249 3300046665 Bacteria 62275
1026 Ga0495661_0000356 3300046665 Bacteria 49895
1027 Ga0495661_0002685 3300046665 Bacteria 13578
1028 Ga0495661_0027443 3300046665 Bacteria 3654
1029 Ga0495661_0051180 3300046665 Bacteria 2495
1030 Ga0495661_0052462 3300046665 Bacteria 2457
1031 Ga0495661_0057470 3300046665 Bacteria 2322
1032 Ga0495661_0089645 3300046665 Bacteria 1752
1033 Ga0495588_0055014 3300046674 Bacteria 2053
1034 Ga0495599_0163583 3300046678 Bacteria 1375
1035 Ga0495623_0024079 3300046679 Bacteria 3927
1036 Ga0495646_0010704 3300046680 Bacteria 5827
1037 Ga0495646_0026649 3300046680 Bacteria 3628
1038 Ga0495646_0118679 3300046680 Bacteria 1498
1039 Ga0495669_0001839 3300046684 Bacteria 8688
1040 Ga0495613_0021702 3300046689 Bacteria 4783
1041 Ga0495613_0045845 3300046689 Bacteria 3233
1042 Ga0495613_0153926 3300046689 Bacteria 1638
1043 Ga0495624_0004808 3300046690 Bacteria 9823
1044 Ga0495670_0001216 3300046691 Bacteria 12520
1045 Ga0495670_0007443 3300046691 Bacteria 5375
1046 Ga0495670_0025557 3300046691 Bacteria 2921
1047 Ga0495670_0032412 3300046691 Bacteria 2599
1048 Ga0495671_0000831 3300046692 Bacteria 22044
1049 Ga0495671_0000930 3300046692 Bacteria 20686
1050 Ga0495671_0001865 3300046692 Bacteria 13547
1051 Ga0495671_0002003 3300046692 Bacteria 13097
1052 Ga0495671_0011188 3300046692 Bacteria 4950
1053 Ga0495671_0013145 3300046692 Bacteria 4494
1054 Ga0495671_0018753 3300046692 Bacteria 3667
1055 Ga0495671_0043844 3300046692 Bacteria 2244
1056 Ga0495671_0087110 3300046692 Bacteria 1530
1057 Ga0495671_0093132 3300046692 Bacteria 1474
1058 Ga0495671_0105862 3300046692 Bacteria 1373
1059 Ga0495671_0163470 3300046692 Bacteria 1082
1060 Ga0495649_0000391 3300046694 Bacteria 38039
1061 Ga0495649_0001382 3300046694 Bacteria 18331
1062 Ga0495649_0003914 3300046694 Bacteria 9845
1063 Ga0495649_0011871 3300046694 Bacteria 5092
1064 Ga0495649_0012215 3300046694 Bacteria 5007
1065 Ga0495649_0012769 3300046694 Bacteria 4871
1066 Ga0495649_0013378 3300046694 Bacteria 4733
1067 Ga0495649_0019527 3300046694 Bacteria 3807
1068 Ga0495649_0025753 3300046694 Bacteria 3275
1069 Ga0495649_0027475 3300046694 Bacteria 3157
1070 Ga0495649_0044222 3300046694 Bacteria 2431
1071 Ga0495649_0055038 3300046694 Bacteria 2150
1072 Ga0495649_0068190 3300046694 Bacteria 1908
1073 Ga0495589_0001212 3300046794 Bacteria 15337
1074 Ga0495589_0004326 3300046794 Bacteria 7580
1075 Ga0495589_0004645 3300046794 Bacteria 7300
1076 Ga0495589_0007909 3300046794 Bacteria 5568
1077 Ga0495589_0013859 3300046794 Bacteria 4156
1078 Ga0495589_0018047 3300046794 Bacteria 3621
1079 Ga0495589_0022546 3300046794 Bacteria 3212
1080 Ga0495589_0025145 3300046794 Bacteria 3023
1081 Ga0495589_0043652 3300046794 Bacteria 2230
1082 Ga0495589_0071278 3300046794 Bacteria 1698
1083 Ga0495589_0085731 3300046794 Bacteria 1530
1084 Ga0495600_0140741 3300046809 Bacteria 1565
1085 Ga0495660_0002722 3300046810 Bacteria 11159
1086 Ga0495660_0005856 3300046810 Bacteria 7333
1087 Ga0495660_0008303 3300046810 Bacteria 6080
1088 Ga0495660_0013313 3300046810 Bacteria 4766
1089 Ga0495660_0019631 3300046810 Bacteria 3879
1090 Ga0495660_0023827 3300046810 Bacteria 3489
1091 Ga0495660_0036834 3300046810 Bacteria 2727
1092 Ga0495660_0047670 3300046810 Bacteria 2345
1093 Ga0495660_0060874 3300046810 Bacteria 2026
1094 Ga0495660_0062559 3300046810 Bacteria 1995
1095 Ga0495660_0063881 3300046810 Bacteria 1969
1096 Ga0495660_0085334 3300046810 Bacteria 1650
1097 Ga0495660_0107614 3300046810 Bacteria 1426
1098 Ga0495660_0136574 3300046810 Bacteria 1224
1099 Ga0495581_0021035 3300047315 Bacteria 3784
1100 Ga0495581_0026114 3300047315 Bacteria 3388
1101 Ga0495604_0024691 3300047317 Bacteria 4795
1102 Ga0495604_0051700 3300047317 Bacteria 3183
1103 Ga0495604_0053935 3300047317 Bacteria 3104
1104 Ga0495636_0050526 3300047318 Bacteria 1740
1105 Ga0495674_0009196 3300047319 Bacteria 9388
1106 Ga0495672_0001708 3300047320 Bacteria 21264
1107 Ga0495672_0001919 3300047320 Bacteria 19718
1108 Ga0495672_0003617 3300047320 Bacteria 13109
1109 Ga0495672_0004432 3300047320 Bacteria 11504
1110 Ga0495672_0005981 3300047320 Bacteria 9529
1111 Ga0495672_0008767 3300047320 Bacteria 7411
1112 Ga0495672_0011203 3300047320 Bacteria 6338
1113 Ga0495672_0011833 3300047320 Bacteria 6127
1114 Ga0495672_0014254 3300047320 Bacteria 5452
1115 Ga0495672_0017398 3300047320 Bacteria 4809
1116 Ga0495672_0019128 3300047320 Bacteria 4528
1117 Ga0495672_0019156 3300047320 Bacteria 4523
1118 Ga0495672_0027510 3300047320 Bacteria 3612
1119 Ga0495672_0035254 3300047320 Bacteria 3082
1120 Ga0495672_0035782 3300047320 Bacteria 3055
1121 Ga0495672_0040242 3300047320 Bacteria 2836
1122 Ga0495672_0131587 3300047320 Bacteria 1315
1123 Ga0495676_0000011 3300047321 Bacteria 242612
1124 Ga0495676_0004159 3300047321 Bacteria 13204
1125 Ga0495676_0055296 3300047321 Bacteria 3147
1126 Ga0495676_0123003 3300047321 Bacteria 1884
1127 Ga0495680_0007292 3300047322 Bacteria 10176
1128 Ga0495680_0014546 3300047322 Bacteria 6812
1129 Ga0495680_0035318 3300047322 Bacteria 4027
1130 Ga0495683_0000194 3300047323 Bacteria 57773
1131 Ga0495683_0001114 3300047323 Bacteria 18552
1132 Ga0495683_0002688 3300047323 Bacteria 10611
1133 Ga0495683_0005802 3300047323 Bacteria 6796
1134 Ga0495683_0006973 3300047323 Bacteria 6134
1135 Ga0495683_0007481 3300047323 Bacteria 5901
1136 Ga0495683_0015035 3300047323 Bacteria 4031
1137 Ga0495683_0031681 3300047323 Bacteria 2694
1138 Ga0495683_0066729 3300047323 Bacteria 1772
1139 Ga0495687_001053 3300047443 Bacteria 27292
1140 Ga0495687_005812 3300047443 Bacteria 7734
1141 Ga0495687_008286 3300047443 Bacteria 5973
1142 Ga0495687_009643 3300047443 Bacteria 5375
1143 Ga0495675_0008389 3300047444 Bacteria 6397
1144 Ga0495677_0000336 3300047445 Bacteria 20222
1145 Ga0495679_000028 3300047446 Bacteria 192300
1146 Ga0495679_002731 3300047446 Bacteria 8782
1147 Ga0495679_005365 3300047446 Bacteria 5689
1148 Ga0495679_010121 3300047446 Bacteria 3724
1149 Ga0495679_013134 3300047446 Bacteria 3122
1150 Ga0495679_023900 3300047446 Bacteria 2066
1151 Ga0495673_0000794 3300047469 Bacteria 29648
1152 Ga0495673_0000807 3300047469 Bacteria 29386
1153 Ga0495673_0000988 3300047469 Bacteria 25450
1154 Ga0495673_0002234 3300047469 Bacteria 13910
1155 Ga0495673_0004284 3300047469 Bacteria 9001
1156 Ga0495673_0008389 3300047469 Bacteria 5823
1157 Ga0495673_0010865 3300047469 Bacteria 4926
1158 Ga0495673_0013454 3300047469 Bacteria 4293
1159 Ga0495673_0018926 3300047469 Bacteria 3461
1160 Ga0495673_0035395 3300047469 Bacteria 2301
1161 Ga0495673_0059311 3300047469 Bacteria 1645
1162 Ga0495673_0079353 3300047469 Bacteria 1362
1163 Ga0495673_0082307 3300047469 Bacteria 1331
1164 Ga0495673_0139829 3300047469 Bacteria 944
1165 Ga0495681_0000579 3300047470 Bacteria 27944
1166 Ga0495681_0000649 3300047470 Bacteria 26486
1167 Ga0495681_0002767 3300047470 Bacteria 12407
1168 Ga0495681_0002835 3300047470 Bacteria 12248
1169 Ga0495681_0005562 3300047470 Bacteria 8412
1170 Ga0495681_0005590 3300047470 Bacteria 8390
1171 Ga0495681_0007496 3300047470 Bacteria 6960
1172 Ga0495681_0009943 3300047470 Bacteria 5802
1173 Ga0495681_0013286 3300047470 Bacteria 4786
1174 Ga0495681_0013626 3300047470 Bacteria 4706
1175 Ga0495681_0016843 3300047470 Bacteria 4078
1176 Ga0495681_0019051 3300047470 Bacteria 3759
1177 Ga0495681_0020639 3300047470 Bacteria 3570
1178 Ga0495681_0022698 3300047470 Bacteria 3351
1179 Ga0495681_0044453 3300047470 Bacteria 2134
1180 Ga0495681_0062696 3300047470 Bacteria 1708
1181 Ga0495681_0073870 3300047470 Bacteria 1539
1182 Ga0495681_0074853 3300047470 Bacteria 1525
1183 Ga0495684_0260373 3300047471 Bacteria 1258
1184 Ga0495686_0007358 3300047472 Bacteria 8258
1185 Ga0495686_0007477 3300047472 Bacteria 8185
1186 Ga0495686_0019205 3300047472 Bacteria 4570
1187 Ga0495686_0036456 3300047472 Bacteria 3156
1188 Ga0495686_0041846 3300047472 Bacteria 2915
1189 Ga0495593_0017532 3300047673 Bacteria 4030
1190 Ga0495593_0032085 3300047673 Bacteria 2865
1191 Ga0495593_0045033 3300047673 Bacteria 2357
1192 Ga0495593_0074302 3300047673 Bacteria 1763
1193 Ga0495602_0186298 3300048088 Bacteria 1595
1194 Ga0495626_0000024 3300048091 Bacteria 214179
1195 Ga0495626_0000557 3300048091 Bacteria 36990
1196 Ga0495626_0000682 3300048091 Bacteria 32520
1197 Ga0495626_0002854 3300048091 Bacteria 11536
1198 Ga0495626_0006633 3300048091 Bacteria 6561
1199 Ga0495626_0008760 3300048091 Bacteria 5507
1200 Ga0495626_0009514 3300048091 Bacteria 5250
1201 Ga0495626_0009654 3300048091 Bacteria 5205
1202 Ga0495626_0013994 3300048091 Bacteria 4153
1203 Ga0495626_0015764 3300048091 Bacteria 3858
1204 Ga0496102_0000830 3300048905 Bacteria 29797
1205 Ga0496103_0007698 3300048906 Bacteria 6404
1206 Ga0496104_0000043 3300048907 Bacteria 154773
1207 Ga0496105_0000726 3300048908 Bacteria 22325
1208 Ga0496105_0228971 3300048908 Bacteria 1511
1209 Ga0496105_0263339 3300048908 Bacteria 1394
1210 Ga0496106_0419846 3300048909 Bacteria 1075
1211 Ga0496110_0138939 3300048913 Bacteria 2196
1212 Ga0496111_0036147 3300048914 Bacteria 3532
1213 Ga0496114_0019300 3300048917 Bacteria 5523
1214 Ga0496114_0026493 3300048917 Bacteria 4746
1215 Ga0496114_0240282 3300048917 Unclassified 1593
1216 Ga0496115_0154850 3300048918 Bacteria 1893
1217 Ga0496116_0001804 3300048919 Bacteria 23238
1218 Ga0496116_0001845 3300048919 Bacteria 22923
1219 Ga0496116_0002210 3300048919 Bacteria 20732
1220 Ga0496116_0002480 3300048919 Bacteria 19338
1221 Ga0496116_0004205 3300048919 Bacteria 13841
1222 Ga0496116_0005461 3300048919 Bacteria 11774
1223 Ga0496116_0007499 3300048919 Bacteria 9657
1224 Ga0496116_0008020 3300048919 Bacteria 9241
1225 Ga0496116_0015440 3300048919 Bacteria 6036
1226 Ga0496116_0031992 3300048919 Bacteria 3756
1227 Ga0496116_0050774 3300048919 Bacteria 2760
1228 Ga0496116_0087462 3300048919 Bacteria 1907
1229 Ga0496117_0000691 3300048920 Bacteria 53735
1230 Ga0496117_0000693 3300048920 Bacteria 53679
1231 Ga0496117_0001950 3300048920 Bacteria 27499
1232 Ga0496117_0004486 3300048920 Bacteria 15353
1233 Ga0496117_0004981 3300048920 Bacteria 14249
1234 Ga0496117_0006161 3300048920 Bacteria 12255
1235 Ga0496117_0007013 3300048920 Bacteria 11162
1236 Ga0496117_0007560 3300048920 Bacteria 10583
1237 Ga0496117_0009703 3300048920 Bacteria 8897
1238 Ga0496117_0010562 3300048920 Bacteria 8392
1239 Ga0496117_0014528 3300048920 Bacteria 6777
1240 Ga0496117_0028756 3300048920 Bacteria 4299
1241 Ga0496117_0035585 3300048920 Bacteria 3736
1242 Ga0496117_0049195 3300048920 Bacteria 3001
1243 Ga0496117_0078745 3300048920 Bacteria 2174
1244 Ga0496117_0181818 3300048920 Bacteria 1207
1245 Ga0496118_0000923 3300048921 Bacteria 45913
1246 Ga0496118_0003183 3300048921 Bacteria 20970
1247 Ga0496118_0007888 3300048921 Bacteria 11155
1248 Ga0496118_0010894 3300048921 Bacteria 8942
1249 Ga0496118_0012044 3300048921 Bacteria 8349
1250 Ga0496118_0018661 3300048921 Bacteria 6237
1251 Ga0496118_0033734 3300048921 Bacteria 4192
1252 Ga0496118_0036928 3300048921 Bacteria 3941
1253 Ga0496118_0045370 3300048921 Bacteria 3432
1254 Ga0496118_0057020 3300048921 Bacteria 2931
1255 Ga0496118_0079730 3300048921 Bacteria 2308
1256 Ga0496118_0088371 3300048921 Bacteria 2144
1257 Ga0496118_0100330 3300048921 Bacteria 1958
1258 Ga0496118_0134759 3300048921 Bacteria 1578
1259 Ga0496118_0135848 3300048921 Bacteria 1569
1260 Ga0496118_0167220 3300048921 Bacteria 1349
1261 Ga0496119_0000001 3300048922 Bacteria 789520
1262 Ga0496119_0000564 3300048922 Bacteria 49944
1263 Ga0496119_0002826 3300048922 Bacteria 18578
1264 Ga0496119_0004543 3300048922 Bacteria 13753
1265 Ga0496119_0007806 3300048922 Bacteria 9542
1266 Ga0496119_0008479 3300048922 Bacteria 9019
1267 Ga0496119_0041830 3300048922 Bacteria 2912
1268 Ga0496119_0051873 3300048922 Bacteria 2516
1269 Ga0496119_0054334 3300048922 Bacteria 2439
1270 Ga0496120_0000497 3300048923 Bacteria 61419
1271 Ga0496120_0000718 3300048923 Bacteria 48575
1272 Ga0496120_0001405 3300048923 Bacteria 29145
1273 Ga0496120_0003823 3300048923 Bacteria 13237
1274 Ga0496120_0009282 3300048923 Bacteria 6998
1275 Ga0496120_0021723 3300048923 Bacteria 4049
1276 Ga0496120_0024626 3300048923 Bacteria 3748
1277 Ga0496120_0030378 3300048923 Bacteria 3285
1278 Ga0496121_0000093 3300048924 Bacteria 212965
1279 Ga0496121_0000816 3300048924 Bacteria 56863
1280 Ga0496121_0000911 3300048924 Bacteria 53320
1281 Ga0496121_0001539 3300048924 Bacteria 38620
1282 Ga0496121_0003938 3300048924 Bacteria 20555
1283 Ga0496121_0006117 3300048924 Bacteria 15128
1284 Ga0496121_0008597 3300048924 Bacteria 11955
1285 Ga0496121_0009784 3300048924 Bacteria 10956
1286 Ga0496121_0010539 3300048924 Bacteria 10399
1287 Ga0496121_0013286 3300048924 Bacteria 8865
1288 Ga0496121_0016049 3300048924 Bacteria 7761
1289 Ga0496121_0022014 3300048924 Bacteria 6208
1290 Ga0496121_0065546 3300048924 Bacteria 2954
1291 Ga0496121_0105195 3300048924 Bacteria 2166
1292 Ga0496121_0134308 3300048924 Bacteria 1845
1293 Ga0496121_0234962 3300048924 Bacteria 1281
1294 Ga0496122_0000616 3300048925 Bacteria 73030
1295 Ga0496122_0002337 3300048925 Bacteria 27356
1296 Ga0496122_0003121 3300048925 Bacteria 22193
1297 Ga0496122_0003169 3300048925 Bacteria 21957
1298 Ga0496122_0003450 3300048925 Bacteria 20789
1299 Ga0496122_0011099 3300048925 Bacteria 9182
1300 Ga0496122_0011127 3300048925 Bacteria 9165
1301 Ga0496122_0011408 3300048925 Bacteria 9000
1302 Ga0496122_0017043 3300048925 Bacteria 6820
1303 Ga0496122_0050549 3300048925 Bacteria 3169
1304 Ga0496122_0052935 3300048925 Bacteria 3065
1305 Ga0496122_0053693 3300048925 Bacteria 3034
1306 Ga0496122_0055098 3300048925 Bacteria 2978
1307 Ga0496122_0064040 3300048925 Bacteria 2677
1308 Ga0496122_0126186 3300048925 Bacteria 1637
1309 Ga0496122_0156936 3300048925 Bacteria 1394
1310 Ga0496123_0000178 3300048926 Bacteria 128587
1311 Ga0496123_0000303 3300048926 Bacteria 95638
1312 Ga0496123_0000515 3300048926 Bacteria 67351
1313 Ga0496123_0001563 3300048926 Bacteria 31308
1314 Ga0496123_0001674 3300048926 Bacteria 29668
1315 Ga0496123_0001979 3300048926 Bacteria 26534
1316 Ga0496123_0002710 3300048926 Bacteria 21277
1317 Ga0496123_0003032 3300048926 Bacteria 19355
1318 Ga0496123_0010647 3300048926 Bacteria 8093
1319 Ga0496123_0022340 3300048926 Bacteria 4879
1320 Ga0496123_0023440 3300048926 Bacteria 4724
1321 Ga0496123_0026258 3300048926 Bacteria 4367
1322 Ga0496123_0036364 3300048926 Bacteria 3493
1323 Ga0496123_0041877 3300048926 Bacteria 3168
1324 Ga0496123_0050844 3300048926 Bacteria 2766
1325 Ga0496123_0064865 3300048926 Bacteria 2325
1326 Ga0496123_0066631 3300048926 Bacteria 2279
1327 Ga0496123_0071947 3300048926 Bacteria 2154
1328 Ga0496123_0149252 3300048926 Bacteria 1264
1329 Ga0496123_0193523 3300048926 Bacteria 1050
1330 Ga0496124_0000073 3300048927 Bacteria 219306
1331 Ga0496124_0000983 3300048927 Bacteria 45224
1332 Ga0496124_0004679 3300048927 Bacteria 15817
1333 Ga0496124_0005876 3300048927 Bacteria 13584
1334 Ga0496124_0010496 3300048927 Bacteria 9371
1335 Ga0496124_0016691 3300048927 Bacteria 6966
1336 Ga0496124_0018495 3300048927 Bacteria 6523
1337 Ga0496124_0026987 3300048927 Bacteria 5167
1338 Ga0496124_0032592 3300048927 Bacteria 4597
1339 Ga0496124_0036140 3300048927 Bacteria 4313
1340 Ga0496124_0043389 3300048927 Bacteria 3866
1341 Ga0496124_0063669 3300048927 Bacteria 3080
1342 Ga0496124_0094167 3300048927 Bacteria 2436
1343 Ga0496124_0133539 3300048927 Bacteria 1968
1344 Ga0496124_0208750 3300048927 Bacteria 1479
1345 Ga0496124_0215123 3300048927 Bacteria 1450
1346 Ga0496124_0227436 3300048927 Bacteria 1397
1347 Ga0496124_0340359 3300048927 Bacteria 1065
1348 Ga0496125_0001600 3300048928 Bacteria 31996
1349 Ga0496125_0002275 3300048928 Bacteria 25467
1350 Ga0496125_0002500 3300048928 Bacteria 23767
1351 Ga0496125_0002683 3300048928 Bacteria 22685
1352 Ga0496125_0002824 3300048928 Bacteria 21899
1353 Ga0496125_0003874 3300048928 Bacteria 17699
1354 Ga0496125_0005692 3300048928 Bacteria 13745
1355 Ga0496125_0010564 3300048928 Bacteria 9331
1356 Ga0496125_0030360 3300048928 Bacteria 4836
1357 Ga0496125_0034340 3300048928 Bacteria 4472
1358 Ga0496125_0041617 3300048928 Bacteria 3925
1359 Ga0496125_0068536 3300048928 Bacteria 2790
1360 Ga0496125_0069247 3300048928 Bacteria 2770
1361 Ga0496125_0094561 3300048928 Bacteria 2226
1362 Ga0496125_0137206 3300048928 Bacteria 1708
1363 Ga0496126_0000142 3300048929 Bacteria 164438
1364 Ga0496126_0001077 3300048929 Bacteria 45939
1365 Ga0496126_0003723 3300048929 Bacteria 19016
1366 Ga0496126_0010970 3300048929 Bacteria 9433
1367 Ga0496126_0015083 3300048929 Bacteria 7787
1368 Ga0496126_0036914 3300048929 Bacteria 4565
1369 Ga0496126_0145996 3300048929 Bacteria 2031
1370 Ga0496126_0150566 3300048929 Bacteria 1994
1371 Ga0496126_0295478 3300048929 Bacteria 1338
1372 Ga0495678_000757 3300049459 Bacteria 29340
1373 Ga0495678_005102 3300049459 Bacteria 7378
1374 Ga0495678_005292 3300049459 Bacteria 7167
1375 Ga0495678_006807 3300049459 Bacteria 6016
1376 Ga0495678_007751 3300049459 Bacteria 5530
1377 Ga0495678_013009 3300049459 Bacteria 3923
1378 Ga0495678_014822 3300049459 Bacteria 3611
1379 Ga0495678_024291 3300049459 Bacteria 2618
1380 Ga0495678_029051 3300049459 Bacteria 2326
1381 Ga0495678_042748 3300049459 Bacteria 1804
1382 Ga0495678_060657 3300049459 Bacteria 1422
1383 Ga0495678_065742 3300049459 Bacteria 1345
1384 Ga0495678_079137 3300049459 Bacteria 1184
1385 Ga0495682_0000090 3300049460 Bacteria 79463
1386 Ga0495682_0001847 3300049460 Bacteria 10622
1387 Ga0495682_0003242 3300049460 Bacteria 7295
1388 Ga0495682_0004289 3300049460 Bacteria 6156
1389 Ga0495682_0020920 3300049460 Bacteria 2453
1390 Ga0495682_0061183 3300049460 Bacteria 1359
1391 Ga0495682_0061825 3300049460 Bacteria 1351
1392 Ga0501032_0017184 3300049569 Bacteria 5083
1393 Ga0501034_0000143 3300049571 Bacteria 133317
1394 Ga0501034_0007498 3300049571 Bacteria 11602
1395 Ga0501034_0017591 3300049571 Bacteria 7329
1396 Ga0501034_0096924 3300049571 Bacteria 2945
1397 Ga0501034_0113583 3300049571 Bacteria 2698
1398 Ga0501034_0153705 3300049571 Bacteria 2276
1399 Ga0501037_0066886 3300049573 Bacteria 2617
1400 Ga0501037_0090962 3300049573 Bacteria 2207
1401 Ga0501037_0262644 3300049573 Bacteria 1206
1402 Ga0501043_0167247 3300049579 Bacteria 1717
1403 Ga0501047_0066657 3300049581 Bacteria 3470
1404 Ga0501070_0038291 3300049586 Bacteria 4001
1405 Ga0501070_0309929 3300049586 Bacteria 1285
1406 Ga0501241_002653 3300049758 Bacteria 3442
1407 Ga0501035_0236910 3300049822 Bacteria 1554
1408 Ga0501035_0387858 3300049822 Bacteria 1164
1409 Ga0501044_0031568 3300049823 Bacteria 5575
1410 Ga0501226_004985 3300049853 Bacteria 1522
1411 nmdc:mga03683_170138_c1 3300050489 Bacteria 990
1412 nmdc:mga03683_29384_c1 3300050489 Bacteria 2192
1413 nmdc:mga03683_44547_c2 3300050489 Bacteria 1644
1414 nmdc:mga03n38_56524_c1 3300050490 Bacteria 1771
1415 nmdc:mga00v17_89846_c1 3300050491 Bacteria 1928
1416 nmdc:mga0yw44_22444_c1 3300050492 Bacteria 3540
1417 nmdc:mga0yw44_240635_c1 3300050492 Bacteria 1203
1418 nmdc:mga0k408_11800_c1 3300050493 Bacteria 4767
1419 nmdc:mga06z11_114371_c1 3300050494 Bacteria 1498
1420 nmdc:mga06z11_83358_c1 3300050494 Bacteria 1720
1421 nmdc:mga04h51_83760_c1 3300050495 Bacteria 1136
1422 nmdc:mga05p37_383767_c1 3300050507 Bacteria 1645
1423 nmdc:mga09592_123541_c1 3300050508 Unclassified 2224
1424 nmdc:mga0qj67_457534_c1 3300050509 Bacteria 1027
1425 nmdc:mga0qj67_85105_c1 3300050509 Unclassified 2536
1426 nmdc:mga08y16_439693_c1 3300050511 Bacteria 1331
1427 nmdc:mga0n895_110839_c1 3300050512 Bacteria 2760
1428 nmdc:mga0sz30_147_c1 3300050516 Bacteria 26410
1429 nmdc:mga0sz30_8939_c1 3300050516 Bacteria 3797
1430 Ga0500651_0070610 3300053093 Bacteria 2174
1431 Ga0500566_0145636 3300053094 Bacteria 1252
1432 Ga0500650_0035843 3300053098 Bacteria 2275
1433 Ga0500572_000527 3300053111 Bacteria 13050
1434 Ga0500618_002632 3300053125 Bacteria 6615
1435 Ga0500642_0069831 3300053130 Bacteria 1596
1436 Ga0500659_0001304 3300053135 Bacteria 15980
1437 Ga0500573_0026782 3300053140 Bacteria 3314
1438 Ga0500577_0018788 3300053142 Bacteria 2229
1439 Ga0500586_036376 3300053145 Bacteria 1651
1440 Ga0500620_016086 3300053155 Bacteria 2131
1441 Ga0500634_0006366 3300053161 Bacteria 5704
1442 Ga0500552_001419 3300053733 Bacteria 2291

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0113583 Ga0501034_0113583_1890_2687 250
2 3300050490 nmdc:mga03n38_56524_c1 nmdc:mga03n38_56524_c1_15_815 250
3 3300035691 Ga0373931_0324504 Ga0373931_0324504_43_891 271
4 3300005834 Ga0068851_10003178 Ga0068851_100031782 272
5 3300005329 Ga0070683_100011003 Ga0070683_1000110037 283
6 3300005339 Ga0070660_100166825 Ga0070660_1001668251 283
7 3300005344 Ga0070661_100071300 Ga0070661_1000713003 283
8 3300005458 Ga0070681_10151166 Ga0070681_101511663 283
9 3300005535 Ga0070684_100107266 Ga0070684_1001072663 283
10 3300005539 Ga0068853_100111544 Ga0068853_1001115443 283
11 3300005564 Ga0070664_100035365 Ga0070664_1000353654 283
12 3300005614 Ga0068856_100037831 Ga0068856_1000378314 283
13 3300005616 Ga0068852_100011372 Ga0068852_1000113726 283
14 3300014497 Ga0182008_10028229 Ga0182008_100282292 283
15 3300025919 Ga0207657_10077024 Ga0207657_100770244 283
16 3300025944 Ga0207661_10223628 Ga0207661_102236282 283
17 3300025945 Ga0207679_10071473 Ga0207679_100714733 283
18 3300037312 Ga0395899_0042131 Ga0395899_0042131_240_1160 283
19 3300037418 Ga0395900_0021617 Ga0395900_0021617_2626_3546 283
20 3300038443 Ga0395901_0017073 Ga0395901_0017073_3668_4588 283
21 3300042005 Ga0439448_0012071 Ga0439448_0012071_419_1339 283
22 3300009174 Ga0105241_10071110 Ga0105241_100711102 284
23 3300005548 Ga0070665_100018865 Ga0070665_1000188658 286
24 3300028379 Ga0268266_10004061 Ga0268266_1000406115 286
25 3300048917 Ga0496114_0240282 Ga0496114_0240282_144_1037 286
26 3300013307 Ga0157372_10000991 Ga0157372_1000099110 288
27 3300048922 Ga0496119_0000564 Ga0496119_0000564_31015_32097 288
28 3300048923 Ga0496120_0000718 Ga0496120_0000718_32859_33941 288
29 iso_pu_bacteria 2821443989 2821450452 288
30 iso_pu_bacteria 2844533157 2844534517 288
31 3300005353 Ga0070669_100045310 Ga0070669_1000453102 289
32 3300013102 Ga0157371_10002249 Ga0157371_1000224913 289
33 3300025923 Ga0207681_10001239 Ga0207681_100012392 289
34 3300031727 Ga0316576_10092861 Ga0316576_100928612 289
35 3300035398 Ga0316574_0038056 Ga0316574_0038056_1879_2793 289
36 2162886007 SwRhRL2b_contig_1560538 SwRhRL2b_0323.00002790 290
37 3300005353 Ga0070669_100083723 Ga0070669_1000837233 290
38 3300005844 Ga0068862_100225380 Ga0068862_1002253802 290
39 3300006177 Ga0075362_10001824 Ga0075362_100018243 290
40 3300006195 Ga0075366_10005136 Ga0075366_100051367 290
41 3300009036 Ga0105244_10022548 Ga0105244_100225482 290
42 3300009148 Ga0105243_10014634 Ga0105243_100146343 290
43 3300025302 Ga0207426_1004145 Ga0207426_10041456 290
44 3300025923 Ga0207681_10109133 Ga0207681_101091333 290
45 3300046515 Ga0495620_0000032 Ga0495620_0000032_66651_67583 290
46 3300046519 Ga0495632_0000254 Ga0495632_0000254_41018_41950 290
47 3300046522 Ga0495643_0000773 Ga0495643_0000773_22212_23144 290
48 3300046524 Ga0495648_0002314 Ga0495648_0002314_11221_12153 290
49 3300048919 Ga0496116_0015440 Ga0496116_0015440_3932_4864 290
50 3300048920 Ga0496117_0000693 Ga0496117_0000693_30548_31480 290
51 3300048920 Ga0496117_0007560 Ga0496117_0007560_5738_6670 290
52 3300048921 Ga0496118_0018661 Ga0496118_0018661_4635_5567 290
53 3300048926 Ga0496123_0193523 Ga0496123_0193523_69_1001 290
54 3300048928 Ga0496125_0002275 Ga0496125_0002275_21848_22780 290
55 3300049571 Ga0501034_0007498 Ga0501034_0007498_7819_8736 290
56 3300049571 Ga0501034_0017591 Ga0501034_0017591_4513_5430 290
57 3300049573 Ga0501037_0262644 Ga0501037_0262644_208_1125 290
58 3300049586 Ga0501070_0038291 Ga0501070_0038291_1801_2718 290
59 3300049823 Ga0501044_0031568 Ga0501044_0031568_12_929 290
60 3300050489 nmdc:mga03683_170138_c1 nmdc:mga03683_170138_c1_43_963 290
61 3300050493 nmdc:mga0k408_11800_c1 nmdc:mga0k408_11800_c1_1833_2753 290
62 3300050494 nmdc:mga06z11_83358_c1 nmdc:mga06z11_83358_c1_190_1110 290
63 3300005338 Ga0068868_100228084 Ga0068868_1002280842 291
64 3300005344 Ga0070661_100367454 Ga0070661_1003674541 291
65 3300005535 Ga0070684_100686356 Ga0070684_1006863561 291
66 3300005548 Ga0070665_100071342 Ga0070665_1000713424 291
67 3300005937 Ga0081455_10070944 Ga0081455_100709443 291
68 3300005983 Ga0081540_1096962 Ga0081540_10969622 291
69 3300006846 Ga0075430_100080904 Ga0075430_1000809044 291
70 3300006847 Ga0075431_100270441 Ga0075431_1002704412 291
71 3300006871 Ga0075434_100605287 Ga0075434_1006052871 291
72 3300006880 Ga0075429_100144120 Ga0075429_1001441202 291
73 3300009093 Ga0105240_10158156 Ga0105240_101581562 291
74 3300009147 Ga0114129_10139767 Ga0114129_101397673 291
75 3300013296 Ga0157374_10122903 Ga0157374_101229032 291
76 3300025297 Ga0209758_1000350 Ga0209758_10003502 291
77 3300025931 Ga0207644_10209736 Ga0207644_102097362 291
78 3300026121 Ga0207683_10010692 Ga0207683_100106925 291
79 3300028379 Ga0268266_10108917 Ga0268266_101089172 291
80 3300035695 Ga0373927_0265013 Ga0373927_0265013_61_1038 291
81 3300037471 Ga0395905_0315726 Ga0395905_0315726_62_982 291
82 3300038443 Ga0395901_0113195 Ga0395901_0113195_1009_1929 291
83 3300044694 Ga0466963_0033206 Ga0466963_0033206_1082_2002 291
84 3300045976 Ga0466967_0122982 Ga0466967_0122982_650_1570 291
85 3300048909 Ga0496106_0419846 Ga0496106_0419846_85_1005 291
86 3300049571 Ga0501034_0153705 Ga0501034_0153705_1337_2254 291
87 3300050507 nmdc:mga05p37_383767_c1 nmdc:mga05p37_383767_c1_600_1520 291
88 3300050508 nmdc:mga09592_123541_c1 nmdc:mga09592_123541_c1_226_1146 291
89 3300050509 nmdc:mga0qj67_85105_c1 nmdc:mga0qj67_85105_c1_1450_2370 291
90 3300050512 nmdc:mga0n895_110839_c1 nmdc:mga0n895_110839_c1_1636_2556 291
91 3300003187 JGI25151J46595_10000321 JGI25151J46595_1000032115 292
92 3300005327 Ga0070658_10002808 Ga0070658_100028086 292
93 3300005336 Ga0070680_100008477 Ga0070680_1000084778 292
94 3300005338 Ga0068868_100436151 Ga0068868_1004361511 292
95 3300005339 Ga0070660_100051364 Ga0070660_1000513643 292
96 3300005341 Ga0070691_10002276 Ga0070691_100022765 292
97 3300005445 Ga0070708_100099728 Ga0070708_1000997281 292
98 3300005456 Ga0070678_100094306 Ga0070678_1000943061 292
99 3300005458 Ga0070681_10018158 Ga0070681_100181583 292
100 3300005467 Ga0070706_100063652 Ga0070706_1000636524 292
101 3300005471 Ga0070698_100003213 Ga0070698_10000321310 292
102 3300005530 Ga0070679_100134111 Ga0070679_1001341113 292
103 3300005548 Ga0070665_100018130 Ga0070665_1000181306 292
104 3300005563 Ga0068855_100041138 Ga0068855_1000411385 292
105 3300005937 Ga0081455_10001851 Ga0081455_1000185115 292
106 3300005937 Ga0081455_10002478 Ga0081455_1000247812 292
107 3300005937 Ga0081455_10007317 Ga0081455_100073174 292
108 3300005985 Ga0081539_10001293 Ga0081539_100012935 292
109 3300006038 Ga0075365_10058682 Ga0075365_100586822 292
110 3300006038 Ga0075365_10085414 Ga0075365_100854143 292
111 3300006042 Ga0075368_10084364 Ga0075368_100843642 292
112 3300006177 Ga0075362_10008747 Ga0075362_100087474 292
113 3300006178 Ga0075367_10086307 Ga0075367_100863071 292
114 3300006186 Ga0075369_10021742 Ga0075369_100217423 292
115 3300007265 Ga0099794_10067924 Ga0099794_100679243 292
116 3300009093 Ga0105240_10010321 Ga0105240_100103218 292
117 3300009098 Ga0105245_10573556 Ga0105245_105735561 292
118 3300009177 Ga0105248_10480941 Ga0105248_104809411 292
119 3300010159 Ga0099796_10020266 Ga0099796_100202663 292
120 3300013105 Ga0157369_10159391 Ga0157369_101593911 292
121 3300013297 Ga0157378_10428942 Ga0157378_104289421 292
122 3300021441 Ga0213871_10000355 Ga0213871_100003555 292
123 3300025284 Ga0209130_1000403 Ga0209130_10004032 292
124 3300025294 Ga0209025_1000224 Ga0209025_100022463 292
125 3300025297 Ga0209758_1001111 Ga0209758_100111112 292
126 3300025302 Ga0207426_1000151 Ga0207426_1000151101 292
127 3300025909 Ga0207705_10007165 Ga0207705_100071654 292
128 3300025910 Ga0207684_10041459 Ga0207684_100414593 292
129 3300025912 Ga0207707_10003527 Ga0207707_100035278 292
130 3300025913 Ga0207695_10016461 Ga0207695_100164618 292
131 3300025915 Ga0207693_10150129 Ga0207693_101501293 292
132 3300025917 Ga0207660_10032043 Ga0207660_100320432 292
133 3300025919 Ga0207657_10155854 Ga0207657_101558541 292
134 3300025921 Ga0207652_10234386 Ga0207652_102343861 292
135 3300025922 Ga0207646_10376656 Ga0207646_103766562 292
136 3300025925 Ga0207650_10158995 Ga0207650_101589952 292
137 3300025939 Ga0207665_10138416 Ga0207665_101384161 292
138 3300025949 Ga0207667_10002821 Ga0207667_1000282111 292
139 3300025961 Ga0207712_10299890 Ga0207712_102998902 292
140 3300026116 Ga0207674_10144440 Ga0207674_101444402 292
141 3300028379 Ga0268266_10084353 Ga0268266_100843531 292
142 3300028794 Ga0307515_10008688 Ga0307515_1000868819 292
143 3300031238 Ga0265332_10067104 Ga0265332_100671042 292
144 3300031247 Ga0265340_10025165 Ga0265340_100251654 292
145 3300031247 Ga0265340_10091773 Ga0265340_100917732 292
146 3300031616 Ga0307508_10001872 Ga0307508_1000187218 292
147 3300031649 Ga0307514_10214367 Ga0307514_102143671 292
148 3300033179 Ga0307507_10118549 Ga0307507_101185492 292
149 3300034816 Ga0373930_0019898 Ga0373930_0019898_357_1280 292
150 3300035084 Ga0373928_0033584 Ga0373928_0033584_172_1095 292
151 3300035115 Ga0373941_0035837 Ga0373941_0035837_192_1115 292
152 3300035691 Ga0373931_0022171 Ga0373931_0022171_1901_2824 292
153 3300035725 Ga0373947_0142170 Ga0373947_0142170_156_1079 292
154 3300035725 Ga0373947_0228903 Ga0373947_0228903_168_1091 292
155 3300036401 Ga0373937_0186180 Ga0373937_0186180_802_1725 292
156 3300037068 Ga0373925_0368132 Ga0373925_0368132_184_1107 292
157 3300037312 Ga0395899_0059184 Ga0395899_0059184_1273_2196 292
158 3300037418 Ga0395900_0097455 Ga0395900_0097455_542_1465 292
159 3300037418 Ga0395900_0099955 Ga0395900_0099955_1476_2399 292
160 3300038443 Ga0395901_0007074 Ga0395901_0007074_805_1728 292
161 3300038443 Ga0395901_0156410 Ga0395901_0156410_857_1780 292
162 3300039438 Ga0436360_1076911 Ga0436360_1076911_2567_3496 292
163 3300039447 Ga0436361_0167998 Ga0436361_0167998_464_1393 292
164 3300041997 Ga0439431_0046729 Ga0439431_0046729_107_1042 292
165 3300042001 Ga0439441_033552 Ga0439441_033552_56_979 292
166 3300042438 Ga0439459_0006721 Ga0439459_0006721_389_1312 292
167 3300046512 Ga0495610_0105286 Ga0495610_0105286_87_1022 292
168 3300048929 Ga0496126_0295478 Ga0496126_0295478_382_1305 292
169 3300049573 Ga0501037_0090962 Ga0501037_0090962_750_1673 292
170 3300049579 Ga0501043_0167247 Ga0501043_0167247_212_1135 292
171 3300049581 Ga0501047_0066657 Ga0501047_0066657_679_1602 292
172 3300049586 Ga0501070_0309929 Ga0501070_0309929_68_991 292
173 3300049822 Ga0501035_0387858 Ga0501035_0387858_34_960 292
174 3300050489 nmdc:mga03683_29384_c1 nmdc:mga03683_29384_c1_96_1019 292
175 3300050492 nmdc:mga0yw44_22444_c1 nmdc:mga0yw44_22444_c1_1402_2325 292
176 3300050492 nmdc:mga0yw44_240635_c1 nmdc:mga0yw44_240635_c1_54_977 292
177 3300050494 nmdc:mga06z11_114371_c1 nmdc:mga06z11_114371_c1_81_1004 292
178 3300050495 nmdc:mga04h51_83760_c1 nmdc:mga04h51_83760_c1_132_1055 292
179 3300050509 nmdc:mga0qj67_457534_c1 nmdc:mga0qj67_457534_c1_84_1007 292
180 3300050511 nmdc:mga08y16_439693_c1 nmdc:mga08y16_439693_c1_68_991 292
181 3300050516 nmdc:mga0sz30_147_c1 nmdc:mga0sz30_147_c1_4410_5333 292
182 3300050516 nmdc:mga0sz30_8939_c1 nmdc:mga0sz30_8939_c1_1339_2262 292
183 3300053093 Ga0500651_0070610 Ga0500651_0070610_248_1171 292
184 3300053094 Ga0500566_0145636 Ga0500566_0145636_33_974 292
185 3300053098 Ga0500650_0035843 Ga0500650_0035843_1317_2240 292
186 3300053130 Ga0500642_0069831 Ga0500642_0069831_623_1546 292
187 3300053155 Ga0500620_016086 Ga0500620_016086_404_1327 292
188 3300053733 Ga0500552_001419 Ga0500552_001419_127_1050 292
189 3300005327 Ga0070658_10096351 Ga0070658_100963512 293
190 3300005344 Ga0070661_100001582 Ga0070661_10000158214 293
191 3300005366 Ga0070659_100033553 Ga0070659_1000335534 293
192 3300005458 Ga0070681_10026934 Ga0070681_100269342 293
193 3300005535 Ga0070684_100004661 Ga0070684_1000046615 293
194 3300005539 Ga0068853_100040481 Ga0068853_1000404814 293
195 3300005563 Ga0068855_100002880 Ga0068855_1000028803 293
196 3300005577 Ga0068857_100000144 Ga0068857_10000014418 293
197 3300005578 Ga0068854_100008049 Ga0068854_1000080493 293
198 3300005614 Ga0068856_100001498 Ga0068856_10000149813 293
199 3300005616 Ga0068852_100001466 Ga0068852_10000146614 293
200 3300009093 Ga0105240_10007190 Ga0105240_1000719014 293
201 3300009174 Ga0105241_10133494 Ga0105241_101334942 293
202 3300009545 Ga0105237_10174357 Ga0105237_101743572 293
203 3300009551 Ga0105238_10001694 Ga0105238_1000169413 293
204 3300013100 Ga0157373_10017022 Ga0157373_100170225 293
205 3300013104 Ga0157370_10008197 Ga0157370_1000819711 293
206 3300013105 Ga0157369_10001339 Ga0157369_1000133933 293
207 3300013307 Ga0157372_10005148 Ga0157372_100051486 293
208 3300025912 Ga0207707_10040573 Ga0207707_100405733 293
209 3300025913 Ga0207695_10012606 Ga0207695_100126065 293
210 3300025914 Ga0207671_10108225 Ga0207671_101082252 293
211 3300025924 Ga0207694_10033017 Ga0207694_100330174 293
212 3300025929 Ga0207664_10012275 Ga0207664_100122754 293
213 3300025932 Ga0207690_10137821 Ga0207690_101378212 293
214 3300025945 Ga0207679_10155013 Ga0207679_101550132 293
215 3300025949 Ga0207667_10004426 Ga0207667_100044265 293
216 3300025981 Ga0207640_10013478 Ga0207640_100134782 293
217 3300026078 Ga0207702_10012298 Ga0207702_100122988 293
218 3300026116 Ga0207674_10000020 Ga0207674_10000020137 293
219 3300026142 Ga0207698_10005091 Ga0207698_100050919 293
220 3300048924 Ga0496121_0003938 Ga0496121_0003938_17259_18182 293
221 3300005289 Ga0065704_10076920 Ga0065704_100769203 294
222 3300025728 Ga0207655_1021403 Ga0207655_10214032 294
223 3300025935 Ga0207709_10004027 Ga0207709_100040274 294
224 3300046515 Ga0495620_0003408 Ga0495620_0003408_3752_4669 294
225 3300046523 Ga0495644_0000310 Ga0495644_0000310_19505_20491 294
226 3300046665 Ga0495661_0057470 Ga0495661_0057470_1200_2186 294
227 3300048926 Ga0496123_0071947 Ga0496123_0071947_317_1243 294
228 3300048927 Ga0496124_0043389 Ga0496124_0043389_276_1202 294
229 3300048928 Ga0496125_0068536 Ga0496125_0068536_1750_2676 294
230 3300048929 Ga0496126_0015083 Ga0496126_0015083_4478_5404 294
231 iso_pu_bacteria 2946006987 2946013170 294
232 iso_pu_bacteria 8016728285 8016731875 295
233 3300005548 Ga0070665_100389172 Ga0070665_1003891722 296
234 3300009036 Ga0105244_10024238 Ga0105244_100242382 296
235 3300021384 Ga0213876_10039915 Ga0213876_100399152 296
236 3300025292 Ga0209676_1003229 Ga0209676_10032298 296
237 3300025711 Ga0207696_1000050 Ga0207696_100005017 296
238 3300025728 Ga0207655_1022092 Ga0207655_10220922 296
239 3300025735 Ga0207713_1007514 Ga0207713_10075143 296
240 3300039437 Ga0436365_0298705 Ga0436365_0298705_3114_4043 296
241 3300046491 Ga0495584_0004685 Ga0495584_0004685_3734_4624 296
242 3300046506 Ga0495583_0000086 Ga0495583_0000086_160346_161248 296
243 3300046520 Ga0495637_0005498 Ga0495637_0005498_1969_2859 296
244 3300046530 Ga0495654_0000117 Ga0495654_0000117_84687_85589 296
245 3300047469 Ga0495673_0082307 Ga0495673_0082307_420_1310 296
246 3300047470 Ga0495681_0005590 Ga0495681_0005590_3745_4635 296
247 3300006353 Ga0075370_10128420 Ga0075370_101284202 297
248 3300006944 Ga0099823_1035626 Ga0099823_10356262 297
249 3300027296 Ga0209389_1080368 Ga0209389_10803682 297
250 iso_pu_bacteria 2547132416 2548652990 297
251 iso_pu_bacteria 2602042047 2603642459 297
252 iso_pu_bacteria 2602042066 2603699028 297
253 iso_pu_bacteria 2602042067 2603703056 297
254 iso_pu_bacteria 2671180115 2671585644 297
255 iso_pu_bacteria 2681812866 2681997383 297
256 iso_pu_bacteria 2751185917 2753855914 297
257 iso_pu_bacteria 2775506706 2775538935 297
258 iso_pu_bacteria 2821118458 2821118509 297
259 iso_pu_bacteria 2821118458 2821119748 297
260 iso_pu_bacteria 2844425489 2844427475 297
261 iso_pu_bacteria 2855195626 2855198610 297
262 iso_pu_bacteria 2923634449 2923634798 297
263 iso_pu_bacteria 2927833300 2927834162 297
264 iso_pu_bacteria 2935625433 2935626393 297
265 iso_pu_bacteria 2937539931 2937541715 297
266 iso_pu_bacteria 2974435778 2974438710 297
267 iso_pu_bacteria 8018221730 8018223004 297
268 3300009011 Ga0105251_10001647 Ga0105251_1000164715 298
269 3300025735 Ga0207713_1000029 Ga0207713_100002970 298
270 3300042142 Ga0450905_000332 Ga0450905_000332_1994_2920 298
271 3300042439 Ga0439464_0006320 Ga0439464_0006320_23_949 298
272 3300009011 Ga0105251_10000133 Ga0105251_1000013353 299
273 3300009011 Ga0105251_10023119 Ga0105251_100231191 299
274 3300009011 Ga0105251_10092596 Ga0105251_100925962 299
275 3300009036 Ga0105244_10029705 Ga0105244_100297052 299
276 3300009036 Ga0105244_10130193 Ga0105244_101301932 299
277 3300009092 Ga0105250_10000561 Ga0105250_1000056112 299
278 3300009092 Ga0105250_10001898 Ga0105250_100018987 299
279 3300009092 Ga0105250_10033340 Ga0105250_100333402 299
280 3300011119 Ga0105246_10036391 Ga0105246_100363912 299
281 3300013100 Ga0157373_10014072 Ga0157373_100140723 299
282 3300013100 Ga0157373_10018309 Ga0157373_100183092 299
283 3300013102 Ga0157371_10300494 Ga0157371_103004942 299
284 3300013104 Ga0157370_10207502 Ga0157370_102075022 299
285 3300014497 Ga0182008_10002966 Ga0182008_100029663 299
286 3300014497 Ga0182008_10007265 Ga0182008_100072653 299
287 3300014497 Ga0182008_10093275 Ga0182008_100932751 299
288 3300015261 Ga0182006_1002357 Ga0182006_10023571 299
289 3300015261 Ga0182006_1002509 Ga0182006_10025093 299
290 3300015262 Ga0182007_10002483 Ga0182007_100024834 299
291 3300015265 Ga0182005_1001831 Ga0182005_10018312 299
292 3300015265 Ga0182005_1001921 Ga0182005_10019213 299
293 3300042006 Ga0439432_006289 Ga0439432_006289_3257_4156 299
294 3300042009 Ga0439451_013214 Ga0439451_013214_755_1654 299
295 3300042013 Ga0439456_024458 Ga0439456_024458_14_913 299
296 3300042016 Ga0439463_000660 Ga0439463_000660_4660_5559 299
297 3300042115 Ga0450911_000697 Ga0450911_000697_2164_3063 299
298 3300042144 Ga0450889_006147 Ga0450889_006147_18_917 299
299 3300046453 Ga0495627_001460 Ga0495627_001460_8376_9275 299
300 3300046453 Ga0495627_005774 Ga0495627_005774_482_1381 299
301 3300046453 Ga0495627_008441 Ga0495627_008441_1623_2522 299
302 3300046458 Ga0495591_000546 Ga0495591_000546_19352_20251 299
303 3300046458 Ga0495591_000561 Ga0495591_000561_23306_24205 299
304 3300046458 Ga0495591_002349 Ga0495591_002349_5997_6896 299
305 3300046458 Ga0495591_003158 Ga0495591_003158_1662_2561 299
306 3300046458 Ga0495591_012169 Ga0495591_012169_360_1259 299
307 3300046458 Ga0495591_017701 Ga0495591_017701_1058_1957 299
308 3300046460 Ga0495638_0006351 Ga0495638_0006351_5836_6735 299
309 3300046463 Ga0495653_0008904 Ga0495653_0008904_2445_3344 299
310 3300046474 Ga0495605_0000896 Ga0495605_0000896_4250_5149 299
311 3300046474 Ga0495605_0011563 Ga0495605_0011563_455_1354 299
312 3300046474 Ga0495605_0040927 Ga0495605_0040927_254_1153 299
313 3300046475 Ga0495639_0000213 Ga0495639_0000213_6714_7613 299
314 3300046491 Ga0495584_0001823 Ga0495584_0001823_2343_3242 299
315 3300046491 Ga0495584_0007268 Ga0495584_0007268_1285_2184 299
316 3300046491 Ga0495584_0028584 Ga0495584_0028584_879_1778 299
317 3300046492 Ga0495585_0005273 Ga0495585_0005273_6337_7236 299
318 3300046492 Ga0495585_0021927 Ga0495585_0021927_833_1732 299
319 3300046492 Ga0495585_0050756 Ga0495585_0050756_352_1251 299
320 3300046492 Ga0495585_0114374 Ga0495585_0114374_269_1168 299
321 3300046499 Ga0495594_0020267 Ga0495594_0020267_1050_1949 299
322 3300046500 Ga0495596_0002642 Ga0495596_0002642_1787_2686 299
323 3300046501 Ga0495607_0008710 Ga0495607_0008710_4846_5745 299
324 3300046501 Ga0495607_0018773 Ga0495607_0018773_994_1893 299
325 3300046501 Ga0495607_0038024 Ga0495607_0038024_1283_2182 299
326 3300046501 Ga0495607_0098176 Ga0495607_0098176_236_1135 299
327 3300046501 Ga0495607_0108793 Ga0495607_0108793_310_1209 299
328 3300046506 Ga0495583_0000896 Ga0495583_0000896_8996_9895 299
329 3300046506 Ga0495583_0017212 Ga0495583_0017212_2372_3271 299
330 3300046507 Ga0495606_0000655 Ga0495606_0000655_49606_50505 299
331 3300046507 Ga0495606_0001126 Ga0495606_0001126_26896_27795 299
332 3300046507 Ga0495606_0006517 Ga0495606_0006517_3655_4554 299
333 3300046507 Ga0495606_0008971 Ga0495606_0008971_6524_7423 299
334 3300046507 Ga0495606_0011996 Ga0495606_0011996_809_1708 299
335 3300046507 Ga0495606_0071571 Ga0495606_0071571_1040_1939 299
336 3300046512 Ga0495610_0000834 Ga0495610_0000834_12088_12987 299
337 3300046512 Ga0495610_0006237 Ga0495610_0006237_3727_4626 299
338 3300046512 Ga0495610_0029458 Ga0495610_0029458_75_974 299
339 3300046513 Ga0495616_0000415 Ga0495616_0000415_3551_4450 299
340 3300046515 Ga0495620_0004173 Ga0495620_0004173_1884_2783 299
341 3300046515 Ga0495620_0006753 Ga0495620_0006753_334_1233 299
342 3300046517 Ga0495630_0019172 Ga0495630_0019172_1550_2449 299
343 3300046519 Ga0495632_0001184 Ga0495632_0001184_13568_14467 299
344 3300046519 Ga0495632_0003017 Ga0495632_0003017_3335_4234 299
345 3300046519 Ga0495632_0090903 Ga0495632_0090903_434_1333 299
346 3300046520 Ga0495637_0000234 Ga0495637_0000234_26001_26900 299
347 3300046520 Ga0495637_0003950 Ga0495637_0003950_5072_5971 299
348 3300046520 Ga0495637_0008605 Ga0495637_0008605_569_1468 299
349 3300046520 Ga0495637_0009494 Ga0495637_0009494_3582_4481 299
350 3300046522 Ga0495643_0012274 Ga0495643_0012274_4043_4948 299
351 3300046524 Ga0495648_0005085 Ga0495648_0005085_6254_7153 299
352 3300046524 Ga0495648_0011702 Ga0495648_0011702_3613_4512 299
353 3300046530 Ga0495654_0000481 Ga0495654_0000481_28431_29330 299
354 3300046530 Ga0495654_0000689 Ga0495654_0000689_16544_17443 299
355 3300046530 Ga0495654_0005000 Ga0495654_0005000_2817_3716 299
356 3300046530 Ga0495654_0009036 Ga0495654_0009036_187_1086 299
357 3300046530 Ga0495654_0130938 Ga0495654_0130938_50_949 299
358 3300046536 Ga0495587_0014226 Ga0495587_0014226_3902_4801 299
359 3300046538 Ga0495609_0000453 Ga0495609_0000453_9119_10018 299
360 3300046557 Ga0495622_0012257 Ga0495622_0012257_1202_2101 299
361 3300046558 Ga0495633_0098899 Ga0495633_0098899_196_1095 299
362 3300046616 Ga0495668_0061889 Ga0495668_0061889_604_1503 299
363 3300046642 Ga0495634_0001159 Ga0495634_0001159_4225_5124 299
364 3300046648 Ga0495611_0009086 Ga0495611_0009086_1517_2416 299
365 3300046660 Ga0495625_0000061 Ga0495625_0000061_152037_152936 299
366 3300046660 Ga0495625_0001582 Ga0495625_0001582_22827_23726 299
367 3300046660 Ga0495625_0031606 Ga0495625_0031606_2818_3717 299
368 3300046660 Ga0495625_0072822 Ga0495625_0072822_1254_2153 299
369 3300046660 Ga0495625_0129115 Ga0495625_0129115_467_1366 299
370 3300046663 Ga0495635_0000351 Ga0495635_0000351_24705_25604 299
371 3300046664 Ga0495659_0001364 Ga0495659_0001364_2883_3782 299
372 3300046665 Ga0495661_0000356 Ga0495661_0000356_23001_23900 299
373 3300046665 Ga0495661_0051180 Ga0495661_0051180_1172_2071 299
374 3300046678 Ga0495599_0163583 Ga0495599_0163583_111_1010 299
375 3300046679 Ga0495623_0024079 Ga0495623_0024079_489_1388 299
376 3300046680 Ga0495646_0026649 Ga0495646_0026649_709_1608 299
377 3300046689 Ga0495613_0045845 Ga0495613_0045845_1797_2696 299
378 3300046692 Ga0495671_0011188 Ga0495671_0011188_465_1364 299
379 3300046692 Ga0495671_0043844 Ga0495671_0043844_504_1403 299
380 3300046692 Ga0495671_0163470 Ga0495671_0163470_126_1025 299
381 3300046694 Ga0495649_0012215 Ga0495649_0012215_796_1695 299
382 3300046694 Ga0495649_0019527 Ga0495649_0019527_164_1063 299
383 3300046694 Ga0495649_0027475 Ga0495649_0027475_1977_2876 299
384 3300046694 Ga0495649_0068190 Ga0495649_0068190_914_1813 299
385 3300046794 Ga0495589_0004645 Ga0495589_0004645_5862_6761 299
386 3300046794 Ga0495589_0013859 Ga0495589_0013859_2681_3580 299
387 3300046810 Ga0495660_0002722 Ga0495660_0002722_1849_2748 299
388 3300046810 Ga0495660_0023827 Ga0495660_0023827_403_1302 299
389 3300046810 Ga0495660_0060874 Ga0495660_0060874_218_1117 299
390 3300046810 Ga0495660_0062559 Ga0495660_0062559_1044_1943 299
391 3300047315 Ga0495581_0026114 Ga0495581_0026114_2019_2918 299
392 3300047317 Ga0495604_0053935 Ga0495604_0053935_656_1555 299
393 3300047320 Ga0495672_0131587 Ga0495672_0131587_229_1128 299
394 3300047321 Ga0495676_0000011 Ga0495676_0000011_25962_26861 299
395 3300047322 Ga0495680_0007292 Ga0495680_0007292_2465_3364 299
396 3300047323 Ga0495683_0002688 Ga0495683_0002688_3848_4747 299
397 3300047323 Ga0495683_0015035 Ga0495683_0015035_889_1788 299
398 3300047443 Ga0495687_008286 Ga0495687_008286_2887_3786 299
399 3300047446 Ga0495679_000028 Ga0495679_000028_31559_32458 299
400 3300047446 Ga0495679_010121 Ga0495679_010121_2195_3094 299
401 3300047446 Ga0495679_023900 Ga0495679_023900_603_1502 299
402 3300047469 Ga0495673_0000988 Ga0495673_0000988_1247_2146 299
403 3300047469 Ga0495673_0002234 Ga0495673_0002234_4451_5350 299
404 3300047469 Ga0495673_0004284 Ga0495673_0004284_5799_6698 299
405 3300047469 Ga0495673_0013454 Ga0495673_0013454_2498_3397 299
406 3300047470 Ga0495681_0002835 Ga0495681_0002835_3760_4659 299
407 3300047470 Ga0495681_0007496 Ga0495681_0007496_2394_3293 299
408 3300047470 Ga0495681_0013286 Ga0495681_0013286_3624_4523 299
409 3300047472 Ga0495686_0007358 Ga0495686_0007358_3660_4559 299
410 3300047472 Ga0495686_0019205 Ga0495686_0019205_3075_3974 299
411 3300047673 Ga0495593_0017532 Ga0495593_0017532_2520_3419 299
412 3300047673 Ga0495593_0032085 Ga0495593_0032085_1878_2777 299
413 3300048091 Ga0495626_0000024 Ga0495626_0000024_152515_153414 299
414 3300048091 Ga0495626_0000682 Ga0495626_0000682_28032_28931 299
415 3300048091 Ga0495626_0002854 Ga0495626_0002854_6631_7530 299
416 3300048905 Ga0496102_0000830 Ga0496102_0000830_4165_5064 299
417 3300048906 Ga0496103_0007698 Ga0496103_0007698_1588_2487 299
418 3300048908 Ga0496105_0263339 Ga0496105_0263339_449_1348 299
419 3300048917 Ga0496114_0026493 Ga0496114_0026493_2217_3122 299
420 3300048918 Ga0496115_0154850 Ga0496115_0154850_711_1610 299
421 3300048919 Ga0496116_0001804 Ga0496116_0001804_490_1389 299
422 3300048919 Ga0496116_0002210 Ga0496116_0002210_19278_20177 299
423 3300048919 Ga0496116_0007499 Ga0496116_0007499_6514_7413 299
424 3300048919 Ga0496116_0031992 Ga0496116_0031992_2196_3095 299
425 3300048920 Ga0496117_0001950 Ga0496117_0001950_24642_25541 299
426 3300048920 Ga0496117_0014528 Ga0496117_0014528_4204_5109 299
427 3300048920 Ga0496117_0035585 Ga0496117_0035585_1402_2301 299
428 3300048921 Ga0496118_0003183 Ga0496118_0003183_769_1668 299
429 3300048921 Ga0496118_0033734 Ga0496118_0033734_1627_2532 299
430 3300048921 Ga0496118_0036928 Ga0496118_0036928_1621_2520 299
431 3300048921 Ga0496118_0088371 Ga0496118_0088371_440_1339 299
432 3300048924 Ga0496121_0010539 Ga0496121_0010539_5208_6107 299
433 3300048924 Ga0496121_0065546 Ga0496121_0065546_261_1160 299
434 3300048924 Ga0496121_0234962 Ga0496121_0234962_142_1041 299
435 3300048925 Ga0496122_0000616 Ga0496122_0000616_51077_51976 299
436 3300048925 Ga0496122_0002337 Ga0496122_0002337_1502_2407 299
437 3300048925 Ga0496122_0011127 Ga0496122_0011127_1649_2548 299
438 3300048925 Ga0496122_0050549 Ga0496122_0050549_2117_3016 299
439 3300048926 Ga0496123_0000178 Ga0496123_0000178_89091_89996 299
440 3300048926 Ga0496123_0000515 Ga0496123_0000515_23230_24129 299
441 3300048926 Ga0496123_0023440 Ga0496123_0023440_143_1042 299
442 3300048927 Ga0496124_0000073 Ga0496124_0000073_194484_195383 299
443 3300048927 Ga0496124_0010496 Ga0496124_0010496_3591_4490 299
444 3300048927 Ga0496124_0018495 Ga0496124_0018495_3619_4518 299
445 3300048927 Ga0496124_0340359 Ga0496124_0340359_92_991 299
446 3300048928 Ga0496125_0137206 Ga0496125_0137206_537_1436 299
447 3300049459 Ga0495678_014822 Ga0495678_014822_2239_3138 299
448 3300049459 Ga0495678_029051 Ga0495678_029051_421_1320 299
449 3300049758 Ga0501241_002653 Ga0501241_002653_893_1792 299
450 iso_pu_bacteria 2547132181 2547695286 299
451 iso_pu_bacteria 2791355010 2792312878 299
452 iso_pu_bacteria 2917832318 2917833000 299
453 iso_pu_bacteria 2919125081 2919126593 299
454 iso_pu_bacteria 2984504281 2984505210 299
455 iso_pu_bacteria 8016728285 8016732912 299
456 3300013100 Ga0157373_10112065 Ga0157373_101120652 300
457 3300042533 Ga0450901_000260 Ga0450901_000260_976_1896 300
458 3300046492 Ga0495585_0001336 Ga0495585_0001336_6740_7660 300
459 3300046507 Ga0495606_0061387 Ga0495606_0061387_1456_2376 300
460 iso_pu_bacteria 2863421361 2863427818 300
461 3300003320 rootH2_10011139 rootH2_1001113949 301
462 3300003856 Ga0058692_1000144 Ga0058692_100014441 301
463 3300003856 Ga0058692_1000248 Ga0058692_100024811 301
464 3300005289 Ga0065704_10163967 Ga0065704_101639671 301
465 3300005577 Ga0068857_100025370 Ga0068857_1000253705 301
466 3300005834 Ga0068851_10060819 Ga0068851_100608192 301
467 3300006946 Ga0079104_1000632 Ga0079104_100063229 301
468 3300006946 Ga0079104_1009810 Ga0079104_10098105 301
469 3300009011 Ga0105251_10003744 Ga0105251_100037444 301
470 3300009011 Ga0105251_10054776 Ga0105251_100547761 301
471 3300009011 Ga0105251_10055323 Ga0105251_100553232 301
472 3300009011 Ga0105251_10108315 Ga0105251_101083152 301
473 3300009092 Ga0105250_10099541 Ga0105250_100995411 301
474 3300013100 Ga0157373_10210126 Ga0157373_102101262 301
475 3300013102 Ga0157371_10021423 Ga0157371_100214232 301
476 3300013105 Ga0157369_10016498 Ga0157369_100164983 301
477 3300013307 Ga0157372_10021449 Ga0157372_100214492 301
478 3300015679 Ga0183366_1001 Ga0183366_10011320 301
479 3300015680 Ga0183370_1001 Ga0183370_10011320 301
480 3300015685 Ga0183369_1001 Ga0183369_10011320 301
481 3300015687 Ga0183368_1001 Ga0183368_10011320 301
482 3300025735 Ga0207713_1000427 Ga0207713_100042730 301
483 3300025735 Ga0207713_1001907 Ga0207713_100190710 301
484 3300025735 Ga0207713_1001912 Ga0207713_100191217 301
485 3300025735 Ga0207713_1009464 Ga0207713_10094645 301
486 3300025735 Ga0207713_1013460 Ga0207713_10134603 301
487 3300025932 Ga0207690_10063361 Ga0207690_100633613 301
488 3300026116 Ga0207674_10076058 Ga0207674_100760584 301
489 3300027111 Ga0209281_1000605 Ga0209281_100060543 301
490 3300027111 Ga0209281_1000611 Ga0209281_100061112 301
491 3300027312 Ga0209371_1000001 Ga0209371_10000011249 301
492 3300027312 Ga0209371_1000278 Ga0209371_100027826 301
493 3300027312 Ga0209371_1004717 Ga0209371_10047175 301
494 3300027312 Ga0209371_1013051 Ga0209371_10130512 301
495 3300030500 Ga0268256_1000001 Ga0268256_10000011392 301
496 3300030500 Ga0268256_1000231 Ga0268256_100023126 301
497 3300030500 Ga0268256_1004514 Ga0268256_10045145 301
498 3300030500 Ga0268256_1014305 Ga0268256_10143053 301
499 3300042010 Ga0439452_000662 Ga0439452_000662_14448_15374 301
500 3300044669 Ga0466981_0000027 Ga0466981_0000027_65417_66328 301
501 3300048907 Ga0496104_0000043 Ga0496104_0000043_35706_36629 301
502 3300048908 Ga0496105_0000726 Ga0496105_0000726_14809_15732 301
503 3300048908 Ga0496105_0228971 Ga0496105_0228971_415_1332 301
504 3300048919 Ga0496116_0001845 Ga0496116_0001845_19387_20304 301
505 3300048919 Ga0496116_0002480 Ga0496116_0002480_8568_9491 301
506 3300048919 Ga0496116_0008020 Ga0496116_0008020_6559_7482 301
507 3300048919 Ga0496116_0050774 Ga0496116_0050774_1276_2199 301
508 3300048920 Ga0496117_0000691 Ga0496117_0000691_31921_32838 301
509 3300048920 Ga0496117_0006161 Ga0496117_0006161_4104_5027 301
510 3300048920 Ga0496117_0007013 Ga0496117_0007013_3038_3961 301
511 3300048920 Ga0496117_0010562 Ga0496117_0010562_4906_5829 301
512 3300048920 Ga0496117_0181818 Ga0496117_0181818_273_1196 301
513 3300048921 Ga0496118_0000923 Ga0496118_0000923_35936_36853 301
514 3300048921 Ga0496118_0010894 Ga0496118_0010894_2649_3572 301
515 3300048921 Ga0496118_0057020 Ga0496118_0057020_1363_2286 301
516 3300048921 Ga0496118_0100330 Ga0496118_0100330_43_966 301
517 3300048922 Ga0496119_0000001 Ga0496119_0000001_296535_297452 301
518 3300048922 Ga0496119_0002826 Ga0496119_0002826_4875_5798 301
519 3300048922 Ga0496119_0004543 Ga0496119_0004543_9537_10460 301
520 3300048922 Ga0496119_0007806 Ga0496119_0007806_2416_3339 301
521 3300048922 Ga0496119_0041830 Ga0496119_0041830_1905_2828 301
522 3300048922 Ga0496119_0051873 Ga0496119_0051873_811_1734 301
523 3300048922 Ga0496119_0054334 Ga0496119_0054334_1257_2180 301
524 3300048923 Ga0496120_0000497 Ga0496120_0000497_28730_29653 301
525 3300048923 Ga0496120_0001405 Ga0496120_0001405_12306_13229 301
526 3300048923 Ga0496120_0003823 Ga0496120_0003823_7418_8341 301
527 3300048923 Ga0496120_0009282 Ga0496120_0009282_3034_3951 301
528 3300048923 Ga0496120_0021723 Ga0496120_0021723_406_1329 301
529 3300048923 Ga0496120_0024626 Ga0496120_0024626_1094_2017 301
530 3300048924 Ga0496121_0000816 Ga0496121_0000816_46460_47383 301
531 3300048924 Ga0496121_0001539 Ga0496121_0001539_20300_21223 301
532 3300048924 Ga0496121_0006117 Ga0496121_0006117_6476_7399 301
533 3300048924 Ga0496121_0008597 Ga0496121_0008597_4980_5903 301
534 3300048924 Ga0496121_0009784 Ga0496121_0009784_8732_9658 301
535 3300048924 Ga0496121_0016049 Ga0496121_0016049_5094_6017 301
536 3300048925 Ga0496122_0003450 Ga0496122_0003450_8495_9418 301
537 3300048925 Ga0496122_0011099 Ga0496122_0011099_1276_2193 301
538 3300048925 Ga0496122_0011408 Ga0496122_0011408_5428_6351 301
539 3300048925 Ga0496122_0052935 Ga0496122_0052935_968_1891 301
540 3300048925 Ga0496122_0053693 Ga0496122_0053693_901_1824 301
541 3300048925 Ga0496122_0064040 Ga0496122_0064040_273_1196 301
542 3300048926 Ga0496123_0001563 Ga0496123_0001563_17480_18403 301
543 3300048926 Ga0496123_0001674 Ga0496123_0001674_21854_22777 301
544 3300048926 Ga0496123_0001979 Ga0496123_0001979_18261_19184 301
545 3300048926 Ga0496123_0002710 Ga0496123_0002710_10748_11665 301
546 3300048926 Ga0496123_0010647 Ga0496123_0010647_3849_4775 301
547 3300048926 Ga0496123_0026258 Ga0496123_0026258_2188_3111 301
548 3300048926 Ga0496123_0041877 Ga0496123_0041877_1065_1988 301
549 3300048926 Ga0496123_0064865 Ga0496123_0064865_609_1532 301
550 3300048926 Ga0496123_0149252 Ga0496123_0149252_19_942 301
551 3300048927 Ga0496124_0000983 Ga0496124_0000983_37575_38498 301
552 3300048927 Ga0496124_0004679 Ga0496124_0004679_1112_2038 301
553 3300048927 Ga0496124_0026987 Ga0496124_0026987_2223_3146 301
554 3300048927 Ga0496124_0032592 Ga0496124_0032592_547_1464 301
555 3300048928 Ga0496125_0001600 Ga0496125_0001600_25037_25963 301
556 3300048928 Ga0496125_0002824 Ga0496125_0002824_18343_19266 301
557 3300048928 Ga0496125_0003874 Ga0496125_0003874_10831_11754 301
558 3300048928 Ga0496125_0034340 Ga0496125_0034340_919_1842 301
559 3300048929 Ga0496126_0000142 Ga0496126_0000142_100809_101732 301
560 3300048929 Ga0496126_0001077 Ga0496126_0001077_9600_10523 301
561 3300048929 Ga0496126_0010970 Ga0496126_0010970_5408_6331 301
562 3300048929 Ga0496126_0145996 Ga0496126_0145996_761_1684 301
563 3300048929 Ga0496126_0150566 Ga0496126_0150566_1033_1959 301
564 iso_pu_bacteria 2554235132 2554818396 301
565 iso_pu_bacteria 2606217733 2608385051 301
566 iso_pu_bacteria 2811994881 2812369585 301
567 iso_pu_bacteria 2923519811 2923523672 301
568 iso_pu_bacteria 3007872151 3007876541 301
569 iso_pu_bacteria 2511231004 2511252693 302
570 iso_pu_bacteria 2511231006 2511265973 302
571 iso_pu_bacteria 2511231007 2511269999 302
572 iso_pu_bacteria 2511231008 2511279237 302
573 iso_pu_bacteria 2511231011 2511294418 302
574 iso_pu_bacteria 2511231012 2511301987 302
575 iso_pu_bacteria 2511231014 2511315322 302
576 iso_pu_bacteria 2511231015 2511321643 302
577 iso_pu_bacteria 2511231016 2511324998 302
578 iso_pu_bacteria 2511231017 2511334792 302
579 iso_pu_bacteria 2511231018 2511339127 302
580 iso_pu_bacteria 2511231019 2511343119 302
581 iso_pu_bacteria 2511231020 2511350992 302
582 iso_pu_bacteria 2511231021 2511353661 302
583 iso_pu_bacteria 2511231022 2511364182 302
584 iso_pu_bacteria 2511231023 2511371356 302
585 iso_pu_bacteria 2511231024 2511377839 302
586 iso_pu_bacteria 2511231031 2511416545 302
587 iso_pu_bacteria 2511231156 2511827739 302
588 iso_pu_bacteria 2512047018 2512326575 302
589 iso_pu_bacteria 2554235231 2555248006 302
590 iso_pu_bacteria 2554235341 2555672932 302
591 iso_pu_bacteria 2582580891 2583795624 302
592 iso_pu_bacteria 2597489887 2597860982 302
593 iso_pu_bacteria 2597489888 2597866722 302
594 iso_pu_bacteria 2597489889 2597872583 302
595 iso_pu_bacteria 2599185155 2599327757 302
596 iso_pu_bacteria 2599185160 2599353483 302
597 iso_pu_bacteria 2599185160 2599355863 302
598 iso_pu_bacteria 2599185161 2599362735 302
599 iso_pu_bacteria 2599185161 2599363881 302
600 iso_pu_bacteria 2599185162 2599368959 302
601 iso_pu_bacteria 2599185162 2599370201 302
602 iso_pu_bacteria 2599185163 2599372508 302
603 iso_pu_bacteria 2599185163 2599375844 302
604 iso_pu_bacteria 2599185164 2599378591 302
605 iso_pu_bacteria 2599185164 2599380969 302
606 iso_pu_bacteria 2599185165 2599384032 302
607 iso_pu_bacteria 2599185165 2599387515 302
608 iso_pu_bacteria 2599185166 2599391367 302
609 iso_pu_bacteria 2599185166 2599394702 302
610 iso_pu_bacteria 2599185167 2599400888 302
611 iso_pu_bacteria 2599185168 2599406467 302
612 iso_pu_bacteria 2599185168 2599407613 302
613 iso_pu_bacteria 2599185179 2599449767 302
614 iso_pu_bacteria 2599185181 2599460317 302
615 iso_pu_bacteria 2599185181 2599462697 302
616 iso_pu_bacteria 2599185182 2599467881 302
617 iso_pu_bacteria 2599185182 2599470714 302
618 iso_pu_bacteria 2599185185 2599485784 302
619 iso_pu_bacteria 2599185186 2599489338 302
620 iso_pu_bacteria 2599185186 2599491714 302
621 iso_pu_bacteria 2599185188 2599500355 302
622 iso_pu_bacteria 2599185189 2599505845 302
623 iso_pu_bacteria 2599185190 2599511841 302
624 iso_pu_bacteria 2599185191 2599516825 302
625 iso_pu_bacteria 2599185212 2599615933 302
626 iso_pu_bacteria 2599185248 2599768051 302
627 iso_pu_bacteria 2599185257 2599804563 302
628 iso_pu_bacteria 2599185288 2599879135 302
629 iso_pu_bacteria 2599185289 2599885488 302
630 iso_pu_bacteria 2599185290 2599893344 302
631 iso_pu_bacteria 2599185291 2599897202 302
632 iso_pu_bacteria 2599185300 2599930623 302
633 iso_pu_bacteria 2599185302 2599942261 302
634 iso_pu_bacteria 2599185303 2599948919 302
635 iso_pu_bacteria 2599185304 2599954325 302
636 iso_pu_bacteria 2599185305 2599963069 302
637 iso_pu_bacteria 2599185306 2599966040 302
638 iso_pu_bacteria 2599185307 2599971960 302
639 iso_pu_bacteria 2599185308 2599977910 302
640 iso_pu_bacteria 2599185309 2599982831 302
641 iso_pu_bacteria 2599185310 2599988418 302
642 iso_pu_bacteria 2599185311 2599994081 302
643 iso_pu_bacteria 2599185312 2599999213 302
644 iso_pu_bacteria 2599185313 2600004214 302
645 iso_pu_bacteria 2599185314 2600012077 302
646 iso_pu_bacteria 2599185315 2600019857 302
647 iso_pu_bacteria 2599185316 2600026160 302
648 iso_pu_bacteria 2599185317 2600031231 302
649 iso_pu_bacteria 2599185318 2600036069 302
650 iso_pu_bacteria 2599185319 2600044292 302
651 iso_pu_bacteria 2599185320 2600046744 302
652 iso_pu_bacteria 2599185321 2600054509 302
653 iso_pu_bacteria 2599185322 2600062254 302
654 iso_pu_bacteria 2599185323 2600067931 302
655 iso_pu_bacteria 2599185324 2600071962 302
656 iso_pu_bacteria 2599185325 2600076449 302
657 iso_pu_bacteria 2599185356 2600212925 302
658 iso_pu_bacteria 2599185356 2600215321 302
659 iso_pu_bacteria 2600254930 2600359544 302
660 iso_pu_bacteria 2600254931 2600363453 302
661 iso_pu_bacteria 2600254954 2600444192 302
662 iso_pu_bacteria 2600255283 2601627535 302
663 iso_pu_bacteria 2600255296 2601693081 302
664 iso_pu_bacteria 2600255313 2601773093 302
665 iso_pu_bacteria 2600255313 2601775487 302
666 iso_pu_bacteria 2600255318 2601798468 302
667 iso_pu_bacteria 2600255389 2602008330 302
668 iso_pu_bacteria 2603880185 2606077362 302
669 iso_pu_bacteria 2603880199 2606129392 302
670 iso_pu_bacteria 2619619299 2621296751 302
671 iso_pu_bacteria 2623620443 2624483508 302
672 iso_pu_bacteria 2623620446 2624495059 302
673 iso_pu_bacteria 2643221565 2643843057 302
674 iso_pu_bacteria 2643221571 2643872360 302
675 iso_pu_bacteria 2643221589 2643955542 302
676 iso_pu_bacteria 2643221602 2644020336 302
677 iso_pu_bacteria 2643221633 2644184379 302
678 iso_pu_bacteria 2643221650 2644283133 302
679 iso_pu_bacteria 2643221713 2644624676 302
680 iso_pu_bacteria 2651869719 2652544591 302
681 iso_pu_bacteria 2667528170 2671089649 302
682 iso_pu_bacteria 2667528171 2671094945 302
683 iso_pu_bacteria 2667528171 2671099376 302
684 iso_pu_bacteria 2667528176 2671128494 302
685 iso_pu_bacteria 2671180172 2671771570 302
686 iso_pu_bacteria 2675903420 2677897248 302
687 iso_pu_bacteria 2675903515 2678266241 302
688 iso_pu_bacteria 2713897148 2715749741 302
689 iso_pu_bacteria 2713897149 2715754756 302
690 iso_pu_bacteria 2718217725 2718636712 302
691 iso_pu_bacteria 2721755607 2723251458 302
692 iso_pu_bacteria 2738541265 2738671570 302
693 iso_pu_bacteria 2738541271 2738690436 302
694 iso_pu_bacteria 2738541282 2738749964 302
695 iso_pu_bacteria 2738541294 2738807351 302
696 iso_pu_bacteria 2738541303 2738859004 302
697 iso_pu_bacteria 2738541309 2738894711 302
698 iso_pu_bacteria 2738543004 2739199148 302
699 iso_pu_bacteria 2738543015 2739260502 302
700 iso_pu_bacteria 2738543016 2739266210 302
701 iso_pu_bacteria 2738543020 2739288775 302
702 iso_pu_bacteria 2738543021 2739294087 302
703 iso_pu_bacteria 2738543025 2739312410 302
704 iso_pu_bacteria 2740892503 2743740522 302
705 iso_pu_bacteria 2744054620 2745007473 302
706 iso_pu_bacteria 2765235841 2765586664 302
707 iso_pu_bacteria 2773857670 2774118258 302
708 iso_pu_bacteria 2773857673 2774135466 302
709 iso_pu_bacteria 2784132063 2784261719 302
710 iso_pu_bacteria 2784132072 2784313691 302
711 iso_pu_bacteria 2791355520 2794593746 302
712 iso_pu_bacteria 2806310737 2807405901 302
713 iso_pu_bacteria 2806310745 2807454236 302
714 iso_pu_bacteria 2808606361 2808855601 302
715 iso_pu_bacteria 2808606376 2808926069 302
716 iso_pu_bacteria 2808606377 2808928339 302
717 iso_pu_bacteria 2808606378 2808935562 302
718 iso_pu_bacteria 2808606379 2808942222 302
719 iso_pu_bacteria 2808606380 2808948170 302
720 iso_pu_bacteria 2808606381 2808950478 302
721 iso_pu_bacteria 2808606382 2808959984 302
722 iso_pu_bacteria 2808606383 2808964170 302
723 iso_pu_bacteria 2808606385 2808976247 302
724 iso_pu_bacteria 2808606388 2808994292 302
725 iso_pu_bacteria 2808606389 2808998994 302
726 iso_pu_bacteria 2808606445 2809217298 302
727 iso_pu_bacteria 2816332298 2817494136 302
728 iso_pu_bacteria 2818991456 2819655227 302
729 iso_pu_bacteria 2818991464 2819704522 302
730 iso_pu_bacteria 2818991464 2819705701 302
731 iso_pu_bacteria 2823421272 2823425814 302
732 iso_pu_bacteria 2825651385 2825654973 302
733 iso_pu_bacteria 2826581358 2826581803 302
734 iso_pu_bacteria 2834028612 2834031047 302
735 iso_pu_bacteria 2842805378 2842807859 302
736 iso_pu_bacteria 2842815866 2842816945 302
737 iso_pu_bacteria 2842826826 2842828675 302
738 iso_pu_bacteria 2842832357 2842833552 302
739 iso_pu_bacteria 2842837860 2842837992 302
740 iso_pu_bacteria 2842843487 2842845779 302
741 iso_pu_bacteria 2842849001 2842852177 302
742 iso_pu_bacteria 2842854478 2842855716 302
743 iso_pu_bacteria 2844665904 2844667194 302
744 iso_pu_bacteria 2852612431 2852616447 302
745 iso_pu_bacteria 2852657418 2852659787 302
746 iso_pu_bacteria 2852667396 2852671415 302
747 iso_pu_bacteria 2860339153 2860341827 302
748 iso_pu_bacteria 2860867994 2860873117 302
749 iso_pu_bacteria 2878029506 2878035445 302
750 iso_pu_bacteria 2880230671 2880236092 302
751 iso_pu_bacteria 2904518522 2904518857 302
752 iso_pu_bacteria 2904550169 2904551452 302
753 iso_pu_bacteria 2908446538 2908452711 302
754 iso_pu_bacteria 2912963787 2912968974 302
755 iso_pu_bacteria 2913036834 2913042622 302
756 iso_pu_bacteria 2917070673 2917073331 302
757 iso_pu_bacteria 2917070673 2917076831 302
758 iso_pu_bacteria 2919063839 2919065417 302
759 iso_pu_bacteria 2919155634 2919155976 302
760 iso_pu_bacteria 2919385768 2919389099 302
761 iso_pu_bacteria 2919456309 2919457680 302
762 iso_pu_bacteria 2919481497 2919485751 302
763 iso_pu_bacteria 2919487758 2919488077 302
764 iso_pu_bacteria 2919501602 2919502570 302
765 iso_pu_bacteria 2919697872 2919700478 302
766 iso_pu_bacteria 2923153595 2923159615 302
767 iso_pu_bacteria 2923586266 2923589092 302
768 iso_pu_bacteria 2926063275 2926064243 302
769 iso_pu_bacteria 2929144301 2929150013 302
770 iso_pu_bacteria 2929189879 2929195243 302
771 iso_pu_bacteria 2931369376 2931372543 302
772 iso_pu_bacteria 2931390751 2931396509 302
773 iso_pu_bacteria 2931396565 2931398211 302
774 iso_pu_bacteria 2935353572 2935357668 302
775 iso_pu_bacteria 2935353572 2935358202 302
776 iso_pu_bacteria 2939636861 2939640706 302
777 iso_pu_bacteria 2939651529 2939654234 302
778 iso_pu_bacteria 2945961074 2945966963 302
779 iso_pu_bacteria 2946027586 2946027995 302
780 iso_pu_bacteria 2947233263 2947234522 302
781 iso_pu_bacteria 2969304461 2969310300 302
782 iso_pu_bacteria 2974289157 2974293987 302
783 iso_pu_bacteria 2984286254 2984286499 302
784 iso_pu_bacteria 2988728565 2988731555 302
785 iso_pu_bacteria 2998139840 2998145490 302
786 iso_pu_bacteria 3007252601 3007255692 302
787 iso_pu_bacteria 3007315729 3007320219 302
788 iso_pu_bacteria 3007395558 3007399297 302
789 iso_pu_bacteria 3007419365 3007425834 302
790 iso_pu_bacteria 3007511990 3007517275 302
791 iso_pu_bacteria 3007614139 3007619421 302
792 iso_pu_bacteria 3007619802 3007624615 302
793 iso_pu_bacteria 3007718800 3007719536 302
794 iso_pu_bacteria 3007803356 3007807631 302
795 iso_pu_bacteria 3007855910 3007859282 302
796 iso_pu_bacteria 3007861166 3007865013 302
797 iso_pu_bacteria 3007866637 3007866691 302
798 iso_pu_bacteria 637000220 637319849 302
799 iso_pu_bacteria 637000220 637323363 302
800 iso_pu_bacteria 8015687852 8015693713 302
801 iso_pu_bacteria 8019769354 8019769674 302
802 iso_pu_bacteria 8019775933 8019777586 302
803 iso_pu_bacteria 8029995093 8029995414 302
804 iso_pu_bacteria 8034962539 8034965146 302
805 iso_pu_bacteria 8052494512 8052494759 302
806 iso_pu_bacteria 8054285046 8054289828 302
807 iso_pu_bacteria 8054347763 8054349490 302
808 iso_pu_bacteria 8054503363 8054509030 302
809 iso_pu_bacteria 8054929484 8054931237 302
810 iso_pu_bacteria 8055770955 8055776971 302
811 iso_pu_bacteria 8055817908 8055824004 302
812 iso_pu_bacteria 8055878733 8055883937 302
813 iso_pu_bacteria 8056115690 8056116215 302
814 iso_pu_bacteria 8056120720 8056120830 302
815 iso_pu_bacteria 8056125926 8056131697 302
816 iso_pu_bacteria 8056131705 8056137408 302
817 iso_pu_bacteria 8056137416 8056142888 302
818 iso_pu_bacteria 8056143049 8056148865 302
819 iso_pu_bacteria 8056148874 8056151397 302
820 iso_pu_bacteria 8056155041 8056159804 302
821 iso_pu_bacteria 8056161164 8056163719 302
822 iso_pu_bacteria 8056166840 8056171217 302
823 iso_pu_bacteria 8056172158 8056177320 302
824 iso_pu_bacteria 8056177738 8056182090 302
825 iso_pu_bacteria 8056569372 8056570564 302
826 iso_pu_bacteria 8057798959 8057802039 302
827 3300003320 rootH2_10018913 rootH2_100189132 303
828 3300003322 rootL2_10224169 rootL2_102241692 303
829 3300003758 Ga0055532_1000197 Ga0055532_10001977 303
830 3300003760 Ga0055527_1000132 Ga0055527_100013221 303
831 3300003761 Ga0055535_1000199 Ga0055535_100019939 303
832 3300003762 Ga0055542_1000235 Ga0055542_100023539 303
833 3300003763 Ga0055529_1000255 Ga0055529_100025539 303
834 3300003790 Ga0055528_1000645 Ga0055528_100064522 303
835 3300003856 Ga0058692_1007740 Ga0058692_10077403 303
836 3300025228 Ga0209672_100025 Ga0209672_100025237 303
837 3300025229 Ga0209147_100032 Ga0209147_100032237 303
838 3300025242 Ga0209258_100050 Ga0209258_100050237 303
839 3300025254 Ga0209148_1000060 Ga0209148_1000060237 303
840 3300025272 Ga0209455_1000055 Ga0209455_1000055237 303
841 3300025273 Ga0209673_1000513 Ga0209673_100051337 303
842 3300025295 Ga0209564_1006950 Ga0209564_10069505 303
843 3300027312 Ga0209371_1000551 Ga0209371_10005517 303
844 3300030500 Ga0268256_1000872 Ga0268256_10008727 303
845 iso_pu_bacteria 2561511199 2562462845 303
846 iso_pu_bacteria 651053060 651177944 303
847 3300027907 Ga0207428_10138007 Ga0207428_101380073 305
848 3300032002 Ga0307416_100051550 Ga0307416_1000515502 305
849 3300041404 Ga0439436_0000080 Ga0439436_0000080_21570_22487 305
850 3300041405 Ga0439438_000765 Ga0439438_000765_3361_4278 305
851 3300041407 Ga0439447_000907 Ga0439447_000907_1932_2849 305
852 3300041411 Ga0439466_0000196 Ga0439466_0000196_8665_9582 305
853 3300042006 Ga0439432_000538 Ga0439432_000538_5805_6722 305
854 3300042010 Ga0439452_000464 Ga0439452_000464_20002_20919 305
855 3300042156 Ga0439446_0009441 Ga0439446_0009441_210_1127 305
856 3300042435 Ga0439434_0001007 Ga0439434_0001007_5957_6874 305
857 3300047446 Ga0495679_002731 Ga0495679_002731_3256_4173 305
858 3300049569 Ga0501032_0017184 Ga0501032_0017184_1965_2894 305
859 3300049571 Ga0501034_0096924 Ga0501034_0096924_71_988 305
860 3300049573 Ga0501037_0066886 Ga0501037_0066886_1417_2346 305
861 iso_pu_bacteria 2510065053 2510283056 305
862 iso_pu_bacteria 2510065055 2510293730 305
863 iso_pu_bacteria 2510065058 2510310664 305
864 iso_pu_bacteria 2773857672 2774131247 305
865 iso_pu_bacteria 2917832318 2917837000 305
866 iso_pu_bacteria 2919125081 2919127139 305
867 iso_pu_bacteria 2974298342 2974302686 305
868 iso_pu_bacteria 2984499530 2984499728 305
869 iso_pu_bacteria 2984504281 2984506142 305
870 iso_pu_bacteria 3007419365 3007424306 305
871 2124908027 MRS2a_Contig_60 MRS2a_00470350 306
872 2162886007 SwRhRL2b_contig_3124744 SwRhRL2b_0046.00006000 306
873 3300002737 JGI25162J39368_1000014 JGI25162J39368_1000014190 306
874 3300002737 JGI25162J39368_1000455 JGI25162J39368_10004559 306
875 3300002737 JGI25162J39368_1000473 JGI25162J39368_100047323 306
876 3300002738 JGI25154J39366_1009942 JGI25154J39366_10099422 306
877 3300002771 JGI25163J39215_1000130 JGI25163J39215_100013016 306
878 3300002771 JGI25163J39215_1000425 JGI25163J39215_10004254 306
879 3300002771 JGI25163J39215_1000564 JGI25163J39215_10005643 306
880 3300002772 JGI25164J39214_1000015 JGI25164J39214_100001523 306
881 3300002772 JGI25164J39214_1000311 JGI25164J39214_10003119 306
882 3300002772 JGI25164J39214_1000323 JGI25164J39214_10003238 306
883 3300003214 JGI25165J46597_1000027 JGI25165J46597_1000027129 306
884 3300003214 JGI25165J46597_1000581 JGI25165J46597_10005819 306
885 3300003214 JGI25165J46597_1000599 JGI25165J46597_10005998 306
886 3300003323 rootH1_10193555 rootH1_101935552 306
887 3300003751 Ga0055538_1000012 Ga0055538_1000012293 306
888 3300003752 Ga0055539_1000017 Ga0055539_1000017293 306
889 3300003756 Ga0055533_1000021 Ga0055533_1000021293 306
890 3300003758 Ga0055532_1000119 Ga0055532_100011933 306
891 3300003759 Ga0055525_1000255 Ga0055525_100025522 306
892 3300003761 Ga0055535_1005721 Ga0055535_10057212 306
893 3300003781 Ga0055536_1000081 Ga0055536_100008161 306
894 3300003781 Ga0055536_1002765 Ga0055536_10027653 306
895 3300003791 Ga0055530_10001106 Ga0055530_100011064 306
896 3300003791 Ga0055530_10001116 Ga0055530_1000111618 306
897 3300003791 Ga0055530_10001165 Ga0055530_100011654 306
898 3300003792 Ga0055540_1000304 Ga0055540_100030422 306
899 3300003792 Ga0055540_1000852 Ga0055540_10008524 306
900 3300003792 Ga0055540_1001731 Ga0055540_10017312 306
901 3300003794 Ga0055531_10001391 Ga0055531_1000139117 306
902 3300003841 Ga0055541_1000012 Ga0055541_1000012293 306
903 3300005288 Ga0065714_10000008 Ga0065714_1000000815 306
904 3300005288 Ga0065714_10002290 Ga0065714_1000229013 306
905 3300005288 Ga0065714_10004542 Ga0065714_100045422 306
906 3300005288 Ga0065714_10006434 Ga0065714_100064342 306
907 3300005288 Ga0065714_10018229 Ga0065714_100182292 306
908 3300005288 Ga0065714_10066250 Ga0065714_100662503 306
909 3300005288 Ga0065714_10089821 Ga0065714_100898212 306
910 3300005288 Ga0065714_10091926 Ga0065714_100919262 306
911 3300005289 Ga0065704_10071914 Ga0065704_100719144 306
912 3300005289 Ga0065704_10186555 Ga0065704_101865551 306
913 3300005290 Ga0065712_10003071 Ga0065712_100030712 306
914 3300005290 Ga0065712_10068078 Ga0065712_100680789 306
915 3300005290 Ga0065712_10069883 Ga0065712_100698833 306
916 3300005293 Ga0065715_10021387 Ga0065715_100213871 306
917 3300005331 Ga0070670_100002668 Ga0070670_1000026685 306
918 3300005331 Ga0070670_100005686 Ga0070670_1000056864 306
919 3300005344 Ga0070661_100001872 Ga0070661_1000018724 306
920 3300005353 Ga0070669_100000443 Ga0070669_1000004436 306
921 3300005353 Ga0070669_100000444 Ga0070669_1000004449 306
922 3300005366 Ga0070659_100083163 Ga0070659_1000831632 306
923 3300005457 Ga0070662_100000528 Ga0070662_1000005282 306
924 3300005539 Ga0068853_100000031 Ga0068853_10000003175 306
925 3300005548 Ga0070665_100109082 Ga0070665_1001090822 306
926 3300005564 Ga0070664_100002881 Ga0070664_1000028816 306
927 3300005564 Ga0070664_100011952 Ga0070664_1000119524 306
928 3300005577 Ga0068857_100437814 Ga0068857_1004378141 306
929 3300005834 Ga0068851_10000007 Ga0068851_10000007154 306
930 3300006051 Ga0075364_10039244 Ga0075364_100392442 306
931 3300006051 Ga0075364_10081343 Ga0075364_100813432 306
932 3300006051 Ga0075364_10202325 Ga0075364_102023251 306
933 3300006051 Ga0075364_10299589 Ga0075364_102995891 306
934 3300006058 Ga0075432_10024396 Ga0075432_100243961 306
935 3300006058 Ga0075432_10025172 Ga0075432_100251721 306
936 3300006058 Ga0075432_10031235 Ga0075432_100312352 306
937 3300006177 Ga0075362_10110684 Ga0075362_101106842 306
938 3300006186 Ga0075369_10051060 Ga0075369_100510602 306
939 3300006914 Ga0075436_100147002 Ga0075436_1001470022 306
940 3300006944 Ga0099823_1005494 Ga0099823_10054944 306
941 3300006946 Ga0079104_1000344 Ga0079104_100034436 306
942 3300006946 Ga0079104_1001022 Ga0079104_10010229 306
943 3300006946 Ga0079104_1004706 Ga0079104_10047062 306
944 3300006948 Ga0099826_10005746 Ga0099826_100057466 306
945 3300009011 Ga0105251_10000009 Ga0105251_10000009182 306
946 3300009011 Ga0105251_10000033 Ga0105251_100000335 306
947 3300009011 Ga0105251_10003640 Ga0105251_100036404 306
948 3300009011 Ga0105251_10005297 Ga0105251_100052975 306
949 3300009011 Ga0105251_10007830 Ga0105251_100078302 306
950 3300009011 Ga0105251_10011743 Ga0105251_100117433 306
951 3300009011 Ga0105251_10017218 Ga0105251_100172182 306
952 3300009011 Ga0105251_10020891 Ga0105251_100208912 306
953 3300009011 Ga0105251_10035081 Ga0105251_100350811 306
954 3300009011 Ga0105251_10108525 Ga0105251_101085252 306
955 3300009036 Ga0105244_10003048 Ga0105244_100030486 306
956 3300009036 Ga0105244_10003452 Ga0105244_100034524 306
957 3300009036 Ga0105244_10005869 Ga0105244_100058694 306
958 3300009036 Ga0105244_10029966 Ga0105244_100299662 306
959 3300009036 Ga0105244_10035250 Ga0105244_100352502 306
960 3300009036 Ga0105244_10035450 Ga0105244_100354501 306
961 3300009036 Ga0105244_10036556 Ga0105244_100365561 306
962 3300009036 Ga0105244_10044191 Ga0105244_100441912 306
963 3300009036 Ga0105244_10118523 Ga0105244_101185231 306
964 3300009036 Ga0105244_10123265 Ga0105244_101232651 306
965 3300009036 Ga0105244_10136904 Ga0105244_101369041 306
966 3300009092 Ga0105250_10000858 Ga0105250_100008584 306
967 3300009092 Ga0105250_10000911 Ga0105250_100009113 306
968 3300009092 Ga0105250_10001236 Ga0105250_100012362 306
969 3300009092 Ga0105250_10012019 Ga0105250_100120193 306
970 3300009092 Ga0105250_10018754 Ga0105250_100187541 306
971 3300009092 Ga0105250_10018989 Ga0105250_100189891 306
972 3300009092 Ga0105250_10034590 Ga0105250_100345901 306
973 3300009148 Ga0105243_10001569 Ga0105243_100015699 306
974 3300009148 Ga0105243_10003513 Ga0105243_100035139 306
975 3300009148 Ga0105243_10010213 Ga0105243_100102135 306
976 3300009148 Ga0105243_10014954 Ga0105243_100149542 306
977 3300009148 Ga0105243_10029833 Ga0105243_100298333 306
978 3300009148 Ga0105243_10098759 Ga0105243_100987592 306
979 3300009176 Ga0105242_10004710 Ga0105242_100047103 306
980 3300009176 Ga0105242_10230729 Ga0105242_102307292 306
981 3300009545 Ga0105237_10005959 Ga0105237_100059596 306
982 3300009545 Ga0105237_10166274 Ga0105237_101662742 306
983 3300009553 Ga0105249_10008191 Ga0105249_100081916 306
984 3300011119 Ga0105246_10002168 Ga0105246_100021685 306
985 3300011119 Ga0105246_10015946 Ga0105246_100159462 306
986 3300011119 Ga0105246_10017211 Ga0105246_100172113 306
987 3300011119 Ga0105246_10023277 Ga0105246_100232772 306
988 3300012498 Ga0157345_1000051 Ga0157345_100005125 306
989 3300013100 Ga0157373_10005026 Ga0157373_100050263 306
990 3300013100 Ga0157373_10006705 Ga0157373_100067054 306
991 3300013100 Ga0157373_10009024 Ga0157373_100090244 306
992 3300013100 Ga0157373_10010609 Ga0157373_100106092 306
993 3300013100 Ga0157373_10012301 Ga0157373_100123012 306
994 3300013100 Ga0157373_10016622 Ga0157373_100166222 306
995 3300013100 Ga0157373_10025490 Ga0157373_100254903 306
996 3300013100 Ga0157373_10084697 Ga0157373_100846972 306
997 3300013100 Ga0157373_10147076 Ga0157373_101470762 306
998 3300013102 Ga0157371_10000147 Ga0157371_1000014762 306
999 3300013102 Ga0157371_10001869 Ga0157371_1000186912 306
1000 3300013102 Ga0157371_10003783 Ga0157371_100037834 306
1001 3300013102 Ga0157371_10005611 Ga0157371_100056118 306
1002 3300013102 Ga0157371_10010181 Ga0157371_100101812 306
1003 3300013102 Ga0157371_10018665 Ga0157371_100186652 306
1004 3300013102 Ga0157371_10037860 Ga0157371_100378602 306
1005 3300013104 Ga0157370_10000265 Ga0157370_1000026537 306
1006 3300013104 Ga0157370_10021128 Ga0157370_100211283 306
1007 3300013104 Ga0157370_10023872 Ga0157370_100238722 306
1008 3300013104 Ga0157370_10041422 Ga0157370_100414223 306
1009 3300013104 Ga0157370_10194116 Ga0157370_101941162 306
1010 3300013105 Ga0157369_10003275 Ga0157369_1000327520 306
1011 3300013105 Ga0157369_10004624 Ga0157369_1000462410 306
1012 3300013105 Ga0157369_10015293 Ga0157369_100152935 306
1013 3300013105 Ga0157369_10035235 Ga0157369_100352354 306
1014 3300013105 Ga0157369_10044710 Ga0157369_100447103 306
1015 3300013105 Ga0157369_10048379 Ga0157369_100483791 306
1016 3300013105 Ga0157369_10647962 Ga0157369_106479621 306
1017 3300013306 Ga0163162_10006188 Ga0163162_100061886 306
1018 3300013306 Ga0163162_10057186 Ga0163162_100571863 306
1019 3300013306 Ga0163162_10157675 Ga0163162_101576752 306
1020 3300013306 Ga0163162_10307648 Ga0163162_103076482 306
1021 3300013307 Ga0157372_10008332 Ga0157372_100083323 306
1022 3300013308 Ga0157375_10004938 Ga0157375_100049386 306
1023 3300013308 Ga0157375_10009034 Ga0157375_100090343 306
1024 3300013308 Ga0157375_10023654 Ga0157375_100236543 306
1025 3300013308 Ga0157375_10095333 Ga0157375_100953332 306
1026 3300014497 Ga0182008_10001897 Ga0182008_100018974 306
1027 3300014497 Ga0182008_10002044 Ga0182008_100020443 306
1028 3300014497 Ga0182008_10003039 Ga0182008_100030395 306
1029 3300014497 Ga0182008_10003146 Ga0182008_100031466 306
1030 3300014497 Ga0182008_10013860 Ga0182008_100138602 306
1031 3300014497 Ga0182008_10017701 Ga0182008_100177013 306
1032 3300014497 Ga0182008_10075576 Ga0182008_100755762 306
1033 3300014497 Ga0182008_10078181 Ga0182008_100781812 306
1034 3300015261 Ga0182006_1002087 Ga0182006_10020877 306
1035 3300015261 Ga0182006_1003702 Ga0182006_10037023 306
1036 3300015261 Ga0182006_1003978 Ga0182006_10039782 306
1037 3300015261 Ga0182006_1006022 Ga0182006_10060223 306
1038 3300015261 Ga0182006_1006430 Ga0182006_10064302 306
1039 3300015261 Ga0182006_1060433 Ga0182006_10604332 306
1040 3300015262 Ga0182007_10000858 Ga0182007_1000085817 306
1041 3300015265 Ga0182005_1008449 Ga0182005_10084491 306
1042 3300015265 Ga0182005_1031916 Ga0182005_10319161 306
1043 3300017792 Ga0163161_10003433 Ga0163161_100034333 306
1044 3300017792 Ga0163161_10007206 Ga0163161_100072062 306
1045 3300017792 Ga0163161_10007625 Ga0163161_100076253 306
1046 3300017792 Ga0163161_10007868 Ga0163161_100078683 306
1047 3300017792 Ga0163161_10011091 Ga0163161_100110913 306
1048 3300017792 Ga0163161_10017166 Ga0163161_100171663 306
1049 3300017792 Ga0163161_10082799 Ga0163161_100827992 306
1050 3300017792 Ga0163161_10158020 Ga0163161_101580202 306
1051 3300017792 Ga0163161_10202445 Ga0163161_102024452 306
1052 3300017792 Ga0163161_10296376 Ga0163161_102963762 306
1053 3300025206 Ga0209435_100796 Ga0209435_1007964 306
1054 3300025207 Ga0209760_100027 Ga0209760_10002718 306
1055 3300025207 Ga0209760_100116 Ga0209760_10011635 306
1056 3300025207 Ga0209760_100119 Ga0209760_10011931 306
1057 3300025224 Ga0209784_100007 Ga0209784_100007291 306
1058 3300025225 Ga0209566_100009 Ga0209566_100009291 306
1059 3300025226 Ga0209674_100021 Ga0209674_100021291 306
1060 3300025229 Ga0209147_100009 Ga0209147_100009291 306
1061 3300025230 Ga0209563_100018 Ga0209563_100018291 306
1062 3300025230 Ga0209563_107683 Ga0209563_1076832 306
1063 3300025231 Ga0207427_100003 Ga0207427_100003607 306
1064 3300025231 Ga0207427_100005 Ga0207427_100005423 306
1065 3300025231 Ga0207427_100006 Ga0207427_100006350 306
1066 3300025233 Ga0209437_100002 Ga0209437_100002406 306
1067 3300025233 Ga0209437_100013 Ga0209437_100013350 306
1068 3300025233 Ga0209437_100018 Ga0209437_100018333 306
1069 3300025242 Ga0209258_100249 Ga0209258_10024964 306
1070 3300025246 Ga0209646_1001197 Ga0209646_10011972 306
1071 3300025253 Ga0209677_100012 Ga0209677_100012291 306
1072 3300025261 Ga0209233_1000004 Ga0209233_10000041019 306
1073 3300025261 Ga0209233_1000021 Ga0209233_1000021423 306
1074 3300025261 Ga0209233_1000022 Ga0209233_1000022350 306
1075 3300025292 Ga0209676_1000015 Ga0209676_1000015321 306
1076 3300025292 Ga0209676_1000030 Ga0209676_1000030367 306
1077 3300025292 Ga0209676_1000041 Ga0209676_100004184 306
1078 3300025292 Ga0209676_1006073 Ga0209676_10060736 306
1079 3300025298 Ga0209050_1000024 Ga0209050_100002474 306
1080 3300025298 Ga0209050_1000030 Ga0209050_1000030117 306
1081 3300025298 Ga0209050_1000332 Ga0209050_100033261 306
1082 3300025298 Ga0209050_1001625 Ga0209050_10016255 306
1083 3300025303 Ga0209051_1000012 Ga0209051_1000012358 306
1084 3300025303 Ga0209051_1000660 Ga0209051_100066022 306
1085 3300025303 Ga0209051_1000672 Ga0209051_100067222 306
1086 3300025304 Ga0209257_1000262 Ga0209257_100026268 306
1087 3300025304 Ga0209257_1011361 Ga0209257_10113613 306
1088 3300025321 Ga0207656_10000015 Ga0207656_1000001577 306
1089 3300025711 Ga0207696_1000020 Ga0207696_1000020296 306
1090 3300025711 Ga0207696_1000031 Ga0207696_1000031328 306
1091 3300025711 Ga0207696_1000080 Ga0207696_10000806 306
1092 3300025711 Ga0207696_1000127 Ga0207696_1000127114 306
1093 3300025711 Ga0207696_1001769 Ga0207696_10017694 306
1094 3300025711 Ga0207696_1005733 Ga0207696_10057332 306
1095 3300025711 Ga0207696_1006450 Ga0207696_10064502 306
1096 3300025711 Ga0207696_1007083 Ga0207696_10070833 306
1097 3300025711 Ga0207696_1008117 Ga0207696_10081172 306
1098 3300025711 Ga0207696_1012374 Ga0207696_10123742 306
1099 3300025728 Ga0207655_1000100 Ga0207655_100010038 306
1100 3300025728 Ga0207655_1000401 Ga0207655_100040136 306
1101 3300025728 Ga0207655_1000446 Ga0207655_100044651 306
1102 3300025728 Ga0207655_1000597 Ga0207655_100059720 306
1103 3300025728 Ga0207655_1000868 Ga0207655_100086825 306
1104 3300025728 Ga0207655_1001125 Ga0207655_10011252 306
1105 3300025728 Ga0207655_1003650 Ga0207655_10036506 306
1106 3300025728 Ga0207655_1004572 Ga0207655_10045724 306
1107 3300025728 Ga0207655_1010623 Ga0207655_10106231 306
1108 3300025728 Ga0207655_1013085 Ga0207655_10130852 306
1109 3300025728 Ga0207655_1022496 Ga0207655_10224961 306
1110 3300025728 Ga0207655_1023041 Ga0207655_10230412 306
1111 3300025728 Ga0207655_1028590 Ga0207655_10285902 306
1112 3300025728 Ga0207655_1032011 Ga0207655_10320112 306
1113 3300025728 Ga0207655_1033325 Ga0207655_10333252 306
1114 3300025728 Ga0207655_1075772 Ga0207655_10757722 306
1115 3300025735 Ga0207713_1000032 Ga0207713_100003280 306
1116 3300025735 Ga0207713_1000079 Ga0207713_100007957 306
1117 3300025735 Ga0207713_1000126 Ga0207713_1000126114 306
1118 3300025735 Ga0207713_1000249 Ga0207713_100024940 306
1119 3300025735 Ga0207713_1000784 Ga0207713_100078411 306
1120 3300025735 Ga0207713_1001471 Ga0207713_100147110 306
1121 3300025735 Ga0207713_1001947 Ga0207713_10019477 306
1122 3300025735 Ga0207713_1002962 Ga0207713_10029623 306
1123 3300025735 Ga0207713_1002963 Ga0207713_10029633 306
1124 3300025735 Ga0207713_1007222 Ga0207713_10072223 306
1125 3300025735 Ga0207713_1007642 Ga0207713_10076421 306
1126 3300025735 Ga0207713_1009897 Ga0207713_10098972 306
1127 3300025735 Ga0207713_1026892 Ga0207713_10268922 306
1128 3300025735 Ga0207713_1038663 Ga0207713_10386632 306
1129 3300025735 Ga0207713_1066692 Ga0207713_10666921 306
1130 3300025914 Ga0207671_10000027 Ga0207671_10000027220 306
1131 3300025920 Ga0207649_10000012 Ga0207649_10000012206 306
1132 3300025923 Ga0207681_10000138 Ga0207681_1000013833 306
1133 3300025923 Ga0207681_10001902 Ga0207681_100019024 306
1134 3300025925 Ga0207650_10000639 Ga0207650_1000063921 306
1135 3300025925 Ga0207650_10000642 Ga0207650_1000064222 306
1136 3300025933 Ga0207706_10000312 Ga0207706_1000031233 306
1137 3300025933 Ga0207706_10004172 Ga0207706_100041727 306
1138 3300025934 Ga0207686_10002070 Ga0207686_100020703 306
1139 3300025934 Ga0207686_10014355 Ga0207686_100143553 306
1140 3300025935 Ga0207709_10000061 Ga0207709_10000061175 306
1141 3300025935 Ga0207709_10000558 Ga0207709_1000055822 306
1142 3300025935 Ga0207709_10003388 Ga0207709_1000338811 306
1143 3300025935 Ga0207709_10006308 Ga0207709_100063082 306
1144 3300025935 Ga0207709_10006878 Ga0207709_100068782 306
1145 3300025935 Ga0207709_10027783 Ga0207709_100277832 306
1146 3300025935 Ga0207709_10043174 Ga0207709_100431742 306
1147 3300025945 Ga0207679_10000015 Ga0207679_10000015206 306
1148 3300025961 Ga0207712_10014098 Ga0207712_100140983 306
1149 3300025981 Ga0207640_10011607 Ga0207640_100116072 306
1150 3300026041 Ga0207639_10000146 Ga0207639_1000014623 306
1151 3300027111 Ga0209281_1000016 Ga0209281_1000016399 306
1152 3300027111 Ga0209281_1000019 Ga0209281_1000019128 306
1153 3300027111 Ga0209281_1004592 Ga0209281_10045922 306
1154 3300027111 Ga0209281_1022105 Ga0209281_10221051 306
1155 3300027296 Ga0209389_1000213 Ga0209389_100021315 306
1156 3300027312 Ga0209371_1000228 Ga0209371_100022874 306
1157 3300027312 Ga0209371_1000311 Ga0209371_100031115 306
1158 3300027312 Ga0209371_1016217 Ga0209371_10162172 306
1159 3300027395 Ga0209996_1002056 Ga0209996_10020562 306
1160 3300027471 Ga0209995_1001892 Ga0209995_10018922 306
1161 3300027543 Ga0209999_1004224 Ga0209999_10042242 306
1162 3300027666 Ga0209282_1026535 Ga0209282_10265351 306
1163 3300027682 Ga0209971_1001201 Ga0209971_10012014 306
1164 3300027876 Ga0209974_10003879 Ga0209974_100038792 306
1165 3300027907 Ga0207428_10026090 Ga0207428_100260903 306
1166 3300027907 Ga0207428_10073628 Ga0207428_100736282 306
1167 3300027907 Ga0207428_10083525 Ga0207428_100835252 306
1168 3300028379 Ga0268266_10040487 Ga0268266_100404872 306
1169 3300028379 Ga0268266_10352517 Ga0268266_103525171 306
1170 3300028786 Ga0307517_10051807 Ga0307517_100518071 306
1171 3300028786 Ga0307517_10090210 Ga0307517_100902102 306
1172 3300030500 Ga0268256_1000188 Ga0268256_10001885 306
1173 3300030500 Ga0268256_1000268 Ga0268256_100026815 306
1174 3300030500 Ga0268256_1018298 Ga0268256_10182982 306
1175 3300030521 Ga0307511_10004225 Ga0307511_100042252 306
1176 3300030521 Ga0307511_10050445 Ga0307511_100504452 306
1177 3300030521 Ga0307511_10061190 Ga0307511_100611902 306
1178 3300030733 Ga0314311_1154416 Ga0314311_11544162 306
1179 3300030735 Ga0316178_1002751 Ga0316178_100275121 306
1180 3300030742 Ga0316183_1078778 Ga0316183_10787782 306
1181 3300030742 Ga0316183_1126843 Ga0316183_11268432 306
1182 3300030744 Ga0316181_1041594 Ga0316181_10415942 306
1183 3300031507 Ga0307509_10010578 Ga0307509_1001057810 306
1184 3300031548 Ga0307408_100000002 Ga0307408_100000002499 306
1185 3300031548 Ga0307408_100002873 Ga0307408_1000028736 306
1186 3300031548 Ga0307408_100004562 Ga0307408_1000045624 306
1187 3300031548 Ga0307408_100005109 Ga0307408_1000051094 306
1188 3300031731 Ga0307405_10000832 Ga0307405_100008324 306
1189 3300031731 Ga0307405_10001657 Ga0307405_100016574 306
1190 3300031731 Ga0307405_10004020 Ga0307405_100040202 306
1191 3300031824 Ga0307413_10091461 Ga0307413_100914612 306
1192 3300031901 Ga0307406_10001920 Ga0307406_100019204 306
1193 3300031903 Ga0307407_10013462 Ga0307407_100134622 306
1194 3300031903 Ga0307407_10110500 Ga0307407_101105002 306
1195 3300031911 Ga0307412_10001709 Ga0307412_100017096 306
1196 3300031911 Ga0307412_10002078 Ga0307412_100020787 306
1197 3300031911 Ga0307412_10011163 Ga0307412_100111632 306
1198 3300031911 Ga0307412_10032217 Ga0307412_100322173 306
1199 3300031911 Ga0307412_10082649 Ga0307412_100826492 306
1200 3300031911 Ga0307412_10449187 Ga0307412_104491871 306
1201 3300031995 Ga0307409_100025721 Ga0307409_1000257212 306
1202 3300031995 Ga0307409_100218574 Ga0307409_1002185742 306
1203 3300032004 Ga0307414_10004509 Ga0307414_100045093 306
1204 3300032004 Ga0307414_10027220 Ga0307414_100272202 306
1205 3300032005 Ga0307411_10018627 Ga0307411_100186272 306
1206 3300032005 Ga0307411_10057514 Ga0307411_100575142 306
1207 3300033180 Ga0307510_10000983 Ga0307510_100009833 306
1208 3300041405 Ga0439438_000310 Ga0439438_000310_3590_4510 306
1209 3300041405 Ga0439438_000839 Ga0439438_000839_133_1053 306
1210 3300041405 Ga0439438_001494 Ga0439438_001494_4696_5616 306
1211 3300041405 Ga0439438_002207 Ga0439438_002207_3726_4646 306
1212 3300041405 Ga0439438_002474 Ga0439438_002474_6547_7626 306
1213 3300041405 Ga0439438_002800 Ga0439438_002800_4151_5071 306
1214 3300041405 Ga0439438_009946 Ga0439438_009946_1831_2751 306
1215 3300041405 Ga0439438_010767 Ga0439438_010767_435_1355 306
1216 3300041405 Ga0439438_026223 Ga0439438_026223_133_1053 306
1217 3300041405 Ga0439438_029770 Ga0439438_029770_251_1192 306
1218 3300041405 Ga0439438_037247 Ga0439438_037247_192_1112 306
1219 3300041407 Ga0439447_000170 Ga0439447_000170_2270_3190 306
1220 3300041407 Ga0439447_001590 Ga0439447_001590_1186_2106 306
1221 3300041407 Ga0439447_003261 Ga0439447_003261_2218_3138 306
1222 3300041407 Ga0439447_010575 Ga0439447_010575_871_1791 306
1223 3300041407 Ga0439447_015423 Ga0439447_015423_531_1451 306
1224 3300041407 Ga0439447_021990 Ga0439447_021990_624_1544 306
1225 3300041407 Ga0439447_022880 Ga0439447_022880_140_1060 306
1226 3300041411 Ga0439466_0000328 Ga0439466_0000328_4409_5329 306
1227 3300041411 Ga0439466_0002642 Ga0439466_0002642_4753_5673 306
1228 3300041411 Ga0439466_0005127 Ga0439466_0005127_3205_4125 306
1229 3300041411 Ga0439466_0005174 Ga0439466_0005174_2060_2980 306
1230 3300041411 Ga0439466_0006040 Ga0439466_0006040_2613_3533 306
1231 3300041411 Ga0439466_0012147 Ga0439466_0012147_797_1717 306
1232 3300041411 Ga0439466_0018940 Ga0439466_0018940_1142_2062 306
1233 3300041411 Ga0439466_0020579 Ga0439466_0020579_500_1420 306
1234 3300041411 Ga0439466_0022043 Ga0439466_0022043_158_1237 306
1235 3300041411 Ga0439466_0038308 Ga0439466_0038308_14_934 306
1236 3300041411 Ga0439466_0043873 Ga0439466_0043873_532_1452 306
1237 3300041997 Ga0439431_0002297 Ga0439431_0002297_870_1790 306
1238 3300042004 Ga0439445_0004179 Ga0439445_0004179_2086_3006 306
1239 3300042004 Ga0439445_0011138 Ga0439445_0011138_537_1457 306
1240 3300042004 Ga0439445_0043117 Ga0439445_0043117_260_1180 306
1241 3300042006 Ga0439432_002588 Ga0439432_002588_56_982 306
1242 3300042006 Ga0439432_004306 Ga0439432_004306_140_1060 306
1243 3300042006 Ga0439432_018381 Ga0439432_018381_148_1068 306
1244 3300042006 Ga0439432_031848 Ga0439432_031848_164_1084 306
1245 3300042009 Ga0439451_004895 Ga0439451_004895_1493_2413 306
1246 3300042009 Ga0439451_007159 Ga0439451_007159_1227_2147 306
1247 3300042009 Ga0439451_007238 Ga0439451_007238_1112_2107 306
1248 3300042009 Ga0439451_011057 Ga0439451_011057_449_1369 306
1249 3300042009 Ga0439451_017117 Ga0439451_017117_184_1170 306
1250 3300042010 Ga0439452_000432 Ga0439452_000432_18488_19408 306
1251 3300042010 Ga0439452_000633 Ga0439452_000633_13388_14308 306
1252 3300042010 Ga0439452_001172 Ga0439452_001172_6793_7713 306
1253 3300042010 Ga0439452_004938 Ga0439452_004938_2859_3779 306
1254 3300042010 Ga0439452_006149 Ga0439452_006149_1594_2514 306
1255 3300042010 Ga0439452_012245 Ga0439452_012245_228_1148 306
1256 3300042013 Ga0439456_000017 Ga0439456_000017_57358_58302 306
1257 3300042013 Ga0439456_000188 Ga0439456_000188_16978_17898 306
1258 3300042013 Ga0439456_001652 Ga0439456_001652_1478_2398 306
1259 3300042013 Ga0439456_008813 Ga0439456_008813_673_1593 306
1260 3300042016 Ga0439463_000210 Ga0439463_000210_14368_15288 306
1261 3300042016 Ga0439463_023473 Ga0439463_023473_392_1312 306
1262 3300042115 Ga0450911_001680 Ga0450911_001680_2225_3145 306
1263 3300042115 Ga0450911_003197 Ga0450911_003197_709_1629 306
1264 3300042127 Ga0450890_000886 Ga0450890_000886_430_1509 306
1265 3300042137 Ga0450902_001321 Ga0450902_001321_1017_1937 306
1266 3300042137 Ga0450902_001631 Ga0450902_001631_1883_2803 306
1267 3300042137 Ga0450902_004930 Ga0450902_004930_547_1467 306
1268 3300042137 Ga0450902_009790 Ga0450902_009790_104_1024 306
1269 3300042138 Ga0450903_009094 Ga0450903_009094_467_1387 306
1270 3300042139 Ga0450904_000089 Ga0450904_000089_275_1195 306
1271 3300042139 Ga0450904_001216 Ga0450904_001216_225_1145 306
1272 3300042142 Ga0450905_000239 Ga0450905_000239_2960_3889 306
1273 3300042142 Ga0450905_002238 Ga0450905_002238_272_1192 306
1274 3300042145 Ga0450906_000485 Ga0450906_000485_661_1581 306
1275 3300042145 Ga0450906_001940 Ga0450906_001940_971_1891 306
1276 3300042146 Ga0450907_000099 Ga0450907_000099_23087_24007 306
1277 3300042146 Ga0450907_000147 Ga0450907_000147_4117_5037 306
1278 3300042146 Ga0450907_001664 Ga0450907_001664_1452_2531 306
1279 3300042146 Ga0450907_007701 Ga0450907_007701_297_1217 306
1280 3300042147 Ga0450910_000048 Ga0450910_000048_1308_2228 306
1281 3300042147 Ga0450910_002333 Ga0450910_002333_223_1143 306
1282 3300042156 Ga0439446_0003869 Ga0439446_0003869_1458_2378 306
1283 3300042156 Ga0439446_0007125 Ga0439446_0007125_1353_2273 306
1284 3300042185 Ga0450909_012498 Ga0450909_012498_193_1113 306
1285 3300042435 Ga0439434_0000163 Ga0439434_0000163_12946_13866 306
1286 3300042439 Ga0439464_0002644 Ga0439464_0002644_1710_2630 306
1287 3300042439 Ga0439464_0008879 Ga0439464_0008879_1541_2461 306
1288 3300042461 Ga0439460_0006235 Ga0439460_0006235_483_1403 306
1289 3300042461 Ga0439460_0013674 Ga0439460_0013674_81_1076 306
1290 3300042531 Ga0450918_006396 Ga0450918_006396_58_1053 306
1291 3300042532 Ga0450893_0010474 Ga0450893_0010474_293_1213 306
1292 3300042533 Ga0450901_001058 Ga0450901_001058_1886_2815 306
1293 3300042993 Ga0439440_0000517 Ga0439440_0000517_4145_5065 306
1294 3300042993 Ga0439440_0036592 Ga0439440_0036592_113_1033 306
1295 3300046452 Ga0495617_002385 Ga0495617_002385_2590_3510 306
1296 3300046452 Ga0495617_003484 Ga0495617_003484_3256_4176 306
1297 3300046452 Ga0495617_004037 Ga0495617_004037_2642_3562 306
1298 3300046452 Ga0495617_006943 Ga0495617_006943_2090_3010 306
1299 3300046452 Ga0495617_008364 Ga0495617_008364_299_1219 306
1300 3300046452 Ga0495617_015221 Ga0495617_015221_1679_2599 306
1301 3300046452 Ga0495617_065761 Ga0495617_065761_143_1138 306
1302 3300046452 Ga0495617_071449 Ga0495617_071449_32_952 306
1303 3300046453 Ga0495627_000095 Ga0495627_000095_57671_58591 306
1304 3300046453 Ga0495627_000368 Ga0495627_000368_11494_12414 306
1305 3300046453 Ga0495627_001110 Ga0495627_001110_3499_4485 306
1306 3300046453 Ga0495627_001419 Ga0495627_001419_430_1350 306
1307 3300046453 Ga0495627_002741 Ga0495627_002741_3795_4715 306
1308 3300046453 Ga0495627_013660 Ga0495627_013660_1332_2252 306
1309 3300046453 Ga0495627_030802 Ga0495627_030802_284_1204 306
1310 3300046455 Ga0495603_0023413 Ga0495603_0023413_173_1093 306
1311 3300046455 Ga0495603_0060632 Ga0495603_0060632_272_1192 306
1312 3300046457 Ga0495590_0000880 Ga0495590_0000880_8861_9781 306
1313 3300046457 Ga0495590_0002408 Ga0495590_0002408_2818_3738 306
1314 3300046457 Ga0495590_0036700 Ga0495590_0036700_234_1154 306
1315 3300046457 Ga0495590_0037124 Ga0495590_0037124_527_1447 306
1316 3300046458 Ga0495591_000198 Ga0495591_000198_14858_15778 306
1317 3300046458 Ga0495591_000279 Ga0495591_000279_3919_4839 306
1318 3300046458 Ga0495591_001131 Ga0495591_001131_13285_14205 306
1319 3300046458 Ga0495591_003739 Ga0495591_003739_4299_5219 306
1320 3300046458 Ga0495591_003991 Ga0495591_003991_3503_4498 306
1321 3300046458 Ga0495591_012056 Ga0495591_012056_1218_2138 306
1322 3300046458 Ga0495591_022010 Ga0495591_022010_885_1805 306
1323 3300046458 Ga0495591_036100 Ga0495591_036100_264_1184 306
1324 3300046459 Ga0495629_0106456 Ga0495629_0106456_463_1383 306
1325 3300046460 Ga0495638_0002209 Ga0495638_0002209_14338_15258 306
1326 3300046460 Ga0495638_0003242 Ga0495638_0003242_3246_4241 306
1327 3300046460 Ga0495638_0021214 Ga0495638_0021214_313_1233 306
1328 3300046460 Ga0495638_0033608 Ga0495638_0033608_2131_3051 306
1329 3300046460 Ga0495638_0034788 Ga0495638_0034788_51_971 306
1330 3300046460 Ga0495638_0045614 Ga0495638_0045614_423_1409 306
1331 3300046460 Ga0495638_0055513 Ga0495638_0055513_304_1224 306
1332 3300046460 Ga0495638_0058515 Ga0495638_0058515_401_1321 306
1333 3300046463 Ga0495653_0000344 Ga0495653_0000344_2032_2952 306
1334 3300046463 Ga0495653_0008460 Ga0495653_0008460_3357_4277 306
1335 3300046463 Ga0495653_0017177 Ga0495653_0017177_3715_4635 306
1336 3300046463 Ga0495653_0138468 Ga0495653_0138468_550_1545 306
1337 3300046471 Ga0495650_0002237 Ga0495650_0002237_1428_2348 306
1338 3300046471 Ga0495650_0009166 Ga0495650_0009166_1458_2378 306
1339 3300046471 Ga0495650_0009578 Ga0495650_0009578_151_1071 306
1340 3300046471 Ga0495650_0013441 Ga0495650_0013441_2483_3403 306
1341 3300046471 Ga0495650_0015789 Ga0495650_0015789_2883_3803 306
1342 3300046471 Ga0495650_0016789 Ga0495650_0016789_129_1049 306
1343 3300046471 Ga0495650_0021347 Ga0495650_0021347_2149_3069 306
1344 3300046471 Ga0495650_0030767 Ga0495650_0030767_1180_2100 306
1345 3300046473 Ga0495582_0008143 Ga0495582_0008143_505_1425 306
1346 3300046474 Ga0495605_0000122 Ga0495605_0000122_4138_5058 306
1347 3300046474 Ga0495605_0001053 Ga0495605_0001053_4044_4964 306
1348 3300046474 Ga0495605_0001101 Ga0495605_0001101_13131_14051 306
1349 3300046474 Ga0495605_0002412 Ga0495605_0002412_7105_8025 306
1350 3300046474 Ga0495605_0009873 Ga0495605_0009873_514_1434 306
1351 3300046474 Ga0495605_0018459 Ga0495605_0018459_899_1819 306
1352 3300046474 Ga0495605_0025408 Ga0495605_0025408_596_1516 306
1353 3300046474 Ga0495605_0026538 Ga0495605_0026538_84_1184 306
1354 3300046474 Ga0495605_0094225 Ga0495605_0094225_236_1156 306
1355 3300046475 Ga0495639_0005024 Ga0495639_0005024_418_1338 306
1356 3300046491 Ga0495584_0001705 Ga0495584_0001705_8013_8933 306
1357 3300046491 Ga0495584_0004226 Ga0495584_0004226_2843_3763 306
1358 3300046491 Ga0495584_0005757 Ga0495584_0005757_5482_6402 306
1359 3300046491 Ga0495584_0011782 Ga0495584_0011782_1890_2810 306
1360 3300046491 Ga0495584_0022347 Ga0495584_0022347_2027_2947 306
1361 3300046491 Ga0495584_0060956 Ga0495584_0060956_140_1060 306
1362 3300046491 Ga0495584_0104851 Ga0495584_0104851_129_1049 306
1363 3300046492 Ga0495585_0004194 Ga0495585_0004194_3310_4230 306
1364 3300046492 Ga0495585_0022677 Ga0495585_0022677_979_1899 306
1365 3300046492 Ga0495585_0024877 Ga0495585_0024877_1947_2942 306
1366 3300046492 Ga0495585_0027510 Ga0495585_0027510_2003_2923 306
1367 3300046492 Ga0495585_0101348 Ga0495585_0101348_370_1290 306
1368 3300046499 Ga0495594_0022200 Ga0495594_0022200_503_1423 306
1369 3300046499 Ga0495594_0040864 Ga0495594_0040864_692_1612 306
1370 3300046499 Ga0495594_0134006 Ga0495594_0134006_107_1027 306
1371 3300046500 Ga0495596_0003684 Ga0495596_0003684_2649_3569 306
1372 3300046501 Ga0495607_0000973 Ga0495607_0000973_23353_24273 306
1373 3300046501 Ga0495607_0001789 Ga0495607_0001789_3964_4884 306
1374 3300046501 Ga0495607_0005262 Ga0495607_0005262_3919_4839 306
1375 3300046501 Ga0495607_0006894 Ga0495607_0006894_3877_4797 306
1376 3300046501 Ga0495607_0010249 Ga0495607_0010249_2039_2959 306
1377 3300046501 Ga0495607_0013248 Ga0495607_0013248_4117_5037 306
1378 3300046501 Ga0495607_0016933 Ga0495607_0016933_2677_3597 306
1379 3300046501 Ga0495607_0028985 Ga0495607_0028985_110_1189 306
1380 3300046501 Ga0495607_0079219 Ga0495607_0079219_475_1461 306
1381 3300046501 Ga0495607_0090773 Ga0495607_0090773_365_1285 306
1382 3300046501 Ga0495607_0167122 Ga0495607_0167122_110_1030 306
1383 3300046501 Ga0495607_0196115 Ga0495607_0196115_68_988 306
1384 3300046501 Ga0495607_0201490 Ga0495607_0201490_35_955 306
1385 3300046506 Ga0495583_0001193 Ga0495583_0001193_5251_6171 306
1386 3300046506 Ga0495583_0002444 Ga0495583_0002444_2376_3296 306
1387 3300046506 Ga0495583_0003659 Ga0495583_0003659_4476_5396 306
1388 3300046506 Ga0495583_0005028 Ga0495583_0005028_3589_4509 306
1389 3300046506 Ga0495583_0031225 Ga0495583_0031225_1006_1926 306
1390 3300046507 Ga0495606_0000246 Ga0495606_0000246_3825_4745 306
1391 3300046507 Ga0495606_0002005 Ga0495606_0002005_20294_21214 306
1392 3300046507 Ga0495606_0004844 Ga0495606_0004844_3821_4741 306
1393 3300046507 Ga0495606_0005974 Ga0495606_0005974_4689_5609 306
1394 3300046507 Ga0495606_0009111 Ga0495606_0009111_3364_4284 306
1395 3300046507 Ga0495606_0010807 Ga0495606_0010807_5901_6821 306
1396 3300046507 Ga0495606_0040567 Ga0495606_0040567_876_1796 306
1397 3300046507 Ga0495606_0085085 Ga0495606_0085085_575_1561 306
1398 3300046507 Ga0495606_0100878 Ga0495606_0100878_266_1186 306
1399 3300046512 Ga0495610_0004559 Ga0495610_0004559_6557_7477 306
1400 3300046512 Ga0495610_0009103 Ga0495610_0009103_3302_4222 306
1401 3300046512 Ga0495610_0012535 Ga0495610_0012535_3651_4571 306
1402 3300046512 Ga0495610_0021453 Ga0495610_0021453_2006_2926 306
1403 3300046512 Ga0495610_0028426 Ga0495610_0028426_1780_2700 306
1404 3300046512 Ga0495610_0057280 Ga0495610_0057280_362_1282 306
1405 3300046512 Ga0495610_0061511 Ga0495610_0061511_437_1357 306
1406 3300046512 Ga0495610_0103760 Ga0495610_0103760_313_1233 306
1407 3300046513 Ga0495616_0000593 Ga0495616_0000593_2206_3126 306
1408 3300046513 Ga0495616_0000721 Ga0495616_0000721_76_1071 306
1409 3300046513 Ga0495616_0001779 Ga0495616_0001779_3005_3925 306
1410 3300046513 Ga0495616_0002078 Ga0495616_0002078_354_1274 306
1411 3300046513 Ga0495616_0052052 Ga0495616_0052052_572_1558 306
1412 3300046513 Ga0495616_0060209 Ga0495616_0060209_316_1236 306
1413 3300046513 Ga0495616_0069522 Ga0495616_0069522_524_1444 306
1414 3300046513 Ga0495616_0082575 Ga0495616_0082575_275_1195 306
1415 3300046515 Ga0495620_0001145 Ga0495620_0001145_3608_4528 306
1416 3300046515 Ga0495620_0004673 Ga0495620_0004673_6265_7185 306
1417 3300046515 Ga0495620_0010640 Ga0495620_0010640_3512_4432 306
1418 3300046515 Ga0495620_0014925 Ga0495620_0014925_2547_3467 306
1419 3300046515 Ga0495620_0051454 Ga0495620_0051454_263_1183 306
1420 3300046517 Ga0495630_0018276 Ga0495630_0018276_3762_4682 306
1421 3300046517 Ga0495630_0034636 Ga0495630_0034636_283_1203 306
1422 3300046518 Ga0495631_0000379 Ga0495631_0000379_5814_6734 306
1423 3300046518 Ga0495631_0001488 Ga0495631_0001488_9623_10543 306
1424 3300046518 Ga0495631_0003817 Ga0495631_0003817_4730_5650 306
1425 3300046518 Ga0495631_0023466 Ga0495631_0023466_1342_2262 306
1426 3300046518 Ga0495631_0045912 Ga0495631_0045912_256_1176 306
1427 3300046518 Ga0495631_0059933 Ga0495631_0059933_262_1182 306
1428 3300046518 Ga0495631_0068547 Ga0495631_0068547_238_1158 306
1429 3300046519 Ga0495632_0000701 Ga0495632_0000701_23757_24677 306
1430 3300046519 Ga0495632_0001853 Ga0495632_0001853_16068_16988 306
1431 3300046519 Ga0495632_0002400 Ga0495632_0002400_3999_4919 306
1432 3300046519 Ga0495632_0003929 Ga0495632_0003929_8293_9213 306
1433 3300046519 Ga0495632_0006012 Ga0495632_0006012_4879_5799 306
1434 3300046519 Ga0495632_0008276 Ga0495632_0008276_4870_5790 306
1435 3300046519 Ga0495632_0008989 Ga0495632_0008989_1582_2568 306
1436 3300046519 Ga0495632_0010837 Ga0495632_0010837_2197_3117 306
1437 3300046519 Ga0495632_0051940 Ga0495632_0051940_297_1217 306
1438 3300046519 Ga0495632_0078626 Ga0495632_0078626_263_1183 306
1439 3300046520 Ga0495637_0003797 Ga0495637_0003797_4298_5218 306
1440 3300046520 Ga0495637_0004292 Ga0495637_0004292_3568_4488 306
1441 3300046520 Ga0495637_0005883 Ga0495637_0005883_3552_4538 306
1442 3300046520 Ga0495637_0006242 Ga0495637_0006242_310_1398 306
1443 3300046520 Ga0495637_0010569 Ga0495637_0010569_1786_2706 306
1444 3300046520 Ga0495637_0011701 Ga0495637_0011701_1651_2571 306
1445 3300046520 Ga0495637_0038039 Ga0495637_0038039_506_1426 306
1446 3300046520 Ga0495637_0053818 Ga0495637_0053818_256_1176 306
1447 3300046522 Ga0495643_0000382 Ga0495643_0000382_33703_34623 306
1448 3300046522 Ga0495643_0001896 Ga0495643_0001896_14310_15230 306
1449 3300046522 Ga0495643_0002500 Ga0495643_0002500_201_1121 306
1450 3300046522 Ga0495643_0007738 Ga0495643_0007738_1445_2365 306
1451 3300046522 Ga0495643_0011179 Ga0495643_0011179_2306_3226 306
1452 3300046522 Ga0495643_0029896 Ga0495643_0029896_319_1239 306
1453 3300046522 Ga0495643_0060141 Ga0495643_0060141_82_1002 306
1454 3300046522 Ga0495643_0128094 Ga0495643_0128094_71_991 306
1455 3300046523 Ga0495644_0015706 Ga0495644_0015706_908_1828 306
1456 3300046523 Ga0495644_0016797 Ga0495644_0016797_1348_2268 306
1457 3300046523 Ga0495644_0035088 Ga0495644_0035088_172_1092 306
1458 3300046524 Ga0495648_0002485 Ga0495648_0002485_2282_3202 306
1459 3300046524 Ga0495648_0009405 Ga0495648_0009405_261_1181 306
1460 3300046524 Ga0495648_0011049 Ga0495648_0011049_3821_4741 306
1461 3300046524 Ga0495648_0019059 Ga0495648_0019059_2825_3745 306
1462 3300046524 Ga0495648_0024396 Ga0495648_0024396_2783_3778 306
1463 3300046524 Ga0495648_0027047 Ga0495648_0027047_2543_3463 306
1464 3300046524 Ga0495648_0038087 Ga0495648_0038087_1221_2141 306
1465 3300046524 Ga0495648_0055105 Ga0495648_0055105_378_1298 306
1466 3300046524 Ga0495648_0060364 Ga0495648_0060364_861_1781 306
1467 3300046524 Ga0495648_0197862 Ga0495648_0197862_44_964 306
1468 3300046526 Ga0495666_0036734 Ga0495666_0036734_258_1178 306
1469 3300046528 Ga0495642_0000195 Ga0495642_0000195_23554_24474 306
1470 3300046528 Ga0495642_0002236 Ga0495642_0002236_4002_4922 306
1471 3300046528 Ga0495642_0007223 Ga0495642_0007223_2733_3653 306
1472 3300046528 Ga0495642_0052368 Ga0495642_0052368_232_1311 306
1473 3300046529 Ga0495652_0312609 Ga0495652_0312609_56_994 306
1474 3300046530 Ga0495654_0000888 Ga0495654_0000888_1787_2707 306
1475 3300046530 Ga0495654_0002087 Ga0495654_0002087_9991_10911 306
1476 3300046530 Ga0495654_0003941 Ga0495654_0003941_3567_4487 306
1477 3300046530 Ga0495654_0005350 Ga0495654_0005350_3930_4850 306
1478 3300046530 Ga0495654_0009410 Ga0495654_0009410_3128_4048 306
1479 3300046530 Ga0495654_0009532 Ga0495654_0009532_955_1875 306
1480 3300046530 Ga0495654_0009719 Ga0495654_0009719_56_1072 306
1481 3300046530 Ga0495654_0012976 Ga0495654_0012976_2036_2956 306
1482 3300046530 Ga0495654_0019277 Ga0495654_0019277_2372_3292 306
1483 3300046530 Ga0495654_0027966 Ga0495654_0027966_1389_2309 306
1484 3300046530 Ga0495654_0031359 Ga0495654_0031359_135_1055 306
1485 3300046530 Ga0495654_0070847 Ga0495654_0070847_383_1378 306
1486 3300046530 Ga0495654_0077764 Ga0495654_0077764_610_1530 306
1487 3300046530 Ga0495654_0082581 Ga0495654_0082581_289_1209 306
1488 3300046530 Ga0495654_0091344 Ga0495654_0091344_264_1184 306
1489 3300046530 Ga0495654_0096431 Ga0495654_0096431_218_1213 306
1490 3300046536 Ga0495587_0017152 Ga0495587_0017152_1384_2304 306
1491 3300046538 Ga0495609_0005649 Ga0495609_0005649_1899_2819 306
1492 3300046538 Ga0495609_0014388 Ga0495609_0014388_264_1184 306
1493 3300046538 Ga0495609_0015335 Ga0495609_0015335_2457_3377 306
1494 3300046538 Ga0495609_0015576 Ga0495609_0015576_264_1184 306
1495 3300046538 Ga0495609_0028984 Ga0495609_0028984_139_1059 306
1496 3300046538 Ga0495609_0075332 Ga0495609_0075332_148_1068 306
1497 3300046542 Ga0495597_0000033 Ga0495597_0000033_100402_101388 306
1498 3300046542 Ga0495597_0001110 Ga0495597_0001110_277_1197 306
1499 3300046542 Ga0495597_0001821 Ga0495597_0001821_13249_14169 306
1500 3300046542 Ga0495597_0030883 Ga0495597_0030883_1107_2027 306
1501 3300046542 Ga0495597_0033425 Ga0495597_0033425_930_1850 306
1502 3300046542 Ga0495597_0084285 Ga0495597_0084285_292_1212 306
1503 3300046543 Ga0495645_0050226 Ga0495645_0050226_1908_2828 306
1504 3300046557 Ga0495622_0001083 Ga0495622_0001083_3565_4485 306
1505 3300046557 Ga0495622_0001716 Ga0495622_0001716_3084_4004 306
1506 3300046557 Ga0495622_0019340 Ga0495622_0019340_1326_2246 306
1507 3300046557 Ga0495622_0048401 Ga0495622_0048401_267_1187 306
1508 3300046558 Ga0495633_0000778 Ga0495633_0000778_3330_4250 306
1509 3300046558 Ga0495633_0002090 Ga0495633_0002090_13127_14047 306
1510 3300046558 Ga0495633_0009352 Ga0495633_0009352_1866_2795 306
1511 3300046616 Ga0495668_0004858 Ga0495668_0004858_7072_7992 306
1512 3300046616 Ga0495668_0012425 Ga0495668_0012425_2825_3745 306
1513 3300046616 Ga0495668_0065962 Ga0495668_0065962_518_1504 306
1514 3300046616 Ga0495668_0166705 Ga0495668_0166705_237_1157 306
1515 3300046642 Ga0495634_0145233 Ga0495634_0145233_147_1142 306
1516 3300046648 Ga0495611_0000413 Ga0495611_0000413_21922_22842 306
1517 3300046648 Ga0495611_0019925 Ga0495611_0019925_1411_2331 306
1518 3300046660 Ga0495625_0005058 Ga0495625_0005058_2212_3132 306
1519 3300046660 Ga0495625_0008072 Ga0495625_0008072_3394_4314 306
1520 3300046660 Ga0495625_0010914 Ga0495625_0010914_481_1467 306
1521 3300046660 Ga0495625_0014449 Ga0495625_0014449_3512_4507 306
1522 3300046660 Ga0495625_0025653 Ga0495625_0025653_65_985 306
1523 3300046660 Ga0495625_0076556 Ga0495625_0076556_44_964 306
1524 3300046660 Ga0495625_0098949 Ga0495625_0098949_645_1565 306
1525 3300046660 Ga0495625_0121780 Ga0495625_0121780_397_1317 306
1526 3300046663 Ga0495635_0006687 Ga0495635_0006687_1941_2861 306
1527 3300046665 Ga0495661_0000036 Ga0495661_0000036_3777_4697 306
1528 3300046665 Ga0495661_0000249 Ga0495661_0000249_21546_22466 306
1529 3300046665 Ga0495661_0002685 Ga0495661_0002685_8408_9328 306
1530 3300046665 Ga0495661_0027443 Ga0495661_0027443_528_1448 306
1531 3300046665 Ga0495661_0052462 Ga0495661_0052462_474_1394 306
1532 3300046665 Ga0495661_0089645 Ga0495661_0089645_36_956 306
1533 3300046674 Ga0495588_0055014 Ga0495588_0055014_256_1176 306
1534 3300046680 Ga0495646_0010704 Ga0495646_0010704_954_1874 306
1535 3300046680 Ga0495646_0118679 Ga0495646_0118679_335_1330 306
1536 3300046684 Ga0495669_0001839 Ga0495669_0001839_4399_5319 306
1537 3300046689 Ga0495613_0021702 Ga0495613_0021702_371_1366 306
1538 3300046689 Ga0495613_0153926 Ga0495613_0153926_368_1288 306
1539 3300046690 Ga0495624_0004808 Ga0495624_0004808_5341_6336 306
1540 3300046691 Ga0495670_0001216 Ga0495670_0001216_8036_8956 306
1541 3300046691 Ga0495670_0007443 Ga0495670_0007443_1339_2259 306
1542 3300046691 Ga0495670_0025557 Ga0495670_0025557_1783_2703 306
1543 3300046691 Ga0495670_0032412 Ga0495670_0032412_10_1089 306
1544 3300046692 Ga0495671_0000831 Ga0495671_0000831_4152_5072 306
1545 3300046692 Ga0495671_0000930 Ga0495671_0000930_7966_8886 306
1546 3300046692 Ga0495671_0001865 Ga0495671_0001865_8395_9315 306
1547 3300046692 Ga0495671_0002003 Ga0495671_0002003_8787_9707 306
1548 3300046692 Ga0495671_0013145 Ga0495671_0013145_1123_2043 306
1549 3300046692 Ga0495671_0018753 Ga0495671_0018753_129_1049 306
1550 3300046692 Ga0495671_0087110 Ga0495671_0087110_419_1348 306
1551 3300046692 Ga0495671_0093132 Ga0495671_0093132_264_1184 306
1552 3300046692 Ga0495671_0105862 Ga0495671_0105862_190_1110 306
1553 3300046694 Ga0495649_0000391 Ga0495649_0000391_27736_28656 306
1554 3300046694 Ga0495649_0001382 Ga0495649_0001382_3928_4857 306
1555 3300046694 Ga0495649_0003914 Ga0495649_0003914_4183_5103 306
1556 3300046694 Ga0495649_0011871 Ga0495649_0011871_2615_3535 306
1557 3300046694 Ga0495649_0012769 Ga0495649_0012769_1427_2347 306
1558 3300046694 Ga0495649_0013378 Ga0495649_0013378_3523_4443 306
1559 3300046694 Ga0495649_0025753 Ga0495649_0025753_250_1170 306
1560 3300046694 Ga0495649_0044222 Ga0495649_0044222_1224_2144 306
1561 3300046694 Ga0495649_0055038 Ga0495649_0055038_41_961 306
1562 3300046794 Ga0495589_0001212 Ga0495589_0001212_11674_12594 306
1563 3300046794 Ga0495589_0004326 Ga0495589_0004326_2682_3602 306
1564 3300046794 Ga0495589_0007909 Ga0495589_0007909_3461_4381 306
1565 3300046794 Ga0495589_0018047 Ga0495589_0018047_471_1391 306
1566 3300046794 Ga0495589_0022546 Ga0495589_0022546_954_1874 306
1567 3300046794 Ga0495589_0025145 Ga0495589_0025145_1870_2835 306
1568 3300046794 Ga0495589_0043652 Ga0495589_0043652_260_1180 306
1569 3300046794 Ga0495589_0071278 Ga0495589_0071278_190_1110 306
1570 3300046794 Ga0495589_0085731 Ga0495589_0085731_156_1151 306
1571 3300046809 Ga0495600_0140741 Ga0495600_0140741_478_1473 306
1572 3300046810 Ga0495660_0005856 Ga0495660_0005856_2206_3192 306
1573 3300046810 Ga0495660_0008303 Ga0495660_0008303_1560_2480 306
1574 3300046810 Ga0495660_0013313 Ga0495660_0013313_20_940 306
1575 3300046810 Ga0495660_0019631 Ga0495660_0019631_823_1743 306
1576 3300046810 Ga0495660_0036834 Ga0495660_0036834_1750_2670 306
1577 3300046810 Ga0495660_0047670 Ga0495660_0047670_735_1655 306
1578 3300046810 Ga0495660_0063881 Ga0495660_0063881_230_1150 306
1579 3300046810 Ga0495660_0085334 Ga0495660_0085334_164_1084 306
1580 3300046810 Ga0495660_0107614 Ga0495660_0107614_264_1184 306
1581 3300046810 Ga0495660_0136574 Ga0495660_0136574_41_961 306
1582 3300047315 Ga0495581_0021035 Ga0495581_0021035_2356_3276 306
1583 3300047317 Ga0495604_0024691 Ga0495604_0024691_1638_2558 306
1584 3300047317 Ga0495604_0051700 Ga0495604_0051700_1807_2802 306
1585 3300047318 Ga0495636_0050526 Ga0495636_0050526_286_1206 306
1586 3300047319 Ga0495674_0009196 Ga0495674_0009196_3554_4654 306
1587 3300047320 Ga0495672_0001708 Ga0495672_0001708_4001_4921 306
1588 3300047320 Ga0495672_0001919 Ga0495672_0001919_8924_9853 306
1589 3300047320 Ga0495672_0003617 Ga0495672_0003617_3504_4424 306
1590 3300047320 Ga0495672_0004432 Ga0495672_0004432_8606_9526 306
1591 3300047320 Ga0495672_0005981 Ga0495672_0005981_3208_4203 306
1592 3300047320 Ga0495672_0008767 Ga0495672_0008767_2536_3522 306
1593 3300047320 Ga0495672_0011203 Ga0495672_0011203_1958_2878 306
1594 3300047320 Ga0495672_0011833 Ga0495672_0011833_1577_2563 306
1595 3300047320 Ga0495672_0014254 Ga0495672_0014254_4258_5178 306
1596 3300047320 Ga0495672_0017398 Ga0495672_0017398_671_1591 306
1597 3300047320 Ga0495672_0019128 Ga0495672_0019128_3236_4156 306
1598 3300047320 Ga0495672_0019156 Ga0495672_0019156_304_1224 306
1599 3300047320 Ga0495672_0027510 Ga0495672_0027510_446_1366 306
1600 3300047320 Ga0495672_0035254 Ga0495672_0035254_1249_2169 306
1601 3300047320 Ga0495672_0035782 Ga0495672_0035782_644_1564 306
1602 3300047320 Ga0495672_0040242 Ga0495672_0040242_1597_2517 306
1603 3300047321 Ga0495676_0004159 Ga0495676_0004159_8789_9709 306
1604 3300047321 Ga0495676_0055296 Ga0495676_0055296_1675_2604 306
1605 3300047321 Ga0495676_0123003 Ga0495676_0123003_701_1696 306
1606 3300047322 Ga0495680_0014546 Ga0495680_0014546_496_1491 306
1607 3300047322 Ga0495680_0035318 Ga0495680_0035318_1520_2440 306
1608 3300047323 Ga0495683_0000194 Ga0495683_0000194_37584_38504 306
1609 3300047323 Ga0495683_0001114 Ga0495683_0001114_3330_4250 306
1610 3300047323 Ga0495683_0005802 Ga0495683_0005802_2485_3405 306
1611 3300047323 Ga0495683_0006973 Ga0495683_0006973_1565_2551 306
1612 3300047323 Ga0495683_0007481 Ga0495683_0007481_821_1741 306
1613 3300047323 Ga0495683_0031681 Ga0495683_0031681_531_1451 306
1614 3300047323 Ga0495683_0066729 Ga0495683_0066729_495_1415 306
1615 3300047443 Ga0495687_001053 Ga0495687_001053_22404_23324 306
1616 3300047443 Ga0495687_005812 Ga0495687_005812_3996_4916 306
1617 3300047443 Ga0495687_009643 Ga0495687_009643_788_1708 306
1618 3300047444 Ga0495675_0008389 Ga0495675_0008389_1588_2508 306
1619 3300047445 Ga0495677_0000336 Ga0495677_0000336_18559_19479 306
1620 3300047446 Ga0495679_005365 Ga0495679_005365_220_1140 306
1621 3300047446 Ga0495679_013134 Ga0495679_013134_1997_2917 306
1622 3300047469 Ga0495673_0000794 Ga0495673_0000794_21322_22242 306
1623 3300047469 Ga0495673_0000807 Ga0495673_0000807_26855_27775 306
1624 3300047469 Ga0495673_0008389 Ga0495673_0008389_3118_4038 306
1625 3300047469 Ga0495673_0010865 Ga0495673_0010865_3884_4804 306
1626 3300047469 Ga0495673_0018926 Ga0495673_0018926_2364_3284 306
1627 3300047469 Ga0495673_0035395 Ga0495673_0035395_191_1186 306
1628 3300047469 Ga0495673_0059311 Ga0495673_0059311_709_1629 306
1629 3300047469 Ga0495673_0079353 Ga0495673_0079353_253_1173 306
1630 3300047469 Ga0495673_0139829 Ga0495673_0139829_12_932 306
1631 3300047470 Ga0495681_0000579 Ga0495681_0000579_2218_3138 306
1632 3300047470 Ga0495681_0000649 Ga0495681_0000649_23344_24264 306
1633 3300047470 Ga0495681_0002767 Ga0495681_0002767_4052_5038 306
1634 3300047470 Ga0495681_0005562 Ga0495681_0005562_4225_5145 306
1635 3300047470 Ga0495681_0009943 Ga0495681_0009943_1493_2413 306
1636 3300047470 Ga0495681_0013626 Ga0495681_0013626_3726_4646 306
1637 3300047470 Ga0495681_0016843 Ga0495681_0016843_1206_2126 306
1638 3300047470 Ga0495681_0019051 Ga0495681_0019051_2490_3485 306
1639 3300047470 Ga0495681_0020639 Ga0495681_0020639_2260_3180 306
1640 3300047470 Ga0495681_0022698 Ga0495681_0022698_2168_3088 306
1641 3300047470 Ga0495681_0044453 Ga0495681_0044453_197_1117 306
1642 3300047470 Ga0495681_0062696 Ga0495681_0062696_205_1125 306
1643 3300047470 Ga0495681_0073870 Ga0495681_0073870_329_1249 306
1644 3300047470 Ga0495681_0074853 Ga0495681_0074853_224_1189 306
1645 3300047471 Ga0495684_0260373 Ga0495684_0260373_89_1084 306
1646 3300047472 Ga0495686_0007477 Ga0495686_0007477_7068_8063 306
1647 3300047472 Ga0495686_0036456 Ga0495686_0036456_2063_2983 306
1648 3300047472 Ga0495686_0041846 Ga0495686_0041846_1558_2478 306
1649 3300047673 Ga0495593_0045033 Ga0495593_0045033_363_1283 306
1650 3300047673 Ga0495593_0074302 Ga0495593_0074302_782_1702 306
1651 3300048088 Ga0495602_0186298 Ga0495602_0186298_431_1426 306
1652 3300048091 Ga0495626_0000557 Ga0495626_0000557_3348_4268 306
1653 3300048091 Ga0495626_0006633 Ga0495626_0006633_4749_5669 306
1654 3300048091 Ga0495626_0008760 Ga0495626_0008760_3671_4591 306
1655 3300048091 Ga0495626_0009514 Ga0495626_0009514_2375_3295 306
1656 3300048091 Ga0495626_0009654 Ga0495626_0009654_1567_2487 306
1657 3300048091 Ga0495626_0013994 Ga0495626_0013994_2700_3695 306
1658 3300048091 Ga0495626_0015764 Ga0495626_0015764_251_1171 306
1659 3300048913 Ga0496110_0138939 Ga0496110_0138939_643_1563 306
1660 3300048914 Ga0496111_0036147 Ga0496111_0036147_503_1423 306
1661 3300048917 Ga0496114_0019300 Ga0496114_0019300_4322_5248 306
1662 3300048919 Ga0496116_0004205 Ga0496116_0004205_8619_9539 306
1663 3300048919 Ga0496116_0005461 Ga0496116_0005461_3542_4537 306
1664 3300048919 Ga0496116_0087462 Ga0496116_0087462_901_1821 306
1665 3300048920 Ga0496117_0004486 Ga0496117_0004486_10249_11169 306
1666 3300048920 Ga0496117_0004981 Ga0496117_0004981_6733_7695 306
1667 3300048920 Ga0496117_0009703 Ga0496117_0009703_6012_6932 306
1668 3300048920 Ga0496117_0028756 Ga0496117_0028756_352_1272 306
1669 3300048920 Ga0496117_0049195 Ga0496117_0049195_1439_2359 306
1670 3300048920 Ga0496117_0078745 Ga0496117_0078745_173_1093 306
1671 3300048921 Ga0496118_0007888 Ga0496118_0007888_3101_4021 306
1672 3300048921 Ga0496118_0012044 Ga0496118_0012044_7192_8112 306
1673 3300048921 Ga0496118_0045370 Ga0496118_0045370_1051_2013 306
1674 3300048921 Ga0496118_0079730 Ga0496118_0079730_191_1111 306
1675 3300048921 Ga0496118_0134759 Ga0496118_0134759_482_1402 306
1676 3300048921 Ga0496118_0135848 Ga0496118_0135848_474_1394 306
1677 3300048921 Ga0496118_0167220 Ga0496118_0167220_254_1174 306
1678 3300048922 Ga0496119_0008479 Ga0496119_0008479_6017_6937 306
1679 3300048923 Ga0496120_0030378 Ga0496120_0030378_552_1472 306
1680 3300048924 Ga0496121_0000093 Ga0496121_0000093_189327_190259 306
1681 3300048924 Ga0496121_0000911 Ga0496121_0000911_47625_48545 306
1682 3300048924 Ga0496121_0013286 Ga0496121_0013286_1967_2887 306
1683 3300048924 Ga0496121_0022014 Ga0496121_0022014_4464_5384 306
1684 3300048924 Ga0496121_0105195 Ga0496121_0105195_607_1602 306
1685 3300048924 Ga0496121_0134308 Ga0496121_0134308_554_1549 306
1686 3300048925 Ga0496122_0003121 Ga0496122_0003121_10354_11286 306
1687 3300048925 Ga0496122_0003169 Ga0496122_0003169_2870_3790 306
1688 3300048925 Ga0496122_0017043 Ga0496122_0017043_5402_6322 306
1689 3300048925 Ga0496122_0055098 Ga0496122_0055098_1466_2386 306
1690 3300048925 Ga0496122_0126186 Ga0496122_0126186_92_1012 306
1691 3300048925 Ga0496122_0156936 Ga0496122_0156936_244_1164 306
1692 3300048926 Ga0496123_0000303 Ga0496123_0000303_10621_11553 306
1693 3300048926 Ga0496123_0003032 Ga0496123_0003032_263_1183 306
1694 3300048926 Ga0496123_0022340 Ga0496123_0022340_1591_2511 306
1695 3300048926 Ga0496123_0036364 Ga0496123_0036364_2159_3079 306
1696 3300048926 Ga0496123_0050844 Ga0496123_0050844_1478_2443 306
1697 3300048926 Ga0496123_0066631 Ga0496123_0066631_576_1496 306
1698 3300048927 Ga0496124_0005876 Ga0496124_0005876_4173_5093 306
1699 3300048927 Ga0496124_0016691 Ga0496124_0016691_5863_6792 306
1700 3300048927 Ga0496124_0036140 Ga0496124_0036140_87_1013 306
1701 3300048927 Ga0496124_0063669 Ga0496124_0063669_481_1401 306
1702 3300048927 Ga0496124_0094167 Ga0496124_0094167_625_1545 306
1703 3300048927 Ga0496124_0133539 Ga0496124_0133539_887_1807 306
1704 3300048927 Ga0496124_0208750 Ga0496124_0208750_279_1259 306
1705 3300048927 Ga0496124_0215123 Ga0496124_0215123_109_1029 306
1706 3300048927 Ga0496124_0227436 Ga0496124_0227436_29_949 306
1707 3300048928 Ga0496125_0002500 Ga0496125_0002500_19331_20251 306
1708 3300048928 Ga0496125_0002683 Ga0496125_0002683_3586_4506 306
1709 3300048928 Ga0496125_0005692 Ga0496125_0005692_8461_9426 306
1710 3300048928 Ga0496125_0010564 Ga0496125_0010564_6019_6939 306
1711 3300048928 Ga0496125_0030360 Ga0496125_0030360_409_1329 306
1712 3300048928 Ga0496125_0041617 Ga0496125_0041617_2237_3157 306
1713 3300048928 Ga0496125_0069247 Ga0496125_0069247_342_1262 306
1714 3300048928 Ga0496125_0094561 Ga0496125_0094561_893_1813 306
1715 3300048929 Ga0496126_0003723 Ga0496126_0003723_48_968 306
1716 3300048929 Ga0496126_0036914 Ga0496126_0036914_1943_2863 306
1717 3300049459 Ga0495678_000757 Ga0495678_000757_24855_25775 306
1718 3300049459 Ga0495678_005102 Ga0495678_005102_545_1465 306
1719 3300049459 Ga0495678_005292 Ga0495678_005292_5593_6588 306
1720 3300049459 Ga0495678_006807 Ga0495678_006807_3515_4435 306
1721 3300049459 Ga0495678_007751 Ga0495678_007751_2657_3577 306
1722 3300049459 Ga0495678_013009 Ga0495678_013009_1388_2383 306
1723 3300049459 Ga0495678_024291 Ga0495678_024291_183_1178 306
1724 3300049459 Ga0495678_042748 Ga0495678_042748_586_1506 306
1725 3300049459 Ga0495678_060657 Ga0495678_060657_92_1021 306
1726 3300049459 Ga0495678_065742 Ga0495678_065742_255_1175 306
1727 3300049459 Ga0495678_079137 Ga0495678_079137_144_1064 306
1728 3300049460 Ga0495682_0000090 Ga0495682_0000090_65344_66285 306
1729 3300049460 Ga0495682_0001847 Ga0495682_0001847_3564_4484 306
1730 3300049460 Ga0495682_0003242 Ga0495682_0003242_5929_6849 306
1731 3300049460 Ga0495682_0004289 Ga0495682_0004289_2693_3613 306
1732 3300049460 Ga0495682_0020920 Ga0495682_0020920_1171_2091 306
1733 3300049460 Ga0495682_0061183 Ga0495682_0061183_251_1171 306
1734 3300049460 Ga0495682_0061825 Ga0495682_0061825_128_1048 306
1735 3300049571 Ga0501034_0000143 Ga0501034_0000143_30431_31357 306
1736 3300049822 Ga0501035_0236910 Ga0501035_0236910_539_1459 306
1737 3300049853 Ga0501226_004985 Ga0501226_004985_436_1356 306
1738 3300050489 nmdc:mga03683_44547_c2 nmdc:mga03683_44547_c2_40_960 306
1739 3300050491 nmdc:mga00v17_89846_c1 nmdc:mga00v17_89846_c1_709_1629 306
1740 3300053111 Ga0500572_000527 Ga0500572_000527_442_1362 306
1741 3300053125 Ga0500618_002632 Ga0500618_002632_3902_4873 306
1742 3300053135 Ga0500659_0001304 Ga0500659_0001304_4438_5364 306
1743 3300053140 Ga0500573_0026782 Ga0500573_0026782_408_1328 306
1744 3300053142 Ga0500577_0018788 Ga0500577_0018788_197_1117 306
1745 3300053145 Ga0500586_036376 Ga0500586_036376_121_1116 306
1746 3300053161 Ga0500634_0006366 Ga0500634_0006366_228_1148 306
1747 iso_pu_bacteria 2511231011 2511294134 306
1748 iso_pu_bacteria 2554235341 2555669518 306
1749 iso_pu_bacteria 2675903420 2677900298 306
1750 iso_pu_bacteria 2728369097 2729148607 306
1751 iso_pu_bacteria 2844665904 2844670580 306
1752 iso_pu_bacteria 640427133 640489863 306
1753 iso_pu_bacteria 8011350971 8011352171 306

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

68

127

0.96

PF03466

LysR_substrate

LysR substrate binding domain

148

355

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7trv-assembly1.cif.gz_A crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.9202 2 88
7trv-assembly1.cif.gz_B crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.915 4 88
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.8987 6 88
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.8969 6 88
7trv-assembly1.cif.gz_A crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.8912 2 88
ID Description Score Start End Superfamily
af_Q57083_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9736 7 84 1.10.10.10
af_P75836_3_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9653 6 87 1.10.10.10
af_P0A9F6_3_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9502 3 89 1.10.10.10
af_P77333_5_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9486 7 88 1.10.10.10
af_P77746_4_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9481 6 85 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2R7KHJ9-F1-model_v4 deleted 0.9696 3 88
AF-A0A6N3U979-F1-model_v4 deleted 0.9629 6 78
AF-A0A496X5J3-F1-model_v4 HTH lysR-type domain-containing protein 0.9556 1 72 GO:0003700
GO:0006351
GO:0043565
AF-A0A5R1NF86-F1-model_v4 deleted 0.9444 6 79
AF-A0A833KNX1-F1-model_v4 deleted 0.9412 7 77

Feature Viewer

pLDDT pTM Quality
91.3 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map