F495375

General Info

Members Datasets Scaffolds Average Seq Length
1696 412 3370 213

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10062716|Ga0111539_100627166
Length 255
Sequence MSTPRTYREPRVRVPGLHSASGDVLDGGYDRRLAPTHAIRRAWMNDKPNWKVTRLDDLERRGRDIPVREHLGIHAFGINAYTPGEDGTLINEHDEAGTGQEELYIVLDGKATFEVDGETVDAPPGTFVFVGPESRRKATGDGTVLAVGATPGEAYQGIDWGEAWPFHSESMTAYSEQRYADALEAVRGALERMPDHAGLHYNYACFATLAGETGDDTFAHLRRSVELFPRFREDAPRDDDFAAVRDDPRFEEALR

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
91 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
102 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
103 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
108 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
216 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
217 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
218 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
219 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
220 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
221 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
222 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
223 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
224 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
225 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
226 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
227 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
228 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
229 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
230 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
231 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
232 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
233 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
234 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
235 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
236 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
237 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
238 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
239 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
240 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
241 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
242 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
243 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
244 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
245 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
246 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
247 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
248 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
249 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
250 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
251 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
252 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
253 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
254 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
255 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
256 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
257 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
259 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
260 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
261 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
262 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
263 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
264 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
265 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
266 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
267 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
268 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
269 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
270 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
271 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
272 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
273 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
274 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
275 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
276 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
277 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
278 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
279 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
280 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
281 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
282 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
283 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
284 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
285 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
286 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
287 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
288 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
289 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
290 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
291 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
292 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
293 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
294 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
295 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
296 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
297 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
298 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
299 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
300 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
301 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
302 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
303 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
304 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
305 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
306 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
307 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
308 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
309 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
310 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
311 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
312 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
313 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
314 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
315 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
316 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
317 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
318 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
319 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
320 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
321 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
322 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
323 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
324 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
325 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
326 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
327 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
328 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
329 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
330 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
331 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
332 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
333 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
334 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
335 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
336 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
337 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
338 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
339 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
340 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
341 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
342 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
343 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
344 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
345 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
346 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
347 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
348 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
349 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
350 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
351 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
352 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
353 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
354 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
355 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
356 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
357 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
358 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
359 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
375 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
376 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
377 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
378 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
379 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
380 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
381 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
382 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
383 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
384 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
385 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
386 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
387 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
388 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
389 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
392 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
393 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
394 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
395 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
396 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
397 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
398 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
399 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
400 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
401 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
402 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
403 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
404 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
405 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
406 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
407 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
408 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
409 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
410 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
411 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
412 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.35
Metatranscriptomes 1.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.83
Nodule 0
Rhizoplane 13.15
Rhizosphere 85.85
Stem 0
Stem Tuber 0
Unclassified 15.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10062716 3300009094 Bacteria 4399
2 ARcpr5yngRDRAFT_c004151 3300000043 Bacteria 1382
3 ARSoilOldRDRAFT_c002807 3300000044 Bacteria 1519
4 ARCol0yngRDRAFT_1001939 3300000652 Bacteria 1611
5 JGI24747J21853_1008829 3300001978 Bacteria 989
6 JGI24739J22299_10095130 3300001989 Bacteria 903
7 JGI24739J22299_10105358 3300001989 Unclassified 849
8 JGI24737J22298_10086158 3300001990 Bacteria 933
9 JGI24743J22301_10039925 3300001991 Unclassified 940
10 JGI24743J22301_10061939 3300001991 Bacteria 772
11 JGI24738J21930_10034049 3300002075 Bacteria 1038
12 JGI24033J26618_1004749 3300002155 Bacteria 1476
13 JGI24751J29686_10024707 3300002459 Unclassified 1247
14 JGI25406J46586_10011902 3300003203 Bacteria 3795
15 JGI25407J50210_10035069 3300003373 Bacteria 1293
16 Ga0070658_10081640 3300005327 Bacteria 2656
17 Ga0070658_10158991 3300005327 Bacteria 1895
18 Ga0070658_10624188 3300005327 Bacteria 935
19 Ga0070658_10926831 3300005327 Bacteria 757
20 Ga0070676_10254822 3300005328 Bacteria 1172
21 Ga0070676_10573730 3300005328 Bacteria 810
22 Ga0070683_100000911 3300005329 Bacteria 21931
23 Ga0070683_100009526 3300005329 Bacteria 8313
24 Ga0070683_100043043 3300005329 Bacteria 4160
25 Ga0070683_100068268 3300005329 Bacteria 3312
26 Ga0070683_100072613 3300005329 Bacteria 3212
27 Ga0070683_100212793 3300005329 Bacteria 1836
28 Ga0070683_100263225 3300005329 Bacteria 1640
29 Ga0070690_100088857 3300005330 Bacteria 2032
30 Ga0070690_100270598 3300005330 Unclassified 1208
31 Ga0070670_100157967 3300005331 Bacteria 1964
32 Ga0068869_100204833 3300005334 Bacteria 1557
33 Ga0070680_100002541 3300005336 Bacteria 13513
34 Ga0070680_100009498 3300005336 Bacteria 7471
35 Ga0070680_100028541 3300005336 Bacteria 4476
36 Ga0070680_100102740 3300005336 Unclassified 2374
37 Ga0070680_100153255 3300005336 Bacteria 1935
38 Ga0070682_100034421 3300005337 Bacteria 3085
39 Ga0070682_100184363 3300005337 Bacteria 1460
40 Ga0070682_100706053 3300005337 Bacteria 809
41 Ga0068868_100003848 3300005338 Bacteria 10479
42 Ga0068868_100032081 3300005338 Bacteria 4039
43 Ga0068868_100069856 3300005338 Bacteria 2799
44 Ga0068868_100201825 3300005338 Bacteria 1658
45 Ga0068868_100209432 3300005338 Bacteria 1629
46 Ga0068868_100216010 3300005338 Unclassified 1604
47 Ga0068868_100331813 3300005338 Bacteria 1298
48 Ga0070660_100020713 3300005339 Bacteria 4839
49 Ga0070660_100021187 3300005339 Bacteria 4789
50 Ga0070660_100028747 3300005339 Bacteria 4161
51 Ga0070660_100061666 3300005339 Bacteria 2912
52 Ga0070660_100069446 3300005339 Bacteria 2747
53 Ga0070660_100170770 3300005339 Unclassified 1756
54 Ga0070660_100304083 3300005339 Unclassified 1308
55 Ga0070660_100492292 3300005339 Bacteria 1020
56 Ga0070660_100708345 3300005339 Unclassified 844
57 Ga0070689_100144015 3300005340 Bacteria 1918
58 Ga0070689_100171973 3300005340 Bacteria 1756
59 Ga0070691_10012043 3300005341 Bacteria 3961
60 Ga0070691_10027910 3300005341 Bacteria 2635
61 Ga0070691_10036689 3300005341 Unclassified 2311
62 Ga0070691_10055161 3300005341 Bacteria 1903
63 Ga0070691_10062379 3300005341 Bacteria 1795
64 Ga0070691_10115322 3300005341 Bacteria 1347
65 Ga0070687_100174815 3300005343 Bacteria 1281
66 Ga0070687_100274124 3300005343 Unclassified 1059
67 Ga0070661_100004700 3300005344 Bacteria 9401
68 Ga0070661_100023208 3300005344 Bacteria 4446
69 Ga0070661_100232620 3300005344 Unclassified 1417
70 Ga0070661_100331309 3300005344 Bacteria 1191
71 Ga0070692_10033039 3300005345 Bacteria 2606
72 Ga0070692_10116939 3300005345 Bacteria 1482
73 Ga0070692_10172115 3300005345 Bacteria 1249
74 Ga0070668_100083359 3300005347 Bacteria 2510
75 Ga0070668_100279244 3300005347 Bacteria 1394
76 Ga0070668_100768373 3300005347 Bacteria 854
77 Ga0070669_100336186 3300005353 Bacteria 1223
78 Ga0070669_100465189 3300005353 Bacteria 1044
79 Ga0070669_100494332 3300005353 Bacteria 1014
80 Ga0070675_100071386 3300005354 Bacteria 2880
81 Ga0070675_100109541 3300005354 Bacteria 2334
82 Ga0070675_100170591 3300005354 Bacteria 1876
83 Ga0070675_100498397 3300005354 Bacteria 1097
84 Ga0070671_100095942 3300005355 Bacteria 2486
85 Ga0070674_100016490 3300005356 Bacteria 4631
86 Ga0070674_100531278 3300005356 Bacteria 984
87 Ga0070674_100676771 3300005356 Unclassified 880
88 Ga0070673_100196582 3300005364 Unclassified 1735
89 Ga0070673_100347056 3300005364 Bacteria 1316
90 Ga0070673_100875978 3300005364 Unclassified 832
91 Ga0070688_100024769 3300005365 Bacteria 3545
92 Ga0070688_100295678 3300005365 Unclassified 1169
93 Ga0070688_100598222 3300005365 Bacteria 844
94 Ga0070659_100045715 3300005366 Bacteria 3430
95 Ga0070659_100087179 3300005366 Bacteria 2499
96 Ga0070659_100161095 3300005366 Bacteria 1834
97 Ga0070659_100193695 3300005366 Bacteria 1671
98 Ga0070659_100872868 3300005366 Bacteria 785
99 Ga0070667_100364057 3300005367 Unclassified 1311
100 Ga0070667_100422074 3300005367 Unclassified 1216
101 Ga0070703_10025637 3300005406 Bacteria 1750
102 Ga0070703_10083596 3300005406 Unclassified 1093
103 Ga0070703_10170106 3300005406 Bacteria 834
104 Ga0070709_10022042 3300005434 Bacteria 3720
105 Ga0070709_10165012 3300005434 Bacteria 1543
106 Ga0070709_10232984 3300005434 Bacteria 1318
107 Ga0070714_100063739 3300005435 Bacteria 3170
108 Ga0070714_100331395 3300005435 Unclassified 1425
109 Ga0070714_100350969 3300005435 Unclassified 1385
110 Ga0070714_100459419 3300005435 Bacteria 1210
111 Ga0070714_100502371 3300005435 Bacteria 1156
112 Ga0070714_100728255 3300005435 Unclassified 958
113 Ga0070713_100119093 3300005436 Bacteria 2313
114 Ga0070713_100165283 3300005436 Bacteria 1978
115 Ga0070713_100206275 3300005436 Bacteria 1777
116 Ga0070713_100309315 3300005436 Bacteria 1457
117 Ga0070710_10015751 3300005437 Bacteria 3833
118 Ga0070710_10030911 3300005437 Bacteria 2885
119 Ga0070710_10104026 3300005437 Bacteria 1695
120 Ga0070710_10127905 3300005437 Bacteria 1545
121 Ga0070710_10138852 3300005437 Bacteria 1488
122 Ga0070710_10159486 3300005437 Bacteria 1398
123 Ga0070701_10019951 3300005438 Bacteria 3174
124 Ga0070711_100008457 3300005439 Bacteria 6304
125 Ga0070711_100112918 3300005439 Unclassified 1997
126 Ga0070711_100227241 3300005439 Bacteria 1454
127 Ga0070711_100267015 3300005439 Bacteria 1349
128 Ga0070711_100268385 3300005439 Bacteria 1345
129 Ga0070711_100288840 3300005439 Bacteria 1300
130 Ga0070711_100364979 3300005439 Bacteria 1164
131 Ga0070711_100872791 3300005439 Unclassified 766
132 Ga0070705_100043529 3300005440 Bacteria 2573
133 Ga0070705_100144776 3300005440 Bacteria 1569
134 Ga0070705_100172054 3300005440 Bacteria 1459
135 Ga0070700_100021601 3300005441 Bacteria 3743
136 Ga0070700_100024887 3300005441 Bacteria 3519
137 Ga0070700_100076154 3300005441 Bacteria 2154
138 Ga0070708_100079811 3300005445 Unclassified 2961
139 Ga0070708_100182465 3300005445 Unclassified 1962
140 Ga0070663_100016045 3300005455 Bacteria 4851
141 Ga0070663_100146310 3300005455 Bacteria 1808
142 Ga0070678_100027606 3300005456 Bacteria 3856
143 Ga0070678_100050291 3300005456 Bacteria 3014
144 Ga0070678_100060215 3300005456 Bacteria 2794
145 Ga0070678_100233777 3300005456 Unclassified 1534
146 Ga0070678_100361151 3300005456 Unclassified 1251
147 Ga0070678_100679166 3300005456 Bacteria 926
148 Ga0070662_100008424 3300005457 Bacteria 6721
149 Ga0070662_100012945 3300005457 Bacteria 5542
150 Ga0070662_100017331 3300005457 Bacteria 4855
151 Ga0070662_100075742 3300005457 Bacteria 2492
152 Ga0070662_100085365 3300005457 Bacteria 2359
153 Ga0070662_100163894 3300005457 Bacteria 1740
154 Ga0070662_100287694 3300005457 Bacteria 1331
155 Ga0070681_10119186 3300005458 Bacteria 2575
156 Ga0070681_10134193 3300005458 Bacteria 2406
157 Ga0070681_10210522 3300005458 Bacteria 1860
158 Ga0070681_10239381 3300005458 Bacteria 1729
159 Ga0070681_10249201 3300005458 Bacteria 1689
160 Ga0070681_10251959 3300005458 Bacteria 1678
161 Ga0070681_10255215 3300005458 Bacteria 1665
162 Ga0070681_10354962 3300005458 Unclassified 1376
163 Ga0070681_10856258 3300005458 Bacteria 827
164 Ga0068867_100143956 3300005459 Bacteria 1866
165 Ga0068867_100218258 3300005459 Unclassified 1535
166 Ga0068867_100272799 3300005459 Bacteria 1384
167 Ga0068867_100397474 3300005459 Bacteria 1161
168 Ga0070685_10002654 3300005466 Bacteria 9156
169 Ga0070706_100546300 3300005467 Bacteria 1078
170 Ga0070698_100094671 3300005471 Bacteria 2965
171 Ga0070698_100111746 3300005471 Bacteria 2697
172 Ga0070699_100174458 3300005518 Bacteria 1906
173 Ga0070699_100375126 3300005518 Bacteria 1284
174 Ga0070679_100024215 3300005530 Bacteria 5949
175 Ga0070679_100057985 3300005530 Bacteria 3859
176 Ga0070679_100065683 3300005530 Bacteria 3616
177 Ga0070679_100098066 3300005530 Bacteria 2918
178 Ga0070679_100101126 3300005530 Bacteria 2869
179 Ga0070679_100117794 3300005530 Unclassified 2641
180 Ga0070679_100121250 3300005530 Bacteria 2599
181 Ga0070679_100178561 3300005530 Bacteria 2096
182 Ga0070679_100417212 3300005530 Bacteria 1288
183 Ga0070679_101016986 3300005530 Bacteria 773
184 Ga0070684_100002987 3300005535 Bacteria 12586
185 Ga0070684_100009104 3300005535 Bacteria 7807
186 Ga0070684_100027885 3300005535 Bacteria 4771
187 Ga0070684_100044620 3300005535 Bacteria 3835
188 Ga0070684_100068948 3300005535 Bacteria 3109
189 Ga0070684_100139286 3300005535 Bacteria 2193
190 Ga0070684_100183625 3300005535 Bacteria 1902
191 Ga0070684_100408185 3300005535 Bacteria 1253
192 Ga0070684_101015564 3300005535 Bacteria 778
193 Ga0070697_100193331 3300005536 Unclassified 1727
194 Ga0070697_100568857 3300005536 Bacteria 995
195 Ga0068853_100049482 3300005539 Bacteria 3612
196 Ga0068853_100116267 3300005539 Bacteria 2381
197 Ga0068853_100120714 3300005539 Bacteria 2338
198 Ga0070672_100011745 3300005543 Bacteria 6118
199 Ga0070672_100060037 3300005543 Bacteria 2993
200 Ga0070672_100426213 3300005543 Bacteria 1140
201 Ga0070672_100571787 3300005543 Unclassified 983
202 Ga0070686_100137369 3300005544 Bacteria 1697
203 Ga0070695_100108789 3300005545 Bacteria 1878
204 Ga0070695_100409955 3300005545 Bacteria 1029
205 Ga0070695_100446471 3300005545 Unclassified 990
206 Ga0070695_100606213 3300005545 Unclassified 860
207 Ga0070696_100040272 3300005546 Bacteria 3226
208 Ga0070696_100079217 3300005546 Bacteria 2324
209 Ga0070696_100083269 3300005546 Bacteria 2269
210 Ga0070696_100113132 3300005546 Unclassified 1956
211 Ga0070696_100428952 3300005546 Bacteria 1039
212 Ga0070696_100476563 3300005546 Unclassified 989
213 Ga0070696_100544602 3300005546 Bacteria 929
214 Ga0070693_100086818 3300005547 Bacteria 1878
215 Ga0070693_100171768 3300005547 Bacteria 1389
216 Ga0070693_100229433 3300005547 Bacteria 1221
217 Ga0070665_100029536 3300005548 Bacteria 5518
218 Ga0070665_100333848 3300005548 Unclassified 1521
219 Ga0070704_100012513 3300005549 Bacteria 5240
220 Ga0070704_100062811 3300005549 Bacteria 2664
221 Ga0070704_100174982 3300005549 Bacteria 1711
222 Ga0068855_100034827 3300005563 Bacteria 6001
223 Ga0068855_100049422 3300005563 Bacteria 4960
224 Ga0068855_100119279 3300005563 Bacteria 3020
225 Ga0068855_100141926 3300005563 Bacteria 2737
226 Ga0068855_100423551 3300005563 Bacteria 1456
227 Ga0068855_100611254 3300005563 Bacteria 1174
228 Ga0070664_100066762 3300005564 Bacteria 3072
229 Ga0070664_100097750 3300005564 Bacteria 2549
230 Ga0070664_100319902 3300005564 Unclassified 1405
231 Ga0070664_100330027 3300005564 Bacteria 1384
232 Ga0070664_100340571 3300005564 Bacteria 1362
233 Ga0070664_100380957 3300005564 Bacteria 1288
234 Ga0068857_100057361 3300005577 Bacteria 3456
235 Ga0068857_100151940 3300005577 Bacteria 2098
236 Ga0068857_100369428 3300005577 Bacteria 1331
237 Ga0068854_100025563 3300005578 Bacteria 4052
238 Ga0068854_100032416 3300005578 Bacteria 3636
239 Ga0068854_100142066 3300005578 Unclassified 1843
240 Ga0068854_100439273 3300005578 Bacteria 1087
241 Ga0068854_100718306 3300005578 Bacteria 864
242 Ga0068856_100028860 3300005614 Bacteria 5421
243 Ga0068856_100044326 3300005614 Bacteria 4377
244 Ga0068856_100048083 3300005614 Bacteria 4203
245 Ga0068856_100100137 3300005614 Unclassified 2890
246 Ga0068856_100321885 3300005614 Bacteria 1563
247 Ga0068856_100354084 3300005614 Bacteria 1487
248 Ga0068856_100509191 3300005614 Bacteria 1225
249 Ga0068856_100602665 3300005614 Bacteria 1119
250 Ga0070702_100019502 3300005615 Bacteria 3539
251 Ga0070702_100056733 3300005615 Bacteria 2263
252 Ga0070702_100084618 3300005615 Bacteria 1908
253 Ga0068852_100041973 3300005616 Bacteria 3870
254 Ga0068852_100059450 3300005616 Bacteria 3314
255 Ga0068852_100066951 3300005616 Bacteria 3139
256 Ga0068852_100125110 3300005616 Bacteria 2359
257 Ga0068852_100175018 3300005616 Bacteria 2014
258 Ga0068852_100206671 3300005616 Unclassified 1860
259 Ga0068852_100353191 3300005616 Bacteria 1436
260 Ga0068852_100491375 3300005616 Bacteria 1221
261 Ga0068852_101036633 3300005616 Bacteria 839
262 Ga0068852_101235524 3300005616 Bacteria 768
263 Ga0068859_100032440 3300005617 Bacteria 5247
264 Ga0068859_100062921 3300005617 Bacteria 3741
265 Ga0068864_100117114 3300005618 Unclassified 2378
266 Ga0068864_100190394 3300005618 Bacteria 1880
267 Ga0068864_100503780 3300005618 Unclassified 1165
268 Ga0068866_10151973 3300005718 Bacteria 1342
269 Ga0068866_10194716 3300005718 Bacteria 1207
270 Ga0068866_10562496 3300005718 Unclassified 764
271 Ga0068861_100026781 3300005719 Bacteria 4194
272 Ga0068861_100120258 3300005719 Bacteria 2118
273 Ga0068861_100218520 3300005719 Bacteria 1609
274 Ga0068861_100326594 3300005719 Unclassified 1338
275 Ga0068861_100461597 3300005719 Unclassified 1140
276 Ga0068861_100716167 3300005719 Bacteria 931
277 Ga0068861_100761201 3300005719 Bacteria 905
278 Ga0068851_10104975 3300005834 Bacteria 1503
279 Ga0068870_10236094 3300005840 Bacteria 1126
280 Ga0068870_10436727 3300005840 Bacteria 860
281 Ga0068863_100214327 3300005841 Bacteria 1855
282 Ga0068860_100069126 3300005843 Bacteria 3356
283 Ga0068860_100248898 3300005843 Bacteria 1730
284 Ga0068862_100390375 3300005844 Bacteria 1300
285 Ga0081455_10014065 3300005937 Bacteria 7866
286 Ga0081455_10017655 3300005937 Bacteria 6828
287 Ga0081455_10030402 3300005937 Bacteria 4905
288 Ga0081455_10063179 3300005937 Bacteria 3108
289 Ga0081455_10064752 3300005937 Bacteria 3059
290 Ga0081455_10091886 3300005937 Bacteria 2457
291 Ga0081455_10271962 3300005937 Unclassified 1228
292 Ga0081455_10323833 3300005937 Unclassified 1097
293 Ga0081455_10424305 3300005937 Bacteria 916
294 Ga0081538_10001352 3300005981 Bacteria 25238
295 Ga0081538_10001944 3300005981 Bacteria 20689
296 Ga0081538_10002644 3300005981 Bacteria 17290
297 Ga0081538_10044597 3300005981 Unclassified 2763
298 Ga0081538_10060840 3300005981 Bacteria 2168
299 Ga0081540_1002691 3300005983 Bacteria 14453
300 Ga0081540_1005407 3300005983 Bacteria 9535
301 Ga0081540_1024567 3300005983 Bacteria 3495
302 Ga0081539_10000888 3300005985 Bacteria 57168
303 Ga0070717_10011193 3300006028 Bacteria 6802
304 Ga0070717_10107798 3300006028 Bacteria 2373
305 Ga0070717_10295528 3300006028 Bacteria 1439
306 Ga0075365_10039156 3300006038 Bacteria 3085
307 Ga0075365_10118842 3300006038 Bacteria 1822
308 Ga0075365_10127154 3300006038 Bacteria 1761
309 Ga0075365_10165895 3300006038 Bacteria 1541
310 Ga0075364_10056676 3300006051 Bacteria 2566
311 Ga0075364_10406976 3300006051 Bacteria 928
312 Ga0075432_10007140 3300006058 Bacteria 3804
313 Ga0075432_10036196 3300006058 Bacteria 1716
314 Ga0075432_10081102 3300006058 Bacteria 1176
315 Ga0075432_10158191 3300006058 Bacteria 875
316 Ga0075432_10263775 3300006058 Unclassified 703
317 Ga0070715_10016227 3300006163 Bacteria 2794
318 Ga0070715_10034332 3300006163 Bacteria 2079
319 Ga0070716_100024186 3300006173 Bacteria 3230
320 Ga0070716_100265100 3300006173 Bacteria 1177
321 Ga0070716_100302279 3300006173 Bacteria 1113
322 Ga0070712_100004135 3300006175 Bacteria 8921
323 Ga0070712_100007311 3300006175 Bacteria 6893
324 Ga0070712_100008944 3300006175 Bacteria 6307
325 Ga0070712_100032793 3300006175 Bacteria 3510
326 Ga0070712_100075604 3300006175 Bacteria 2423
327 Ga0070712_100092967 3300006175 Unclassified 2213
328 Ga0070712_100101638 3300006175 Bacteria 2127
329 Ga0070712_100138284 3300006175 Bacteria 1855
330 Ga0070712_100168426 3300006175 Unclassified 1697
331 Ga0070712_100211899 3300006175 Bacteria 1528
332 Ga0070712_100312338 3300006175 Bacteria 1276
333 Ga0070712_100648718 3300006175 Unclassified 897
334 Ga0075367_10435812 3300006178 Bacteria 830
335 Ga0097621_100051449 3300006237 Bacteria 3353
336 Ga0097621_100059073 3300006237 Bacteria 3139
337 Ga0097621_100132876 3300006237 Bacteria 2120
338 Ga0068871_100111216 3300006358 Bacteria 2304
339 Ga0068871_100497011 3300006358 Unclassified 1099
340 Ga0068871_100540416 3300006358 Bacteria 1054
341 Ga0075428_100002462 3300006844 Bacteria 20093
342 Ga0075428_100006164 3300006844 Bacteria 13343
343 Ga0075428_100026974 3300006844 Bacteria 6362
344 Ga0075428_100049565 3300006844 Bacteria 4607
345 Ga0075430_100028108 3300006846 Bacteria 4777
346 Ga0075431_100049961 3300006847 Bacteria 4312
347 Ga0075431_100054729 3300006847 Bacteria 4115
348 Ga0075431_100640038 3300006847 Bacteria 1044
349 Ga0075433_10011114 3300006852 Bacteria 7241
350 Ga0075433_10022776 3300006852 Bacteria 5262
351 Ga0075433_10063154 3300006852 Bacteria 3245
352 Ga0075433_10074345 3300006852 Bacteria 2990
353 Ga0075433_10157851 3300006852 Bacteria 2018
354 Ga0075433_10181683 3300006852 Unclassified 1872
355 Ga0075433_10321726 3300006852 Bacteria 1368
356 Ga0075433_10635639 3300006852 Archaea 936
357 Ga0075434_100005449 3300006871 Bacteria 11591
358 Ga0075434_100009920 3300006871 Bacteria 8908
359 Ga0075434_100057027 3300006871 Bacteria 3882
360 Ga0075434_100286697 3300006871 Bacteria 1666
361 Ga0075434_100303356 3300006871 Bacteria 1617
362 Ga0075434_100423864 3300006871 Bacteria 1352
363 Ga0075429_100078431 3300006880 Bacteria 2879
364 Ga0075429_100190995 3300006880 Bacteria 1794
365 Ga0075429_100339485 3300006880 Bacteria 1315
366 Ga0075429_100339501 3300006880 Bacteria 1315
367 Ga0068865_100005364 3300006881 Bacteria 7766
368 Ga0068865_100060652 3300006881 Bacteria 2649
369 Ga0068865_100152386 3300006881 Bacteria 1755
370 Ga0068865_100164694 3300006881 Bacteria 1694
371 Ga0068865_100295826 3300006881 Bacteria 1294
372 Ga0075436_100006590 3300006914 Bacteria 7957
373 Ga0075436_100068838 3300006914 Bacteria 2445
374 Ga0075436_100082955 3300006914 Bacteria 2224
375 Ga0075436_100131321 3300006914 Bacteria 1756
376 Ga0075436_100361270 3300006914 Unclassified 1048
377 Ga0097620_100032440 3300006931 Bacteria 5247
378 Ga0097620_100062921 3300006931 Bacteria 3741
379 Ga0075435_100003169 3300007076 Bacteria 11122
380 Ga0075435_100007721 3300007076 Bacteria 7689
381 Ga0075435_100008977 3300007076 Bacteria 7208
382 Ga0075435_100016108 3300007076 Bacteria 5632
383 Ga0075435_100016746 3300007076 Bacteria 5530
384 Ga0075435_100180006 3300007076 Bacteria 1786
385 Ga0075435_100239974 3300007076 Bacteria 1541
386 Ga0075435_100585655 3300007076 Unclassified 967
387 Ga0075435_100585896 3300007076 Unclassified 967
388 Ga0105244_10168129 3300009036 Bacteria 1044
389 Ga0105240_10044774 3300009093 Bacteria 5619
390 Ga0105240_10045214 3300009093 Bacteria 5588
391 Ga0105240_10114108 3300009093 Bacteria 3264
392 Ga0105240_10271865 3300009093 Unclassified 1951
393 Ga0111539_10047436 3300009094 Bacteria 5133
394 Ga0111539_10061220 3300009094 Bacteria 4460
395 Ga0111539_10138710 3300009094 Bacteria 2848
396 Ga0111539_10329014 3300009094 Bacteria 1779
397 Ga0111539_10496540 3300009094 Bacteria 1421
398 Ga0111539_10634155 3300009094 Bacteria 1244
399 Ga0111539_11003456 3300009094 Unclassified 970
400 Ga0105245_10023009 3300009098 Bacteria 5467
401 Ga0105245_10027905 3300009098 Unclassified 4975
402 Ga0105245_10036938 3300009098 Bacteria 4341
403 Ga0105245_10044229 3300009098 Bacteria 3974
404 Ga0105245_10066760 3300009098 Bacteria 3256
405 Ga0105245_10079060 3300009098 Bacteria 3002
406 Ga0105245_10121540 3300009098 Unclassified 2440
407 Ga0105245_10150671 3300009098 Bacteria 2199
408 Ga0105245_10209966 3300009098 Bacteria 1873
409 Ga0105245_10700389 3300009098 Bacteria 1046
410 Ga0105247_10043907 3300009101 Bacteria 2740
411 Ga0105247_10354144 3300009101 Unclassified 1033
412 Ga0114129_10006249 3300009147 Bacteria 16888
413 Ga0114129_10125698 3300009147 Bacteria 3526
414 Ga0114129_10178475 3300009147 Bacteria 2891
415 Ga0114129_10191791 3300009147 Bacteria 2774
416 Ga0114129_10621807 3300009147 Bacteria 1397
417 Ga0114129_11425016 3300009147 Unclassified 854
418 Ga0105243_10006847 3300009148 Bacteria 8789
419 Ga0105243_10039621 3300009148 Bacteria 3675
420 Ga0105243_10123101 3300009148 Bacteria 2190
421 Ga0105243_10272538 3300009148 Unclassified 1520
422 Ga0105243_10359193 3300009148 Unclassified 1340
423 Ga0105243_10394915 3300009148 Unclassified 1283
424 Ga0105243_10474224 3300009148 Bacteria 1179
425 Ga0105243_10504366 3300009148 Archaea 1147
426 Ga0105243_10869198 3300009148 Unclassified 894
427 Ga0105241_10113301 3300009174 Bacteria 2174
428 Ga0105241_10241149 3300009174 Bacteria 1528
429 Ga0105241_10381692 3300009174 Bacteria 1231
430 Ga0105241_10574183 3300009174 Bacteria 1015
431 Ga0105242_10035231 3300009176 Bacteria 4014
432 Ga0105242_10040577 3300009176 Bacteria 3751
433 Ga0105242_10115023 3300009176 Bacteria 2299
434 Ga0105242_10344748 3300009176 Bacteria 1374
435 Ga0105242_10361371 3300009176 Bacteria 1344
436 Ga0105242_11128544 3300009176 Bacteria 799
437 Ga0105248_10135315 3300009177 Bacteria 2780
438 Ga0105248_10161467 3300009177 Unclassified 2527
439 Ga0105248_10327251 3300009177 Bacteria 1726
440 Ga0105248_10476501 3300009177 Bacteria 1407
441 Ga0105248_10753111 3300009177 Bacteria 1099
442 Ga0105248_10970448 3300009177 Bacteria 960
443 Ga0105248_11138158 3300009177 Bacteria 882
444 Ga0105237_10062071 3300009545 Bacteria 3736
445 Ga0105237_10195336 3300009545 Unclassified 2023
446 Ga0105237_10686176 3300009545 Unclassified 1031
447 Ga0105238_10008375 3300009551 Bacteria 10347
448 Ga0105238_10029321 3300009551 Bacteria 5606
449 Ga0105238_10063360 3300009551 Bacteria 3697
450 Ga0105238_10078628 3300009551 Bacteria 3289
451 Ga0105238_10234795 3300009551 Bacteria 1811
452 Ga0105238_10297729 3300009551 Bacteria 1596
453 Ga0105249_10034809 3300009553 Bacteria 4565
454 Ga0105249_10061851 3300009553 Unclassified 3436
455 Ga0105249_10257516 3300009553 Bacteria 1732
456 Ga0105249_10258319 3300009553 Bacteria 1730
457 Ga0105249_10285600 3300009553 Bacteria 1650
458 Ga0105249_11129483 3300009553 Unclassified 854
459 Ga0105239_10021548 3300010375 Bacteria 7106
460 Ga0105239_10033183 3300010375 Bacteria 5670
461 Ga0105239_10124023 3300010375 Bacteria 2870
462 Ga0105239_10138331 3300010375 Bacteria 2712
463 Ga0105239_10195424 3300010375 Bacteria 2265
464 Ga0105239_10198370 3300010375 Bacteria 2248
465 Ga0105239_10218459 3300010375 Bacteria 2137
466 Ga0105239_10219189 3300010375 Bacteria 2134
467 Ga0105239_10261916 3300010375 Bacteria 1943
468 Ga0105239_10267794 3300010375 Bacteria 1921
469 Ga0105239_10323754 3300010375 Unclassified 1738
470 Ga0105239_10471539 3300010375 Bacteria 1425
471 Ga0105239_10815482 3300010375 Bacteria 1069
472 Ga0105246_10003029 3300011119 Bacteria 10191
473 Ga0105246_10040204 3300011119 Bacteria 3155
474 Ga0105246_10050220 3300011119 Bacteria 2860
475 Ga0105246_10184501 3300011119 Bacteria 1609
476 Ga0105246_10417380 3300011119 Unclassified 1119
477 Ga0105246_10475029 3300011119 Bacteria 1056
478 Ga0105246_10816008 3300011119 Bacteria 829
479 Ga0157373_10042382 3300013100 Bacteria 3253
480 Ga0157373_10199124 3300013100 Bacteria 1412
481 Ga0157371_10008246 3300013102 Bacteria 8328
482 Ga0157371_10075482 3300013102 Bacteria 2387
483 Ga0157371_10292949 3300013102 Bacteria 1177
484 Ga0157370_10046230 3300013104 Bacteria 4174
485 Ga0157370_10104911 3300013104 Bacteria 2646
486 Ga0157370_10113885 3300013104 Unclassified 2527
487 Ga0157370_10161676 3300013104 Bacteria 2083
488 Ga0157369_10004625 3300013105 Bacteria 16173
489 Ga0157369_10021973 3300013105 Bacteria 7130
490 Ga0157369_10026569 3300013105 Bacteria 6420
491 Ga0157369_10129622 3300013105 Bacteria 2673
492 Ga0157369_10147727 3300013105 Bacteria 2485
493 Ga0157369_10196375 3300013105 Bacteria 2119
494 Ga0157369_10725844 3300013105 Unclassified 1023
495 Ga0157369_10991725 3300013105 Bacteria 860
496 Ga0157374_10060738 3300013296 Bacteria 3538
497 Ga0157374_10248853 3300013296 Bacteria 1749
498 Ga0157374_10265945 3300013296 Bacteria 1690
499 Ga0157374_10788798 3300013296 Bacteria 965
500 Ga0157378_10129250 3300013297 Unclassified 2336
501 Ga0157378_10242951 3300013297 Unclassified 1721
502 Ga0157378_10267958 3300013297 Bacteria 1641
503 Ga0157378_10394621 3300013297 Bacteria 1362
504 Ga0157378_10522424 3300013297 Bacteria 1189
505 Ga0163162_10018602 3300013306 Bacteria 6807
506 Ga0163162_10022756 3300013306 Bacteria 6179
507 Ga0163162_10035011 3300013306 Bacteria 4999
508 Ga0163162_10046153 3300013306 Bacteria 4367
509 Ga0163162_10099389 3300013306 Bacteria 3000
510 Ga0163162_10228040 3300013306 Bacteria 1993
511 Ga0163162_10620489 3300013306 Viruses 1206
512 Ga0157372_10006343 3300013307 Bacteria 12582
513 Ga0157372_10023387 3300013307 Bacteria 6698
514 Ga0157372_10055119 3300013307 Bacteria 4438
515 Ga0157372_10064467 3300013307 Bacteria 4111
516 Ga0157372_10131746 3300013307 Bacteria 2877
517 Ga0157372_10177549 3300013307 Bacteria 2465
518 Ga0157372_10191967 3300013307 Bacteria 2365
519 Ga0157372_10206599 3300013307 Unclassified 2275
520 Ga0157372_10270410 3300013307 Bacteria 1975
521 Ga0157372_10727179 3300013307 Bacteria 1154
522 Ga0157372_10877217 3300013307 Unclassified 1041
523 Ga0157372_10898117 3300013307 Bacteria 1028
524 Ga0157375_10017225 3300013308 Bacteria 6515
525 Ga0157375_10041947 3300013308 Bacteria 4424
526 Ga0157375_10148964 3300013308 Bacteria 2474
527 Ga0157375_10185272 3300013308 Unclassified 2235
528 Ga0157375_10253549 3300013308 Bacteria 1921
529 Ga0157375_10409981 3300013308 Bacteria 1521
530 Ga0157375_10897336 3300013308 Viruses 1030
531 Ga0157375_10947283 3300013308 Bacteria 1003
532 Ga0157375_11044291 3300013308 Bacteria 955
533 Ga0157375_11087690 3300013308 Bacteria 936
534 Ga0163163_10043357 3300014325 Bacteria 4410
535 Ga0163163_10059175 3300014325 Bacteria 3789
536 Ga0163163_10090522 3300014325 Bacteria 3072
537 Ga0163163_10263426 3300014325 Bacteria 1775
538 Ga0157380_10019074 3300014326 Bacteria 5106
539 Ga0157380_10101333 3300014326 Bacteria 2399
540 Ga0157380_10113798 3300014326 Bacteria 2279
541 Ga0157380_11084390 3300014326 Bacteria 839
542 Ga0182008_10032298 3300014497 Bacteria 2631
543 Ga0157377_10086028 3300014745 Bacteria 1847
544 Ga0157377_10112053 3300014745 Bacteria 1641
545 Ga0157377_10118896 3300014745 Unclassified 1599
546 Ga0157377_10675811 3300014745 Bacteria 746
547 Ga0157379_10193381 3300014968 Bacteria 1839
548 Ga0157376_10036355 3300014969 Unclassified 3990
549 Ga0157376_10079541 3300014969 Bacteria 2810
550 Ga0157376_10079568 3300014969 Bacteria 2810
551 Ga0157376_10149889 3300014969 Bacteria 2102
552 Ga0157376_10205176 3300014969 Bacteria 1816
553 Ga0157376_10222577 3300014969 Bacteria 1749
554 Ga0163161_10014703 3300017792 Bacteria 5451
555 Ga0163161_10110429 3300017792 Unclassified 2055
556 Ga0163161_10647234 3300017792 Bacteria 875
557 Ga0197907_10107874 3300020069 Unclassified 1797
558 Ga0197907_10487754 3300020069 Bacteria 2401
559 Ga0197907_10805701 3300020069 Bacteria 1526
560 Ga0197907_11270642 3300020069 Unclassified 1144
561 Ga0206356_10067745 3300020070 Bacteria 770
562 Ga0206356_10097950 3300020070 Bacteria 1346
563 Ga0206356_10171147 3300020070 Bacteria 1212
564 Ga0206356_10264527 3300020070 Unclassified 1297
565 Ga0206356_10570442 3300020070 Unclassified 2195
566 Ga0206356_10612509 3300020070 Bacteria 1085
567 Ga0206356_11872195 3300020070 Bacteria 895
568 Ga0206349_1478788 3300020075 Bacteria 2594
569 Ga0206349_1884143 3300020075 Bacteria 768
570 Ga0206351_10455175 3300020077 Bacteria 812
571 Ga0206352_11114125 3300020078 Bacteria 2034
572 Ga0206350_10825078 3300020080 Bacteria 2929
573 Ga0206354_10022075 3300020081 Bacteria 2214
574 Ga0206354_10431597 3300020081 Unclassified 2039
575 Ga0206354_10806399 3300020081 Bacteria 1443
576 Ga0206354_10808118 3300020081 Bacteria 908
577 Ga0206354_11620124 3300020081 Bacteria 2213
578 Ga0206353_10391836 3300020082 Unclassified 1644
579 Ga0206353_10658960 3300020082 Bacteria 1859
580 Ga0206353_11419015 3300020082 Bacteria 3146
581 Ga0206353_11715061 3300020082 Unclassified 1099
582 Ga0224712_10042100 3300022467 Bacteria 1729
583 Ga0224712_10119489 3300022467 Unclassified 1140
584 Ga0224712_10269491 3300022467 Bacteria 790
585 Ga0207656_10060160 3300025321 Unclassified 1664
586 Ga0207653_10040613 3300025885 Unclassified 1526
587 Ga0207653_10051409 3300025885 Bacteria 1372
588 Ga0207692_10017224 3300025898 Bacteria 3218
589 Ga0207692_10145206 3300025898 Unclassified 1353
590 Ga0207642_10041998 3300025899 Unclassified 2007
591 Ga0207642_10094797 3300025899 Bacteria 1484
592 Ga0207642_10111509 3300025899 Bacteria 1394
593 Ga0207642_10191989 3300025899 Bacteria 1121
594 Ga0207710_10037491 3300025900 Bacteria 2141
595 Ga0207710_10238893 3300025900 Unclassified 906
596 Ga0207688_10000576 3300025901 Bacteria 18035
597 Ga0207688_10002719 3300025901 Bacteria 9572
598 Ga0207688_10062897 3300025901 Bacteria 2093
599 Ga0207688_10076163 3300025901 Bacteria 1910
600 Ga0207688_10309558 3300025901 Bacteria 967
601 Ga0207647_10096916 3300025904 Bacteria 1754
602 Ga0207647_10100288 3300025904 Bacteria 1719
603 Ga0207685_10021761 3300025905 Bacteria 2155
604 Ga0207685_10160682 3300025905 Bacteria 1025
605 Ga0207685_10205544 3300025905 Unclassified 928
606 Ga0207685_10395120 3300025905 Unclassified 707
607 Ga0207699_10017149 3300025906 Bacteria 3804
608 Ga0207699_10067659 3300025906 Bacteria 2172
609 Ga0207699_10189788 3300025906 Bacteria 1386
610 Ga0207699_10570230 3300025906 Bacteria 822
611 Ga0207645_10024006 3300025907 Bacteria 3958
612 Ga0207645_10154103 3300025907 Bacteria 1501
613 Ga0207645_10278202 3300025907 Unclassified 1111
614 Ga0207643_10033073 3300025908 Bacteria 2893
615 Ga0207643_10105670 3300025908 Unclassified 1654
616 Ga0207705_10187867 3300025909 Bacteria 1561
617 Ga0207705_10229159 3300025909 Bacteria 1413
618 Ga0207705_10627994 3300025909 Bacteria 835
619 Ga0207705_10752019 3300025909 Unclassified 757
620 Ga0207654_10035768 3300025911 Bacteria 2769
621 Ga0207654_10420862 3300025911 Unclassified 932
622 Ga0207654_10456460 3300025911 Bacteria 897
623 Ga0207707_10097301 3300025912 Bacteria 2572
624 Ga0207707_10137608 3300025912 Bacteria 2135
625 Ga0207707_10141899 3300025912 Bacteria 2100
626 Ga0207707_10243644 3300025912 Bacteria 1562
627 Ga0207707_10277199 3300025912 Unclassified 1453
628 Ga0207707_10358546 3300025912 Bacteria 1256
629 Ga0207707_10630481 3300025912 Unclassified 905
630 Ga0207695_10024968 3300025913 Bacteria 6706
631 Ga0207695_10390970 3300025913 Bacteria 1276
632 Ga0207671_10241174 3300025914 Unclassified 1420
633 Ga0207671_10247315 3300025914 Bacteria 1402
634 Ga0207671_10554836 3300025914 Unclassified 916
635 Ga0207693_10008180 3300025915 Bacteria 8569
636 Ga0207693_10012583 3300025915 Bacteria 6835
637 Ga0207693_10016960 3300025915 Bacteria 5817
638 Ga0207693_10017316 3300025915 Bacteria 5747
639 Ga0207693_10032082 3300025915 Bacteria 4147
640 Ga0207693_10053613 3300025915 Bacteria 3164
641 Ga0207693_10064051 3300025915 Bacteria 2880
642 Ga0207693_10069882 3300025915 Bacteria 2748
643 Ga0207693_10073799 3300025915 Bacteria 2671
644 Ga0207693_10079885 3300025915 Bacteria 2560
645 Ga0207693_10080820 3300025915 Bacteria 2544
646 Ga0207663_10016349 3300025916 Bacteria 4112
647 Ga0207663_10017385 3300025916 Bacteria 4006
648 Ga0207663_10033480 3300025916 Bacteria 3062
649 Ga0207663_10052872 3300025916 Unclassified 2535
650 Ga0207663_10055380 3300025916 Bacteria 2488
651 Ga0207663_10176500 3300025916 Bacteria 1522
652 Ga0207663_10196344 3300025916 Bacteria 1453
653 Ga0207663_10225185 3300025916 Bacteria 1367
654 Ga0207663_10226143 3300025916 Bacteria 1364
655 Ga0207660_10111595 3300025917 Bacteria 2058
656 Ga0207660_10281261 3300025917 Unclassified 1320
657 Ga0207660_10393594 3300025917 Bacteria 1115
658 Ga0207660_10398565 3300025917 Unclassified 1108
659 Ga0207660_10421434 3300025917 Unclassified 1077
660 Ga0207660_10452665 3300025917 Unclassified 1038
661 Ga0207662_10138917 3300025918 Unclassified 1537
662 Ga0207662_10159113 3300025918 Bacteria 1442
663 Ga0207662_10177250 3300025918 Archaea 1370
664 Ga0207657_10008583 3300025919 Bacteria 10350
665 Ga0207657_10009230 3300025919 Bacteria 9942
666 Ga0207657_10016295 3300025919 Bacteria 7172
667 Ga0207657_10021109 3300025919 Bacteria 6135
668 Ga0207657_10099966 3300025919 Bacteria 2409
669 Ga0207657_10161025 3300025919 Bacteria 1823
670 Ga0207657_10272647 3300025919 Unclassified 1345
671 Ga0207657_10353343 3300025919 Bacteria 1159
672 Ga0207657_10369915 3300025919 Unclassified 1129
673 Ga0207649_10164389 3300025920 Unclassified 1540
674 Ga0207649_10229103 3300025920 Bacteria 1328
675 Ga0207649_10237364 3300025920 Bacteria 1307
676 Ga0207649_10493745 3300025920 Bacteria 930
677 Ga0207649_10710407 3300025920 Bacteria 780
678 Ga0207649_10863701 3300025920 Bacteria 708
679 Ga0207652_10041627 3300025921 Bacteria 3906
680 Ga0207652_10043852 3300025921 Bacteria 3809
681 Ga0207652_10096545 3300025921 Bacteria 2604
682 Ga0207652_10181291 3300025921 Bacteria 1893
683 Ga0207652_10201690 3300025921 Unclassified 1790
684 Ga0207652_10209402 3300025921 Bacteria 1755
685 Ga0207652_10398170 3300025921 Bacteria 1242
686 Ga0207681_10191444 3300025923 Bacteria 1565
687 Ga0207681_10324206 3300025923 Unclassified 1226
688 Ga0207681_10438031 3300025923 Bacteria 1061
689 Ga0207694_10029479 3300025924 Bacteria 4188
690 Ga0207694_10117246 3300025924 Bacteria 2123
691 Ga0207694_10164544 3300025924 Unclassified 1793
692 Ga0207694_10407488 3300025924 Bacteria 1131
693 Ga0207650_10199701 3300025925 Unclassified 1601
694 Ga0207659_10292590 3300025926 Bacteria 1335
695 Ga0207659_10338888 3300025926 Bacteria 1245
696 Ga0207659_10742315 3300025926 Bacteria 842
697 Ga0207687_10001941 3300025927 Bacteria 14224
698 Ga0207687_10011006 3300025927 Bacteria 5912
699 Ga0207687_10032121 3300025927 Bacteria 3553
700 Ga0207687_10047134 3300025927 Bacteria 2987
701 Ga0207687_10054720 3300025927 Bacteria 2793
702 Ga0207687_10063882 3300025927 Bacteria 2608
703 Ga0207687_10247444 3300025927 Bacteria 1416
704 Ga0207687_10250347 3300025927 Unclassified 1408
705 Ga0207687_10299026 3300025927 Viruses 1296
706 Ga0207687_10569005 3300025927 Bacteria 952
707 Ga0207687_10637087 3300025927 Unclassified 901
708 Ga0207700_10000001 3300025928 Bacteria 1122509
709 Ga0207700_10475324 3300025928 Bacteria 1104
710 Ga0207700_10620135 3300025928 Bacteria 963
711 Ga0207700_10674333 3300025928 Bacteria 922
712 Ga0207700_10690587 3300025928 Unclassified 911
713 Ga0207664_10005882 3300025929 Bacteria 8392
714 Ga0207664_10031936 3300025929 Bacteria 4033
715 Ga0207664_10163281 3300025929 Bacteria 1901
716 Ga0207664_10211966 3300025929 Bacteria 1676
717 Ga0207664_10335989 3300025929 Bacteria 1335
718 Ga0207664_10648295 3300025929 Bacteria 949
719 Ga0207664_10748073 3300025929 Unclassified 879
720 Ga0207664_10851313 3300025929 Bacteria 819
721 Ga0207644_10279142 3300025931 Bacteria 1341
722 Ga0207644_10337877 3300025931 Unclassified 1221
723 Ga0207644_10384764 3300025931 Bacteria 1145
724 Ga0207690_10165745 3300025932 Bacteria 1651
725 Ga0207690_10299356 3300025932 Unclassified 1258
726 Ga0207690_10342908 3300025932 Bacteria 1179
727 Ga0207690_10489908 3300025932 Bacteria 993
728 Ga0207706_10014884 3300025933 Bacteria 7045
729 Ga0207706_10026610 3300025933 Bacteria 5178
730 Ga0207706_10053169 3300025933 Bacteria 3575
731 Ga0207706_10056049 3300025933 Bacteria 3475
732 Ga0207706_10120338 3300025933 Bacteria 2308
733 Ga0207686_10055335 3300025934 Unclassified 2489
734 Ga0207686_10159024 3300025934 Bacteria 1581
735 Ga0207686_10209980 3300025934 Bacteria 1399
736 Ga0207686_10345725 3300025934 Bacteria 1118
737 Ga0207686_10927681 3300025934 Unclassified 704
738 Ga0207709_10046305 3300025935 Bacteria 2639
739 Ga0207709_10070402 3300025935 Bacteria 2218
740 Ga0207709_10081294 3300025935 Bacteria 2089
741 Ga0207709_10144464 3300025935 Bacteria 1639
742 Ga0207709_10162421 3300025935 Bacteria 1559
743 Ga0207709_10171171 3300025935 Bacteria 1524
744 Ga0207709_10598813 3300025935 Bacteria 872
745 Ga0207709_10687388 3300025935 Unclassified 818
746 Ga0207670_10237062 3300025936 Bacteria 1404
747 Ga0207669_10117922 3300025937 Bacteria 1795
748 Ga0207669_10178613 3300025937 Bacteria 1519
749 Ga0207704_10042563 3300025938 Bacteria 2675
750 Ga0207704_10135136 3300025938 Bacteria 1715
751 Ga0207704_10154027 3300025938 Bacteria 1626
752 Ga0207704_10359639 3300025938 Unclassified 1136
753 Ga0207704_10643863 3300025938 Unclassified 872
754 Ga0207665_10003372 3300025939 Bacteria 10696
755 Ga0207665_10014891 3300025939 Bacteria 5111
756 Ga0207665_10027262 3300025939 Bacteria 3775
757 Ga0207665_10065816 3300025939 Bacteria 2465
758 Ga0207665_10134050 3300025939 Bacteria 1761
759 Ga0207691_10018191 3300025940 Bacteria 6657
760 Ga0207691_10481773 3300025940 Bacteria 1054
761 Ga0207711_10096112 3300025941 Bacteria 2614
762 Ga0207711_10175360 3300025941 Bacteria 1947
763 Ga0207711_10206244 3300025941 Bacteria 1795
764 Ga0207711_10421019 3300025941 Bacteria 1242
765 Ga0207711_10603468 3300025941 Bacteria 1024
766 Ga0207689_10071536 3300025942 Bacteria 2849
767 Ga0207689_10079779 3300025942 Bacteria 2690
768 Ga0207661_10002762 3300025944 Bacteria 12091
769 Ga0207661_10062252 3300025944 Bacteria 3018
770 Ga0207661_10083440 3300025944 Bacteria 2644
771 Ga0207661_10145258 3300025944 Unclassified 2046
772 Ga0207661_10225098 3300025944 Bacteria 1659
773 Ga0207661_10227083 3300025944 Bacteria 1652
774 Ga0207661_10321721 3300025944 Bacteria 1390
775 Ga0207661_10512927 3300025944 Bacteria 1096
776 Ga0207679_10122283 3300025945 Bacteria 2074
777 Ga0207679_10140319 3300025945 Bacteria 1952
778 Ga0207679_10220576 3300025945 Unclassified 1595
779 Ga0207679_10261620 3300025945 Bacteria 1476
780 Ga0207679_10262513 3300025945 Unclassified 1473
781 Ga0207679_10864951 3300025945 Bacteria 826
782 Ga0207667_10018802 3300025949 Bacteria 7737
783 Ga0207667_10035997 3300025949 Bacteria 5308
784 Ga0207667_10101370 3300025949 Bacteria 2970
785 Ga0207667_10136410 3300025949 Bacteria 2527
786 Ga0207667_10861754 3300025949 Bacteria 900
787 Ga0207712_10043069 3300025961 Bacteria 3112
788 Ga0207712_10073361 3300025961 Bacteria 2468
789 Ga0207712_10127552 3300025961 Bacteria 1934
790 Ga0207668_10121814 3300025972 Bacteria 1976
791 Ga0207668_10266913 3300025972 Bacteria 1397
792 Ga0207668_10429887 3300025972 Bacteria 1122
793 Ga0207668_10970339 3300025972 Unclassified 759
794 Ga0207640_10196601 3300025981 Bacteria 1524
795 Ga0207640_10366863 3300025981 Bacteria 1162
796 Ga0207658_10312966 3300025986 Bacteria 1357
797 Ga0207677_10032125 3300026023 Unclassified 3371
798 Ga0207677_10266283 3300026023 Unclassified 1399
799 Ga0207677_10322542 3300026023 Bacteria 1284
800 Ga0207677_10537715 3300026023 Bacteria 1016
801 Ga0207677_10572387 3300026023 Unclassified 987
802 Ga0207703_11140213 3300026035 Bacteria 749
803 Ga0207639_10041448 3300026041 Bacteria 3444
804 Ga0207639_10458011 3300026041 Bacteria 1159
805 Ga0207639_10826130 3300026041 Bacteria 864
806 Ga0207678_10004108 3300026067 Bacteria 13090
807 Ga0207678_10039819 3300026067 Bacteria 4077
808 Ga0207678_10237011 3300026067 Bacteria 1562
809 Ga0207678_10419968 3300026067 Bacteria 1160
810 Ga0207708_10003490 3300026075 Bacteria 11596
811 Ga0207708_10018401 3300026075 Bacteria 5261
812 Ga0207708_10020508 3300026075 Bacteria 4985
813 Ga0207702_10011413 3300026078 Bacteria 7406
814 Ga0207702_10314778 3300026078 Unclassified 1489
815 Ga0207702_10609487 3300026078 Bacteria 1072
816 Ga0207702_10688835 3300026078 Unclassified 1007
817 Ga0207702_10725804 3300026078 Bacteria 980
818 Ga0207702_10933307 3300026078 Bacteria 860
819 Ga0207702_11052661 3300026078 Bacteria 807
820 Ga0207641_10483437 3300026088 Bacteria 1200
821 Ga0207648_10013106 3300026089 Bacteria 7730
822 Ga0207648_10034985 3300026089 Bacteria 4428
823 Ga0207648_10046259 3300026089 Bacteria 3815
824 Ga0207648_10111797 3300026089 Bacteria 2398
825 Ga0207676_10142455 3300026095 Unclassified 2054
826 Ga0207676_10403186 3300026095 Bacteria 1278
827 Ga0207676_10602740 3300026095 Bacteria 1055
828 Ga0207676_10753919 3300026095 Bacteria 947
829 Ga0207674_10002797 3300026116 Bacteria 21726
830 Ga0207674_10003158 3300026116 Bacteria 20298
831 Ga0207674_10070528 3300026116 Bacteria 3513
832 Ga0207674_10148470 3300026116 Bacteria 2302
833 Ga0207674_10292968 3300026116 Bacteria 1576
834 Ga0207674_10796660 3300026116 Bacteria 912
835 Ga0207675_100014301 3300026118 Bacteria 7398
836 Ga0207675_100028238 3300026118 Bacteria 5224
837 Ga0207675_100028247 3300026118 Bacteria 5223
838 Ga0207675_100275851 3300026118 Unclassified 1633
839 Ga0207675_100276046 3300026118 Bacteria 1632
840 Ga0207675_100418102 3300026118 Bacteria 1324
841 Ga0207675_100703200 3300026118 Bacteria 1020
842 Ga0207683_10019866 3300026121 Bacteria 5740
843 Ga0207683_10025027 3300026121 Bacteria 5146
844 Ga0207683_10045184 3300026121 Bacteria 3851
845 Ga0207683_10046558 3300026121 Unclassified 3796
846 Ga0207683_10050227 3300026121 Bacteria 3653
847 Ga0207683_10073743 3300026121 Bacteria 3019
848 Ga0207698_10061364 3300026142 Bacteria 2929
849 Ga0207698_10109155 3300026142 Unclassified 2314
850 Ga0207698_10271867 3300026142 Bacteria 1563
851 Ga0207698_10278494 3300026142 Bacteria 1546
852 Ga0207698_10284055 3300026142 Unclassified 1532
853 Ga0207698_10590176 3300026142 Bacteria 1094
854 Ga0207698_10901387 3300026142 Bacteria 891
855 Ga0207698_10964069 3300026142 Bacteria 862
856 Ga0209996_1013331 3300027395 Bacteria 1110
857 Ga0209974_10031452 3300027876 Bacteria 1757
858 Ga0207428_10000961 3300027907 Bacteria 31972
859 Ga0207428_10001607 3300027907 Bacteria 23478
860 Ga0207428_10006497 3300027907 Bacteria 10790
861 Ga0207428_10029057 3300027907 Bacteria 4587
862 Ga0207428_10050377 3300027907 Bacteria 3332
863 Ga0207428_10186543 3300027907 Bacteria 1565
864 Ga0207428_10366783 3300027907 Unclassified 1058
865 Ga0268266_10145897 3300028379 Bacteria 2128
866 Ga0268266_10776320 3300028379 Bacteria 925
867 Ga0268265_10236389 3300028380 Bacteria 1609
868 Ga0268265_10459475 3300028380 Bacteria 1191
869 Ga0268265_10548326 3300028380 Bacteria 1097
870 Ga0268264_10223970 3300028381 Bacteria 1733
871 Ga0268264_11307906 3300028381 Unclassified 735
872 Ga0265338_10006932 3300028800 Bacteria 14255
873 Ga0265327_10003464 3300031251 Bacteria 15020
874 Ga0307408_100055125 3300031548 Bacteria 2877
875 Ga0307408_101015725 3300031548 Bacteria 765
876 Ga0307405_10034016 3300031731 Unclassified 3029
877 Ga0307413_10072009 3300031824 Unclassified 2180
878 Ga0307410_10413128 3300031852 Unclassified 1093
879 Ga0307406_10527070 3300031901 Unclassified 962
880 Ga0307412_10421648 3300031911 Bacteria 1092
881 Ga0307409_100222604 3300031995 Unclassified 1704
882 Ga0307409_100668260 3300031995 Unclassified 1035
883 Ga0307416_100027433 3300032002 Bacteria 4217
884 Ga0307416_100158165 3300032002 Bacteria 2090
885 Ga0307416_100937076 3300032002 Bacteria 967
886 Ga0307414_10657807 3300032004 Unclassified 945
887 Ga0307415_100101915 3300032126 Unclassified 2108
888 Ga0307415_100466596 3300032126 Bacteria 1095
889 Ga0373930_0019390 3300034816 Bacteria 1316
890 Ga0373948_0010741 3300034817 Bacteria 1604
891 Ga0373948_0047377 3300034817 Bacteria 915
892 Ga0373958_0038305 3300034819 Bacteria 970
893 Ga0373959_0024307 3300034820 Bacteria 1183
894 Ga0373959_0047639 3300034820 Bacteria 917
895 Ga0373938_0001710 3300034957 Bacteria 3509
896 Ga0373938_0040779 3300034957 Bacteria 1031
897 Ga0373926_0061506 3300035083 Bacteria 1370
898 Ga0373928_0003299 3300035084 Bacteria 3089
899 Ga0373928_0006972 3300035084 Bacteria 2178
900 Ga0373929_0007133 3300035085 Bacteria 2035
901 Ga0373940_0080041 3300035088 Bacteria 964
902 Ga0373944_0021946 3300035089 Bacteria 1852
903 Ga0373949_0007106 3300035090 Bacteria 2456
904 Ga0373949_0017025 3300035090 Bacteria 1635
905 Ga0373951_0015729 3300035091 Bacteria 1705
906 Ga0373952_0003220 3300035092 Bacteria 2940
907 Ga0373952_0019049 3300035092 Bacteria 1425
908 Ga0373932_0064366 3300035112 Bacteria 1122
909 Ga0373939_0008646 3300035114 Bacteria 2501
910 Ga0373939_0026767 3300035114 Bacteria 1628
911 Ga0373939_0044986 3300035114 Bacteria 1346
912 Ga0373941_0010231 3300035115 Bacteria 2389
913 Ga0373941_0034259 3300035115 Bacteria 1531
914 Ga0373945_0060922 3300035116 Unclassified 1408
915 Ga0373945_0095234 3300035116 Bacteria 1158
916 Ga0373957_0131858 3300035120 Unclassified 1018
917 Ga0373960_0002600 3300035121 Bacteria 4078
918 Ga0373960_0013535 3300035121 Bacteria 2049
919 Ga0373960_0026376 3300035121 Bacteria 1588
920 Ga0373943_0000446 3300035170 Bacteria 17509
921 Ga0373943_0003706 3300035170 Bacteria 6949
922 Ga0373943_0031704 3300035170 Bacteria 2509
923 Ga0373943_0051298 3300035170 Bacteria 2031
924 Ga0373943_0091074 3300035170 Unclassified 1579
925 Ga0373943_0133294 3300035170 Bacteria 1331
926 Ga0373946_0004785 3300035171 Bacteria 4872
927 Ga0373946_0005191 3300035171 Bacteria 4695
928 Ga0373942_0026511 3300035207 Bacteria 1501
929 Ga0373961_0013443 3300035241 Bacteria 2065
930 Ga0373961_0030492 3300035241 Bacteria 1500
931 Ga0373962_0003042 3300035242 Bacteria 4018
932 Ga0373924_0082499 3300035410 Bacteria 1369
933 Ga0373924_0295082 3300035410 Unclassified 720
934 Ga0373931_0018151 3300035691 Bacteria 3494
935 Ga0373931_0128582 3300035691 Bacteria 1455
936 Ga0373931_0142142 3300035691 Bacteria 1391
937 Ga0373931_0525117 3300035691 Bacteria 766
938 Ga0373935_0029195 3300035692 Bacteria 3413
939 Ga0373935_0041188 3300035692 Bacteria 2901
940 Ga0373935_0041505 3300035692 Bacteria 2890
941 Ga0373935_0172203 3300035692 Bacteria 1481
942 Ga0373927_0187623 3300035695 Bacteria 1356
943 Ga0373927_0236852 3300035695 Bacteria 1199
944 Ga0373927_0304819 3300035695 Bacteria 1048
945 Ga0373947_0000387 3300035725 Bacteria 24881
946 Ga0373947_0003076 3300035725 Bacteria 9935
947 Ga0373947_0004637 3300035725 Bacteria 8061
948 Ga0373947_0012427 3300035725 Bacteria 4879
949 Ga0373947_0124486 3300035725 Bacteria 1640
950 Ga0373947_0225748 3300035725 Bacteria 1232
951 Ga0373937_0085424 3300036401 Bacteria 2920
952 Ga0373937_0210250 3300036401 Bacteria 1830
953 Ga0373925_0002635 3300037068 Bacteria 14241
954 Ga0373925_0011235 3300037068 Bacteria 6494
955 Ga0373925_0015834 3300037068 Bacteria 5455
956 Ga0373925_0018474 3300037068 Bacteria 5068
957 Ga0373925_0470224 3300037068 Unclassified 1031
958 Ga0373925_0571140 3300037068 Bacteria 931
959 Ga0395899_0010199 3300037312 Bacteria 7199
960 Ga0395899_0026595 3300037312 Bacteria 4365
961 Ga0395899_0241795 3300037312 Unclassified 1242
962 Ga0395899_0313081 3300037312 Bacteria 1059
963 Ga0395900_0001765 3300037418 Bacteria 24834
964 Ga0395900_0024611 3300037418 Bacteria 6161
965 Ga0395900_0038851 3300037418 Bacteria 4906
966 Ga0395900_0065148 3300037418 Bacteria 3743
967 Ga0395900_0073283 3300037418 Bacteria 3521
968 Ga0395900_0094470 3300037418 Bacteria 3072
969 Ga0395900_0096260 3300037418 Bacteria 3041
970 Ga0395900_0129191 3300037418 Bacteria 2590
971 Ga0395900_0145096 3300037418 Bacteria 2427
972 Ga0395900_0165005 3300037418 Unclassified 2257
973 Ga0395900_0358822 3300037418 Unclassified 1429
974 Ga0395898_0020703 3300037466 Bacteria 6677
975 Ga0395898_0021612 3300037466 Bacteria 6522
976 Ga0395898_0040761 3300037466 Bacteria 4590
977 Ga0395898_0063732 3300037466 Unclassified 3576
978 Ga0395898_0112160 3300037466 Viruses 2613
979 Ga0395898_0129986 3300037466 Bacteria 2412
980 Ga0395898_0157867 3300037466 Bacteria 2169
981 Ga0395898_0190194 3300037466 Bacteria 1961
982 Ga0395898_0228586 3300037466 Unclassified 1774
983 Ga0395898_0293680 3300037466 Bacteria 1550
984 Ga0395898_0346623 3300037466 Bacteria 1416
985 Ga0395898_0457106 3300037466 Bacteria 1216
986 Ga0395898_0533152 3300037466 Unclassified 1116
987 Ga0395898_0812453 3300037466 Bacteria 875
988 Ga0395905_0002747 3300037471 Bacteria 19265
989 Ga0395905_0037931 3300037471 Bacteria 4522
990 Ga0395905_0039926 3300037471 Bacteria 4403
991 Ga0395905_0090396 3300037471 Bacteria 2870
992 Ga0395905_0145492 3300037471 Bacteria 2230
993 Ga0395905_0146059 3300037471 Unclassified 2225
994 Ga0395905_0188859 3300037471 Bacteria 1933
995 Ga0395905_0638865 3300037471 Bacteria 966
996 Ga0395905_0954241 3300037471 Bacteria 760
997 Ga0395901_0004202 3300038443 Bacteria 14516
998 Ga0395901_0033421 3300038443 Bacteria 5310
999 Ga0395901_0058456 3300038443 Bacteria 4010
1000 Ga0395901_0106519 3300038443 Viruses 2942
1001 Ga0395901_0128766 3300038443 Bacteria 2660
1002 Ga0395901_0144071 3300038443 Bacteria 2504
1003 Ga0395901_0176004 3300038443 Bacteria 2244
1004 Ga0395901_0209606 3300038443 Bacteria 2040
1005 Ga0395901_0220128 3300038443 Bacteria 1984
1006 Ga0395901_0316314 3300038443 Bacteria 1616
1007 Ga0395901_0560410 3300038443 Unclassified 1157
1008 Ga0395901_0743451 3300038443 Unclassified 974
1009 Ga0439438_060592 3300041405 Bacteria 948
1010 Ga0439461_0049123 3300041410 Bacteria 931
1011 Ga0451793_1843478 3300041452 Bacteria 1018
1012 Ga0451800_0491729 3300041459 Unclassified 740
1013 Ga0451802_1410741 3300041460 Unclassified 882
1014 Ga0451835_0095057 3300041492 Unclassified 943
1015 Ga0451841_0601019 3300041498 Unclassified 880
1016 Ga0451853_2781693 3300041512 Bacteria 8494
1017 Ga0439448_0064681 3300042005 Bacteria 1212
1018 Ga0439454_012833 3300042011 Bacteria 1142
1019 Ga0439455_0106311 3300042012 Bacteria 778
1020 Ga0439462_0106059 3300042015 Bacteria 776
1021 Ga0450912_007473 3300042116 Unclassified 888
1022 Ga0450906_012998 3300042145 Bacteria 1539
1023 Ga0450908_008473 3300042184 Bacteria 1926
1024 Ga0439435_0019544 3300042436 Bacteria 1738
1025 Ga0450916_020664 3300042530 Bacteria 901
1026 Ga0466961_0116983 3300044693 Bacteria 1675
1027 Ga0466963_0008227 3300044694 Bacteria 6250
1028 Ga0466963_0038413 3300044694 Bacteria 3130
1029 Ga0466963_0047675 3300044694 Unclassified 2829
1030 Ga0466963_0048740 3300044694 Unclassified 2800
1031 Ga0466964_0017660 3300044706 Bacteria 2732
1032 Ga0466968_0002483 3300044735 Bacteria 6779
1033 Ga0466957_0038787 3300044842 Bacteria 2871
1034 Ga0466960_0065768 3300044901 Bacteria 1791
1035 Ga0466959_0055049 3300045049 Bacteria 2905
1036 Ga0451576_0025840 3300045051 Bacteria 6325
1037 Ga0466958_0039270 3300045836 Unclassified 2843
1038 Ga0466967_0003096 3300045976 Bacteria 10692
1039 Ga0466967_0009282 3300045976 Bacteria 7289
1040 Ga0466967_0064789 3300045976 Bacteria 3251
1041 Ga0466967_0099229 3300045976 Bacteria 2660
1042 Ga0466967_0110372 3300045976 Bacteria 2526
1043 Ga0466967_0239583 3300045976 Bacteria 1730
1044 Ga0466967_0483065 3300045976 Bacteria 1214
1045 Ga0466967_0827802 3300045976 Bacteria 919
1046 Ga0466967_0872312 3300045976 Unclassified 895
1047 Ga0466967_1201627 3300045976 Bacteria 755
1048 Ga0495617_120635 3300046452 Bacteria 845
1049 Ga0495592_0187718 3300046454 Unclassified 1403
1050 Ga0495592_0261417 3300046454 Unclassified 1140
1051 Ga0495603_0000339 3300046455 Bacteria 25130
1052 Ga0495603_0010219 3300046455 Bacteria 5682
1053 Ga0495603_0048054 3300046455 Bacteria 2541
1054 Ga0495603_0139749 3300046455 Bacteria 1409
1055 Ga0495603_0263240 3300046455 Bacteria 992
1056 Ga0495603_0322226 3300046455 Unclassified 887
1057 Ga0495629_0000756 3300046459 Bacteria 26121
1058 Ga0495629_0105012 3300046459 Bacteria 1970
1059 Ga0495629_0133718 3300046459 Bacteria 1727
1060 Ga0495629_0176756 3300046459 Unclassified 1480
1061 Ga0495629_0185828 3300046459 Bacteria 1439
1062 Ga0495641_0000626 3300046461 Bacteria 29773
1063 Ga0495641_0009085 3300046461 Bacteria 5954
1064 Ga0495651_0052345 3300046462 Bacteria 3145
1065 Ga0495651_0194067 3300046462 Bacteria 1426
1066 Ga0495651_0238905 3300046462 Bacteria 1247
1067 Ga0495653_0009151 3300046463 Bacteria 8097
1068 Ga0495653_0034594 3300046463 Bacteria 3995
1069 Ga0495653_0084723 3300046463 Bacteria 2334
1070 Ga0495653_0090549 3300046463 Bacteria 2238
1071 Ga0495653_0356485 3300046463 Unclassified 939
1072 Ga0495653_0516025 3300046463 Bacteria 743
1073 Ga0495653_0543703 3300046463 Bacteria 719
1074 Ga0495580_0098927 3300046472 Bacteria 2029
1075 Ga0495580_0158110 3300046472 Bacteria 1569
1076 Ga0495580_0212312 3300046472 Bacteria 1331
1077 Ga0495580_0285844 3300046472 Bacteria 1125
1078 Ga0495582_0001691 3300046473 Bacteria 12453
1079 Ga0495582_0004256 3300046473 Bacteria 8049
1080 Ga0495582_0007425 3300046473 Bacteria 6070
1081 Ga0495582_0030194 3300046473 Bacteria 2974
1082 Ga0495582_0032842 3300046473 Bacteria 2852
1083 Ga0495639_0000390 3300046475 Bacteria 20704
1084 Ga0495639_0000932 3300046475 Bacteria 13207
1085 Ga0495639_0006417 3300046475 Bacteria 5060
1086 Ga0495639_0078952 3300046475 Unclassified 1530
1087 Ga0495662_0001935 3300046476 Bacteria 10397
1088 Ga0495662_0010854 3300046476 Bacteria 4455
1089 Ga0495662_0034980 3300046476 Bacteria 2424
1090 Ga0495664_0006141 3300046477 Bacteria 6632
1091 Ga0495664_0181767 3300046477 Bacteria 1275
1092 Ga0495594_0001020 3300046499 Bacteria 14595
1093 Ga0495594_0191687 3300046499 Unclassified 1165
1094 Ga0495607_0320033 3300046501 Unclassified 724
1095 Ga0495608_0031672 3300046511 Bacteria 3574
1096 Ga0495608_0035495 3300046511 Bacteria 3363
1097 Ga0495618_0015162 3300046514 Bacteria 4702
1098 Ga0495618_0067762 3300046514 Bacteria 2270
1099 Ga0495618_0126627 3300046514 Unclassified 1635
1100 Ga0495618_0144683 3300046514 Bacteria 1520
1101 Ga0495628_0547974 3300046516 Unclassified 831
1102 Ga0495630_0006174 3300046517 Bacteria 8496
1103 Ga0495630_0011353 3300046517 Bacteria 6447
1104 Ga0495630_0015527 3300046517 Bacteria 5561
1105 Ga0495630_0038463 3300046517 Bacteria 3578
1106 Ga0495630_0269249 3300046517 Bacteria 1301
1107 Ga0495630_0305056 3300046517 Bacteria 1217
1108 Ga0495630_0461030 3300046517 Bacteria 974
1109 Ga0495666_0002371 3300046526 Bacteria 9394
1110 Ga0495666_0068093 3300046526 Bacteria 1695
1111 Ga0495666_0074018 3300046526 Bacteria 1616
1112 Ga0495666_0081208 3300046526 Bacteria 1534
1113 Ga0495652_0125804 3300046529 Bacteria 2036
1114 Ga0495652_0129266 3300046529 Bacteria 2002
1115 Ga0495652_0243857 3300046529 Bacteria 1335
1116 Ga0495652_0312101 3300046529 Bacteria 1139
1117 Ga0495652_0417761 3300046529 Bacteria 946
1118 Ga0495665_0001013 3300046531 Bacteria 14856
1119 Ga0495665_0005059 3300046531 Bacteria 7108
1120 Ga0495665_0033964 3300046531 Bacteria 2727
1121 Ga0495640_0008914 3300046533 Bacteria 7833
1122 Ga0495640_0039874 3300046533 Bacteria 3292
1123 Ga0495640_0049800 3300046533 Bacteria 2887
1124 Ga0495640_0385773 3300046533 Unclassified 861
1125 Ga0495586_0265469 3300046535 Bacteria 980
1126 Ga0495587_0134726 3300046536 Bacteria 1411
1127 Ga0495587_0165161 3300046536 Bacteria 1259
1128 Ga0495645_0282942 3300046543 Unclassified 1090
1129 Ga0495622_0134656 3300046557 Bacteria 1124
1130 Ga0495667_0019358 3300046559 Bacteria 4593
1131 Ga0495667_0055301 3300046559 Bacteria 2610
1132 Ga0495667_0062901 3300046559 Bacteria 2431
1133 Ga0495667_0299529 3300046559 Unclassified 1019
1134 Ga0495668_0187250 3300046616 Bacteria 1134
1135 Ga0495634_0023836 3300046642 Bacteria 4299
1136 Ga0495634_0028213 3300046642 Bacteria 3898
1137 Ga0495634_0034230 3300046642 Bacteria 3487
1138 Ga0495634_0137783 3300046642 Bacteria 1552
1139 Ga0495634_0304611 3300046642 Unclassified 963
1140 Ga0495635_0022086 3300046663 Bacteria 4434
1141 Ga0495635_0023627 3300046663 Bacteria 4282
1142 Ga0495635_0052541 3300046663 Unclassified 2807
1143 Ga0495635_0116442 3300046663 Bacteria 1824
1144 Ga0495635_0159386 3300046663 Unclassified 1535
1145 Ga0495588_0000863 3300046674 Bacteria 13378
1146 Ga0495588_0044492 3300046674 Bacteria 2274
1147 Ga0495657_0015061 3300046675 Bacteria 5668
1148 Ga0495657_0048063 3300046675 Bacteria 2880
1149 Ga0495657_0096510 3300046675 Bacteria 1889
1150 Ga0495599_0025318 3300046678 Bacteria 3713
1151 Ga0495599_0216475 3300046678 Bacteria 1173
1152 Ga0495599_0364031 3300046678 Bacteria 865
1153 Ga0495623_0004791 3300046679 Bacteria 8893
1154 Ga0495623_0057491 3300046679 Bacteria 2447
1155 Ga0495623_0189932 3300046679 Bacteria 1188
1156 Ga0495646_0038823 3300046680 Bacteria 2938
1157 Ga0495646_0185193 3300046680 Bacteria 1141
1158 Ga0495646_0434089 3300046680 Bacteria 680
1159 Ga0495647_0007286 3300046681 Bacteria 3699
1160 Ga0495647_0007772 3300046681 Bacteria 3601
1161 Ga0495647_0017457 3300046681 Bacteria 2540
1162 Ga0495647_0165297 3300046681 Unclassified 956
1163 Ga0495658_0000477 3300046683 Bacteria 22157
1164 Ga0495658_0002681 3300046683 Bacteria 8964
1165 Ga0495658_0012424 3300046683 Bacteria 4312
1166 Ga0495658_0067838 3300046683 Bacteria 2064
1167 Ga0495658_0169632 3300046683 Unclassified 1350
1168 Ga0495658_0651318 3300046683 Archaea 675
1169 Ga0495613_0012014 3300046689 Bacteria 6435
1170 Ga0495613_0027883 3300046689 Bacteria 4204
1171 Ga0495613_0035174 3300046689 Bacteria 3719
1172 Ga0495613_0082324 3300046689 Bacteria 2337
1173 Ga0495613_0151997 3300046689 Bacteria 1650
1174 Ga0495613_0171905 3300046689 Bacteria 1537
1175 Ga0495624_0005965 3300046690 Bacteria 8703
1176 Ga0495624_0011629 3300046690 Bacteria 6045
1177 Ga0495624_0026113 3300046690 Bacteria 3829
1178 Ga0495589_0136762 3300046794 Unclassified 1175
1179 Ga0495589_0158424 3300046794 Bacteria 1079
1180 Ga0495600_0060012 3300046809 Bacteria 2483
1181 Ga0495600_0182986 3300046809 Bacteria 1350
1182 Ga0495600_0187762 3300046809 Bacteria 1330
1183 Ga0495600_0226368 3300046809 Bacteria 1195
1184 Ga0495581_0004713 3300047315 Bacteria 7873
1185 Ga0495581_0010091 3300047315 Bacteria 5463
1186 Ga0495581_0010557 3300047315 Bacteria 5339
1187 Ga0495581_0012180 3300047315 Bacteria 4978
1188 Ga0495581_0043668 3300047315 Bacteria 2592
1189 Ga0495604_0094893 3300047317 Bacteria 2204
1190 Ga0495604_0207962 3300047317 Unclassified 1354
1191 Ga0495604_0229187 3300047317 Bacteria 1275
1192 Ga0495604_0337871 3300047317 Unclassified 1003
1193 Ga0495674_0001928 3300047319 Bacteria 20475
1194 Ga0495674_0013017 3300047319 Bacteria 7830
1195 Ga0495674_0020329 3300047319 Bacteria 6148
1196 Ga0495674_0092217 3300047319 Bacteria 2587
1197 Ga0495674_0095249 3300047319 Bacteria 2538
1198 Ga0495674_0182686 3300047319 Unclassified 1746
1199 Ga0495674_0323449 3300047319 Bacteria 1256
1200 Ga0495674_0396684 3300047319 Bacteria 1114
1201 Ga0495674_0454988 3300047319 Unclassified 1028
1202 Ga0495676_0007375 3300047321 Bacteria 10094
1203 Ga0495676_0008869 3300047321 Bacteria 9186
1204 Ga0495676_0039732 3300047321 Bacteria 3892
1205 Ga0495676_0067394 3300047321 Bacteria 2769
1206 Ga0495676_0159325 3300047321 Bacteria 1598
1207 Ga0495676_0351462 3300047321 Bacteria 985
1208 Ga0495680_0001918 3300047322 Bacteria 21832
1209 Ga0495680_0002863 3300047322 Bacteria 17330
1210 Ga0495680_0023233 3300047322 Bacteria 5157
1211 Ga0495680_0035097 3300047322 Bacteria 4043
1212 Ga0495683_0170283 3300047323 Bacteria 1002
1213 Ga0495677_0068950 3300047445 Bacteria 1317
1214 Ga0495677_0178389 3300047445 Bacteria 823
1215 Ga0495684_0017343 3300047471 Bacteria 5541
1216 Ga0495684_0058385 3300047471 Bacteria 2939
1217 Ga0495684_0067293 3300047471 Bacteria 2724
1218 Ga0495684_0080217 3300047471 Bacteria 2477
1219 Ga0495684_0096431 3300047471 Bacteria 2238
1220 Ga0495593_0002453 3300047673 Bacteria 11159
1221 Ga0495593_0016019 3300047673 Bacteria 4232
1222 Ga0495593_0096453 3300047673 Bacteria 1519
1223 Ga0495602_0088357 3300048088 Bacteria 2580
1224 Ga0495602_0122659 3300048088 Unclassified 2088
1225 Ga0495602_0138240 3300048088 Bacteria 1932
1226 Ga0495614_0002561 3300048089 Bacteria 8083
1227 Ga0495614_0015876 3300048089 Unclassified 3280
1228 Ga0495614_0024565 3300048089 Bacteria 2601
1229 Ga0495614_0090968 3300048089 Unclassified 1327
1230 Ga0495626_0101351 3300048091 Bacteria 1255
1231 Ga0496100_0001475 3300048903 Bacteria 11518
1232 Ga0496100_0017504 3300048903 Bacteria 4232
1233 Ga0496100_0019881 3300048903 Bacteria 4016
1234 Ga0496100_0049942 3300048903 Bacteria 2707
1235 Ga0496100_0050735 3300048903 Unclassified 2689
1236 Ga0496100_0069499 3300048903 Bacteria 2345
1237 Ga0496100_0073748 3300048903 Bacteria 2285
1238 Ga0496100_0108686 3300048903 Bacteria 1923
1239 Ga0496100_0217962 3300048903 Bacteria 1399
1240 Ga0496100_0222008 3300048903 Bacteria 1387
1241 Ga0496100_0248643 3300048903 Bacteria 1315
1242 Ga0496100_0272832 3300048903 Bacteria 1258
1243 Ga0496100_0326122 3300048903 Bacteria 1154
1244 Ga0496100_0438652 3300048903 Bacteria 1000
1245 Ga0496100_0694413 3300048903 Bacteria 794
1246 Ga0496101_0007713 3300048904 Bacteria 6990
1247 Ga0496101_0008020 3300048904 Bacteria 6883
1248 Ga0496101_0010537 3300048904 Bacteria 6106
1249 Ga0496101_0012675 3300048904 Bacteria 5634
1250 Ga0496101_0015235 3300048904 Bacteria 5175
1251 Ga0496101_0015329 3300048904 Bacteria 5163
1252 Ga0496101_0031551 3300048904 Bacteria 3726
1253 Ga0496101_0042041 3300048904 Bacteria 3262
1254 Ga0496101_0055799 3300048904 Bacteria 2855
1255 Ga0496101_0075160 3300048904 Bacteria 2486
1256 Ga0496101_0138526 3300048904 Unclassified 1853
1257 Ga0496101_0160097 3300048904 Unclassified 1726
1258 Ga0496101_0225615 3300048904 Bacteria 1455
1259 Ga0496101_0459305 3300048904 Bacteria 1005
1260 Ga0496102_0005018 3300048905 Bacteria 11206
1261 Ga0496102_0006410 3300048905 Bacteria 10032
1262 Ga0496102_0009237 3300048905 Bacteria 8460
1263 Ga0496102_0019899 3300048905 Bacteria 5919
1264 Ga0496102_0034806 3300048905 Bacteria 4532
1265 Ga0496102_0103107 3300048905 Bacteria 2653
1266 Ga0496102_0110844 3300048905 Bacteria 2558
1267 Ga0496102_0175055 3300048905 Bacteria 2020
1268 Ga0496102_0180029 3300048905 Bacteria 1991
1269 Ga0496102_0366048 3300048905 Bacteria 1357
1270 Ga0496102_0624643 3300048905 Bacteria 1000
1271 Ga0496102_0643475 3300048905 Bacteria 983
1272 Ga0496103_0001794 3300048906 Bacteria 14009
1273 Ga0496103_0007950 3300048906 Bacteria 6301
1274 Ga0496103_0044591 3300048906 Bacteria 2733
1275 Ga0496103_0061127 3300048906 Unclassified 2342
1276 Ga0496103_0109678 3300048906 Bacteria 1752
1277 Ga0496103_0221664 3300048906 Bacteria 1216
1278 Ga0496103_0228741 3300048906 Unclassified 1196
1279 Ga0496103_0407035 3300048906 Unclassified 874
1280 Ga0496103_0410661 3300048906 Bacteria 869
1281 Ga0496104_0000461 3300048907 Bacteria 35063
1282 Ga0496104_0000494 3300048907 Bacteria 34055
1283 Ga0496104_0011694 3300048907 Bacteria 7870
1284 Ga0496104_0013270 3300048907 Bacteria 7426
1285 Ga0496104_0025462 3300048907 Bacteria 5454
1286 Ga0496104_0048035 3300048907 Bacteria 4024
1287 Ga0496104_0048116 3300048907 Bacteria 4021
1288 Ga0496104_0143755 3300048907 Bacteria 2291
1289 Ga0496104_0192690 3300048907 Bacteria 1950
1290 Ga0496104_0228606 3300048907 Bacteria 1772
1291 Ga0496104_0246772 3300048907 Bacteria 1698
1292 Ga0496104_0263856 3300048907 Bacteria 1635
1293 Ga0496104_0305216 3300048907 Bacteria 1504
1294 Ga0496104_0314598 3300048907 Unclassified 1479
1295 Ga0496104_0337666 3300048907 Bacteria 1419
1296 Ga0496104_0337782 3300048907 Unclassified 1419
1297 Ga0496104_0385445 3300048907 Bacteria 1314
1298 Ga0496105_0000673 3300048908 Bacteria 22964
1299 Ga0496105_0000930 3300048908 Bacteria 19941
1300 Ga0496105_0001972 3300048908 Bacteria 14767
1301 Ga0496105_0010729 3300048908 Bacteria 7211
1302 Ga0496105_0020091 3300048908 Bacteria 5392
1303 Ga0496105_0025579 3300048908 Bacteria 4807
1304 Ga0496105_0044586 3300048908 Unclassified 3658
1305 Ga0496105_0048906 3300048908 Bacteria 3491
1306 Ga0496105_0054206 3300048908 Bacteria 3311
1307 Ga0496105_0076428 3300048908 Bacteria 2765
1308 Ga0496105_0214849 3300048908 Bacteria 1567
1309 Ga0496105_0245973 3300048908 Bacteria 1450
1310 Ga0496105_0287771 3300048908 Bacteria 1323
1311 Ga0496105_0347036 3300048908 Bacteria 1186
1312 Ga0496105_0389499 3300048908 Bacteria 1108
1313 Ga0496105_0412356 3300048908 Bacteria 1071
1314 Ga0496106_0000456 3300048909 Bacteria 29280
1315 Ga0496106_0008749 3300048909 Bacteria 7485
1316 Ga0496106_0012301 3300048909 Bacteria 6315
1317 Ga0496106_0014956 3300048909 Bacteria 5741
1318 Ga0496106_0037415 3300048909 Bacteria 3630
1319 Ga0496106_0039147 3300048909 Bacteria 3551
1320 Ga0496106_0043208 3300048909 Bacteria 3381
1321 Ga0496106_0097556 3300048909 Bacteria 2275
1322 Ga0496106_0098188 3300048909 Bacteria 2269
1323 Ga0496106_0117405 3300048909 Unclassified 2076
1324 Ga0496106_0411097 3300048909 Bacteria 1087
1325 Ga0496106_0485265 3300048909 Bacteria 993
1326 Ga0496106_0661871 3300048909 Unclassified 834
1327 Ga0496107_0000980 3300048910 Bacteria 16945
1328 Ga0496107_0011989 3300048910 Bacteria 6048
1329 Ga0496107_0019088 3300048910 Bacteria 4835
1330 Ga0496107_0021993 3300048910 Bacteria 4504
1331 Ga0496107_0043490 3300048910 Bacteria 3227
1332 Ga0496107_0043609 3300048910 Bacteria 3223
1333 Ga0496107_0045805 3300048910 Unclassified 3147
1334 Ga0496107_0072819 3300048910 Bacteria 2498
1335 Ga0496107_0235465 3300048910 Bacteria 1362
1336 Ga0496108_0003532 3300048911 Bacteria 12539
1337 Ga0496108_0004458 3300048911 Bacteria 11272
1338 Ga0496108_0011668 3300048911 Bacteria 7150
1339 Ga0496108_0025218 3300048911 Bacteria 4899
1340 Ga0496108_0025655 3300048911 Bacteria 4859
1341 Ga0496108_0029090 3300048911 Bacteria 4573
1342 Ga0496108_0052736 3300048911 Bacteria 3410
1343 Ga0496108_0069163 3300048911 Bacteria 2979
1344 Ga0496108_0091374 3300048911 Bacteria 2588
1345 Ga0496108_0119196 3300048911 Bacteria 2263
1346 Ga0496108_0184967 3300048911 Bacteria 1804
1347 Ga0496108_0407703 3300048911 Unclassified 1187
1348 Ga0496108_0432807 3300048911 Unclassified 1149
1349 Ga0496108_0682290 3300048911 Bacteria 892
1350 Ga0496109_0001074 3300048912 Bacteria 22668
1351 Ga0496109_0003058 3300048912 Bacteria 13944
1352 Ga0496109_0003358 3300048912 Bacteria 13390
1353 Ga0496109_0009488 3300048912 Bacteria 8297
1354 Ga0496109_0010424 3300048912 Bacteria 7937
1355 Ga0496109_0032256 3300048912 Bacteria 4708
1356 Ga0496109_0044210 3300048912 Bacteria 4040
1357 Ga0496109_0064767 3300048912 Bacteria 3344
1358 Ga0496109_0080620 3300048912 Bacteria 2999
1359 Ga0496109_0083336 3300048912 Bacteria 2949
1360 Ga0496109_0166118 3300048912 Bacteria 2069
1361 Ga0496109_0185725 3300048912 Unclassified 1953
1362 Ga0496109_0220819 3300048912 Bacteria 1782
1363 Ga0496109_0255278 3300048912 Bacteria 1651
1364 Ga0496109_0473632 3300048912 Unclassified 1182
1365 Ga0496109_0478020 3300048912 Unclassified 1176
1366 Ga0496109_0494366 3300048912 Bacteria 1155
1367 Ga0496109_0663136 3300048912 Bacteria 980
1368 Ga0496110_0000072 3300048913 Bacteria 51313
1369 Ga0496110_0004711 3300048913 Bacteria 10611
1370 Ga0496110_0006848 3300048913 Bacteria 9057
1371 Ga0496110_0009248 3300048913 Bacteria 7964
1372 Ga0496110_0011742 3300048913 Bacteria 7186
1373 Ga0496110_0016180 3300048913 Bacteria 6221
1374 Ga0496110_0028108 3300048913 Bacteria 4826
1375 Ga0496110_0080889 3300048913 Bacteria 2896
1376 Ga0496110_0097611 3300048913 Unclassified 2633
1377 Ga0496110_0131496 3300048913 Bacteria 2260
1378 Ga0496110_0541663 3300048913 Bacteria 1058
1379 Ga0496110_0583391 3300048913 Unclassified 1015
1380 Ga0496110_0816806 3300048913 Unclassified 837
1381 Ga0496111_0001669 3300048914 Bacteria 12923
1382 Ga0496111_0003404 3300048914 Bacteria 9841
1383 Ga0496111_0009077 3300048914 Bacteria 6619
1384 Ga0496111_0016303 3300048914 Bacteria 5117
1385 Ga0496111_0047674 3300048914 Bacteria 3086
1386 Ga0496111_0101301 3300048914 Bacteria 2116
1387 Ga0496111_0119445 3300048914 Bacteria 1947
1388 Ga0496111_0133472 3300048914 Unclassified 1838
1389 Ga0496111_0152670 3300048914 Unclassified 1713
1390 Ga0496111_0196071 3300048914 Bacteria 1501
1391 Ga0496111_0280505 3300048914 Bacteria 1236
1392 Ga0496111_0406941 3300048914 Bacteria 1005
1393 Ga0496112_0000684 3300048915 Bacteria 23634
1394 Ga0496112_0002604 3300048915 Bacteria 14573
1395 Ga0496112_0005435 3300048915 Bacteria 11019
1396 Ga0496112_0008124 3300048915 Bacteria 9375
1397 Ga0496112_0033515 3300048915 Bacteria 4993
1398 Ga0496112_0062620 3300048915 Bacteria 3670
1399 Ga0496112_0341475 3300048915 Unclassified 1441
1400 Ga0496112_0551344 3300048915 Bacteria 1086
1401 Ga0496112_0700041 3300048915 Bacteria 941
1402 Ga0496113_0000076 3300048916 Bacteria 42925
1403 Ga0496113_0000337 3300048916 Bacteria 22353
1404 Ga0496113_0018937 3300048916 Bacteria 4806
1405 Ga0496113_0018975 3300048916 Bacteria 4802
1406 Ga0496113_0065474 3300048916 Bacteria 2751
1407 Ga0496113_0291019 3300048916 Bacteria 1307
1408 Ga0496114_0004595 3300048917 Bacteria 10722
1409 Ga0496114_0017409 3300048917 Bacteria 5800
1410 Ga0496114_0021228 3300048917 Bacteria 5281
1411 Ga0496114_0021672 3300048917 Bacteria 5228
1412 Ga0496114_0044100 3300048917 Bacteria 3699
1413 Ga0496114_0046657 3300048917 Bacteria 3601
1414 Ga0496114_0061063 3300048917 Bacteria 3152
1415 Ga0496114_0075519 3300048917 Unclassified 2839
1416 Ga0496114_0086255 3300048917 Unclassified 2660
1417 Ga0496114_0093474 3300048917 Unclassified 2557
1418 Ga0496114_0099991 3300048917 Bacteria 2474
1419 Ga0496114_0125607 3300048917 Bacteria 2211
1420 Ga0496114_0137945 3300048917 Bacteria 2110
1421 Ga0496114_0159675 3300048917 Bacteria 1959
1422 Ga0496114_0164189 3300048917 Unclassified 1933
1423 Ga0496114_0228804 3300048917 Bacteria 1633
1424 Ga0496114_0377730 3300048917 Bacteria 1254
1425 Ga0496114_0378967 3300048917 Unclassified 1252
1426 Ga0496114_0477456 3300048917 Bacteria 1103
1427 Ga0496114_0515508 3300048917 Unclassified 1057
1428 Ga0496114_0805605 3300048917 Unclassified 818
1429 Ga0496115_0000719 3300048918 Bacteria 24524
1430 Ga0496115_0001259 3300048918 Bacteria 18182
1431 Ga0496115_0001662 3300048918 Bacteria 15996
1432 Ga0496115_0001827 3300048918 Bacteria 15235
1433 Ga0496115_0007268 3300048918 Bacteria 8145
1434 Ga0496115_0011828 3300048918 Bacteria 6556
1435 Ga0496115_0018979 3300048918 Bacteria 5287
1436 Ga0496115_0023795 3300048918 Bacteria 4756
1437 Ga0496115_0061856 3300048918 Bacteria 3019
1438 Ga0496115_0077714 3300048918 Bacteria 2699
1439 Ga0496115_0107668 3300048918 Bacteria 2288
1440 Ga0496115_0206482 3300048918 Unclassified 1623
1441 Ga0496115_0218948 3300048918 Bacteria 1571
1442 Ga0496115_0276782 3300048918 Bacteria 1378
1443 Ga0496115_0389173 3300048918 Bacteria 1132
1444 Ga0496115_0522745 3300048918 Bacteria 951
1445 Ga0496115_0918629 3300048918 Bacteria 674
1446 Ga0501031_0555509 3300049568 Bacteria 739
1447 Ga0501032_0008328 3300049569 Bacteria 7555
1448 Ga0501032_0331679 3300049569 Unclassified 981
1449 Ga0501033_0066856 3300049570 Bacteria 2643
1450 Ga0501033_0499633 3300049570 Unclassified 841
1451 Ga0501034_0130381 3300049571 Bacteria 2498
1452 Ga0501034_0439928 3300049571 Bacteria 1223
1453 Ga0501036_0014658 3300049572 Bacteria 6532
1454 Ga0501036_0044139 3300049572 Bacteria 3775
1455 Ga0501036_0082083 3300049572 Bacteria 2724
1456 Ga0501036_0203390 3300049572 Bacteria 1665
1457 Ga0501036_0536660 3300049572 Unclassified 972
1458 Ga0501036_0539987 3300049572 Unclassified 969
1459 Ga0501037_0035866 3300049573 Bacteria 3654
1460 Ga0501037_0376702 3300049573 Unclassified 976
1461 Ga0501038_0033069 3300049574 Bacteria 4556
1462 Ga0501038_0059269 3300049574 Bacteria 3279
1463 Ga0501038_0088496 3300049574 Bacteria 2599
1464 Ga0501038_0221520 3300049574 Bacteria 1509
1465 Ga0501038_0323996 3300049574 Unclassified 1205
1466 Ga0501038_0697942 3300049574 Bacteria 760
1467 Ga0501039_0003259 3300049575 Bacteria 12139
1468 Ga0501039_0126905 3300049575 Bacteria 2001
1469 Ga0501039_0185388 3300049575 Bacteria 1636
1470 Ga0501039_0287545 3300049575 Bacteria 1292
1471 Ga0501039_0531596 3300049575 Bacteria 923
1472 Ga0501040_0054456 3300049576 Bacteria 2742
1473 Ga0501040_0194580 3300049576 Bacteria 1439
1474 Ga0501040_0229908 3300049576 Bacteria 1320
1475 Ga0501040_0376347 3300049576 Bacteria 1018
1476 Ga0501041_0026401 3300049577 Bacteria 3494
1477 Ga0501041_0042202 3300049577 Bacteria 2771
1478 Ga0501041_0043876 3300049577 Bacteria 2718
1479 Ga0501042_0047826 3300049578 Bacteria 3050
1480 Ga0501042_0092004 3300049578 Bacteria 2177
1481 Ga0501042_0136480 3300049578 Bacteria 1768
1482 Ga0501042_0141523 3300049578 Bacteria 1735
1483 Ga0501042_0245109 3300049578 Bacteria 1293
1484 Ga0501042_0438902 3300049578 Bacteria 947
1485 Ga0501043_0033541 3300049579 Bacteria 4040
1486 Ga0501043_0102568 3300049579 Unclassified 2248
1487 Ga0501046_0063273 3300049580 Bacteria 2889
1488 Ga0501046_0190891 3300049580 Unclassified 1528
1489 Ga0501046_0297804 3300049580 Bacteria 1179
1490 Ga0501047_0544175 3300049581 Bacteria 986
1491 Ga0501048_0006548 3300049582 Bacteria 8851
1492 Ga0501048_0042780 3300049582 Bacteria 3242
1493 Ga0501048_0045766 3300049582 Bacteria 3124
1494 Ga0501048_0063766 3300049582 Bacteria 2606
1495 Ga0501067_0004883 3300049583 Bacteria 7447
1496 Ga0501067_0005212 3300049583 Bacteria 7225
1497 Ga0501067_0010773 3300049583 Bacteria 5057
1498 Ga0501067_0022805 3300049583 Bacteria 3465
1499 Ga0501067_0363851 3300049583 Unclassified 806
1500 Ga0501068_0001390 3300049584 Bacteria 12856
1501 Ga0501068_0005336 3300049584 Bacteria 7021
1502 Ga0501068_0019697 3300049584 Bacteria 3922
1503 Ga0501068_0049547 3300049584 Bacteria 2537
1504 Ga0501068_0459237 3300049584 Bacteria 824
1505 Ga0501069_0000470 3300049585 Bacteria 18386
1506 Ga0501069_0002995 3300049585 Bacteria 8700
1507 Ga0501069_0010273 3300049585 Bacteria 4955
1508 Ga0501069_0028372 3300049585 Bacteria 3068
1509 Ga0501069_0028781 3300049585 Bacteria 3048
1510 Ga0501069_0040377 3300049585 Bacteria 2579
1511 Ga0501069_0047757 3300049585 Bacteria 2376
1512 Ga0501070_0030738 3300049586 Bacteria 4498
1513 Ga0501070_0044521 3300049586 Bacteria 3693
1514 Ga0501070_0073182 3300049586 Bacteria 2836
1515 Ga0501070_0088562 3300049586 Bacteria 2562
1516 Ga0501071_0050788 3300049587 Bacteria 2987
1517 Ga0501071_0071015 3300049587 Bacteria 2537
1518 Ga0501071_0128483 3300049587 Bacteria 1882
1519 Ga0501071_0296317 3300049587 Bacteria 1225
1520 Ga0501071_0593328 3300049587 Bacteria 851
1521 Ga0501072_0002824 3300049588 Bacteria 13031
1522 Ga0501072_0025295 3300049588 Bacteria 4624
1523 Ga0501072_0143027 3300049588 Unclassified 1907
1524 Ga0501072_0193200 3300049588 Bacteria 1623
1525 Ga0501072_0307827 3300049588 Bacteria 1259
1526 Ga0501072_0583698 3300049588 Unclassified 881
1527 Ga0501073_0005950 3300049589 Bacteria 9101
1528 Ga0501073_0028698 3300049589 Bacteria 3976
1529 Ga0501074_0345799 3300049590 Unclassified 1055
1530 Ga0501075_0002854 3300049591 Bacteria 11587
1531 Ga0501075_0007123 3300049591 Bacteria 7736
1532 Ga0501075_0031937 3300049591 Bacteria 3911
1533 Ga0501075_0096489 3300049591 Unclassified 2243
1534 Ga0501075_0141996 3300049591 Unclassified 1830
1535 Ga0501075_0216055 3300049591 Bacteria 1462
1536 Ga0501075_0218019 3300049591 Bacteria 1455
1537 Ga0501076_0007880 3300049592 Bacteria 7766
1538 Ga0501076_0014673 3300049592 Bacteria 5906
1539 Ga0501076_0069004 3300049592 Bacteria 2824
1540 Ga0501076_0138495 3300049592 Bacteria 1976
1541 Ga0501076_0258854 3300049592 Bacteria 1424
1542 Ga0501076_0605929 3300049592 Bacteria 903
1543 Ga0501076_0689121 3300049592 Bacteria 843
1544 Ga0501077_0003598 3300049593 Bacteria 9315
1545 Ga0501077_0004622 3300049593 Bacteria 8360
1546 Ga0501077_0023897 3300049593 Bacteria 3877
1547 Ga0501079_0011587 3300049741 Bacteria 6731
1548 Ga0501079_0045730 3300049741 Bacteria 3378
1549 Ga0501079_0092391 3300049741 Bacteria 2344
1550 Ga0501079_0169654 3300049741 Bacteria 1701
1551 Ga0501079_0532306 3300049741 Bacteria 924
1552 Ga0501080_0093613 3300049742 Bacteria 2790
1553 Ga0501080_0102866 3300049742 Bacteria 2649
1554 Ga0501080_0171437 3300049742 Bacteria 2001
1555 Ga0501080_0244416 3300049742 Bacteria 1637
1556 Ga0501081_0027422 3300049743 Bacteria 3842
1557 Ga0501081_0045929 3300049743 Bacteria 3000
1558 Ga0501081_0170440 3300049743 Bacteria 1571
1559 Ga0501081_0240652 3300049743 Unclassified 1319
1560 Ga0501081_0555829 3300049743 Bacteria 857
1561 Ga0501081_0560939 3300049743 Bacteria 853
1562 Ga0501083_0069609 3300049744 Bacteria 2341
1563 Ga0501083_0428673 3300049744 Unclassified 860
1564 Ga0501035_0051074 3300049822 Bacteria 3703
1565 Ga0501035_0128834 3300049822 Bacteria 2207
1566 Ga0501044_0012250 3300049823 Bacteria 9285
1567 Ga0501044_0118900 3300049823 Bacteria 2645
1568 Ga0501044_0170265 3300049823 Bacteria 2150
1569 Ga0501045_0016656 3300049824 Bacteria 5222
1570 Ga0501045_0026095 3300049824 Bacteria 4200
1571 Ga0501045_0131086 3300049824 Bacteria 1863
1572 Ga0501045_0250076 3300049824 Unclassified 1319
1573 Ga0501045_0273864 3300049824 Bacteria 1256
1574 nmdc:mga00v17_12668_c1 3300050491 Bacteria 4657
1575 nmdc:mga00v17_157302_c1 3300050491 Bacteria 1462
1576 nmdc:mga00v17_170753_c1 3300050491 Bacteria 1402
1577 nmdc:mga0yw44_102161_c1 3300050492 Bacteria 1827
1578 nmdc:mga0yw44_437603_c1 3300050492 Bacteria 886
1579 nmdc:mga06z11_288636_c1 3300050494 Bacteria 973
1580 nmdc:mga06z11_396647_c1 3300050494 Bacteria 830
1581 nmdc:mga05p37_137064_c1 3300050507 Bacteria 3000
1582 nmdc:mga05p37_362703_c1 3300050507 Bacteria 1703
1583 nmdc:mga05p37_55696_c1 3300050507 Bacteria 4867
1584 nmdc:mga05p37_581011_c1 3300050507 Bacteria 1269
1585 nmdc:mga05p37_8342_c1 3300050507 Bacteria 12252
1586 nmdc:mga05p37_86010_c1 3300050507 Unclassified 3875
1587 nmdc:mga09592_31239_c1 3300050508 Bacteria 4437
1588 nmdc:mga09592_321574_c1 3300050508 Bacteria 1340
1589 nmdc:mga09592_93516_c1 3300050508 Bacteria 2571
1590 nmdc:mga0qj67_19618_c1 3300050509 Bacteria 5168
1591 nmdc:mga06r32_130564_c1 3300050510 Bacteria 2484
1592 nmdc:mga06r32_82451_c1 3300050510 Bacteria 3133
1593 nmdc:mga08y16_164117_c1 3300050511 Bacteria 2308
1594 nmdc:mga08y16_20510_c1 3300050511 Bacteria 6976
1595 nmdc:mga08y16_44827_c1 3300050511 Bacteria 4636
1596 nmdc:mga08y16_48252_c1 3300050511 Bacteria 4456
1597 nmdc:mga08y16_54622_c1 3300050511 Bacteria 4174
1598 nmdc:mga08y16_604287_c1 3300050511 Unclassified 1105
1599 nmdc:mga08y16_660968_c1 3300050511 Bacteria 1048
1600 nmdc:mga08y16_81858_c1 3300050511 Bacteria 3366
1601 nmdc:mga0n895_156774_c1 3300050512 Bacteria 2308
1602 nmdc:mga0n895_18573_c1 3300050512 Bacteria 6438
1603 nmdc:mga0n895_313511_c1 3300050512 Bacteria 1590
1604 nmdc:mga0n895_34097_c1 3300050512 Bacteria 4898
1605 nmdc:mga0n895_343713_c1 3300050512 Bacteria 1511
1606 nmdc:mga0n895_35345_c1 3300050512 Bacteria 4817
1607 nmdc:mga0n895_44306_c1 3300050512 Bacteria 4338
1608 nmdc:mga0n895_4522_c1 3300050512 Bacteria 11441
1609 nmdc:mga0n895_566713_c1 3300050512 Bacteria 1141
1610 nmdc:mga0n895_584299_c1 3300050512 Bacteria 1121
1611 nmdc:mga0n895_637339_c1 3300050512 Bacteria 1066
1612 nmdc:mga0n895_966105_c1 3300050512 Bacteria 835
1613 nmdc:mga0rr50_12864_c1 3300050513 Bacteria 5425
1614 nmdc:mga0rr50_159064_c1 3300050513 Bacteria 1832
1615 nmdc:mga0rr50_1603_c1 3300050513 Bacteria 12461
1616 nmdc:mga0rr50_2621_c1 3300050513 Bacteria 10190
1617 nmdc:mga0rr50_285989_c1 3300050513 Bacteria 1377
1618 nmdc:mga0rr50_402333_c1 3300050513 Bacteria 1157
1619 nmdc:mga0rr50_42678_c1 3300050513 Bacteria 3314
1620 nmdc:mga0rr50_567094_c1 3300050513 Unclassified 967
1621 nmdc:mga0rr50_5699_c1 3300050513 Bacteria 7462
1622 nmdc:mga0rr50_597306_c1 3300050513 Bacteria 941
1623 nmdc:mga0rr50_714807_c1 3300050513 Unclassified 855
1624 nmdc:mga0rr50_7541_c1 3300050513 Bacteria 6720
1625 nmdc:mga0rr50_75521_c1 3300050513 Bacteria 2584
1626 nmdc:mga08x19_114908_c1 3300050514 Bacteria 1799
1627 nmdc:mga08x19_201257_c1 3300050514 Bacteria 1365
1628 nmdc:mga08x19_37222_c1 3300050514 Bacteria 3087
1629 nmdc:mga08x19_4916_c1 3300050514 Bacteria 7892
1630 nmdc:mga08x19_59414_c1 3300050514 Unclassified 2475
1631 nmdc:mga08x19_89056_c1 3300050514 Bacteria 2035
1632 nmdc:mga08x19_94200_c1 3300050514 Bacteria 1980
1633 nmdc:mga0a205_121578_c1 3300050515 Bacteria 2510
1634 nmdc:mga0a205_12370_c1 3300050515 Bacteria 7894
1635 nmdc:mga0a205_124485_c1 3300050515 Bacteria 2478
1636 nmdc:mga0a205_147841_c1 3300050515 Bacteria 2250
1637 nmdc:mga0a205_198981_c1 3300050515 Bacteria 1895
1638 nmdc:mga0a205_21940_c1 3300050515 Bacteria 6040
1639 nmdc:mga0a205_48133_c1 3300050515 Bacteria 4115
1640 nmdc:mga0a205_621551_c1 3300050515 Archaea 933
1641 nmdc:mga0a205_636720_c1 3300050515 Bacteria 918
1642 nmdc:mga0a205_642345_c1 3300050515 Unclassified 913
1643 nmdc:mga0a205_86140_c1 3300050515 Unclassified 3034
1644 Ga0495601_0008919 3300053077 Bacteria 5920
1645 Ga0495601_0016720 3300053077 Bacteria 4448
1646 Ga0495601_0026644 3300053077 Bacteria 3570
1647 Ga0495601_0077562 3300053077 Unclassified 2128
1648 Ga0495601_0086752 3300053077 Unclassified 2011
1649 Ga0495601_0184735 3300053077 Bacteria 1363
1650 Ga0495601_0197870 3300053077 Bacteria 1314
1651 Ga0495601_0213992 3300053077 Bacteria 1259
1652 Ga0495601_0407533 3300053077 Bacteria 881
1653 Ga0495612_0006485 3300053078 Bacteria 4807
1654 Ga0495612_0015873 3300053078 Bacteria 3019
1655 Ga0495612_0057381 3300053078 Bacteria 1608
1656 Ga0495612_0058045 3300053078 Bacteria 1599
1657 Ga0495612_0106611 3300053078 Bacteria 1197
1658 Ga0495655_0094649 3300053083 Bacteria 876
1659 Ga0495595_0017315 3300053084 Bacteria 3100
1660 Ga0495595_0045006 3300053084 Bacteria 2029
1661 Ga0495595_0049129 3300053084 Bacteria 1950
1662 Ga0495595_0061153 3300053084 Unclassified 1763
1663 Ga0495619_0002453 3300053085 Bacteria 12142
1664 Ga0495619_0079924 3300053085 Bacteria 2200
1665 Ga0495619_0101937 3300053085 Bacteria 1955
1666 Ga0495619_0205893 3300053085 Bacteria 1362
1667 Ga0495619_0217454 3300053085 Bacteria 1323
1668 Ga0495619_0726657 3300053085 Unclassified 674
1669 Ga0501084_0022478 3300054114 Bacteria 5262
1670 Ga0501084_0102219 3300054114 Bacteria 2407
1671 Ga0501084_0200778 3300054114 Bacteria 1682
1672 Ga0501084_0719135 3300054114 Bacteria 842
1673 Ga0501082_0003529 3300060353 Bacteria 13659
1674 Ga0501082_0082420 3300060353 Bacteria 2775
1675 Ga0501082_0142314 3300060353 Bacteria 2081
1676 Ga0501082_0428303 3300060353 Bacteria 1155
1677 Ga0501082_0694651 3300060353 Bacteria 890
1678 Ga0466962_0052704 3300061719 Bacteria 1944
1679 Ga0530510_0002635 3300061734 Bacteria 12331
1680 Ga0530510_0069616 3300061734 Unclassified 2553
1681 Ga0530510_0096834 3300061734 Bacteria 2157
1682 Ga0530510_0099375 3300061734 Bacteria 2127
1683 Ga0530510_0130250 3300061734 Bacteria 1850
1684 Ga0530510_0157434 3300061734 Bacteria 1679
1685 Ga0530510_0409752 3300061734 Unclassified 1022
1686 Ga0111539_10062716
1687 ARcpr5yngRDRAFT_c004151
1688 ARSoilOldRDRAFT_c002807
1689 ARCol0yngRDRAFT_1001939
1690 JGI24747J21853_1008829
1691 JGI24739J22299_10095130
1692 JGI24739J22299_10105358
1693 JGI24737J22298_10086158
1694 JGI24743J22301_10039925
1695 JGI24743J22301_10061939
1696 JGI24738J21930_10034049
1697 JGI24033J26618_1004749
1698 JGI24751J29686_10024707
1699 JGI25406J46586_10011902
1700 JGI25407J50210_10035069
1701 Ga0070658_10081640
1702 Ga0070658_10158991
1703 Ga0070658_10624188
1704 Ga0070658_10926831
1705 Ga0070676_10254822
1706 Ga0070676_10573730
1707 Ga0070683_100000911
1708 Ga0070683_100009526
1709 Ga0070683_100043043
1710 Ga0070683_100068268
1711 Ga0070683_100072613
1712 Ga0070683_100212793
1713 Ga0070683_100263225
1714 Ga0070690_100088857
1715 Ga0070690_100270598
1716 Ga0070670_100157967
1717 Ga0068869_100204833
1718 Ga0070680_100002541
1719 Ga0070680_100009498
1720 Ga0070680_100028541
1721 Ga0070680_100102740
1722 Ga0070680_100153255
1723 Ga0070682_100034421
1724 Ga0070682_100184363
1725 Ga0070682_100706053
1726 Ga0068868_100003848
1727 Ga0068868_100032081
1728 Ga0068868_100069856
1729 Ga0068868_100201825
1730 Ga0068868_100209432
1731 Ga0068868_100216010
1732 Ga0068868_100331813
1733 Ga0070660_100020713
1734 Ga0070660_100021187
1735 Ga0070660_100028747
1736 Ga0070660_100061666
1737 Ga0070660_100069446
1738 Ga0070660_100170770
1739 Ga0070660_100304083
1740 Ga0070660_100492292
1741 Ga0070660_100708345
1742 Ga0070689_100144015
1743 Ga0070689_100171973
1744 Ga0070691_10012043
1745 Ga0070691_10027910
1746 Ga0070691_10036689
1747 Ga0070691_10055161
1748 Ga0070691_10062379
1749 Ga0070691_10115322
1750 Ga0070687_100174815
1751 Ga0070687_100274124
1752 Ga0070661_100004700
1753 Ga0070661_100023208
1754 Ga0070661_100232620
1755 Ga0070661_100331309
1756 Ga0070692_10033039
1757 Ga0070692_10116939
1758 Ga0070692_10172115
1759 Ga0070668_100083359
1760 Ga0070668_100279244
1761 Ga0070668_100768373
1762 Ga0070669_100336186
1763 Ga0070669_100465189
1764 Ga0070669_100494332
1765 Ga0070675_100071386
1766 Ga0070675_100109541
1767 Ga0070675_100170591
1768 Ga0070675_100498397
1769 Ga0070671_100095942
1770 Ga0070674_100016490
1771 Ga0070674_100531278
1772 Ga0070674_100676771
1773 Ga0070673_100196582
1774 Ga0070673_100347056
1775 Ga0070673_100875978
1776 Ga0070688_100024769
1777 Ga0070688_100295678
1778 Ga0070688_100598222
1779 Ga0070659_100045715
1780 Ga0070659_100087179
1781 Ga0070659_100161095
1782 Ga0070659_100193695
1783 Ga0070659_100872868
1784 Ga0070667_100364057
1785 Ga0070667_100422074
1786 Ga0070703_10025637
1787 Ga0070703_10083596
1788 Ga0070703_10170106
1789 Ga0070709_10022042
1790 Ga0070709_10165012
1791 Ga0070709_10232984
1792 Ga0070714_100063739
1793 Ga0070714_100331395
1794 Ga0070714_100350969
1795 Ga0070714_100459419
1796 Ga0070714_100502371
1797 Ga0070714_100728255
1798 Ga0070713_100119093
1799 Ga0070713_100165283
1800 Ga0070713_100206275
1801 Ga0070713_100309315
1802 Ga0070710_10015751
1803 Ga0070710_10030911
1804 Ga0070710_10104026
1805 Ga0070710_10127905
1806 Ga0070710_10138852
1807 Ga0070710_10159486
1808 Ga0070701_10019951
1809 Ga0070711_100008457
1810 Ga0070711_100112918
1811 Ga0070711_100227241
1812 Ga0070711_100267015
1813 Ga0070711_100268385
1814 Ga0070711_100288840
1815 Ga0070711_100364979
1816 Ga0070711_100872791
1817 Ga0070705_100043529
1818 Ga0070705_100144776
1819 Ga0070705_100172054
1820 Ga0070700_100021601
1821 Ga0070700_100024887
1822 Ga0070700_100076154
1823 Ga0070708_100079811
1824 Ga0070708_100182465
1825 Ga0070663_100016045
1826 Ga0070663_100146310
1827 Ga0070678_100027606
1828 Ga0070678_100050291
1829 Ga0070678_100060215
1830 Ga0070678_100233777
1831 Ga0070678_100361151
1832 Ga0070678_100679166
1833 Ga0070662_100008424
1834 Ga0070662_100012945
1835 Ga0070662_100017331
1836 Ga0070662_100075742
1837 Ga0070662_100085365
1838 Ga0070662_100163894
1839 Ga0070662_100287694
1840 Ga0070681_10119186
1841 Ga0070681_10134193
1842 Ga0070681_10210522
1843 Ga0070681_10239381
1844 Ga0070681_10249201
1845 Ga0070681_10251959
1846 Ga0070681_10255215
1847 Ga0070681_10354962
1848 Ga0070681_10856258
1849 Ga0068867_100143956
1850 Ga0068867_100218258
1851 Ga0068867_100272799
1852 Ga0068867_100397474
1853 Ga0070685_10002654
1854 Ga0070706_100546300
1855 Ga0070698_100094671
1856 Ga0070698_100111746
1857 Ga0070699_100174458
1858 Ga0070699_100375126
1859 Ga0070679_100024215
1860 Ga0070679_100057985
1861 Ga0070679_100065683
1862 Ga0070679_100098066
1863 Ga0070679_100101126
1864 Ga0070679_100117794
1865 Ga0070679_100121250
1866 Ga0070679_100178561
1867 Ga0070679_100417212
1868 Ga0070679_101016986
1869 Ga0070684_100002987
1870 Ga0070684_100009104
1871 Ga0070684_100027885
1872 Ga0070684_100044620
1873 Ga0070684_100068948
1874 Ga0070684_100139286
1875 Ga0070684_100183625
1876 Ga0070684_100408185
1877 Ga0070684_101015564
1878 Ga0070697_100193331
1879 Ga0070697_100568857
1880 Ga0068853_100049482
1881 Ga0068853_100116267
1882 Ga0068853_100120714
1883 Ga0070672_100011745
1884 Ga0070672_100060037
1885 Ga0070672_100426213
1886 Ga0070672_100571787
1887 Ga0070686_100137369
1888 Ga0070695_100108789
1889 Ga0070695_100409955
1890 Ga0070695_100446471
1891 Ga0070695_100606213
1892 Ga0070696_100040272
1893 Ga0070696_100079217
1894 Ga0070696_100083269
1895 Ga0070696_100113132
1896 Ga0070696_100428952
1897 Ga0070696_100476563
1898 Ga0070696_100544602
1899 Ga0070693_100086818
1900 Ga0070693_100171768
1901 Ga0070693_100229433
1902 Ga0070665_100029536
1903 Ga0070665_100333848
1904 Ga0070704_100012513
1905 Ga0070704_100062811
1906 Ga0070704_100174982
1907 Ga0068855_100034827
1908 Ga0068855_100049422
1909 Ga0068855_100119279
1910 Ga0068855_100141926
1911 Ga0068855_100423551
1912 Ga0068855_100611254
1913 Ga0070664_100066762
1914 Ga0070664_100097750
1915 Ga0070664_100319902
1916 Ga0070664_100330027
1917 Ga0070664_100340571
1918 Ga0070664_100380957
1919 Ga0068857_100057361
1920 Ga0068857_100151940
1921 Ga0068857_100369428
1922 Ga0068854_100025563
1923 Ga0068854_100032416
1924 Ga0068854_100142066
1925 Ga0068854_100439273
1926 Ga0068854_100718306
1927 Ga0068856_100028860
1928 Ga0068856_100044326
1929 Ga0068856_100048083
1930 Ga0068856_100100137
1931 Ga0068856_100321885
1932 Ga0068856_100354084
1933 Ga0068856_100509191
1934 Ga0068856_100602665
1935 Ga0070702_100019502
1936 Ga0070702_100056733
1937 Ga0070702_100084618
1938 Ga0068852_100041973
1939 Ga0068852_100059450
1940 Ga0068852_100066951
1941 Ga0068852_100125110
1942 Ga0068852_100175018
1943 Ga0068852_100206671
1944 Ga0068852_100353191
1945 Ga0068852_100491375
1946 Ga0068852_101036633
1947 Ga0068852_101235524
1948 Ga0068859_100032440
1949 Ga0068859_100062921
1950 Ga0068864_100117114
1951 Ga0068864_100190394
1952 Ga0068864_100503780
1953 Ga0068866_10151973
1954 Ga0068866_10194716
1955 Ga0068866_10562496
1956 Ga0068861_100026781
1957 Ga0068861_100120258
1958 Ga0068861_100218520
1959 Ga0068861_100326594
1960 Ga0068861_100461597
1961 Ga0068861_100716167
1962 Ga0068861_100761201
1963 Ga0068851_10104975
1964 Ga0068870_10236094
1965 Ga0068870_10436727
1966 Ga0068863_100214327
1967 Ga0068860_100069126
1968 Ga0068860_100248898
1969 Ga0068862_100390375
1970 Ga0081455_10014065
1971 Ga0081455_10017655
1972 Ga0081455_10030402
1973 Ga0081455_10063179
1974 Ga0081455_10064752
1975 Ga0081455_10091886
1976 Ga0081455_10271962
1977 Ga0081455_10323833
1978 Ga0081455_10424305
1979 Ga0081538_10001352
1980 Ga0081538_10001944
1981 Ga0081538_10002644
1982 Ga0081538_10044597
1983 Ga0081538_10060840
1984 Ga0081540_1002691
1985 Ga0081540_1005407
1986 Ga0081540_1024567
1987 Ga0081539_10000888
1988 Ga0070717_10011193
1989 Ga0070717_10107798
1990 Ga0070717_10295528
1991 Ga0075365_10039156
1992 Ga0075365_10118842
1993 Ga0075365_10127154
1994 Ga0075365_10165895
1995 Ga0075364_10056676
1996 Ga0075364_10406976
1997 Ga0075432_10007140
1998 Ga0075432_10036196
1999 Ga0075432_10081102
2000 Ga0075432_10158191
2001 Ga0075432_10263775
2002 Ga0070715_10016227
2003 Ga0070715_10034332
2004 Ga0070716_100024186
2005 Ga0070716_100265100
2006 Ga0070716_100302279
2007 Ga0070712_100004135
2008 Ga0070712_100007311
2009 Ga0070712_100008944
2010 Ga0070712_100032793
2011 Ga0070712_100075604
2012 Ga0070712_100092967
2013 Ga0070712_100101638
2014 Ga0070712_100138284
2015 Ga0070712_100168426
2016 Ga0070712_100211899
2017 Ga0070712_100312338
2018 Ga0070712_100648718
2019 Ga0075367_10435812
2020 Ga0097621_100051449
2021 Ga0097621_100059073
2022 Ga0097621_100132876
2023 Ga0068871_100111216
2024 Ga0068871_100497011
2025 Ga0068871_100540416
2026 Ga0075428_100002462
2027 Ga0075428_100006164
2028 Ga0075428_100026974
2029 Ga0075428_100049565
2030 Ga0075430_100028108
2031 Ga0075431_100049961
2032 Ga0075431_100054729
2033 Ga0075431_100640038
2034 Ga0075433_10011114
2035 Ga0075433_10022776
2036 Ga0075433_10063154
2037 Ga0075433_10074345
2038 Ga0075433_10157851
2039 Ga0075433_10181683
2040 Ga0075433_10321726
2041 Ga0075433_10635639
2042 Ga0075434_100005449
2043 Ga0075434_100009920
2044 Ga0075434_100057027
2045 Ga0075434_100286697
2046 Ga0075434_100303356
2047 Ga0075434_100423864
2048 Ga0075429_100078431
2049 Ga0075429_100190995
2050 Ga0075429_100339485
2051 Ga0075429_100339501
2052 Ga0068865_100005364
2053 Ga0068865_100060652
2054 Ga0068865_100152386
2055 Ga0068865_100164694
2056 Ga0068865_100295826
2057 Ga0075436_100006590
2058 Ga0075436_100068838
2059 Ga0075436_100082955
2060 Ga0075436_100131321
2061 Ga0075436_100361270
2062 Ga0097620_100032440
2063 Ga0097620_100062921
2064 Ga0075435_100003169
2065 Ga0075435_100007721
2066 Ga0075435_100008977
2067 Ga0075435_100016108
2068 Ga0075435_100016746
2069 Ga0075435_100180006
2070 Ga0075435_100239974
2071 Ga0075435_100585655
2072 Ga0075435_100585896
2073 Ga0105244_10168129
2074 Ga0105240_10044774
2075 Ga0105240_10045214
2076 Ga0105240_10114108
2077 Ga0105240_10271865
2078 Ga0111539_10047436
2079 Ga0111539_10061220
2080 Ga0111539_10138710
2081 Ga0111539_10329014
2082 Ga0111539_10496540
2083 Ga0111539_10634155
2084 Ga0111539_11003456
2085 Ga0105245_10023009
2086 Ga0105245_10027905
2087 Ga0105245_10036938
2088 Ga0105245_10044229
2089 Ga0105245_10066760
2090 Ga0105245_10079060
2091 Ga0105245_10121540
2092 Ga0105245_10150671
2093 Ga0105245_10209966
2094 Ga0105245_10700389
2095 Ga0105247_10043907
2096 Ga0105247_10354144
2097 Ga0114129_10006249
2098 Ga0114129_10125698
2099 Ga0114129_10178475
2100 Ga0114129_10191791
2101 Ga0114129_10621807
2102 Ga0114129_11425016
2103 Ga0105243_10006847
2104 Ga0105243_10039621
2105 Ga0105243_10123101
2106 Ga0105243_10272538
2107 Ga0105243_10359193
2108 Ga0105243_10394915
2109 Ga0105243_10474224
2110 Ga0105243_10504366
2111 Ga0105243_10869198
2112 Ga0105241_10113301
2113 Ga0105241_10241149
2114 Ga0105241_10381692
2115 Ga0105241_10574183
2116 Ga0105242_10035231
2117 Ga0105242_10040577
2118 Ga0105242_10115023
2119 Ga0105242_10344748
2120 Ga0105242_10361371
2121 Ga0105242_11128544
2122 Ga0105248_10135315
2123 Ga0105248_10161467
2124 Ga0105248_10327251
2125 Ga0105248_10476501
2126 Ga0105248_10753111
2127 Ga0105248_10970448
2128 Ga0105248_11138158
2129 Ga0105237_10062071
2130 Ga0105237_10195336
2131 Ga0105237_10686176
2132 Ga0105238_10008375
2133 Ga0105238_10029321
2134 Ga0105238_10063360
2135 Ga0105238_10078628
2136 Ga0105238_10234795
2137 Ga0105238_10297729
2138 Ga0105249_10034809
2139 Ga0105249_10061851
2140 Ga0105249_10257516
2141 Ga0105249_10258319
2142 Ga0105249_10285600
2143 Ga0105249_11129483
2144 Ga0105239_10021548
2145 Ga0105239_10033183
2146 Ga0105239_10124023
2147 Ga0105239_10138331
2148 Ga0105239_10195424
2149 Ga0105239_10198370
2150 Ga0105239_10218459
2151 Ga0105239_10219189
2152 Ga0105239_10261916
2153 Ga0105239_10267794
2154 Ga0105239_10323754
2155 Ga0105239_10471539
2156 Ga0105239_10815482
2157 Ga0105246_10003029
2158 Ga0105246_10040204
2159 Ga0105246_10050220
2160 Ga0105246_10184501
2161 Ga0105246_10417380
2162 Ga0105246_10475029
2163 Ga0105246_10816008
2164 Ga0157373_10042382
2165 Ga0157373_10199124
2166 Ga0157371_10008246
2167 Ga0157371_10075482
2168 Ga0157371_10292949
2169 Ga0157370_10046230
2170 Ga0157370_10104911
2171 Ga0157370_10113885
2172 Ga0157370_10161676
2173 Ga0157369_10004625
2174 Ga0157369_10021973
2175 Ga0157369_10026569
2176 Ga0157369_10129622
2177 Ga0157369_10147727
2178 Ga0157369_10196375
2179 Ga0157369_10725844
2180 Ga0157369_10991725
2181 Ga0157374_10060738
2182 Ga0157374_10248853
2183 Ga0157374_10265945
2184 Ga0157374_10788798
2185 Ga0157378_10129250
2186 Ga0157378_10242951
2187 Ga0157378_10267958
2188 Ga0157378_10394621
2189 Ga0157378_10522424
2190 Ga0163162_10018602
2191 Ga0163162_10022756
2192 Ga0163162_10035011
2193 Ga0163162_10046153
2194 Ga0163162_10099389
2195 Ga0163162_10228040
2196 Ga0163162_10620489
2197 Ga0157372_10006343
2198 Ga0157372_10023387
2199 Ga0157372_10055119
2200 Ga0157372_10064467
2201 Ga0157372_10131746
2202 Ga0157372_10177549
2203 Ga0157372_10191967
2204 Ga0157372_10206599
2205 Ga0157372_10270410
2206 Ga0157372_10727179
2207 Ga0157372_10877217
2208 Ga0157372_10898117
2209 Ga0157375_10017225
2210 Ga0157375_10041947
2211 Ga0157375_10148964
2212 Ga0157375_10185272
2213 Ga0157375_10253549
2214 Ga0157375_10409981
2215 Ga0157375_10897336
2216 Ga0157375_10947283
2217 Ga0157375_11044291
2218 Ga0157375_11087690
2219 Ga0163163_10043357
2220 Ga0163163_10059175
2221 Ga0163163_10090522
2222 Ga0163163_10263426
2223 Ga0157380_10019074
2224 Ga0157380_10101333
2225 Ga0157380_10113798
2226 Ga0157380_11084390
2227 Ga0182008_10032298
2228 Ga0157377_10086028
2229 Ga0157377_10112053
2230 Ga0157377_10118896
2231 Ga0157377_10675811
2232 Ga0157379_10193381
2233 Ga0157376_10036355
2234 Ga0157376_10079541
2235 Ga0157376_10079568
2236 Ga0157376_10149889
2237 Ga0157376_10205176
2238 Ga0157376_10222577
2239 Ga0163161_10014703
2240 Ga0163161_10110429
2241 Ga0163161_10647234
2242 Ga0197907_10107874
2243 Ga0197907_10487754
2244 Ga0197907_10805701
2245 Ga0197907_11270642
2246 Ga0206356_10067745
2247 Ga0206356_10097950
2248 Ga0206356_10171147
2249 Ga0206356_10264527
2250 Ga0206356_10570442
2251 Ga0206356_10612509
2252 Ga0206356_11872195
2253 Ga0206349_1478788
2254 Ga0206349_1884143
2255 Ga0206351_10455175
2256 Ga0206352_11114125
2257 Ga0206350_10825078
2258 Ga0206354_10022075
2259 Ga0206354_10431597
2260 Ga0206354_10806399
2261 Ga0206354_10808118
2262 Ga0206354_11620124
2263 Ga0206353_10391836
2264 Ga0206353_10658960
2265 Ga0206353_11419015
2266 Ga0206353_11715061
2267 Ga0224712_10042100
2268 Ga0224712_10119489
2269 Ga0224712_10269491
2270 Ga0207656_10060160
2271 Ga0207653_10040613
2272 Ga0207653_10051409
2273 Ga0207692_10017224
2274 Ga0207692_10145206
2275 Ga0207642_10041998
2276 Ga0207642_10094797
2277 Ga0207642_10111509
2278 Ga0207642_10191989
2279 Ga0207710_10037491
2280 Ga0207710_10238893
2281 Ga0207688_10000576
2282 Ga0207688_10002719
2283 Ga0207688_10062897
2284 Ga0207688_10076163
2285 Ga0207688_10309558
2286 Ga0207647_10096916
2287 Ga0207647_10100288
2288 Ga0207685_10021761
2289 Ga0207685_10160682
2290 Ga0207685_10205544
2291 Ga0207685_10395120
2292 Ga0207699_10017149
2293 Ga0207699_10067659
2294 Ga0207699_10189788
2295 Ga0207699_10570230
2296 Ga0207645_10024006
2297 Ga0207645_10154103
2298 Ga0207645_10278202
2299 Ga0207643_10033073
2300 Ga0207643_10105670
2301 Ga0207705_10187867
2302 Ga0207705_10229159
2303 Ga0207705_10627994
2304 Ga0207705_10752019
2305 Ga0207654_10035768
2306 Ga0207654_10420862
2307 Ga0207654_10456460
2308 Ga0207707_10097301
2309 Ga0207707_10137608
2310 Ga0207707_10141899
2311 Ga0207707_10243644
2312 Ga0207707_10277199
2313 Ga0207707_10358546
2314 Ga0207707_10630481
2315 Ga0207695_10024968
2316 Ga0207695_10390970
2317 Ga0207671_10241174
2318 Ga0207671_10247315
2319 Ga0207671_10554836
2320 Ga0207693_10008180
2321 Ga0207693_10012583
2322 Ga0207693_10016960
2323 Ga0207693_10017316
2324 Ga0207693_10032082
2325 Ga0207693_10053613
2326 Ga0207693_10064051
2327 Ga0207693_10069882
2328 Ga0207693_10073799
2329 Ga0207693_10079885
2330 Ga0207693_10080820
2331 Ga0207663_10016349
2332 Ga0207663_10017385
2333 Ga0207663_10033480
2334 Ga0207663_10052872
2335 Ga0207663_10055380
2336 Ga0207663_10176500
2337 Ga0207663_10196344
2338 Ga0207663_10225185
2339 Ga0207663_10226143
2340 Ga0207660_10111595
2341 Ga0207660_10281261
2342 Ga0207660_10393594
2343 Ga0207660_10398565
2344 Ga0207660_10421434
2345 Ga0207660_10452665
2346 Ga0207662_10138917
2347 Ga0207662_10159113
2348 Ga0207662_10177250
2349 Ga0207657_10008583
2350 Ga0207657_10009230
2351 Ga0207657_10016295
2352 Ga0207657_10021109
2353 Ga0207657_10099966
2354 Ga0207657_10161025
2355 Ga0207657_10272647
2356 Ga0207657_10353343
2357 Ga0207657_10369915
2358 Ga0207649_10164389
2359 Ga0207649_10229103
2360 Ga0207649_10237364
2361 Ga0207649_10493745
2362 Ga0207649_10710407
2363 Ga0207649_10863701
2364 Ga0207652_10041627
2365 Ga0207652_10043852
2366 Ga0207652_10096545
2367 Ga0207652_10181291
2368 Ga0207652_10201690
2369 Ga0207652_10209402
2370 Ga0207652_10398170
2371 Ga0207681_10191444
2372 Ga0207681_10324206
2373 Ga0207681_10438031
2374 Ga0207694_10029479
2375 Ga0207694_10117246
2376 Ga0207694_10164544
2377 Ga0207694_10407488
2378 Ga0207650_10199701
2379 Ga0207659_10292590
2380 Ga0207659_10338888
2381 Ga0207659_10742315
2382 Ga0207687_10001941
2383 Ga0207687_10011006
2384 Ga0207687_10032121
2385 Ga0207687_10047134
2386 Ga0207687_10054720
2387 Ga0207687_10063882
2388 Ga0207687_10247444
2389 Ga0207687_10250347
2390 Ga0207687_10299026
2391 Ga0207687_10569005
2392 Ga0207687_10637087
2393 Ga0207700_10000001
2394 Ga0207700_10475324
2395 Ga0207700_10620135
2396 Ga0207700_10674333
2397 Ga0207700_10690587
2398 Ga0207664_10005882
2399 Ga0207664_10031936
2400 Ga0207664_10163281
2401 Ga0207664_10211966
2402 Ga0207664_10335989
2403 Ga0207664_10648295
2404 Ga0207664_10748073
2405 Ga0207664_10851313
2406 Ga0207644_10279142
2407 Ga0207644_10337877
2408 Ga0207644_10384764
2409 Ga0207690_10165745
2410 Ga0207690_10299356
2411 Ga0207690_10342908
2412 Ga0207690_10489908
2413 Ga0207706_10014884
2414 Ga0207706_10026610
2415 Ga0207706_10053169
2416 Ga0207706_10056049
2417 Ga0207706_10120338
2418 Ga0207686_10055335
2419 Ga0207686_10159024
2420 Ga0207686_10209980
2421 Ga0207686_10345725
2422 Ga0207686_10927681
2423 Ga0207709_10046305
2424 Ga0207709_10070402
2425 Ga0207709_10081294
2426 Ga0207709_10144464
2427 Ga0207709_10162421
2428 Ga0207709_10171171
2429 Ga0207709_10598813
2430 Ga0207709_10687388
2431 Ga0207670_10237062
2432 Ga0207669_10117922
2433 Ga0207669_10178613
2434 Ga0207704_10042563
2435 Ga0207704_10135136
2436 Ga0207704_10154027
2437 Ga0207704_10359639
2438 Ga0207704_10643863
2439 Ga0207665_10003372
2440 Ga0207665_10014891
2441 Ga0207665_10027262
2442 Ga0207665_10065816
2443 Ga0207665_10134050
2444 Ga0207691_10018191
2445 Ga0207691_10481773
2446 Ga0207711_10096112
2447 Ga0207711_10175360
2448 Ga0207711_10206244
2449 Ga0207711_10421019
2450 Ga0207711_10603468
2451 Ga0207689_10071536
2452 Ga0207689_10079779
2453 Ga0207661_10002762
2454 Ga0207661_10062252
2455 Ga0207661_10083440
2456 Ga0207661_10145258
2457 Ga0207661_10225098
2458 Ga0207661_10227083
2459 Ga0207661_10321721
2460 Ga0207661_10512927
2461 Ga0207679_10122283
2462 Ga0207679_10140319
2463 Ga0207679_10220576
2464 Ga0207679_10261620
2465 Ga0207679_10262513
2466 Ga0207679_10864951
2467 Ga0207667_10018802
2468 Ga0207667_10035997
2469 Ga0207667_10101370
2470 Ga0207667_10136410
2471 Ga0207667_10861754
2472 Ga0207712_10043069
2473 Ga0207712_10073361
2474 Ga0207712_10127552
2475 Ga0207668_10121814
2476 Ga0207668_10266913
2477 Ga0207668_10429887
2478 Ga0207668_10970339
2479 Ga0207640_10196601
2480 Ga0207640_10366863
2481 Ga0207658_10312966
2482 Ga0207677_10032125
2483 Ga0207677_10266283
2484 Ga0207677_10322542
2485 Ga0207677_10537715
2486 Ga0207677_10572387
2487 Ga0207703_11140213
2488 Ga0207639_10041448
2489 Ga0207639_10458011
2490 Ga0207639_10826130
2491 Ga0207678_10004108
2492 Ga0207678_10039819
2493 Ga0207678_10237011
2494 Ga0207678_10419968
2495 Ga0207708_10003490
2496 Ga0207708_10018401
2497 Ga0207708_10020508
2498 Ga0207702_10011413
2499 Ga0207702_10314778
2500 Ga0207702_10609487
2501 Ga0207702_10688835
2502 Ga0207702_10725804
2503 Ga0207702_10933307
2504 Ga0207702_11052661
2505 Ga0207641_10483437
2506 Ga0207648_10013106
2507 Ga0207648_10034985
2508 Ga0207648_10046259
2509 Ga0207648_10111797
2510 Ga0207676_10142455
2511 Ga0207676_10403186
2512 Ga0207676_10602740
2513 Ga0207676_10753919
2514 Ga0207674_10002797
2515 Ga0207674_10003158
2516 Ga0207674_10070528
2517 Ga0207674_10148470
2518 Ga0207674_10292968
2519 Ga0207674_10796660
2520 Ga0207675_100014301
2521 Ga0207675_100028238
2522 Ga0207675_100028247
2523 Ga0207675_100275851
2524 Ga0207675_100276046
2525 Ga0207675_100418102
2526 Ga0207675_100703200
2527 Ga0207683_10019866
2528 Ga0207683_10025027
2529 Ga0207683_10045184
2530 Ga0207683_10046558
2531 Ga0207683_10050227
2532 Ga0207683_10073743
2533 Ga0207698_10061364
2534 Ga0207698_10109155
2535 Ga0207698_10271867
2536 Ga0207698_10278494
2537 Ga0207698_10284055
2538 Ga0207698_10590176
2539 Ga0207698_10901387
2540 Ga0207698_10964069
2541 Ga0209996_1013331
2542 Ga0209974_10031452
2543 Ga0207428_10000961
2544 Ga0207428_10001607
2545 Ga0207428_10006497
2546 Ga0207428_10029057
2547 Ga0207428_10050377
2548 Ga0207428_10186543
2549 Ga0207428_10366783
2550 Ga0268266_10145897
2551 Ga0268266_10776320
2552 Ga0268265_10236389
2553 Ga0268265_10459475
2554 Ga0268265_10548326
2555 Ga0268264_10223970
2556 Ga0268264_11307906
2557 Ga0265338_10006932
2558 Ga0265327_10003464
2559 Ga0307408_100055125
2560 Ga0307408_101015725
2561 Ga0307405_10034016
2562 Ga0307413_10072009
2563 Ga0307410_10413128
2564 Ga0307406_10527070
2565 Ga0307412_10421648
2566 Ga0307409_100222604
2567 Ga0307409_100668260
2568 Ga0307416_100027433
2569 Ga0307416_100158165
2570 Ga0307416_100937076
2571 Ga0307414_10657807
2572 Ga0307415_100101915
2573 Ga0307415_100466596
2574 Ga0373930_0019390
2575 Ga0373948_0010741
2576 Ga0373948_0047377
2577 Ga0373958_0038305
2578 Ga0373959_0024307
2579 Ga0373959_0047639
2580 Ga0373938_0001710
2581 Ga0373938_0040779
2582 Ga0373926_0061506
2583 Ga0373928_0003299
2584 Ga0373928_0006972
2585 Ga0373929_0007133
2586 Ga0373940_0080041
2587 Ga0373944_0021946
2588 Ga0373949_0007106
2589 Ga0373949_0017025
2590 Ga0373951_0015729
2591 Ga0373952_0003220
2592 Ga0373952_0019049
2593 Ga0373932_0064366
2594 Ga0373939_0008646
2595 Ga0373939_0026767
2596 Ga0373939_0044986
2597 Ga0373941_0010231
2598 Ga0373941_0034259
2599 Ga0373945_0060922
2600 Ga0373945_0095234
2601 Ga0373957_0131858
2602 Ga0373960_0002600
2603 Ga0373960_0013535
2604 Ga0373960_0026376
2605 Ga0373943_0000446
2606 Ga0373943_0003706
2607 Ga0373943_0031704
2608 Ga0373943_0051298
2609 Ga0373943_0091074
2610 Ga0373943_0133294
2611 Ga0373946_0004785
2612 Ga0373946_0005191
2613 Ga0373942_0026511
2614 Ga0373961_0013443
2615 Ga0373961_0030492
2616 Ga0373962_0003042
2617 Ga0373924_0082499
2618 Ga0373924_0295082
2619 Ga0373931_0018151
2620 Ga0373931_0128582
2621 Ga0373931_0142142
2622 Ga0373931_0525117
2623 Ga0373935_0029195
2624 Ga0373935_0041188
2625 Ga0373935_0041505
2626 Ga0373935_0172203
2627 Ga0373927_0187623
2628 Ga0373927_0236852
2629 Ga0373927_0304819
2630 Ga0373947_0000387
2631 Ga0373947_0003076
2632 Ga0373947_0004637
2633 Ga0373947_0012427
2634 Ga0373947_0124486
2635 Ga0373947_0225748
2636 Ga0373937_0085424
2637 Ga0373937_0210250
2638 Ga0373925_0002635
2639 Ga0373925_0011235
2640 Ga0373925_0015834
2641 Ga0373925_0018474
2642 Ga0373925_0470224
2643 Ga0373925_0571140
2644 Ga0395899_0010199
2645 Ga0395899_0026595
2646 Ga0395899_0241795
2647 Ga0395899_0313081
2648 Ga0395900_0001765
2649 Ga0395900_0024611
2650 Ga0395900_0038851
2651 Ga0395900_0065148
2652 Ga0395900_0073283
2653 Ga0395900_0094470
2654 Ga0395900_0096260
2655 Ga0395900_0129191
2656 Ga0395900_0145096
2657 Ga0395900_0165005
2658 Ga0395900_0358822
2659 Ga0395898_0020703
2660 Ga0395898_0021612
2661 Ga0395898_0040761
2662 Ga0395898_0063732
2663 Ga0395898_0112160
2664 Ga0395898_0129986
2665 Ga0395898_0157867
2666 Ga0395898_0190194
2667 Ga0395898_0228586
2668 Ga0395898_0293680
2669 Ga0395898_0346623
2670 Ga0395898_0457106
2671 Ga0395898_0533152
2672 Ga0395898_0812453
2673 Ga0395905_0002747
2674 Ga0395905_0037931
2675 Ga0395905_0039926
2676 Ga0395905_0090396
2677 Ga0395905_0145492
2678 Ga0395905_0146059
2679 Ga0395905_0188859
2680 Ga0395905_0638865
2681 Ga0395905_0954241
2682 Ga0395901_0004202
2683 Ga0395901_0033421
2684 Ga0395901_0058456
2685 Ga0395901_0106519
2686 Ga0395901_0128766
2687 Ga0395901_0144071
2688 Ga0395901_0176004
2689 Ga0395901_0209606
2690 Ga0395901_0220128
2691 Ga0395901_0316314
2692 Ga0395901_0560410
2693 Ga0395901_0743451
2694 Ga0439438_060592
2695 Ga0439461_0049123
2696 Ga0451793_1843478
2697 Ga0451800_0491729
2698 Ga0451802_1410741
2699 Ga0451835_0095057
2700 Ga0451841_0601019
2701 Ga0451853_2781693
2702 Ga0439448_0064681
2703 Ga0439454_012833
2704 Ga0439455_0106311
2705 Ga0439462_0106059
2706 Ga0450912_007473
2707 Ga0450906_012998
2708 Ga0450908_008473
2709 Ga0439435_0019544
2710 Ga0450916_020664
2711 Ga0466961_0116983
2712 Ga0466963_0008227
2713 Ga0466963_0038413
2714 Ga0466963_0047675
2715 Ga0466963_0048740
2716 Ga0466964_0017660
2717 Ga0466968_0002483
2718 Ga0466957_0038787
2719 Ga0466960_0065768
2720 Ga0466959_0055049
2721 Ga0451576_0025840
2722 Ga0466958_0039270
2723 Ga0466967_0003096
2724 Ga0466967_0009282
2725 Ga0466967_0064789
2726 Ga0466967_0099229
2727 Ga0466967_0110372
2728 Ga0466967_0239583
2729 Ga0466967_0483065
2730 Ga0466967_0827802
2731 Ga0466967_0872312
2732 Ga0466967_1201627
2733 Ga0495617_120635
2734 Ga0495592_0187718
2735 Ga0495592_0261417
2736 Ga0495603_0000339
2737 Ga0495603_0010219
2738 Ga0495603_0048054
2739 Ga0495603_0139749
2740 Ga0495603_0263240
2741 Ga0495603_0322226
2742 Ga0495629_0000756
2743 Ga0495629_0105012
2744 Ga0495629_0133718
2745 Ga0495629_0176756
2746 Ga0495629_0185828
2747 Ga0495641_0000626
2748 Ga0495641_0009085
2749 Ga0495651_0052345
2750 Ga0495651_0194067
2751 Ga0495651_0238905
2752 Ga0495653_0009151
2753 Ga0495653_0034594
2754 Ga0495653_0084723
2755 Ga0495653_0090549
2756 Ga0495653_0356485
2757 Ga0495653_0516025
2758 Ga0495653_0543703
2759 Ga0495580_0098927
2760 Ga0495580_0158110
2761 Ga0495580_0212312
2762 Ga0495580_0285844
2763 Ga0495582_0001691
2764 Ga0495582_0004256
2765 Ga0495582_0007425
2766 Ga0495582_0030194
2767 Ga0495582_0032842
2768 Ga0495639_0000390
2769 Ga0495639_0000932
2770 Ga0495639_0006417
2771 Ga0495639_0078952
2772 Ga0495662_0001935
2773 Ga0495662_0010854
2774 Ga0495662_0034980
2775 Ga0495664_0006141
2776 Ga0495664_0181767
2777 Ga0495594_0001020
2778 Ga0495594_0191687
2779 Ga0495607_0320033
2780 Ga0495608_0031672
2781 Ga0495608_0035495
2782 Ga0495618_0015162
2783 Ga0495618_0067762
2784 Ga0495618_0126627
2785 Ga0495618_0144683
2786 Ga0495628_0547974
2787 Ga0495630_0006174
2788 Ga0495630_0011353
2789 Ga0495630_0015527
2790 Ga0495630_0038463
2791 Ga0495630_0269249
2792 Ga0495630_0305056
2793 Ga0495630_0461030
2794 Ga0495666_0002371
2795 Ga0495666_0068093
2796 Ga0495666_0074018
2797 Ga0495666_0081208
2798 Ga0495652_0125804
2799 Ga0495652_0129266
2800 Ga0495652_0243857
2801 Ga0495652_0312101
2802 Ga0495652_0417761
2803 Ga0495665_0001013
2804 Ga0495665_0005059
2805 Ga0495665_0033964
2806 Ga0495640_0008914
2807 Ga0495640_0039874
2808 Ga0495640_0049800
2809 Ga0495640_0385773
2810 Ga0495586_0265469
2811 Ga0495587_0134726
2812 Ga0495587_0165161
2813 Ga0495645_0282942
2814 Ga0495622_0134656
2815 Ga0495667_0019358
2816 Ga0495667_0055301
2817 Ga0495667_0062901
2818 Ga0495667_0299529
2819 Ga0495668_0187250
2820 Ga0495634_0023836
2821 Ga0495634_0028213
2822 Ga0495634_0034230
2823 Ga0495634_0137783
2824 Ga0495634_0304611
2825 Ga0495635_0022086
2826 Ga0495635_0023627
2827 Ga0495635_0052541
2828 Ga0495635_0116442
2829 Ga0495635_0159386
2830 Ga0495588_0000863
2831 Ga0495588_0044492
2832 Ga0495657_0015061
2833 Ga0495657_0048063
2834 Ga0495657_0096510
2835 Ga0495599_0025318
2836 Ga0495599_0216475
2837 Ga0495599_0364031
2838 Ga0495623_0004791
2839 Ga0495623_0057491
2840 Ga0495623_0189932
2841 Ga0495646_0038823
2842 Ga0495646_0185193
2843 Ga0495646_0434089
2844 Ga0495647_0007286
2845 Ga0495647_0007772
2846 Ga0495647_0017457
2847 Ga0495647_0165297
2848 Ga0495658_0000477
2849 Ga0495658_0002681
2850 Ga0495658_0012424
2851 Ga0495658_0067838
2852 Ga0495658_0169632
2853 Ga0495658_0651318
2854 Ga0495613_0012014
2855 Ga0495613_0027883
2856 Ga0495613_0035174
2857 Ga0495613_0082324
2858 Ga0495613_0151997
2859 Ga0495613_0171905
2860 Ga0495624_0005965
2861 Ga0495624_0011629
2862 Ga0495624_0026113
2863 Ga0495589_0136762
2864 Ga0495589_0158424
2865 Ga0495600_0060012
2866 Ga0495600_0182986
2867 Ga0495600_0187762
2868 Ga0495600_0226368
2869 Ga0495581_0004713
2870 Ga0495581_0010091
2871 Ga0495581_0010557
2872 Ga0495581_0012180
2873 Ga0495581_0043668
2874 Ga0495604_0094893
2875 Ga0495604_0207962
2876 Ga0495604_0229187
2877 Ga0495604_0337871
2878 Ga0495674_0001928
2879 Ga0495674_0013017
2880 Ga0495674_0020329
2881 Ga0495674_0092217
2882 Ga0495674_0095249
2883 Ga0495674_0182686
2884 Ga0495674_0323449
2885 Ga0495674_0396684
2886 Ga0495674_0454988
2887 Ga0495676_0007375
2888 Ga0495676_0008869
2889 Ga0495676_0039732
2890 Ga0495676_0067394
2891 Ga0495676_0159325
2892 Ga0495676_0351462
2893 Ga0495680_0001918
2894 Ga0495680_0002863
2895 Ga0495680_0023233
2896 Ga0495680_0035097
2897 Ga0495683_0170283
2898 Ga0495677_0068950
2899 Ga0495677_0178389
2900 Ga0495684_0017343
2901 Ga0495684_0058385
2902 Ga0495684_0067293
2903 Ga0495684_0080217
2904 Ga0495684_0096431
2905 Ga0495593_0002453
2906 Ga0495593_0016019
2907 Ga0495593_0096453
2908 Ga0495602_0088357
2909 Ga0495602_0122659
2910 Ga0495602_0138240
2911 Ga0495614_0002561
2912 Ga0495614_0015876
2913 Ga0495614_0024565
2914 Ga0495614_0090968
2915 Ga0495626_0101351
2916 Ga0496100_0001475
2917 Ga0496100_0017504
2918 Ga0496100_0019881
2919 Ga0496100_0049942
2920 Ga0496100_0050735
2921 Ga0496100_0069499
2922 Ga0496100_0073748
2923 Ga0496100_0108686
2924 Ga0496100_0217962
2925 Ga0496100_0222008
2926 Ga0496100_0248643
2927 Ga0496100_0272832
2928 Ga0496100_0326122
2929 Ga0496100_0438652
2930 Ga0496100_0694413
2931 Ga0496101_0007713
2932 Ga0496101_0008020
2933 Ga0496101_0010537
2934 Ga0496101_0012675
2935 Ga0496101_0015235
2936 Ga0496101_0015329
2937 Ga0496101_0031551
2938 Ga0496101_0042041
2939 Ga0496101_0055799
2940 Ga0496101_0075160
2941 Ga0496101_0138526
2942 Ga0496101_0160097
2943 Ga0496101_0225615
2944 Ga0496101_0459305
2945 Ga0496102_0005018
2946 Ga0496102_0006410
2947 Ga0496102_0009237
2948 Ga0496102_0019899
2949 Ga0496102_0034806
2950 Ga0496102_0103107
2951 Ga0496102_0110844
2952 Ga0496102_0175055
2953 Ga0496102_0180029
2954 Ga0496102_0366048
2955 Ga0496102_0624643
2956 Ga0496102_0643475
2957 Ga0496103_0001794
2958 Ga0496103_0007950
2959 Ga0496103_0044591
2960 Ga0496103_0061127
2961 Ga0496103_0109678
2962 Ga0496103_0221664
2963 Ga0496103_0228741
2964 Ga0496103_0407035
2965 Ga0496103_0410661
2966 Ga0496104_0000461
2967 Ga0496104_0000494
2968 Ga0496104_0011694
2969 Ga0496104_0013270
2970 Ga0496104_0025462
2971 Ga0496104_0048035
2972 Ga0496104_0048116
2973 Ga0496104_0143755
2974 Ga0496104_0192690
2975 Ga0496104_0228606
2976 Ga0496104_0246772
2977 Ga0496104_0263856
2978 Ga0496104_0305216
2979 Ga0496104_0314598
2980 Ga0496104_0337666
2981 Ga0496104_0337782
2982 Ga0496104_0385445
2983 Ga0496105_0000673
2984 Ga0496105_0000930
2985 Ga0496105_0001972
2986 Ga0496105_0010729
2987 Ga0496105_0020091
2988 Ga0496105_0025579
2989 Ga0496105_0044586
2990 Ga0496105_0048906
2991 Ga0496105_0054206
2992 Ga0496105_0076428
2993 Ga0496105_0214849
2994 Ga0496105_0245973
2995 Ga0496105_0287771
2996 Ga0496105_0347036
2997 Ga0496105_0389499
2998 Ga0496105_0412356
2999 Ga0496106_0000456
3000 Ga0496106_0008749
3001 Ga0496106_0012301
3002 Ga0496106_0014956
3003 Ga0496106_0037415
3004 Ga0496106_0039147
3005 Ga0496106_0043208
3006 Ga0496106_0097556
3007 Ga0496106_0098188
3008 Ga0496106_0117405
3009 Ga0496106_0411097
3010 Ga0496106_0485265
3011 Ga0496106_0661871
3012 Ga0496107_0000980
3013 Ga0496107_0011989
3014 Ga0496107_0019088
3015 Ga0496107_0021993
3016 Ga0496107_0043490
3017 Ga0496107_0043609
3018 Ga0496107_0045805
3019 Ga0496107_0072819
3020 Ga0496107_0235465
3021 Ga0496108_0003532
3022 Ga0496108_0004458
3023 Ga0496108_0011668
3024 Ga0496108_0025218
3025 Ga0496108_0025655
3026 Ga0496108_0029090
3027 Ga0496108_0052736
3028 Ga0496108_0069163
3029 Ga0496108_0091374
3030 Ga0496108_0119196
3031 Ga0496108_0184967
3032 Ga0496108_0407703
3033 Ga0496108_0432807
3034 Ga0496108_0682290
3035 Ga0496109_0001074
3036 Ga0496109_0003058
3037 Ga0496109_0003358
3038 Ga0496109_0009488
3039 Ga0496109_0010424
3040 Ga0496109_0032256
3041 Ga0496109_0044210
3042 Ga0496109_0064767
3043 Ga0496109_0080620
3044 Ga0496109_0083336
3045 Ga0496109_0166118
3046 Ga0496109_0185725
3047 Ga0496109_0220819
3048 Ga0496109_0255278
3049 Ga0496109_0473632
3050 Ga0496109_0478020
3051 Ga0496109_0494366
3052 Ga0496109_0663136
3053 Ga0496110_0000072
3054 Ga0496110_0004711
3055 Ga0496110_0006848
3056 Ga0496110_0009248
3057 Ga0496110_0011742
3058 Ga0496110_0016180
3059 Ga0496110_0028108
3060 Ga0496110_0080889
3061 Ga0496110_0097611
3062 Ga0496110_0131496
3063 Ga0496110_0541663
3064 Ga0496110_0583391
3065 Ga0496110_0816806
3066 Ga0496111_0001669
3067 Ga0496111_0003404
3068 Ga0496111_0009077
3069 Ga0496111_0016303
3070 Ga0496111_0047674
3071 Ga0496111_0101301
3072 Ga0496111_0119445
3073 Ga0496111_0133472
3074 Ga0496111_0152670
3075 Ga0496111_0196071
3076 Ga0496111_0280505
3077 Ga0496111_0406941
3078 Ga0496112_0000684
3079 Ga0496112_0002604
3080 Ga0496112_0005435
3081 Ga0496112_0008124
3082 Ga0496112_0033515
3083 Ga0496112_0062620
3084 Ga0496112_0341475
3085 Ga0496112_0551344
3086 Ga0496112_0700041
3087 Ga0496113_0000076
3088 Ga0496113_0000337
3089 Ga0496113_0018937
3090 Ga0496113_0018975
3091 Ga0496113_0065474
3092 Ga0496113_0291019
3093 Ga0496114_0004595
3094 Ga0496114_0017409
3095 Ga0496114_0021228
3096 Ga0496114_0021672
3097 Ga0496114_0044100
3098 Ga0496114_0046657
3099 Ga0496114_0061063
3100 Ga0496114_0075519
3101 Ga0496114_0086255
3102 Ga0496114_0093474
3103 Ga0496114_0099991
3104 Ga0496114_0125607
3105 Ga0496114_0137945
3106 Ga0496114_0159675
3107 Ga0496114_0164189
3108 Ga0496114_0228804
3109 Ga0496114_0377730
3110 Ga0496114_0378967
3111 Ga0496114_0477456
3112 Ga0496114_0515508
3113 Ga0496114_0805605
3114 Ga0496115_0000719
3115 Ga0496115_0001259
3116 Ga0496115_0001662
3117 Ga0496115_0001827
3118 Ga0496115_0007268
3119 Ga0496115_0011828
3120 Ga0496115_0018979
3121 Ga0496115_0023795
3122 Ga0496115_0061856
3123 Ga0496115_0077714
3124 Ga0496115_0107668
3125 Ga0496115_0206482
3126 Ga0496115_0218948
3127 Ga0496115_0276782
3128 Ga0496115_0389173
3129 Ga0496115_0522745
3130 Ga0496115_0918629
3131 Ga0501031_0555509
3132 Ga0501032_0008328
3133 Ga0501032_0331679
3134 Ga0501033_0066856
3135 Ga0501033_0499633
3136 Ga0501034_0130381
3137 Ga0501034_0439928
3138 Ga0501036_0014658
3139 Ga0501036_0044139
3140 Ga0501036_0082083
3141 Ga0501036_0203390
3142 Ga0501036_0536660
3143 Ga0501036_0539987
3144 Ga0501037_0035866
3145 Ga0501037_0376702
3146 Ga0501038_0033069
3147 Ga0501038_0059269
3148 Ga0501038_0088496
3149 Ga0501038_0221520
3150 Ga0501038_0323996
3151 Ga0501038_0697942
3152 Ga0501039_0003259
3153 Ga0501039_0126905
3154 Ga0501039_0185388
3155 Ga0501039_0287545
3156 Ga0501039_0531596
3157 Ga0501040_0054456
3158 Ga0501040_0194580
3159 Ga0501040_0229908
3160 Ga0501040_0376347
3161 Ga0501041_0026401
3162 Ga0501041_0042202
3163 Ga0501041_0043876
3164 Ga0501042_0047826
3165 Ga0501042_0092004
3166 Ga0501042_0136480
3167 Ga0501042_0141523
3168 Ga0501042_0245109
3169 Ga0501042_0438902
3170 Ga0501043_0033541
3171 Ga0501043_0102568
3172 Ga0501046_0063273
3173 Ga0501046_0190891
3174 Ga0501046_0297804
3175 Ga0501047_0544175
3176 Ga0501048_0006548
3177 Ga0501048_0042780
3178 Ga0501048_0045766
3179 Ga0501048_0063766
3180 Ga0501067_0004883
3181 Ga0501067_0005212
3182 Ga0501067_0010773
3183 Ga0501067_0022805
3184 Ga0501067_0363851
3185 Ga0501068_0001390
3186 Ga0501068_0005336
3187 Ga0501068_0019697
3188 Ga0501068_0049547
3189 Ga0501068_0459237
3190 Ga0501069_0000470
3191 Ga0501069_0002995
3192 Ga0501069_0010273
3193 Ga0501069_0028372
3194 Ga0501069_0028781
3195 Ga0501069_0040377
3196 Ga0501069_0047757
3197 Ga0501070_0030738
3198 Ga0501070_0044521
3199 Ga0501070_0073182
3200 Ga0501070_0088562
3201 Ga0501071_0050788
3202 Ga0501071_0071015
3203 Ga0501071_0128483
3204 Ga0501071_0296317
3205 Ga0501071_0593328
3206 Ga0501072_0002824
3207 Ga0501072_0025295
3208 Ga0501072_0143027
3209 Ga0501072_0193200
3210 Ga0501072_0307827
3211 Ga0501072_0583698
3212 Ga0501073_0005950
3213 Ga0501073_0028698
3214 Ga0501074_0345799
3215 Ga0501075_0002854
3216 Ga0501075_0007123
3217 Ga0501075_0031937
3218 Ga0501075_0096489
3219 Ga0501075_0141996
3220 Ga0501075_0216055
3221 Ga0501075_0218019
3222 Ga0501076_0007880
3223 Ga0501076_0014673
3224 Ga0501076_0069004
3225 Ga0501076_0138495
3226 Ga0501076_0258854
3227 Ga0501076_0605929
3228 Ga0501076_0689121
3229 Ga0501077_0003598
3230 Ga0501077_0004622
3231 Ga0501077_0023897
3232 Ga0501079_0011587
3233 Ga0501079_0045730
3234 Ga0501079_0092391
3235 Ga0501079_0169654
3236 Ga0501079_0532306
3237 Ga0501080_0093613
3238 Ga0501080_0102866
3239 Ga0501080_0171437
3240 Ga0501080_0244416
3241 Ga0501081_0027422
3242 Ga0501081_0045929
3243 Ga0501081_0170440
3244 Ga0501081_0240652
3245 Ga0501081_0555829
3246 Ga0501081_0560939
3247 Ga0501083_0069609
3248 Ga0501083_0428673
3249 Ga0501035_0051074
3250 Ga0501035_0128834
3251 Ga0501044_0012250
3252 Ga0501044_0118900
3253 Ga0501044_0170265
3254 Ga0501045_0016656
3255 Ga0501045_0026095
3256 Ga0501045_0131086
3257 Ga0501045_0250076
3258 Ga0501045_0273864
3259 nmdc:mga00v17_12668_c1
3260 nmdc:mga00v17_157302_c1
3261 nmdc:mga00v17_170753_c1
3262 nmdc:mga0yw44_102161_c1
3263 nmdc:mga0yw44_437603_c1
3264 nmdc:mga06z11_288636_c1
3265 nmdc:mga06z11_396647_c1
3266 nmdc:mga05p37_137064_c1
3267 nmdc:mga05p37_362703_c1
3268 nmdc:mga05p37_55696_c1
3269 nmdc:mga05p37_581011_c1
3270 nmdc:mga05p37_8342_c1
3271 nmdc:mga05p37_86010_c1
3272 nmdc:mga09592_31239_c1
3273 nmdc:mga09592_321574_c1
3274 nmdc:mga09592_93516_c1
3275 nmdc:mga0qj67_19618_c1
3276 nmdc:mga06r32_130564_c1
3277 nmdc:mga06r32_82451_c1
3278 nmdc:mga08y16_164117_c1
3279 nmdc:mga08y16_20510_c1
3280 nmdc:mga08y16_44827_c1
3281 nmdc:mga08y16_48252_c1
3282 nmdc:mga08y16_54622_c1
3283 nmdc:mga08y16_604287_c1
3284 nmdc:mga08y16_660968_c1
3285 nmdc:mga08y16_81858_c1
3286 nmdc:mga0n895_156774_c1
3287 nmdc:mga0n895_18573_c1
3288 nmdc:mga0n895_313511_c1
3289 nmdc:mga0n895_34097_c1
3290 nmdc:mga0n895_343713_c1
3291 nmdc:mga0n895_35345_c1
3292 nmdc:mga0n895_44306_c1
3293 nmdc:mga0n895_4522_c1
3294 nmdc:mga0n895_566713_c1
3295 nmdc:mga0n895_584299_c1
3296 nmdc:mga0n895_637339_c1
3297 nmdc:mga0n895_966105_c1
3298 nmdc:mga0rr50_12864_c1
3299 nmdc:mga0rr50_159064_c1
3300 nmdc:mga0rr50_1603_c1
3301 nmdc:mga0rr50_2621_c1
3302 nmdc:mga0rr50_285989_c1
3303 nmdc:mga0rr50_402333_c1
3304 nmdc:mga0rr50_42678_c1
3305 nmdc:mga0rr50_567094_c1
3306 nmdc:mga0rr50_5699_c1
3307 nmdc:mga0rr50_597306_c1
3308 nmdc:mga0rr50_714807_c1
3309 nmdc:mga0rr50_7541_c1
3310 nmdc:mga0rr50_75521_c1
3311 nmdc:mga08x19_114908_c1
3312 nmdc:mga08x19_201257_c1
3313 nmdc:mga08x19_37222_c1
3314 nmdc:mga08x19_4916_c1
3315 nmdc:mga08x19_59414_c1
3316 nmdc:mga08x19_89056_c1
3317 nmdc:mga08x19_94200_c1
3318 nmdc:mga0a205_121578_c1
3319 nmdc:mga0a205_12370_c1
3320 nmdc:mga0a205_124485_c1
3321 nmdc:mga0a205_147841_c1
3322 nmdc:mga0a205_198981_c1
3323 nmdc:mga0a205_21940_c1
3324 nmdc:mga0a205_48133_c1
3325 nmdc:mga0a205_621551_c1
3326 nmdc:mga0a205_636720_c1
3327 nmdc:mga0a205_642345_c1
3328 nmdc:mga0a205_86140_c1
3329 Ga0495601_0008919
3330 Ga0495601_0016720
3331 Ga0495601_0026644
3332 Ga0495601_0077562
3333 Ga0495601_0086752
3334 Ga0495601_0184735
3335 Ga0495601_0197870
3336 Ga0495601_0213992
3337 Ga0495601_0407533
3338 Ga0495612_0006485
3339 Ga0495612_0015873
3340 Ga0495612_0057381
3341 Ga0495612_0058045
3342 Ga0495612_0106611
3343 Ga0495655_0094649
3344 Ga0495595_0017315
3345 Ga0495595_0045006
3346 Ga0495595_0049129
3347 Ga0495595_0061153
3348 Ga0495619_0002453
3349 Ga0495619_0079924
3350 Ga0495619_0101937
3351 Ga0495619_0205893
3352 Ga0495619_0217454
3353 Ga0495619_0726657
3354 Ga0501084_0022478
3355 Ga0501084_0102219
3356 Ga0501084_0200778
3357 Ga0501084_0719135
3358 Ga0501082_0003529
3359 Ga0501082_0082420
3360 Ga0501082_0142314
3361 Ga0501082_0428303
3362 Ga0501082_0694651
3363 Ga0466962_0052704
3364 Ga0530510_0002635
3365 Ga0530510_0069616
3366 Ga0530510_0096834
3367 Ga0530510_0099375
3368 Ga0530510_0130250
3369 Ga0530510_0157434
3370 Ga0530510_0409752

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2avp-assembly1.cif.gz_A crystal structure of an 8 repeat consensus tpr superhelix 0.9194 121 187
1na3-assembly2.cif.gz_B design of stable alpha-helical arrays from an idealized tpr motif 0.904 120 190
5a31-assembly1.cif.gz_J structure of the human apc-cdh1-hsl1-ubch10 complex. 0.899 123 186
4ui9-assembly1.cif.gz_J atomic structure of the human anaphase-promoting complex 0.899 123 186
1na3-assembly1.cif.gz_A design of stable alpha-helical arrays from an idealized tpr motif 0.8982 120 190
ID Description Score Start End Superfamily
af_A0A1D6H657_109_266_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.943 123 186 1.25.40.10
af_G3UYY4_1785_1856_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9381 120 184 1.25.40.10
af_Q86TZ1_442_519_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9336 119 184 1.25.40.10
af_A4I5Y0_716_784_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9318 121 186 1.25.40.10
af_Q4DHE6_84_178_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9306 121 184 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A538ICF3-F1-model_v4 Cupin domain-containing protein 0.968 25 205
AF-A0A538ICF3-F1-model_v4 Cupin domain-containing protein 0.9526 25 205
AF-A0A7W0T7X3-F1-model_v4 Cupin domain-containing protein 0.9421 21 117
AF-A0A7W0SUB2-F1-model_v4 Cupin domain-containing protein 0.9347 1 212
AF-A0A1F2ST92-F1-model_v4 Uncharacterized protein 0.9189 120 212

Map