F495375
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1696 | 412 | 3370 | 213 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10062716|Ga0111539_100627166 |
| Length | 255 |
| Sequence | MSTPRTYREPRVRVPGLHSASGDVLDGGYDRRLAPTHAIRRAWMNDKPNWKVTRLDDLERRGRDIPVREHLGIHAFGINAYTPGEDGTLINEHDEAGTGQEELYIVLDGKATFEVDGETVDAPPGTFVFVGPESRRKATGDGTVLAVGATPGEAYQGIDWGEAWPFHSESMTAYSEQRYADALEAVRGALERMPDHAGLHYNYACFATLAGETGDDTFAHLRRSVELFPRFREDAPRDDDFAAVRDDPRFEEALR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 4 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 5 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 11 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 12 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 13 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 80 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 90 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 91 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 92 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 99 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 100 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 101 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 102 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 103 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 104 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 105 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 106 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 108 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 134 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 217 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 218 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 219 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 220 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 221 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 222 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 223 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 224 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 225 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 226 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 227 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 228 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 229 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 230 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 231 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 232 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 233 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 234 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 235 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 238 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 240 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 242 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 245 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 246 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 247 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 248 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 251 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 252 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 253 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 254 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 255 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 256 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 259 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 260 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 261 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 262 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 263 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 264 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 265 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 266 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 267 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 268 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 269 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 270 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 271 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 272 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 273 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 274 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 275 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 276 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 277 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 278 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 279 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 280 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 281 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 282 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 283 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 284 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 285 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 286 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 287 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 288 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 289 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 290 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 346 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 347 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 348 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 349 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 350 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 351 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 354 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 355 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 356 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 357 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 358 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 359 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 393 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 394 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 395 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 412 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.35 |
| Metatranscriptomes | 1.65 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.83 |
| Nodule | 0 |
| Rhizoplane | 13.15 |
| Rhizosphere | 85.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0111539_10062716 | 3300009094 | Bacteria | 4399 |
| 2 | ARcpr5yngRDRAFT_c004151 | 3300000043 | Bacteria | 1382 |
| 3 | ARSoilOldRDRAFT_c002807 | 3300000044 | Bacteria | 1519 |
| 4 | ARCol0yngRDRAFT_1001939 | 3300000652 | Bacteria | 1611 |
| 5 | JGI24747J21853_1008829 | 3300001978 | Bacteria | 989 |
| 6 | JGI24739J22299_10095130 | 3300001989 | Bacteria | 903 |
| 7 | JGI24739J22299_10105358 | 3300001989 | Unclassified | 849 |
| 8 | JGI24737J22298_10086158 | 3300001990 | Bacteria | 933 |
| 9 | JGI24743J22301_10039925 | 3300001991 | Unclassified | 940 |
| 10 | JGI24743J22301_10061939 | 3300001991 | Bacteria | 772 |
| 11 | JGI24738J21930_10034049 | 3300002075 | Bacteria | 1038 |
| 12 | JGI24033J26618_1004749 | 3300002155 | Bacteria | 1476 |
| 13 | JGI24751J29686_10024707 | 3300002459 | Unclassified | 1247 |
| 14 | JGI25406J46586_10011902 | 3300003203 | Bacteria | 3795 |
| 15 | JGI25407J50210_10035069 | 3300003373 | Bacteria | 1293 |
| 16 | Ga0070658_10081640 | 3300005327 | Bacteria | 2656 |
| 17 | Ga0070658_10158991 | 3300005327 | Bacteria | 1895 |
| 18 | Ga0070658_10624188 | 3300005327 | Bacteria | 935 |
| 19 | Ga0070658_10926831 | 3300005327 | Bacteria | 757 |
| 20 | Ga0070676_10254822 | 3300005328 | Bacteria | 1172 |
| 21 | Ga0070676_10573730 | 3300005328 | Bacteria | 810 |
| 22 | Ga0070683_100000911 | 3300005329 | Bacteria | 21931 |
| 23 | Ga0070683_100009526 | 3300005329 | Bacteria | 8313 |
| 24 | Ga0070683_100043043 | 3300005329 | Bacteria | 4160 |
| 25 | Ga0070683_100068268 | 3300005329 | Bacteria | 3312 |
| 26 | Ga0070683_100072613 | 3300005329 | Bacteria | 3212 |
| 27 | Ga0070683_100212793 | 3300005329 | Bacteria | 1836 |
| 28 | Ga0070683_100263225 | 3300005329 | Bacteria | 1640 |
| 29 | Ga0070690_100088857 | 3300005330 | Bacteria | 2032 |
| 30 | Ga0070690_100270598 | 3300005330 | Unclassified | 1208 |
| 31 | Ga0070670_100157967 | 3300005331 | Bacteria | 1964 |
| 32 | Ga0068869_100204833 | 3300005334 | Bacteria | 1557 |
| 33 | Ga0070680_100002541 | 3300005336 | Bacteria | 13513 |
| 34 | Ga0070680_100009498 | 3300005336 | Bacteria | 7471 |
| 35 | Ga0070680_100028541 | 3300005336 | Bacteria | 4476 |
| 36 | Ga0070680_100102740 | 3300005336 | Unclassified | 2374 |
| 37 | Ga0070680_100153255 | 3300005336 | Bacteria | 1935 |
| 38 | Ga0070682_100034421 | 3300005337 | Bacteria | 3085 |
| 39 | Ga0070682_100184363 | 3300005337 | Bacteria | 1460 |
| 40 | Ga0070682_100706053 | 3300005337 | Bacteria | 809 |
| 41 | Ga0068868_100003848 | 3300005338 | Bacteria | 10479 |
| 42 | Ga0068868_100032081 | 3300005338 | Bacteria | 4039 |
| 43 | Ga0068868_100069856 | 3300005338 | Bacteria | 2799 |
| 44 | Ga0068868_100201825 | 3300005338 | Bacteria | 1658 |
| 45 | Ga0068868_100209432 | 3300005338 | Bacteria | 1629 |
| 46 | Ga0068868_100216010 | 3300005338 | Unclassified | 1604 |
| 47 | Ga0068868_100331813 | 3300005338 | Bacteria | 1298 |
| 48 | Ga0070660_100020713 | 3300005339 | Bacteria | 4839 |
| 49 | Ga0070660_100021187 | 3300005339 | Bacteria | 4789 |
| 50 | Ga0070660_100028747 | 3300005339 | Bacteria | 4161 |
| 51 | Ga0070660_100061666 | 3300005339 | Bacteria | 2912 |
| 52 | Ga0070660_100069446 | 3300005339 | Bacteria | 2747 |
| 53 | Ga0070660_100170770 | 3300005339 | Unclassified | 1756 |
| 54 | Ga0070660_100304083 | 3300005339 | Unclassified | 1308 |
| 55 | Ga0070660_100492292 | 3300005339 | Bacteria | 1020 |
| 56 | Ga0070660_100708345 | 3300005339 | Unclassified | 844 |
| 57 | Ga0070689_100144015 | 3300005340 | Bacteria | 1918 |
| 58 | Ga0070689_100171973 | 3300005340 | Bacteria | 1756 |
| 59 | Ga0070691_10012043 | 3300005341 | Bacteria | 3961 |
| 60 | Ga0070691_10027910 | 3300005341 | Bacteria | 2635 |
| 61 | Ga0070691_10036689 | 3300005341 | Unclassified | 2311 |
| 62 | Ga0070691_10055161 | 3300005341 | Bacteria | 1903 |
| 63 | Ga0070691_10062379 | 3300005341 | Bacteria | 1795 |
| 64 | Ga0070691_10115322 | 3300005341 | Bacteria | 1347 |
| 65 | Ga0070687_100174815 | 3300005343 | Bacteria | 1281 |
| 66 | Ga0070687_100274124 | 3300005343 | Unclassified | 1059 |
| 67 | Ga0070661_100004700 | 3300005344 | Bacteria | 9401 |
| 68 | Ga0070661_100023208 | 3300005344 | Bacteria | 4446 |
| 69 | Ga0070661_100232620 | 3300005344 | Unclassified | 1417 |
| 70 | Ga0070661_100331309 | 3300005344 | Bacteria | 1191 |
| 71 | Ga0070692_10033039 | 3300005345 | Bacteria | 2606 |
| 72 | Ga0070692_10116939 | 3300005345 | Bacteria | 1482 |
| 73 | Ga0070692_10172115 | 3300005345 | Bacteria | 1249 |
| 74 | Ga0070668_100083359 | 3300005347 | Bacteria | 2510 |
| 75 | Ga0070668_100279244 | 3300005347 | Bacteria | 1394 |
| 76 | Ga0070668_100768373 | 3300005347 | Bacteria | 854 |
| 77 | Ga0070669_100336186 | 3300005353 | Bacteria | 1223 |
| 78 | Ga0070669_100465189 | 3300005353 | Bacteria | 1044 |
| 79 | Ga0070669_100494332 | 3300005353 | Bacteria | 1014 |
| 80 | Ga0070675_100071386 | 3300005354 | Bacteria | 2880 |
| 81 | Ga0070675_100109541 | 3300005354 | Bacteria | 2334 |
| 82 | Ga0070675_100170591 | 3300005354 | Bacteria | 1876 |
| 83 | Ga0070675_100498397 | 3300005354 | Bacteria | 1097 |
| 84 | Ga0070671_100095942 | 3300005355 | Bacteria | 2486 |
| 85 | Ga0070674_100016490 | 3300005356 | Bacteria | 4631 |
| 86 | Ga0070674_100531278 | 3300005356 | Bacteria | 984 |
| 87 | Ga0070674_100676771 | 3300005356 | Unclassified | 880 |
| 88 | Ga0070673_100196582 | 3300005364 | Unclassified | 1735 |
| 89 | Ga0070673_100347056 | 3300005364 | Bacteria | 1316 |
| 90 | Ga0070673_100875978 | 3300005364 | Unclassified | 832 |
| 91 | Ga0070688_100024769 | 3300005365 | Bacteria | 3545 |
| 92 | Ga0070688_100295678 | 3300005365 | Unclassified | 1169 |
| 93 | Ga0070688_100598222 | 3300005365 | Bacteria | 844 |
| 94 | Ga0070659_100045715 | 3300005366 | Bacteria | 3430 |
| 95 | Ga0070659_100087179 | 3300005366 | Bacteria | 2499 |
| 96 | Ga0070659_100161095 | 3300005366 | Bacteria | 1834 |
| 97 | Ga0070659_100193695 | 3300005366 | Bacteria | 1671 |
| 98 | Ga0070659_100872868 | 3300005366 | Bacteria | 785 |
| 99 | Ga0070667_100364057 | 3300005367 | Unclassified | 1311 |
| 100 | Ga0070667_100422074 | 3300005367 | Unclassified | 1216 |
| 101 | Ga0070703_10025637 | 3300005406 | Bacteria | 1750 |
| 102 | Ga0070703_10083596 | 3300005406 | Unclassified | 1093 |
| 103 | Ga0070703_10170106 | 3300005406 | Bacteria | 834 |
| 104 | Ga0070709_10022042 | 3300005434 | Bacteria | 3720 |
| 105 | Ga0070709_10165012 | 3300005434 | Bacteria | 1543 |
| 106 | Ga0070709_10232984 | 3300005434 | Bacteria | 1318 |
| 107 | Ga0070714_100063739 | 3300005435 | Bacteria | 3170 |
| 108 | Ga0070714_100331395 | 3300005435 | Unclassified | 1425 |
| 109 | Ga0070714_100350969 | 3300005435 | Unclassified | 1385 |
| 110 | Ga0070714_100459419 | 3300005435 | Bacteria | 1210 |
| 111 | Ga0070714_100502371 | 3300005435 | Bacteria | 1156 |
| 112 | Ga0070714_100728255 | 3300005435 | Unclassified | 958 |
| 113 | Ga0070713_100119093 | 3300005436 | Bacteria | 2313 |
| 114 | Ga0070713_100165283 | 3300005436 | Bacteria | 1978 |
| 115 | Ga0070713_100206275 | 3300005436 | Bacteria | 1777 |
| 116 | Ga0070713_100309315 | 3300005436 | Bacteria | 1457 |
| 117 | Ga0070710_10015751 | 3300005437 | Bacteria | 3833 |
| 118 | Ga0070710_10030911 | 3300005437 | Bacteria | 2885 |
| 119 | Ga0070710_10104026 | 3300005437 | Bacteria | 1695 |
| 120 | Ga0070710_10127905 | 3300005437 | Bacteria | 1545 |
| 121 | Ga0070710_10138852 | 3300005437 | Bacteria | 1488 |
| 122 | Ga0070710_10159486 | 3300005437 | Bacteria | 1398 |
| 123 | Ga0070701_10019951 | 3300005438 | Bacteria | 3174 |
| 124 | Ga0070711_100008457 | 3300005439 | Bacteria | 6304 |
| 125 | Ga0070711_100112918 | 3300005439 | Unclassified | 1997 |
| 126 | Ga0070711_100227241 | 3300005439 | Bacteria | 1454 |
| 127 | Ga0070711_100267015 | 3300005439 | Bacteria | 1349 |
| 128 | Ga0070711_100268385 | 3300005439 | Bacteria | 1345 |
| 129 | Ga0070711_100288840 | 3300005439 | Bacteria | 1300 |
| 130 | Ga0070711_100364979 | 3300005439 | Bacteria | 1164 |
| 131 | Ga0070711_100872791 | 3300005439 | Unclassified | 766 |
| 132 | Ga0070705_100043529 | 3300005440 | Bacteria | 2573 |
| 133 | Ga0070705_100144776 | 3300005440 | Bacteria | 1569 |
| 134 | Ga0070705_100172054 | 3300005440 | Bacteria | 1459 |
| 135 | Ga0070700_100021601 | 3300005441 | Bacteria | 3743 |
| 136 | Ga0070700_100024887 | 3300005441 | Bacteria | 3519 |
| 137 | Ga0070700_100076154 | 3300005441 | Bacteria | 2154 |
| 138 | Ga0070708_100079811 | 3300005445 | Unclassified | 2961 |
| 139 | Ga0070708_100182465 | 3300005445 | Unclassified | 1962 |
| 140 | Ga0070663_100016045 | 3300005455 | Bacteria | 4851 |
| 141 | Ga0070663_100146310 | 3300005455 | Bacteria | 1808 |
| 142 | Ga0070678_100027606 | 3300005456 | Bacteria | 3856 |
| 143 | Ga0070678_100050291 | 3300005456 | Bacteria | 3014 |
| 144 | Ga0070678_100060215 | 3300005456 | Bacteria | 2794 |
| 145 | Ga0070678_100233777 | 3300005456 | Unclassified | 1534 |
| 146 | Ga0070678_100361151 | 3300005456 | Unclassified | 1251 |
| 147 | Ga0070678_100679166 | 3300005456 | Bacteria | 926 |
| 148 | Ga0070662_100008424 | 3300005457 | Bacteria | 6721 |
| 149 | Ga0070662_100012945 | 3300005457 | Bacteria | 5542 |
| 150 | Ga0070662_100017331 | 3300005457 | Bacteria | 4855 |
| 151 | Ga0070662_100075742 | 3300005457 | Bacteria | 2492 |
| 152 | Ga0070662_100085365 | 3300005457 | Bacteria | 2359 |
| 153 | Ga0070662_100163894 | 3300005457 | Bacteria | 1740 |
| 154 | Ga0070662_100287694 | 3300005457 | Bacteria | 1331 |
| 155 | Ga0070681_10119186 | 3300005458 | Bacteria | 2575 |
| 156 | Ga0070681_10134193 | 3300005458 | Bacteria | 2406 |
| 157 | Ga0070681_10210522 | 3300005458 | Bacteria | 1860 |
| 158 | Ga0070681_10239381 | 3300005458 | Bacteria | 1729 |
| 159 | Ga0070681_10249201 | 3300005458 | Bacteria | 1689 |
| 160 | Ga0070681_10251959 | 3300005458 | Bacteria | 1678 |
| 161 | Ga0070681_10255215 | 3300005458 | Bacteria | 1665 |
| 162 | Ga0070681_10354962 | 3300005458 | Unclassified | 1376 |
| 163 | Ga0070681_10856258 | 3300005458 | Bacteria | 827 |
| 164 | Ga0068867_100143956 | 3300005459 | Bacteria | 1866 |
| 165 | Ga0068867_100218258 | 3300005459 | Unclassified | 1535 |
| 166 | Ga0068867_100272799 | 3300005459 | Bacteria | 1384 |
| 167 | Ga0068867_100397474 | 3300005459 | Bacteria | 1161 |
| 168 | Ga0070685_10002654 | 3300005466 | Bacteria | 9156 |
| 169 | Ga0070706_100546300 | 3300005467 | Bacteria | 1078 |
| 170 | Ga0070698_100094671 | 3300005471 | Bacteria | 2965 |
| 171 | Ga0070698_100111746 | 3300005471 | Bacteria | 2697 |
| 172 | Ga0070699_100174458 | 3300005518 | Bacteria | 1906 |
| 173 | Ga0070699_100375126 | 3300005518 | Bacteria | 1284 |
| 174 | Ga0070679_100024215 | 3300005530 | Bacteria | 5949 |
| 175 | Ga0070679_100057985 | 3300005530 | Bacteria | 3859 |
| 176 | Ga0070679_100065683 | 3300005530 | Bacteria | 3616 |
| 177 | Ga0070679_100098066 | 3300005530 | Bacteria | 2918 |
| 178 | Ga0070679_100101126 | 3300005530 | Bacteria | 2869 |
| 179 | Ga0070679_100117794 | 3300005530 | Unclassified | 2641 |
| 180 | Ga0070679_100121250 | 3300005530 | Bacteria | 2599 |
| 181 | Ga0070679_100178561 | 3300005530 | Bacteria | 2096 |
| 182 | Ga0070679_100417212 | 3300005530 | Bacteria | 1288 |
| 183 | Ga0070679_101016986 | 3300005530 | Bacteria | 773 |
| 184 | Ga0070684_100002987 | 3300005535 | Bacteria | 12586 |
| 185 | Ga0070684_100009104 | 3300005535 | Bacteria | 7807 |
| 186 | Ga0070684_100027885 | 3300005535 | Bacteria | 4771 |
| 187 | Ga0070684_100044620 | 3300005535 | Bacteria | 3835 |
| 188 | Ga0070684_100068948 | 3300005535 | Bacteria | 3109 |
| 189 | Ga0070684_100139286 | 3300005535 | Bacteria | 2193 |
| 190 | Ga0070684_100183625 | 3300005535 | Bacteria | 1902 |
| 191 | Ga0070684_100408185 | 3300005535 | Bacteria | 1253 |
| 192 | Ga0070684_101015564 | 3300005535 | Bacteria | 778 |
| 193 | Ga0070697_100193331 | 3300005536 | Unclassified | 1727 |
| 194 | Ga0070697_100568857 | 3300005536 | Bacteria | 995 |
| 195 | Ga0068853_100049482 | 3300005539 | Bacteria | 3612 |
| 196 | Ga0068853_100116267 | 3300005539 | Bacteria | 2381 |
| 197 | Ga0068853_100120714 | 3300005539 | Bacteria | 2338 |
| 198 | Ga0070672_100011745 | 3300005543 | Bacteria | 6118 |
| 199 | Ga0070672_100060037 | 3300005543 | Bacteria | 2993 |
| 200 | Ga0070672_100426213 | 3300005543 | Bacteria | 1140 |
| 201 | Ga0070672_100571787 | 3300005543 | Unclassified | 983 |
| 202 | Ga0070686_100137369 | 3300005544 | Bacteria | 1697 |
| 203 | Ga0070695_100108789 | 3300005545 | Bacteria | 1878 |
| 204 | Ga0070695_100409955 | 3300005545 | Bacteria | 1029 |
| 205 | Ga0070695_100446471 | 3300005545 | Unclassified | 990 |
| 206 | Ga0070695_100606213 | 3300005545 | Unclassified | 860 |
| 207 | Ga0070696_100040272 | 3300005546 | Bacteria | 3226 |
| 208 | Ga0070696_100079217 | 3300005546 | Bacteria | 2324 |
| 209 | Ga0070696_100083269 | 3300005546 | Bacteria | 2269 |
| 210 | Ga0070696_100113132 | 3300005546 | Unclassified | 1956 |
| 211 | Ga0070696_100428952 | 3300005546 | Bacteria | 1039 |
| 212 | Ga0070696_100476563 | 3300005546 | Unclassified | 989 |
| 213 | Ga0070696_100544602 | 3300005546 | Bacteria | 929 |
| 214 | Ga0070693_100086818 | 3300005547 | Bacteria | 1878 |
| 215 | Ga0070693_100171768 | 3300005547 | Bacteria | 1389 |
| 216 | Ga0070693_100229433 | 3300005547 | Bacteria | 1221 |
| 217 | Ga0070665_100029536 | 3300005548 | Bacteria | 5518 |
| 218 | Ga0070665_100333848 | 3300005548 | Unclassified | 1521 |
| 219 | Ga0070704_100012513 | 3300005549 | Bacteria | 5240 |
| 220 | Ga0070704_100062811 | 3300005549 | Bacteria | 2664 |
| 221 | Ga0070704_100174982 | 3300005549 | Bacteria | 1711 |
| 222 | Ga0068855_100034827 | 3300005563 | Bacteria | 6001 |
| 223 | Ga0068855_100049422 | 3300005563 | Bacteria | 4960 |
| 224 | Ga0068855_100119279 | 3300005563 | Bacteria | 3020 |
| 225 | Ga0068855_100141926 | 3300005563 | Bacteria | 2737 |
| 226 | Ga0068855_100423551 | 3300005563 | Bacteria | 1456 |
| 227 | Ga0068855_100611254 | 3300005563 | Bacteria | 1174 |
| 228 | Ga0070664_100066762 | 3300005564 | Bacteria | 3072 |
| 229 | Ga0070664_100097750 | 3300005564 | Bacteria | 2549 |
| 230 | Ga0070664_100319902 | 3300005564 | Unclassified | 1405 |
| 231 | Ga0070664_100330027 | 3300005564 | Bacteria | 1384 |
| 232 | Ga0070664_100340571 | 3300005564 | Bacteria | 1362 |
| 233 | Ga0070664_100380957 | 3300005564 | Bacteria | 1288 |
| 234 | Ga0068857_100057361 | 3300005577 | Bacteria | 3456 |
| 235 | Ga0068857_100151940 | 3300005577 | Bacteria | 2098 |
| 236 | Ga0068857_100369428 | 3300005577 | Bacteria | 1331 |
| 237 | Ga0068854_100025563 | 3300005578 | Bacteria | 4052 |
| 238 | Ga0068854_100032416 | 3300005578 | Bacteria | 3636 |
| 239 | Ga0068854_100142066 | 3300005578 | Unclassified | 1843 |
| 240 | Ga0068854_100439273 | 3300005578 | Bacteria | 1087 |
| 241 | Ga0068854_100718306 | 3300005578 | Bacteria | 864 |
| 242 | Ga0068856_100028860 | 3300005614 | Bacteria | 5421 |
| 243 | Ga0068856_100044326 | 3300005614 | Bacteria | 4377 |
| 244 | Ga0068856_100048083 | 3300005614 | Bacteria | 4203 |
| 245 | Ga0068856_100100137 | 3300005614 | Unclassified | 2890 |
| 246 | Ga0068856_100321885 | 3300005614 | Bacteria | 1563 |
| 247 | Ga0068856_100354084 | 3300005614 | Bacteria | 1487 |
| 248 | Ga0068856_100509191 | 3300005614 | Bacteria | 1225 |
| 249 | Ga0068856_100602665 | 3300005614 | Bacteria | 1119 |
| 250 | Ga0070702_100019502 | 3300005615 | Bacteria | 3539 |
| 251 | Ga0070702_100056733 | 3300005615 | Bacteria | 2263 |
| 252 | Ga0070702_100084618 | 3300005615 | Bacteria | 1908 |
| 253 | Ga0068852_100041973 | 3300005616 | Bacteria | 3870 |
| 254 | Ga0068852_100059450 | 3300005616 | Bacteria | 3314 |
| 255 | Ga0068852_100066951 | 3300005616 | Bacteria | 3139 |
| 256 | Ga0068852_100125110 | 3300005616 | Bacteria | 2359 |
| 257 | Ga0068852_100175018 | 3300005616 | Bacteria | 2014 |
| 258 | Ga0068852_100206671 | 3300005616 | Unclassified | 1860 |
| 259 | Ga0068852_100353191 | 3300005616 | Bacteria | 1436 |
| 260 | Ga0068852_100491375 | 3300005616 | Bacteria | 1221 |
| 261 | Ga0068852_101036633 | 3300005616 | Bacteria | 839 |
| 262 | Ga0068852_101235524 | 3300005616 | Bacteria | 768 |
| 263 | Ga0068859_100032440 | 3300005617 | Bacteria | 5247 |
| 264 | Ga0068859_100062921 | 3300005617 | Bacteria | 3741 |
| 265 | Ga0068864_100117114 | 3300005618 | Unclassified | 2378 |
| 266 | Ga0068864_100190394 | 3300005618 | Bacteria | 1880 |
| 267 | Ga0068864_100503780 | 3300005618 | Unclassified | 1165 |
| 268 | Ga0068866_10151973 | 3300005718 | Bacteria | 1342 |
| 269 | Ga0068866_10194716 | 3300005718 | Bacteria | 1207 |
| 270 | Ga0068866_10562496 | 3300005718 | Unclassified | 764 |
| 271 | Ga0068861_100026781 | 3300005719 | Bacteria | 4194 |
| 272 | Ga0068861_100120258 | 3300005719 | Bacteria | 2118 |
| 273 | Ga0068861_100218520 | 3300005719 | Bacteria | 1609 |
| 274 | Ga0068861_100326594 | 3300005719 | Unclassified | 1338 |
| 275 | Ga0068861_100461597 | 3300005719 | Unclassified | 1140 |
| 276 | Ga0068861_100716167 | 3300005719 | Bacteria | 931 |
| 277 | Ga0068861_100761201 | 3300005719 | Bacteria | 905 |
| 278 | Ga0068851_10104975 | 3300005834 | Bacteria | 1503 |
| 279 | Ga0068870_10236094 | 3300005840 | Bacteria | 1126 |
| 280 | Ga0068870_10436727 | 3300005840 | Bacteria | 860 |
| 281 | Ga0068863_100214327 | 3300005841 | Bacteria | 1855 |
| 282 | Ga0068860_100069126 | 3300005843 | Bacteria | 3356 |
| 283 | Ga0068860_100248898 | 3300005843 | Bacteria | 1730 |
| 284 | Ga0068862_100390375 | 3300005844 | Bacteria | 1300 |
| 285 | Ga0081455_10014065 | 3300005937 | Bacteria | 7866 |
| 286 | Ga0081455_10017655 | 3300005937 | Bacteria | 6828 |
| 287 | Ga0081455_10030402 | 3300005937 | Bacteria | 4905 |
| 288 | Ga0081455_10063179 | 3300005937 | Bacteria | 3108 |
| 289 | Ga0081455_10064752 | 3300005937 | Bacteria | 3059 |
| 290 | Ga0081455_10091886 | 3300005937 | Bacteria | 2457 |
| 291 | Ga0081455_10271962 | 3300005937 | Unclassified | 1228 |
| 292 | Ga0081455_10323833 | 3300005937 | Unclassified | 1097 |
| 293 | Ga0081455_10424305 | 3300005937 | Bacteria | 916 |
| 294 | Ga0081538_10001352 | 3300005981 | Bacteria | 25238 |
| 295 | Ga0081538_10001944 | 3300005981 | Bacteria | 20689 |
| 296 | Ga0081538_10002644 | 3300005981 | Bacteria | 17290 |
| 297 | Ga0081538_10044597 | 3300005981 | Unclassified | 2763 |
| 298 | Ga0081538_10060840 | 3300005981 | Bacteria | 2168 |
| 299 | Ga0081540_1002691 | 3300005983 | Bacteria | 14453 |
| 300 | Ga0081540_1005407 | 3300005983 | Bacteria | 9535 |
| 301 | Ga0081540_1024567 | 3300005983 | Bacteria | 3495 |
| 302 | Ga0081539_10000888 | 3300005985 | Bacteria | 57168 |
| 303 | Ga0070717_10011193 | 3300006028 | Bacteria | 6802 |
| 304 | Ga0070717_10107798 | 3300006028 | Bacteria | 2373 |
| 305 | Ga0070717_10295528 | 3300006028 | Bacteria | 1439 |
| 306 | Ga0075365_10039156 | 3300006038 | Bacteria | 3085 |
| 307 | Ga0075365_10118842 | 3300006038 | Bacteria | 1822 |
| 308 | Ga0075365_10127154 | 3300006038 | Bacteria | 1761 |
| 309 | Ga0075365_10165895 | 3300006038 | Bacteria | 1541 |
| 310 | Ga0075364_10056676 | 3300006051 | Bacteria | 2566 |
| 311 | Ga0075364_10406976 | 3300006051 | Bacteria | 928 |
| 312 | Ga0075432_10007140 | 3300006058 | Bacteria | 3804 |
| 313 | Ga0075432_10036196 | 3300006058 | Bacteria | 1716 |
| 314 | Ga0075432_10081102 | 3300006058 | Bacteria | 1176 |
| 315 | Ga0075432_10158191 | 3300006058 | Bacteria | 875 |
| 316 | Ga0075432_10263775 | 3300006058 | Unclassified | 703 |
| 317 | Ga0070715_10016227 | 3300006163 | Bacteria | 2794 |
| 318 | Ga0070715_10034332 | 3300006163 | Bacteria | 2079 |
| 319 | Ga0070716_100024186 | 3300006173 | Bacteria | 3230 |
| 320 | Ga0070716_100265100 | 3300006173 | Bacteria | 1177 |
| 321 | Ga0070716_100302279 | 3300006173 | Bacteria | 1113 |
| 322 | Ga0070712_100004135 | 3300006175 | Bacteria | 8921 |
| 323 | Ga0070712_100007311 | 3300006175 | Bacteria | 6893 |
| 324 | Ga0070712_100008944 | 3300006175 | Bacteria | 6307 |
| 325 | Ga0070712_100032793 | 3300006175 | Bacteria | 3510 |
| 326 | Ga0070712_100075604 | 3300006175 | Bacteria | 2423 |
| 327 | Ga0070712_100092967 | 3300006175 | Unclassified | 2213 |
| 328 | Ga0070712_100101638 | 3300006175 | Bacteria | 2127 |
| 329 | Ga0070712_100138284 | 3300006175 | Bacteria | 1855 |
| 330 | Ga0070712_100168426 | 3300006175 | Unclassified | 1697 |
| 331 | Ga0070712_100211899 | 3300006175 | Bacteria | 1528 |
| 332 | Ga0070712_100312338 | 3300006175 | Bacteria | 1276 |
| 333 | Ga0070712_100648718 | 3300006175 | Unclassified | 897 |
| 334 | Ga0075367_10435812 | 3300006178 | Bacteria | 830 |
| 335 | Ga0097621_100051449 | 3300006237 | Bacteria | 3353 |
| 336 | Ga0097621_100059073 | 3300006237 | Bacteria | 3139 |
| 337 | Ga0097621_100132876 | 3300006237 | Bacteria | 2120 |
| 338 | Ga0068871_100111216 | 3300006358 | Bacteria | 2304 |
| 339 | Ga0068871_100497011 | 3300006358 | Unclassified | 1099 |
| 340 | Ga0068871_100540416 | 3300006358 | Bacteria | 1054 |
| 341 | Ga0075428_100002462 | 3300006844 | Bacteria | 20093 |
| 342 | Ga0075428_100006164 | 3300006844 | Bacteria | 13343 |
| 343 | Ga0075428_100026974 | 3300006844 | Bacteria | 6362 |
| 344 | Ga0075428_100049565 | 3300006844 | Bacteria | 4607 |
| 345 | Ga0075430_100028108 | 3300006846 | Bacteria | 4777 |
| 346 | Ga0075431_100049961 | 3300006847 | Bacteria | 4312 |
| 347 | Ga0075431_100054729 | 3300006847 | Bacteria | 4115 |
| 348 | Ga0075431_100640038 | 3300006847 | Bacteria | 1044 |
| 349 | Ga0075433_10011114 | 3300006852 | Bacteria | 7241 |
| 350 | Ga0075433_10022776 | 3300006852 | Bacteria | 5262 |
| 351 | Ga0075433_10063154 | 3300006852 | Bacteria | 3245 |
| 352 | Ga0075433_10074345 | 3300006852 | Bacteria | 2990 |
| 353 | Ga0075433_10157851 | 3300006852 | Bacteria | 2018 |
| 354 | Ga0075433_10181683 | 3300006852 | Unclassified | 1872 |
| 355 | Ga0075433_10321726 | 3300006852 | Bacteria | 1368 |
| 356 | Ga0075433_10635639 | 3300006852 | Archaea | 936 |
| 357 | Ga0075434_100005449 | 3300006871 | Bacteria | 11591 |
| 358 | Ga0075434_100009920 | 3300006871 | Bacteria | 8908 |
| 359 | Ga0075434_100057027 | 3300006871 | Bacteria | 3882 |
| 360 | Ga0075434_100286697 | 3300006871 | Bacteria | 1666 |
| 361 | Ga0075434_100303356 | 3300006871 | Bacteria | 1617 |
| 362 | Ga0075434_100423864 | 3300006871 | Bacteria | 1352 |
| 363 | Ga0075429_100078431 | 3300006880 | Bacteria | 2879 |
| 364 | Ga0075429_100190995 | 3300006880 | Bacteria | 1794 |
| 365 | Ga0075429_100339485 | 3300006880 | Bacteria | 1315 |
| 366 | Ga0075429_100339501 | 3300006880 | Bacteria | 1315 |
| 367 | Ga0068865_100005364 | 3300006881 | Bacteria | 7766 |
| 368 | Ga0068865_100060652 | 3300006881 | Bacteria | 2649 |
| 369 | Ga0068865_100152386 | 3300006881 | Bacteria | 1755 |
| 370 | Ga0068865_100164694 | 3300006881 | Bacteria | 1694 |
| 371 | Ga0068865_100295826 | 3300006881 | Bacteria | 1294 |
| 372 | Ga0075436_100006590 | 3300006914 | Bacteria | 7957 |
| 373 | Ga0075436_100068838 | 3300006914 | Bacteria | 2445 |
| 374 | Ga0075436_100082955 | 3300006914 | Bacteria | 2224 |
| 375 | Ga0075436_100131321 | 3300006914 | Bacteria | 1756 |
| 376 | Ga0075436_100361270 | 3300006914 | Unclassified | 1048 |
| 377 | Ga0097620_100032440 | 3300006931 | Bacteria | 5247 |
| 378 | Ga0097620_100062921 | 3300006931 | Bacteria | 3741 |
| 379 | Ga0075435_100003169 | 3300007076 | Bacteria | 11122 |
| 380 | Ga0075435_100007721 | 3300007076 | Bacteria | 7689 |
| 381 | Ga0075435_100008977 | 3300007076 | Bacteria | 7208 |
| 382 | Ga0075435_100016108 | 3300007076 | Bacteria | 5632 |
| 383 | Ga0075435_100016746 | 3300007076 | Bacteria | 5530 |
| 384 | Ga0075435_100180006 | 3300007076 | Bacteria | 1786 |
| 385 | Ga0075435_100239974 | 3300007076 | Bacteria | 1541 |
| 386 | Ga0075435_100585655 | 3300007076 | Unclassified | 967 |
| 387 | Ga0075435_100585896 | 3300007076 | Unclassified | 967 |
| 388 | Ga0105244_10168129 | 3300009036 | Bacteria | 1044 |
| 389 | Ga0105240_10044774 | 3300009093 | Bacteria | 5619 |
| 390 | Ga0105240_10045214 | 3300009093 | Bacteria | 5588 |
| 391 | Ga0105240_10114108 | 3300009093 | Bacteria | 3264 |
| 392 | Ga0105240_10271865 | 3300009093 | Unclassified | 1951 |
| 393 | Ga0111539_10047436 | 3300009094 | Bacteria | 5133 |
| 394 | Ga0111539_10061220 | 3300009094 | Bacteria | 4460 |
| 395 | Ga0111539_10138710 | 3300009094 | Bacteria | 2848 |
| 396 | Ga0111539_10329014 | 3300009094 | Bacteria | 1779 |
| 397 | Ga0111539_10496540 | 3300009094 | Bacteria | 1421 |
| 398 | Ga0111539_10634155 | 3300009094 | Bacteria | 1244 |
| 399 | Ga0111539_11003456 | 3300009094 | Unclassified | 970 |
| 400 | Ga0105245_10023009 | 3300009098 | Bacteria | 5467 |
| 401 | Ga0105245_10027905 | 3300009098 | Unclassified | 4975 |
| 402 | Ga0105245_10036938 | 3300009098 | Bacteria | 4341 |
| 403 | Ga0105245_10044229 | 3300009098 | Bacteria | 3974 |
| 404 | Ga0105245_10066760 | 3300009098 | Bacteria | 3256 |
| 405 | Ga0105245_10079060 | 3300009098 | Bacteria | 3002 |
| 406 | Ga0105245_10121540 | 3300009098 | Unclassified | 2440 |
| 407 | Ga0105245_10150671 | 3300009098 | Bacteria | 2199 |
| 408 | Ga0105245_10209966 | 3300009098 | Bacteria | 1873 |
| 409 | Ga0105245_10700389 | 3300009098 | Bacteria | 1046 |
| 410 | Ga0105247_10043907 | 3300009101 | Bacteria | 2740 |
| 411 | Ga0105247_10354144 | 3300009101 | Unclassified | 1033 |
| 412 | Ga0114129_10006249 | 3300009147 | Bacteria | 16888 |
| 413 | Ga0114129_10125698 | 3300009147 | Bacteria | 3526 |
| 414 | Ga0114129_10178475 | 3300009147 | Bacteria | 2891 |
| 415 | Ga0114129_10191791 | 3300009147 | Bacteria | 2774 |
| 416 | Ga0114129_10621807 | 3300009147 | Bacteria | 1397 |
| 417 | Ga0114129_11425016 | 3300009147 | Unclassified | 854 |
| 418 | Ga0105243_10006847 | 3300009148 | Bacteria | 8789 |
| 419 | Ga0105243_10039621 | 3300009148 | Bacteria | 3675 |
| 420 | Ga0105243_10123101 | 3300009148 | Bacteria | 2190 |
| 421 | Ga0105243_10272538 | 3300009148 | Unclassified | 1520 |
| 422 | Ga0105243_10359193 | 3300009148 | Unclassified | 1340 |
| 423 | Ga0105243_10394915 | 3300009148 | Unclassified | 1283 |
| 424 | Ga0105243_10474224 | 3300009148 | Bacteria | 1179 |
| 425 | Ga0105243_10504366 | 3300009148 | Archaea | 1147 |
| 426 | Ga0105243_10869198 | 3300009148 | Unclassified | 894 |
| 427 | Ga0105241_10113301 | 3300009174 | Bacteria | 2174 |
| 428 | Ga0105241_10241149 | 3300009174 | Bacteria | 1528 |
| 429 | Ga0105241_10381692 | 3300009174 | Bacteria | 1231 |
| 430 | Ga0105241_10574183 | 3300009174 | Bacteria | 1015 |
| 431 | Ga0105242_10035231 | 3300009176 | Bacteria | 4014 |
| 432 | Ga0105242_10040577 | 3300009176 | Bacteria | 3751 |
| 433 | Ga0105242_10115023 | 3300009176 | Bacteria | 2299 |
| 434 | Ga0105242_10344748 | 3300009176 | Bacteria | 1374 |
| 435 | Ga0105242_10361371 | 3300009176 | Bacteria | 1344 |
| 436 | Ga0105242_11128544 | 3300009176 | Bacteria | 799 |
| 437 | Ga0105248_10135315 | 3300009177 | Bacteria | 2780 |
| 438 | Ga0105248_10161467 | 3300009177 | Unclassified | 2527 |
| 439 | Ga0105248_10327251 | 3300009177 | Bacteria | 1726 |
| 440 | Ga0105248_10476501 | 3300009177 | Bacteria | 1407 |
| 441 | Ga0105248_10753111 | 3300009177 | Bacteria | 1099 |
| 442 | Ga0105248_10970448 | 3300009177 | Bacteria | 960 |
| 443 | Ga0105248_11138158 | 3300009177 | Bacteria | 882 |
| 444 | Ga0105237_10062071 | 3300009545 | Bacteria | 3736 |
| 445 | Ga0105237_10195336 | 3300009545 | Unclassified | 2023 |
| 446 | Ga0105237_10686176 | 3300009545 | Unclassified | 1031 |
| 447 | Ga0105238_10008375 | 3300009551 | Bacteria | 10347 |
| 448 | Ga0105238_10029321 | 3300009551 | Bacteria | 5606 |
| 449 | Ga0105238_10063360 | 3300009551 | Bacteria | 3697 |
| 450 | Ga0105238_10078628 | 3300009551 | Bacteria | 3289 |
| 451 | Ga0105238_10234795 | 3300009551 | Bacteria | 1811 |
| 452 | Ga0105238_10297729 | 3300009551 | Bacteria | 1596 |
| 453 | Ga0105249_10034809 | 3300009553 | Bacteria | 4565 |
| 454 | Ga0105249_10061851 | 3300009553 | Unclassified | 3436 |
| 455 | Ga0105249_10257516 | 3300009553 | Bacteria | 1732 |
| 456 | Ga0105249_10258319 | 3300009553 | Bacteria | 1730 |
| 457 | Ga0105249_10285600 | 3300009553 | Bacteria | 1650 |
| 458 | Ga0105249_11129483 | 3300009553 | Unclassified | 854 |
| 459 | Ga0105239_10021548 | 3300010375 | Bacteria | 7106 |
| 460 | Ga0105239_10033183 | 3300010375 | Bacteria | 5670 |
| 461 | Ga0105239_10124023 | 3300010375 | Bacteria | 2870 |
| 462 | Ga0105239_10138331 | 3300010375 | Bacteria | 2712 |
| 463 | Ga0105239_10195424 | 3300010375 | Bacteria | 2265 |
| 464 | Ga0105239_10198370 | 3300010375 | Bacteria | 2248 |
| 465 | Ga0105239_10218459 | 3300010375 | Bacteria | 2137 |
| 466 | Ga0105239_10219189 | 3300010375 | Bacteria | 2134 |
| 467 | Ga0105239_10261916 | 3300010375 | Bacteria | 1943 |
| 468 | Ga0105239_10267794 | 3300010375 | Bacteria | 1921 |
| 469 | Ga0105239_10323754 | 3300010375 | Unclassified | 1738 |
| 470 | Ga0105239_10471539 | 3300010375 | Bacteria | 1425 |
| 471 | Ga0105239_10815482 | 3300010375 | Bacteria | 1069 |
| 472 | Ga0105246_10003029 | 3300011119 | Bacteria | 10191 |
| 473 | Ga0105246_10040204 | 3300011119 | Bacteria | 3155 |
| 474 | Ga0105246_10050220 | 3300011119 | Bacteria | 2860 |
| 475 | Ga0105246_10184501 | 3300011119 | Bacteria | 1609 |
| 476 | Ga0105246_10417380 | 3300011119 | Unclassified | 1119 |
| 477 | Ga0105246_10475029 | 3300011119 | Bacteria | 1056 |
| 478 | Ga0105246_10816008 | 3300011119 | Bacteria | 829 |
| 479 | Ga0157373_10042382 | 3300013100 | Bacteria | 3253 |
| 480 | Ga0157373_10199124 | 3300013100 | Bacteria | 1412 |
| 481 | Ga0157371_10008246 | 3300013102 | Bacteria | 8328 |
| 482 | Ga0157371_10075482 | 3300013102 | Bacteria | 2387 |
| 483 | Ga0157371_10292949 | 3300013102 | Bacteria | 1177 |
| 484 | Ga0157370_10046230 | 3300013104 | Bacteria | 4174 |
| 485 | Ga0157370_10104911 | 3300013104 | Bacteria | 2646 |
| 486 | Ga0157370_10113885 | 3300013104 | Unclassified | 2527 |
| 487 | Ga0157370_10161676 | 3300013104 | Bacteria | 2083 |
| 488 | Ga0157369_10004625 | 3300013105 | Bacteria | 16173 |
| 489 | Ga0157369_10021973 | 3300013105 | Bacteria | 7130 |
| 490 | Ga0157369_10026569 | 3300013105 | Bacteria | 6420 |
| 491 | Ga0157369_10129622 | 3300013105 | Bacteria | 2673 |
| 492 | Ga0157369_10147727 | 3300013105 | Bacteria | 2485 |
| 493 | Ga0157369_10196375 | 3300013105 | Bacteria | 2119 |
| 494 | Ga0157369_10725844 | 3300013105 | Unclassified | 1023 |
| 495 | Ga0157369_10991725 | 3300013105 | Bacteria | 860 |
| 496 | Ga0157374_10060738 | 3300013296 | Bacteria | 3538 |
| 497 | Ga0157374_10248853 | 3300013296 | Bacteria | 1749 |
| 498 | Ga0157374_10265945 | 3300013296 | Bacteria | 1690 |
| 499 | Ga0157374_10788798 | 3300013296 | Bacteria | 965 |
| 500 | Ga0157378_10129250 | 3300013297 | Unclassified | 2336 |
| 501 | Ga0157378_10242951 | 3300013297 | Unclassified | 1721 |
| 502 | Ga0157378_10267958 | 3300013297 | Bacteria | 1641 |
| 503 | Ga0157378_10394621 | 3300013297 | Bacteria | 1362 |
| 504 | Ga0157378_10522424 | 3300013297 | Bacteria | 1189 |
| 505 | Ga0163162_10018602 | 3300013306 | Bacteria | 6807 |
| 506 | Ga0163162_10022756 | 3300013306 | Bacteria | 6179 |
| 507 | Ga0163162_10035011 | 3300013306 | Bacteria | 4999 |
| 508 | Ga0163162_10046153 | 3300013306 | Bacteria | 4367 |
| 509 | Ga0163162_10099389 | 3300013306 | Bacteria | 3000 |
| 510 | Ga0163162_10228040 | 3300013306 | Bacteria | 1993 |
| 511 | Ga0163162_10620489 | 3300013306 | Viruses | 1206 |
| 512 | Ga0157372_10006343 | 3300013307 | Bacteria | 12582 |
| 513 | Ga0157372_10023387 | 3300013307 | Bacteria | 6698 |
| 514 | Ga0157372_10055119 | 3300013307 | Bacteria | 4438 |
| 515 | Ga0157372_10064467 | 3300013307 | Bacteria | 4111 |
| 516 | Ga0157372_10131746 | 3300013307 | Bacteria | 2877 |
| 517 | Ga0157372_10177549 | 3300013307 | Bacteria | 2465 |
| 518 | Ga0157372_10191967 | 3300013307 | Bacteria | 2365 |
| 519 | Ga0157372_10206599 | 3300013307 | Unclassified | 2275 |
| 520 | Ga0157372_10270410 | 3300013307 | Bacteria | 1975 |
| 521 | Ga0157372_10727179 | 3300013307 | Bacteria | 1154 |
| 522 | Ga0157372_10877217 | 3300013307 | Unclassified | 1041 |
| 523 | Ga0157372_10898117 | 3300013307 | Bacteria | 1028 |
| 524 | Ga0157375_10017225 | 3300013308 | Bacteria | 6515 |
| 525 | Ga0157375_10041947 | 3300013308 | Bacteria | 4424 |
| 526 | Ga0157375_10148964 | 3300013308 | Bacteria | 2474 |
| 527 | Ga0157375_10185272 | 3300013308 | Unclassified | 2235 |
| 528 | Ga0157375_10253549 | 3300013308 | Bacteria | 1921 |
| 529 | Ga0157375_10409981 | 3300013308 | Bacteria | 1521 |
| 530 | Ga0157375_10897336 | 3300013308 | Viruses | 1030 |
| 531 | Ga0157375_10947283 | 3300013308 | Bacteria | 1003 |
| 532 | Ga0157375_11044291 | 3300013308 | Bacteria | 955 |
| 533 | Ga0157375_11087690 | 3300013308 | Bacteria | 936 |
| 534 | Ga0163163_10043357 | 3300014325 | Bacteria | 4410 |
| 535 | Ga0163163_10059175 | 3300014325 | Bacteria | 3789 |
| 536 | Ga0163163_10090522 | 3300014325 | Bacteria | 3072 |
| 537 | Ga0163163_10263426 | 3300014325 | Bacteria | 1775 |
| 538 | Ga0157380_10019074 | 3300014326 | Bacteria | 5106 |
| 539 | Ga0157380_10101333 | 3300014326 | Bacteria | 2399 |
| 540 | Ga0157380_10113798 | 3300014326 | Bacteria | 2279 |
| 541 | Ga0157380_11084390 | 3300014326 | Bacteria | 839 |
| 542 | Ga0182008_10032298 | 3300014497 | Bacteria | 2631 |
| 543 | Ga0157377_10086028 | 3300014745 | Bacteria | 1847 |
| 544 | Ga0157377_10112053 | 3300014745 | Bacteria | 1641 |
| 545 | Ga0157377_10118896 | 3300014745 | Unclassified | 1599 |
| 546 | Ga0157377_10675811 | 3300014745 | Bacteria | 746 |
| 547 | Ga0157379_10193381 | 3300014968 | Bacteria | 1839 |
| 548 | Ga0157376_10036355 | 3300014969 | Unclassified | 3990 |
| 549 | Ga0157376_10079541 | 3300014969 | Bacteria | 2810 |
| 550 | Ga0157376_10079568 | 3300014969 | Bacteria | 2810 |
| 551 | Ga0157376_10149889 | 3300014969 | Bacteria | 2102 |
| 552 | Ga0157376_10205176 | 3300014969 | Bacteria | 1816 |
| 553 | Ga0157376_10222577 | 3300014969 | Bacteria | 1749 |
| 554 | Ga0163161_10014703 | 3300017792 | Bacteria | 5451 |
| 555 | Ga0163161_10110429 | 3300017792 | Unclassified | 2055 |
| 556 | Ga0163161_10647234 | 3300017792 | Bacteria | 875 |
| 557 | Ga0197907_10107874 | 3300020069 | Unclassified | 1797 |
| 558 | Ga0197907_10487754 | 3300020069 | Bacteria | 2401 |
| 559 | Ga0197907_10805701 | 3300020069 | Bacteria | 1526 |
| 560 | Ga0197907_11270642 | 3300020069 | Unclassified | 1144 |
| 561 | Ga0206356_10067745 | 3300020070 | Bacteria | 770 |
| 562 | Ga0206356_10097950 | 3300020070 | Bacteria | 1346 |
| 563 | Ga0206356_10171147 | 3300020070 | Bacteria | 1212 |
| 564 | Ga0206356_10264527 | 3300020070 | Unclassified | 1297 |
| 565 | Ga0206356_10570442 | 3300020070 | Unclassified | 2195 |
| 566 | Ga0206356_10612509 | 3300020070 | Bacteria | 1085 |
| 567 | Ga0206356_11872195 | 3300020070 | Bacteria | 895 |
| 568 | Ga0206349_1478788 | 3300020075 | Bacteria | 2594 |
| 569 | Ga0206349_1884143 | 3300020075 | Bacteria | 768 |
| 570 | Ga0206351_10455175 | 3300020077 | Bacteria | 812 |
| 571 | Ga0206352_11114125 | 3300020078 | Bacteria | 2034 |
| 572 | Ga0206350_10825078 | 3300020080 | Bacteria | 2929 |
| 573 | Ga0206354_10022075 | 3300020081 | Bacteria | 2214 |
| 574 | Ga0206354_10431597 | 3300020081 | Unclassified | 2039 |
| 575 | Ga0206354_10806399 | 3300020081 | Bacteria | 1443 |
| 576 | Ga0206354_10808118 | 3300020081 | Bacteria | 908 |
| 577 | Ga0206354_11620124 | 3300020081 | Bacteria | 2213 |
| 578 | Ga0206353_10391836 | 3300020082 | Unclassified | 1644 |
| 579 | Ga0206353_10658960 | 3300020082 | Bacteria | 1859 |
| 580 | Ga0206353_11419015 | 3300020082 | Bacteria | 3146 |
| 581 | Ga0206353_11715061 | 3300020082 | Unclassified | 1099 |
| 582 | Ga0224712_10042100 | 3300022467 | Bacteria | 1729 |
| 583 | Ga0224712_10119489 | 3300022467 | Unclassified | 1140 |
| 584 | Ga0224712_10269491 | 3300022467 | Bacteria | 790 |
| 585 | Ga0207656_10060160 | 3300025321 | Unclassified | 1664 |
| 586 | Ga0207653_10040613 | 3300025885 | Unclassified | 1526 |
| 587 | Ga0207653_10051409 | 3300025885 | Bacteria | 1372 |
| 588 | Ga0207692_10017224 | 3300025898 | Bacteria | 3218 |
| 589 | Ga0207692_10145206 | 3300025898 | Unclassified | 1353 |
| 590 | Ga0207642_10041998 | 3300025899 | Unclassified | 2007 |
| 591 | Ga0207642_10094797 | 3300025899 | Bacteria | 1484 |
| 592 | Ga0207642_10111509 | 3300025899 | Bacteria | 1394 |
| 593 | Ga0207642_10191989 | 3300025899 | Bacteria | 1121 |
| 594 | Ga0207710_10037491 | 3300025900 | Bacteria | 2141 |
| 595 | Ga0207710_10238893 | 3300025900 | Unclassified | 906 |
| 596 | Ga0207688_10000576 | 3300025901 | Bacteria | 18035 |
| 597 | Ga0207688_10002719 | 3300025901 | Bacteria | 9572 |
| 598 | Ga0207688_10062897 | 3300025901 | Bacteria | 2093 |
| 599 | Ga0207688_10076163 | 3300025901 | Bacteria | 1910 |
| 600 | Ga0207688_10309558 | 3300025901 | Bacteria | 967 |
| 601 | Ga0207647_10096916 | 3300025904 | Bacteria | 1754 |
| 602 | Ga0207647_10100288 | 3300025904 | Bacteria | 1719 |
| 603 | Ga0207685_10021761 | 3300025905 | Bacteria | 2155 |
| 604 | Ga0207685_10160682 | 3300025905 | Bacteria | 1025 |
| 605 | Ga0207685_10205544 | 3300025905 | Unclassified | 928 |
| 606 | Ga0207685_10395120 | 3300025905 | Unclassified | 707 |
| 607 | Ga0207699_10017149 | 3300025906 | Bacteria | 3804 |
| 608 | Ga0207699_10067659 | 3300025906 | Bacteria | 2172 |
| 609 | Ga0207699_10189788 | 3300025906 | Bacteria | 1386 |
| 610 | Ga0207699_10570230 | 3300025906 | Bacteria | 822 |
| 611 | Ga0207645_10024006 | 3300025907 | Bacteria | 3958 |
| 612 | Ga0207645_10154103 | 3300025907 | Bacteria | 1501 |
| 613 | Ga0207645_10278202 | 3300025907 | Unclassified | 1111 |
| 614 | Ga0207643_10033073 | 3300025908 | Bacteria | 2893 |
| 615 | Ga0207643_10105670 | 3300025908 | Unclassified | 1654 |
| 616 | Ga0207705_10187867 | 3300025909 | Bacteria | 1561 |
| 617 | Ga0207705_10229159 | 3300025909 | Bacteria | 1413 |
| 618 | Ga0207705_10627994 | 3300025909 | Bacteria | 835 |
| 619 | Ga0207705_10752019 | 3300025909 | Unclassified | 757 |
| 620 | Ga0207654_10035768 | 3300025911 | Bacteria | 2769 |
| 621 | Ga0207654_10420862 | 3300025911 | Unclassified | 932 |
| 622 | Ga0207654_10456460 | 3300025911 | Bacteria | 897 |
| 623 | Ga0207707_10097301 | 3300025912 | Bacteria | 2572 |
| 624 | Ga0207707_10137608 | 3300025912 | Bacteria | 2135 |
| 625 | Ga0207707_10141899 | 3300025912 | Bacteria | 2100 |
| 626 | Ga0207707_10243644 | 3300025912 | Bacteria | 1562 |
| 627 | Ga0207707_10277199 | 3300025912 | Unclassified | 1453 |
| 628 | Ga0207707_10358546 | 3300025912 | Bacteria | 1256 |
| 629 | Ga0207707_10630481 | 3300025912 | Unclassified | 905 |
| 630 | Ga0207695_10024968 | 3300025913 | Bacteria | 6706 |
| 631 | Ga0207695_10390970 | 3300025913 | Bacteria | 1276 |
| 632 | Ga0207671_10241174 | 3300025914 | Unclassified | 1420 |
| 633 | Ga0207671_10247315 | 3300025914 | Bacteria | 1402 |
| 634 | Ga0207671_10554836 | 3300025914 | Unclassified | 916 |
| 635 | Ga0207693_10008180 | 3300025915 | Bacteria | 8569 |
| 636 | Ga0207693_10012583 | 3300025915 | Bacteria | 6835 |
| 637 | Ga0207693_10016960 | 3300025915 | Bacteria | 5817 |
| 638 | Ga0207693_10017316 | 3300025915 | Bacteria | 5747 |
| 639 | Ga0207693_10032082 | 3300025915 | Bacteria | 4147 |
| 640 | Ga0207693_10053613 | 3300025915 | Bacteria | 3164 |
| 641 | Ga0207693_10064051 | 3300025915 | Bacteria | 2880 |
| 642 | Ga0207693_10069882 | 3300025915 | Bacteria | 2748 |
| 643 | Ga0207693_10073799 | 3300025915 | Bacteria | 2671 |
| 644 | Ga0207693_10079885 | 3300025915 | Bacteria | 2560 |
| 645 | Ga0207693_10080820 | 3300025915 | Bacteria | 2544 |
| 646 | Ga0207663_10016349 | 3300025916 | Bacteria | 4112 |
| 647 | Ga0207663_10017385 | 3300025916 | Bacteria | 4006 |
| 648 | Ga0207663_10033480 | 3300025916 | Bacteria | 3062 |
| 649 | Ga0207663_10052872 | 3300025916 | Unclassified | 2535 |
| 650 | Ga0207663_10055380 | 3300025916 | Bacteria | 2488 |
| 651 | Ga0207663_10176500 | 3300025916 | Bacteria | 1522 |
| 652 | Ga0207663_10196344 | 3300025916 | Bacteria | 1453 |
| 653 | Ga0207663_10225185 | 3300025916 | Bacteria | 1367 |
| 654 | Ga0207663_10226143 | 3300025916 | Bacteria | 1364 |
| 655 | Ga0207660_10111595 | 3300025917 | Bacteria | 2058 |
| 656 | Ga0207660_10281261 | 3300025917 | Unclassified | 1320 |
| 657 | Ga0207660_10393594 | 3300025917 | Bacteria | 1115 |
| 658 | Ga0207660_10398565 | 3300025917 | Unclassified | 1108 |
| 659 | Ga0207660_10421434 | 3300025917 | Unclassified | 1077 |
| 660 | Ga0207660_10452665 | 3300025917 | Unclassified | 1038 |
| 661 | Ga0207662_10138917 | 3300025918 | Unclassified | 1537 |
| 662 | Ga0207662_10159113 | 3300025918 | Bacteria | 1442 |
| 663 | Ga0207662_10177250 | 3300025918 | Archaea | 1370 |
| 664 | Ga0207657_10008583 | 3300025919 | Bacteria | 10350 |
| 665 | Ga0207657_10009230 | 3300025919 | Bacteria | 9942 |
| 666 | Ga0207657_10016295 | 3300025919 | Bacteria | 7172 |
| 667 | Ga0207657_10021109 | 3300025919 | Bacteria | 6135 |
| 668 | Ga0207657_10099966 | 3300025919 | Bacteria | 2409 |
| 669 | Ga0207657_10161025 | 3300025919 | Bacteria | 1823 |
| 670 | Ga0207657_10272647 | 3300025919 | Unclassified | 1345 |
| 671 | Ga0207657_10353343 | 3300025919 | Bacteria | 1159 |
| 672 | Ga0207657_10369915 | 3300025919 | Unclassified | 1129 |
| 673 | Ga0207649_10164389 | 3300025920 | Unclassified | 1540 |
| 674 | Ga0207649_10229103 | 3300025920 | Bacteria | 1328 |
| 675 | Ga0207649_10237364 | 3300025920 | Bacteria | 1307 |
| 676 | Ga0207649_10493745 | 3300025920 | Bacteria | 930 |
| 677 | Ga0207649_10710407 | 3300025920 | Bacteria | 780 |
| 678 | Ga0207649_10863701 | 3300025920 | Bacteria | 708 |
| 679 | Ga0207652_10041627 | 3300025921 | Bacteria | 3906 |
| 680 | Ga0207652_10043852 | 3300025921 | Bacteria | 3809 |
| 681 | Ga0207652_10096545 | 3300025921 | Bacteria | 2604 |
| 682 | Ga0207652_10181291 | 3300025921 | Bacteria | 1893 |
| 683 | Ga0207652_10201690 | 3300025921 | Unclassified | 1790 |
| 684 | Ga0207652_10209402 | 3300025921 | Bacteria | 1755 |
| 685 | Ga0207652_10398170 | 3300025921 | Bacteria | 1242 |
| 686 | Ga0207681_10191444 | 3300025923 | Bacteria | 1565 |
| 687 | Ga0207681_10324206 | 3300025923 | Unclassified | 1226 |
| 688 | Ga0207681_10438031 | 3300025923 | Bacteria | 1061 |
| 689 | Ga0207694_10029479 | 3300025924 | Bacteria | 4188 |
| 690 | Ga0207694_10117246 | 3300025924 | Bacteria | 2123 |
| 691 | Ga0207694_10164544 | 3300025924 | Unclassified | 1793 |
| 692 | Ga0207694_10407488 | 3300025924 | Bacteria | 1131 |
| 693 | Ga0207650_10199701 | 3300025925 | Unclassified | 1601 |
| 694 | Ga0207659_10292590 | 3300025926 | Bacteria | 1335 |
| 695 | Ga0207659_10338888 | 3300025926 | Bacteria | 1245 |
| 696 | Ga0207659_10742315 | 3300025926 | Bacteria | 842 |
| 697 | Ga0207687_10001941 | 3300025927 | Bacteria | 14224 |
| 698 | Ga0207687_10011006 | 3300025927 | Bacteria | 5912 |
| 699 | Ga0207687_10032121 | 3300025927 | Bacteria | 3553 |
| 700 | Ga0207687_10047134 | 3300025927 | Bacteria | 2987 |
| 701 | Ga0207687_10054720 | 3300025927 | Bacteria | 2793 |
| 702 | Ga0207687_10063882 | 3300025927 | Bacteria | 2608 |
| 703 | Ga0207687_10247444 | 3300025927 | Bacteria | 1416 |
| 704 | Ga0207687_10250347 | 3300025927 | Unclassified | 1408 |
| 705 | Ga0207687_10299026 | 3300025927 | Viruses | 1296 |
| 706 | Ga0207687_10569005 | 3300025927 | Bacteria | 952 |
| 707 | Ga0207687_10637087 | 3300025927 | Unclassified | 901 |
| 708 | Ga0207700_10000001 | 3300025928 | Bacteria | 1122509 |
| 709 | Ga0207700_10475324 | 3300025928 | Bacteria | 1104 |
| 710 | Ga0207700_10620135 | 3300025928 | Bacteria | 963 |
| 711 | Ga0207700_10674333 | 3300025928 | Bacteria | 922 |
| 712 | Ga0207700_10690587 | 3300025928 | Unclassified | 911 |
| 713 | Ga0207664_10005882 | 3300025929 | Bacteria | 8392 |
| 714 | Ga0207664_10031936 | 3300025929 | Bacteria | 4033 |
| 715 | Ga0207664_10163281 | 3300025929 | Bacteria | 1901 |
| 716 | Ga0207664_10211966 | 3300025929 | Bacteria | 1676 |
| 717 | Ga0207664_10335989 | 3300025929 | Bacteria | 1335 |
| 718 | Ga0207664_10648295 | 3300025929 | Bacteria | 949 |
| 719 | Ga0207664_10748073 | 3300025929 | Unclassified | 879 |
| 720 | Ga0207664_10851313 | 3300025929 | Bacteria | 819 |
| 721 | Ga0207644_10279142 | 3300025931 | Bacteria | 1341 |
| 722 | Ga0207644_10337877 | 3300025931 | Unclassified | 1221 |
| 723 | Ga0207644_10384764 | 3300025931 | Bacteria | 1145 |
| 724 | Ga0207690_10165745 | 3300025932 | Bacteria | 1651 |
| 725 | Ga0207690_10299356 | 3300025932 | Unclassified | 1258 |
| 726 | Ga0207690_10342908 | 3300025932 | Bacteria | 1179 |
| 727 | Ga0207690_10489908 | 3300025932 | Bacteria | 993 |
| 728 | Ga0207706_10014884 | 3300025933 | Bacteria | 7045 |
| 729 | Ga0207706_10026610 | 3300025933 | Bacteria | 5178 |
| 730 | Ga0207706_10053169 | 3300025933 | Bacteria | 3575 |
| 731 | Ga0207706_10056049 | 3300025933 | Bacteria | 3475 |
| 732 | Ga0207706_10120338 | 3300025933 | Bacteria | 2308 |
| 733 | Ga0207686_10055335 | 3300025934 | Unclassified | 2489 |
| 734 | Ga0207686_10159024 | 3300025934 | Bacteria | 1581 |
| 735 | Ga0207686_10209980 | 3300025934 | Bacteria | 1399 |
| 736 | Ga0207686_10345725 | 3300025934 | Bacteria | 1118 |
| 737 | Ga0207686_10927681 | 3300025934 | Unclassified | 704 |
| 738 | Ga0207709_10046305 | 3300025935 | Bacteria | 2639 |
| 739 | Ga0207709_10070402 | 3300025935 | Bacteria | 2218 |
| 740 | Ga0207709_10081294 | 3300025935 | Bacteria | 2089 |
| 741 | Ga0207709_10144464 | 3300025935 | Bacteria | 1639 |
| 742 | Ga0207709_10162421 | 3300025935 | Bacteria | 1559 |
| 743 | Ga0207709_10171171 | 3300025935 | Bacteria | 1524 |
| 744 | Ga0207709_10598813 | 3300025935 | Bacteria | 872 |
| 745 | Ga0207709_10687388 | 3300025935 | Unclassified | 818 |
| 746 | Ga0207670_10237062 | 3300025936 | Bacteria | 1404 |
| 747 | Ga0207669_10117922 | 3300025937 | Bacteria | 1795 |
| 748 | Ga0207669_10178613 | 3300025937 | Bacteria | 1519 |
| 749 | Ga0207704_10042563 | 3300025938 | Bacteria | 2675 |
| 750 | Ga0207704_10135136 | 3300025938 | Bacteria | 1715 |
| 751 | Ga0207704_10154027 | 3300025938 | Bacteria | 1626 |
| 752 | Ga0207704_10359639 | 3300025938 | Unclassified | 1136 |
| 753 | Ga0207704_10643863 | 3300025938 | Unclassified | 872 |
| 754 | Ga0207665_10003372 | 3300025939 | Bacteria | 10696 |
| 755 | Ga0207665_10014891 | 3300025939 | Bacteria | 5111 |
| 756 | Ga0207665_10027262 | 3300025939 | Bacteria | 3775 |
| 757 | Ga0207665_10065816 | 3300025939 | Bacteria | 2465 |
| 758 | Ga0207665_10134050 | 3300025939 | Bacteria | 1761 |
| 759 | Ga0207691_10018191 | 3300025940 | Bacteria | 6657 |
| 760 | Ga0207691_10481773 | 3300025940 | Bacteria | 1054 |
| 761 | Ga0207711_10096112 | 3300025941 | Bacteria | 2614 |
| 762 | Ga0207711_10175360 | 3300025941 | Bacteria | 1947 |
| 763 | Ga0207711_10206244 | 3300025941 | Bacteria | 1795 |
| 764 | Ga0207711_10421019 | 3300025941 | Bacteria | 1242 |
| 765 | Ga0207711_10603468 | 3300025941 | Bacteria | 1024 |
| 766 | Ga0207689_10071536 | 3300025942 | Bacteria | 2849 |
| 767 | Ga0207689_10079779 | 3300025942 | Bacteria | 2690 |
| 768 | Ga0207661_10002762 | 3300025944 | Bacteria | 12091 |
| 769 | Ga0207661_10062252 | 3300025944 | Bacteria | 3018 |
| 770 | Ga0207661_10083440 | 3300025944 | Bacteria | 2644 |
| 771 | Ga0207661_10145258 | 3300025944 | Unclassified | 2046 |
| 772 | Ga0207661_10225098 | 3300025944 | Bacteria | 1659 |
| 773 | Ga0207661_10227083 | 3300025944 | Bacteria | 1652 |
| 774 | Ga0207661_10321721 | 3300025944 | Bacteria | 1390 |
| 775 | Ga0207661_10512927 | 3300025944 | Bacteria | 1096 |
| 776 | Ga0207679_10122283 | 3300025945 | Bacteria | 2074 |
| 777 | Ga0207679_10140319 | 3300025945 | Bacteria | 1952 |
| 778 | Ga0207679_10220576 | 3300025945 | Unclassified | 1595 |
| 779 | Ga0207679_10261620 | 3300025945 | Bacteria | 1476 |
| 780 | Ga0207679_10262513 | 3300025945 | Unclassified | 1473 |
| 781 | Ga0207679_10864951 | 3300025945 | Bacteria | 826 |
| 782 | Ga0207667_10018802 | 3300025949 | Bacteria | 7737 |
| 783 | Ga0207667_10035997 | 3300025949 | Bacteria | 5308 |
| 784 | Ga0207667_10101370 | 3300025949 | Bacteria | 2970 |
| 785 | Ga0207667_10136410 | 3300025949 | Bacteria | 2527 |
| 786 | Ga0207667_10861754 | 3300025949 | Bacteria | 900 |
| 787 | Ga0207712_10043069 | 3300025961 | Bacteria | 3112 |
| 788 | Ga0207712_10073361 | 3300025961 | Bacteria | 2468 |
| 789 | Ga0207712_10127552 | 3300025961 | Bacteria | 1934 |
| 790 | Ga0207668_10121814 | 3300025972 | Bacteria | 1976 |
| 791 | Ga0207668_10266913 | 3300025972 | Bacteria | 1397 |
| 792 | Ga0207668_10429887 | 3300025972 | Bacteria | 1122 |
| 793 | Ga0207668_10970339 | 3300025972 | Unclassified | 759 |
| 794 | Ga0207640_10196601 | 3300025981 | Bacteria | 1524 |
| 795 | Ga0207640_10366863 | 3300025981 | Bacteria | 1162 |
| 796 | Ga0207658_10312966 | 3300025986 | Bacteria | 1357 |
| 797 | Ga0207677_10032125 | 3300026023 | Unclassified | 3371 |
| 798 | Ga0207677_10266283 | 3300026023 | Unclassified | 1399 |
| 799 | Ga0207677_10322542 | 3300026023 | Bacteria | 1284 |
| 800 | Ga0207677_10537715 | 3300026023 | Bacteria | 1016 |
| 801 | Ga0207677_10572387 | 3300026023 | Unclassified | 987 |
| 802 | Ga0207703_11140213 | 3300026035 | Bacteria | 749 |
| 803 | Ga0207639_10041448 | 3300026041 | Bacteria | 3444 |
| 804 | Ga0207639_10458011 | 3300026041 | Bacteria | 1159 |
| 805 | Ga0207639_10826130 | 3300026041 | Bacteria | 864 |
| 806 | Ga0207678_10004108 | 3300026067 | Bacteria | 13090 |
| 807 | Ga0207678_10039819 | 3300026067 | Bacteria | 4077 |
| 808 | Ga0207678_10237011 | 3300026067 | Bacteria | 1562 |
| 809 | Ga0207678_10419968 | 3300026067 | Bacteria | 1160 |
| 810 | Ga0207708_10003490 | 3300026075 | Bacteria | 11596 |
| 811 | Ga0207708_10018401 | 3300026075 | Bacteria | 5261 |
| 812 | Ga0207708_10020508 | 3300026075 | Bacteria | 4985 |
| 813 | Ga0207702_10011413 | 3300026078 | Bacteria | 7406 |
| 814 | Ga0207702_10314778 | 3300026078 | Unclassified | 1489 |
| 815 | Ga0207702_10609487 | 3300026078 | Bacteria | 1072 |
| 816 | Ga0207702_10688835 | 3300026078 | Unclassified | 1007 |
| 817 | Ga0207702_10725804 | 3300026078 | Bacteria | 980 |
| 818 | Ga0207702_10933307 | 3300026078 | Bacteria | 860 |
| 819 | Ga0207702_11052661 | 3300026078 | Bacteria | 807 |
| 820 | Ga0207641_10483437 | 3300026088 | Bacteria | 1200 |
| 821 | Ga0207648_10013106 | 3300026089 | Bacteria | 7730 |
| 822 | Ga0207648_10034985 | 3300026089 | Bacteria | 4428 |
| 823 | Ga0207648_10046259 | 3300026089 | Bacteria | 3815 |
| 824 | Ga0207648_10111797 | 3300026089 | Bacteria | 2398 |
| 825 | Ga0207676_10142455 | 3300026095 | Unclassified | 2054 |
| 826 | Ga0207676_10403186 | 3300026095 | Bacteria | 1278 |
| 827 | Ga0207676_10602740 | 3300026095 | Bacteria | 1055 |
| 828 | Ga0207676_10753919 | 3300026095 | Bacteria | 947 |
| 829 | Ga0207674_10002797 | 3300026116 | Bacteria | 21726 |
| 830 | Ga0207674_10003158 | 3300026116 | Bacteria | 20298 |
| 831 | Ga0207674_10070528 | 3300026116 | Bacteria | 3513 |
| 832 | Ga0207674_10148470 | 3300026116 | Bacteria | 2302 |
| 833 | Ga0207674_10292968 | 3300026116 | Bacteria | 1576 |
| 834 | Ga0207674_10796660 | 3300026116 | Bacteria | 912 |
| 835 | Ga0207675_100014301 | 3300026118 | Bacteria | 7398 |
| 836 | Ga0207675_100028238 | 3300026118 | Bacteria | 5224 |
| 837 | Ga0207675_100028247 | 3300026118 | Bacteria | 5223 |
| 838 | Ga0207675_100275851 | 3300026118 | Unclassified | 1633 |
| 839 | Ga0207675_100276046 | 3300026118 | Bacteria | 1632 |
| 840 | Ga0207675_100418102 | 3300026118 | Bacteria | 1324 |
| 841 | Ga0207675_100703200 | 3300026118 | Bacteria | 1020 |
| 842 | Ga0207683_10019866 | 3300026121 | Bacteria | 5740 |
| 843 | Ga0207683_10025027 | 3300026121 | Bacteria | 5146 |
| 844 | Ga0207683_10045184 | 3300026121 | Bacteria | 3851 |
| 845 | Ga0207683_10046558 | 3300026121 | Unclassified | 3796 |
| 846 | Ga0207683_10050227 | 3300026121 | Bacteria | 3653 |
| 847 | Ga0207683_10073743 | 3300026121 | Bacteria | 3019 |
| 848 | Ga0207698_10061364 | 3300026142 | Bacteria | 2929 |
| 849 | Ga0207698_10109155 | 3300026142 | Unclassified | 2314 |
| 850 | Ga0207698_10271867 | 3300026142 | Bacteria | 1563 |
| 851 | Ga0207698_10278494 | 3300026142 | Bacteria | 1546 |
| 852 | Ga0207698_10284055 | 3300026142 | Unclassified | 1532 |
| 853 | Ga0207698_10590176 | 3300026142 | Bacteria | 1094 |
| 854 | Ga0207698_10901387 | 3300026142 | Bacteria | 891 |
| 855 | Ga0207698_10964069 | 3300026142 | Bacteria | 862 |
| 856 | Ga0209996_1013331 | 3300027395 | Bacteria | 1110 |
| 857 | Ga0209974_10031452 | 3300027876 | Bacteria | 1757 |
| 858 | Ga0207428_10000961 | 3300027907 | Bacteria | 31972 |
| 859 | Ga0207428_10001607 | 3300027907 | Bacteria | 23478 |
| 860 | Ga0207428_10006497 | 3300027907 | Bacteria | 10790 |
| 861 | Ga0207428_10029057 | 3300027907 | Bacteria | 4587 |
| 862 | Ga0207428_10050377 | 3300027907 | Bacteria | 3332 |
| 863 | Ga0207428_10186543 | 3300027907 | Bacteria | 1565 |
| 864 | Ga0207428_10366783 | 3300027907 | Unclassified | 1058 |
| 865 | Ga0268266_10145897 | 3300028379 | Bacteria | 2128 |
| 866 | Ga0268266_10776320 | 3300028379 | Bacteria | 925 |
| 867 | Ga0268265_10236389 | 3300028380 | Bacteria | 1609 |
| 868 | Ga0268265_10459475 | 3300028380 | Bacteria | 1191 |
| 869 | Ga0268265_10548326 | 3300028380 | Bacteria | 1097 |
| 870 | Ga0268264_10223970 | 3300028381 | Bacteria | 1733 |
| 871 | Ga0268264_11307906 | 3300028381 | Unclassified | 735 |
| 872 | Ga0265338_10006932 | 3300028800 | Bacteria | 14255 |
| 873 | Ga0265327_10003464 | 3300031251 | Bacteria | 15020 |
| 874 | Ga0307408_100055125 | 3300031548 | Bacteria | 2877 |
| 875 | Ga0307408_101015725 | 3300031548 | Bacteria | 765 |
| 876 | Ga0307405_10034016 | 3300031731 | Unclassified | 3029 |
| 877 | Ga0307413_10072009 | 3300031824 | Unclassified | 2180 |
| 878 | Ga0307410_10413128 | 3300031852 | Unclassified | 1093 |
| 879 | Ga0307406_10527070 | 3300031901 | Unclassified | 962 |
| 880 | Ga0307412_10421648 | 3300031911 | Bacteria | 1092 |
| 881 | Ga0307409_100222604 | 3300031995 | Unclassified | 1704 |
| 882 | Ga0307409_100668260 | 3300031995 | Unclassified | 1035 |
| 883 | Ga0307416_100027433 | 3300032002 | Bacteria | 4217 |
| 884 | Ga0307416_100158165 | 3300032002 | Bacteria | 2090 |
| 885 | Ga0307416_100937076 | 3300032002 | Bacteria | 967 |
| 886 | Ga0307414_10657807 | 3300032004 | Unclassified | 945 |
| 887 | Ga0307415_100101915 | 3300032126 | Unclassified | 2108 |
| 888 | Ga0307415_100466596 | 3300032126 | Bacteria | 1095 |
| 889 | Ga0373930_0019390 | 3300034816 | Bacteria | 1316 |
| 890 | Ga0373948_0010741 | 3300034817 | Bacteria | 1604 |
| 891 | Ga0373948_0047377 | 3300034817 | Bacteria | 915 |
| 892 | Ga0373958_0038305 | 3300034819 | Bacteria | 970 |
| 893 | Ga0373959_0024307 | 3300034820 | Bacteria | 1183 |
| 894 | Ga0373959_0047639 | 3300034820 | Bacteria | 917 |
| 895 | Ga0373938_0001710 | 3300034957 | Bacteria | 3509 |
| 896 | Ga0373938_0040779 | 3300034957 | Bacteria | 1031 |
| 897 | Ga0373926_0061506 | 3300035083 | Bacteria | 1370 |
| 898 | Ga0373928_0003299 | 3300035084 | Bacteria | 3089 |
| 899 | Ga0373928_0006972 | 3300035084 | Bacteria | 2178 |
| 900 | Ga0373929_0007133 | 3300035085 | Bacteria | 2035 |
| 901 | Ga0373940_0080041 | 3300035088 | Bacteria | 964 |
| 902 | Ga0373944_0021946 | 3300035089 | Bacteria | 1852 |
| 903 | Ga0373949_0007106 | 3300035090 | Bacteria | 2456 |
| 904 | Ga0373949_0017025 | 3300035090 | Bacteria | 1635 |
| 905 | Ga0373951_0015729 | 3300035091 | Bacteria | 1705 |
| 906 | Ga0373952_0003220 | 3300035092 | Bacteria | 2940 |
| 907 | Ga0373952_0019049 | 3300035092 | Bacteria | 1425 |
| 908 | Ga0373932_0064366 | 3300035112 | Bacteria | 1122 |
| 909 | Ga0373939_0008646 | 3300035114 | Bacteria | 2501 |
| 910 | Ga0373939_0026767 | 3300035114 | Bacteria | 1628 |
| 911 | Ga0373939_0044986 | 3300035114 | Bacteria | 1346 |
| 912 | Ga0373941_0010231 | 3300035115 | Bacteria | 2389 |
| 913 | Ga0373941_0034259 | 3300035115 | Bacteria | 1531 |
| 914 | Ga0373945_0060922 | 3300035116 | Unclassified | 1408 |
| 915 | Ga0373945_0095234 | 3300035116 | Bacteria | 1158 |
| 916 | Ga0373957_0131858 | 3300035120 | Unclassified | 1018 |
| 917 | Ga0373960_0002600 | 3300035121 | Bacteria | 4078 |
| 918 | Ga0373960_0013535 | 3300035121 | Bacteria | 2049 |
| 919 | Ga0373960_0026376 | 3300035121 | Bacteria | 1588 |
| 920 | Ga0373943_0000446 | 3300035170 | Bacteria | 17509 |
| 921 | Ga0373943_0003706 | 3300035170 | Bacteria | 6949 |
| 922 | Ga0373943_0031704 | 3300035170 | Bacteria | 2509 |
| 923 | Ga0373943_0051298 | 3300035170 | Bacteria | 2031 |
| 924 | Ga0373943_0091074 | 3300035170 | Unclassified | 1579 |
| 925 | Ga0373943_0133294 | 3300035170 | Bacteria | 1331 |
| 926 | Ga0373946_0004785 | 3300035171 | Bacteria | 4872 |
| 927 | Ga0373946_0005191 | 3300035171 | Bacteria | 4695 |
| 928 | Ga0373942_0026511 | 3300035207 | Bacteria | 1501 |
| 929 | Ga0373961_0013443 | 3300035241 | Bacteria | 2065 |
| 930 | Ga0373961_0030492 | 3300035241 | Bacteria | 1500 |
| 931 | Ga0373962_0003042 | 3300035242 | Bacteria | 4018 |
| 932 | Ga0373924_0082499 | 3300035410 | Bacteria | 1369 |
| 933 | Ga0373924_0295082 | 3300035410 | Unclassified | 720 |
| 934 | Ga0373931_0018151 | 3300035691 | Bacteria | 3494 |
| 935 | Ga0373931_0128582 | 3300035691 | Bacteria | 1455 |
| 936 | Ga0373931_0142142 | 3300035691 | Bacteria | 1391 |
| 937 | Ga0373931_0525117 | 3300035691 | Bacteria | 766 |
| 938 | Ga0373935_0029195 | 3300035692 | Bacteria | 3413 |
| 939 | Ga0373935_0041188 | 3300035692 | Bacteria | 2901 |
| 940 | Ga0373935_0041505 | 3300035692 | Bacteria | 2890 |
| 941 | Ga0373935_0172203 | 3300035692 | Bacteria | 1481 |
| 942 | Ga0373927_0187623 | 3300035695 | Bacteria | 1356 |
| 943 | Ga0373927_0236852 | 3300035695 | Bacteria | 1199 |
| 944 | Ga0373927_0304819 | 3300035695 | Bacteria | 1048 |
| 945 | Ga0373947_0000387 | 3300035725 | Bacteria | 24881 |
| 946 | Ga0373947_0003076 | 3300035725 | Bacteria | 9935 |
| 947 | Ga0373947_0004637 | 3300035725 | Bacteria | 8061 |
| 948 | Ga0373947_0012427 | 3300035725 | Bacteria | 4879 |
| 949 | Ga0373947_0124486 | 3300035725 | Bacteria | 1640 |
| 950 | Ga0373947_0225748 | 3300035725 | Bacteria | 1232 |
| 951 | Ga0373937_0085424 | 3300036401 | Bacteria | 2920 |
| 952 | Ga0373937_0210250 | 3300036401 | Bacteria | 1830 |
| 953 | Ga0373925_0002635 | 3300037068 | Bacteria | 14241 |
| 954 | Ga0373925_0011235 | 3300037068 | Bacteria | 6494 |
| 955 | Ga0373925_0015834 | 3300037068 | Bacteria | 5455 |
| 956 | Ga0373925_0018474 | 3300037068 | Bacteria | 5068 |
| 957 | Ga0373925_0470224 | 3300037068 | Unclassified | 1031 |
| 958 | Ga0373925_0571140 | 3300037068 | Bacteria | 931 |
| 959 | Ga0395899_0010199 | 3300037312 | Bacteria | 7199 |
| 960 | Ga0395899_0026595 | 3300037312 | Bacteria | 4365 |
| 961 | Ga0395899_0241795 | 3300037312 | Unclassified | 1242 |
| 962 | Ga0395899_0313081 | 3300037312 | Bacteria | 1059 |
| 963 | Ga0395900_0001765 | 3300037418 | Bacteria | 24834 |
| 964 | Ga0395900_0024611 | 3300037418 | Bacteria | 6161 |
| 965 | Ga0395900_0038851 | 3300037418 | Bacteria | 4906 |
| 966 | Ga0395900_0065148 | 3300037418 | Bacteria | 3743 |
| 967 | Ga0395900_0073283 | 3300037418 | Bacteria | 3521 |
| 968 | Ga0395900_0094470 | 3300037418 | Bacteria | 3072 |
| 969 | Ga0395900_0096260 | 3300037418 | Bacteria | 3041 |
| 970 | Ga0395900_0129191 | 3300037418 | Bacteria | 2590 |
| 971 | Ga0395900_0145096 | 3300037418 | Bacteria | 2427 |
| 972 | Ga0395900_0165005 | 3300037418 | Unclassified | 2257 |
| 973 | Ga0395900_0358822 | 3300037418 | Unclassified | 1429 |
| 974 | Ga0395898_0020703 | 3300037466 | Bacteria | 6677 |
| 975 | Ga0395898_0021612 | 3300037466 | Bacteria | 6522 |
| 976 | Ga0395898_0040761 | 3300037466 | Bacteria | 4590 |
| 977 | Ga0395898_0063732 | 3300037466 | Unclassified | 3576 |
| 978 | Ga0395898_0112160 | 3300037466 | Viruses | 2613 |
| 979 | Ga0395898_0129986 | 3300037466 | Bacteria | 2412 |
| 980 | Ga0395898_0157867 | 3300037466 | Bacteria | 2169 |
| 981 | Ga0395898_0190194 | 3300037466 | Bacteria | 1961 |
| 982 | Ga0395898_0228586 | 3300037466 | Unclassified | 1774 |
| 983 | Ga0395898_0293680 | 3300037466 | Bacteria | 1550 |
| 984 | Ga0395898_0346623 | 3300037466 | Bacteria | 1416 |
| 985 | Ga0395898_0457106 | 3300037466 | Bacteria | 1216 |
| 986 | Ga0395898_0533152 | 3300037466 | Unclassified | 1116 |
| 987 | Ga0395898_0812453 | 3300037466 | Bacteria | 875 |
| 988 | Ga0395905_0002747 | 3300037471 | Bacteria | 19265 |
| 989 | Ga0395905_0037931 | 3300037471 | Bacteria | 4522 |
| 990 | Ga0395905_0039926 | 3300037471 | Bacteria | 4403 |
| 991 | Ga0395905_0090396 | 3300037471 | Bacteria | 2870 |
| 992 | Ga0395905_0145492 | 3300037471 | Bacteria | 2230 |
| 993 | Ga0395905_0146059 | 3300037471 | Unclassified | 2225 |
| 994 | Ga0395905_0188859 | 3300037471 | Bacteria | 1933 |
| 995 | Ga0395905_0638865 | 3300037471 | Bacteria | 966 |
| 996 | Ga0395905_0954241 | 3300037471 | Bacteria | 760 |
| 997 | Ga0395901_0004202 | 3300038443 | Bacteria | 14516 |
| 998 | Ga0395901_0033421 | 3300038443 | Bacteria | 5310 |
| 999 | Ga0395901_0058456 | 3300038443 | Bacteria | 4010 |
| 1000 | Ga0395901_0106519 | 3300038443 | Viruses | 2942 |
| 1001 | Ga0395901_0128766 | 3300038443 | Bacteria | 2660 |
| 1002 | Ga0395901_0144071 | 3300038443 | Bacteria | 2504 |
| 1003 | Ga0395901_0176004 | 3300038443 | Bacteria | 2244 |
| 1004 | Ga0395901_0209606 | 3300038443 | Bacteria | 2040 |
| 1005 | Ga0395901_0220128 | 3300038443 | Bacteria | 1984 |
| 1006 | Ga0395901_0316314 | 3300038443 | Bacteria | 1616 |
| 1007 | Ga0395901_0560410 | 3300038443 | Unclassified | 1157 |
| 1008 | Ga0395901_0743451 | 3300038443 | Unclassified | 974 |
| 1009 | Ga0439438_060592 | 3300041405 | Bacteria | 948 |
| 1010 | Ga0439461_0049123 | 3300041410 | Bacteria | 931 |
| 1011 | Ga0451793_1843478 | 3300041452 | Bacteria | 1018 |
| 1012 | Ga0451800_0491729 | 3300041459 | Unclassified | 740 |
| 1013 | Ga0451802_1410741 | 3300041460 | Unclassified | 882 |
| 1014 | Ga0451835_0095057 | 3300041492 | Unclassified | 943 |
| 1015 | Ga0451841_0601019 | 3300041498 | Unclassified | 880 |
| 1016 | Ga0451853_2781693 | 3300041512 | Bacteria | 8494 |
| 1017 | Ga0439448_0064681 | 3300042005 | Bacteria | 1212 |
| 1018 | Ga0439454_012833 | 3300042011 | Bacteria | 1142 |
| 1019 | Ga0439455_0106311 | 3300042012 | Bacteria | 778 |
| 1020 | Ga0439462_0106059 | 3300042015 | Bacteria | 776 |
| 1021 | Ga0450912_007473 | 3300042116 | Unclassified | 888 |
| 1022 | Ga0450906_012998 | 3300042145 | Bacteria | 1539 |
| 1023 | Ga0450908_008473 | 3300042184 | Bacteria | 1926 |
| 1024 | Ga0439435_0019544 | 3300042436 | Bacteria | 1738 |
| 1025 | Ga0450916_020664 | 3300042530 | Bacteria | 901 |
| 1026 | Ga0466961_0116983 | 3300044693 | Bacteria | 1675 |
| 1027 | Ga0466963_0008227 | 3300044694 | Bacteria | 6250 |
| 1028 | Ga0466963_0038413 | 3300044694 | Bacteria | 3130 |
| 1029 | Ga0466963_0047675 | 3300044694 | Unclassified | 2829 |
| 1030 | Ga0466963_0048740 | 3300044694 | Unclassified | 2800 |
| 1031 | Ga0466964_0017660 | 3300044706 | Bacteria | 2732 |
| 1032 | Ga0466968_0002483 | 3300044735 | Bacteria | 6779 |
| 1033 | Ga0466957_0038787 | 3300044842 | Bacteria | 2871 |
| 1034 | Ga0466960_0065768 | 3300044901 | Bacteria | 1791 |
| 1035 | Ga0466959_0055049 | 3300045049 | Bacteria | 2905 |
| 1036 | Ga0451576_0025840 | 3300045051 | Bacteria | 6325 |
| 1037 | Ga0466958_0039270 | 3300045836 | Unclassified | 2843 |
| 1038 | Ga0466967_0003096 | 3300045976 | Bacteria | 10692 |
| 1039 | Ga0466967_0009282 | 3300045976 | Bacteria | 7289 |
| 1040 | Ga0466967_0064789 | 3300045976 | Bacteria | 3251 |
| 1041 | Ga0466967_0099229 | 3300045976 | Bacteria | 2660 |
| 1042 | Ga0466967_0110372 | 3300045976 | Bacteria | 2526 |
| 1043 | Ga0466967_0239583 | 3300045976 | Bacteria | 1730 |
| 1044 | Ga0466967_0483065 | 3300045976 | Bacteria | 1214 |
| 1045 | Ga0466967_0827802 | 3300045976 | Bacteria | 919 |
| 1046 | Ga0466967_0872312 | 3300045976 | Unclassified | 895 |
| 1047 | Ga0466967_1201627 | 3300045976 | Bacteria | 755 |
| 1048 | Ga0495617_120635 | 3300046452 | Bacteria | 845 |
| 1049 | Ga0495592_0187718 | 3300046454 | Unclassified | 1403 |
| 1050 | Ga0495592_0261417 | 3300046454 | Unclassified | 1140 |
| 1051 | Ga0495603_0000339 | 3300046455 | Bacteria | 25130 |
| 1052 | Ga0495603_0010219 | 3300046455 | Bacteria | 5682 |
| 1053 | Ga0495603_0048054 | 3300046455 | Bacteria | 2541 |
| 1054 | Ga0495603_0139749 | 3300046455 | Bacteria | 1409 |
| 1055 | Ga0495603_0263240 | 3300046455 | Bacteria | 992 |
| 1056 | Ga0495603_0322226 | 3300046455 | Unclassified | 887 |
| 1057 | Ga0495629_0000756 | 3300046459 | Bacteria | 26121 |
| 1058 | Ga0495629_0105012 | 3300046459 | Bacteria | 1970 |
| 1059 | Ga0495629_0133718 | 3300046459 | Bacteria | 1727 |
| 1060 | Ga0495629_0176756 | 3300046459 | Unclassified | 1480 |
| 1061 | Ga0495629_0185828 | 3300046459 | Bacteria | 1439 |
| 1062 | Ga0495641_0000626 | 3300046461 | Bacteria | 29773 |
| 1063 | Ga0495641_0009085 | 3300046461 | Bacteria | 5954 |
| 1064 | Ga0495651_0052345 | 3300046462 | Bacteria | 3145 |
| 1065 | Ga0495651_0194067 | 3300046462 | Bacteria | 1426 |
| 1066 | Ga0495651_0238905 | 3300046462 | Bacteria | 1247 |
| 1067 | Ga0495653_0009151 | 3300046463 | Bacteria | 8097 |
| 1068 | Ga0495653_0034594 | 3300046463 | Bacteria | 3995 |
| 1069 | Ga0495653_0084723 | 3300046463 | Bacteria | 2334 |
| 1070 | Ga0495653_0090549 | 3300046463 | Bacteria | 2238 |
| 1071 | Ga0495653_0356485 | 3300046463 | Unclassified | 939 |
| 1072 | Ga0495653_0516025 | 3300046463 | Bacteria | 743 |
| 1073 | Ga0495653_0543703 | 3300046463 | Bacteria | 719 |
| 1074 | Ga0495580_0098927 | 3300046472 | Bacteria | 2029 |
| 1075 | Ga0495580_0158110 | 3300046472 | Bacteria | 1569 |
| 1076 | Ga0495580_0212312 | 3300046472 | Bacteria | 1331 |
| 1077 | Ga0495580_0285844 | 3300046472 | Bacteria | 1125 |
| 1078 | Ga0495582_0001691 | 3300046473 | Bacteria | 12453 |
| 1079 | Ga0495582_0004256 | 3300046473 | Bacteria | 8049 |
| 1080 | Ga0495582_0007425 | 3300046473 | Bacteria | 6070 |
| 1081 | Ga0495582_0030194 | 3300046473 | Bacteria | 2974 |
| 1082 | Ga0495582_0032842 | 3300046473 | Bacteria | 2852 |
| 1083 | Ga0495639_0000390 | 3300046475 | Bacteria | 20704 |
| 1084 | Ga0495639_0000932 | 3300046475 | Bacteria | 13207 |
| 1085 | Ga0495639_0006417 | 3300046475 | Bacteria | 5060 |
| 1086 | Ga0495639_0078952 | 3300046475 | Unclassified | 1530 |
| 1087 | Ga0495662_0001935 | 3300046476 | Bacteria | 10397 |
| 1088 | Ga0495662_0010854 | 3300046476 | Bacteria | 4455 |
| 1089 | Ga0495662_0034980 | 3300046476 | Bacteria | 2424 |
| 1090 | Ga0495664_0006141 | 3300046477 | Bacteria | 6632 |
| 1091 | Ga0495664_0181767 | 3300046477 | Bacteria | 1275 |
| 1092 | Ga0495594_0001020 | 3300046499 | Bacteria | 14595 |
| 1093 | Ga0495594_0191687 | 3300046499 | Unclassified | 1165 |
| 1094 | Ga0495607_0320033 | 3300046501 | Unclassified | 724 |
| 1095 | Ga0495608_0031672 | 3300046511 | Bacteria | 3574 |
| 1096 | Ga0495608_0035495 | 3300046511 | Bacteria | 3363 |
| 1097 | Ga0495618_0015162 | 3300046514 | Bacteria | 4702 |
| 1098 | Ga0495618_0067762 | 3300046514 | Bacteria | 2270 |
| 1099 | Ga0495618_0126627 | 3300046514 | Unclassified | 1635 |
| 1100 | Ga0495618_0144683 | 3300046514 | Bacteria | 1520 |
| 1101 | Ga0495628_0547974 | 3300046516 | Unclassified | 831 |
| 1102 | Ga0495630_0006174 | 3300046517 | Bacteria | 8496 |
| 1103 | Ga0495630_0011353 | 3300046517 | Bacteria | 6447 |
| 1104 | Ga0495630_0015527 | 3300046517 | Bacteria | 5561 |
| 1105 | Ga0495630_0038463 | 3300046517 | Bacteria | 3578 |
| 1106 | Ga0495630_0269249 | 3300046517 | Bacteria | 1301 |
| 1107 | Ga0495630_0305056 | 3300046517 | Bacteria | 1217 |
| 1108 | Ga0495630_0461030 | 3300046517 | Bacteria | 974 |
| 1109 | Ga0495666_0002371 | 3300046526 | Bacteria | 9394 |
| 1110 | Ga0495666_0068093 | 3300046526 | Bacteria | 1695 |
| 1111 | Ga0495666_0074018 | 3300046526 | Bacteria | 1616 |
| 1112 | Ga0495666_0081208 | 3300046526 | Bacteria | 1534 |
| 1113 | Ga0495652_0125804 | 3300046529 | Bacteria | 2036 |
| 1114 | Ga0495652_0129266 | 3300046529 | Bacteria | 2002 |
| 1115 | Ga0495652_0243857 | 3300046529 | Bacteria | 1335 |
| 1116 | Ga0495652_0312101 | 3300046529 | Bacteria | 1139 |
| 1117 | Ga0495652_0417761 | 3300046529 | Bacteria | 946 |
| 1118 | Ga0495665_0001013 | 3300046531 | Bacteria | 14856 |
| 1119 | Ga0495665_0005059 | 3300046531 | Bacteria | 7108 |
| 1120 | Ga0495665_0033964 | 3300046531 | Bacteria | 2727 |
| 1121 | Ga0495640_0008914 | 3300046533 | Bacteria | 7833 |
| 1122 | Ga0495640_0039874 | 3300046533 | Bacteria | 3292 |
| 1123 | Ga0495640_0049800 | 3300046533 | Bacteria | 2887 |
| 1124 | Ga0495640_0385773 | 3300046533 | Unclassified | 861 |
| 1125 | Ga0495586_0265469 | 3300046535 | Bacteria | 980 |
| 1126 | Ga0495587_0134726 | 3300046536 | Bacteria | 1411 |
| 1127 | Ga0495587_0165161 | 3300046536 | Bacteria | 1259 |
| 1128 | Ga0495645_0282942 | 3300046543 | Unclassified | 1090 |
| 1129 | Ga0495622_0134656 | 3300046557 | Bacteria | 1124 |
| 1130 | Ga0495667_0019358 | 3300046559 | Bacteria | 4593 |
| 1131 | Ga0495667_0055301 | 3300046559 | Bacteria | 2610 |
| 1132 | Ga0495667_0062901 | 3300046559 | Bacteria | 2431 |
| 1133 | Ga0495667_0299529 | 3300046559 | Unclassified | 1019 |
| 1134 | Ga0495668_0187250 | 3300046616 | Bacteria | 1134 |
| 1135 | Ga0495634_0023836 | 3300046642 | Bacteria | 4299 |
| 1136 | Ga0495634_0028213 | 3300046642 | Bacteria | 3898 |
| 1137 | Ga0495634_0034230 | 3300046642 | Bacteria | 3487 |
| 1138 | Ga0495634_0137783 | 3300046642 | Bacteria | 1552 |
| 1139 | Ga0495634_0304611 | 3300046642 | Unclassified | 963 |
| 1140 | Ga0495635_0022086 | 3300046663 | Bacteria | 4434 |
| 1141 | Ga0495635_0023627 | 3300046663 | Bacteria | 4282 |
| 1142 | Ga0495635_0052541 | 3300046663 | Unclassified | 2807 |
| 1143 | Ga0495635_0116442 | 3300046663 | Bacteria | 1824 |
| 1144 | Ga0495635_0159386 | 3300046663 | Unclassified | 1535 |
| 1145 | Ga0495588_0000863 | 3300046674 | Bacteria | 13378 |
| 1146 | Ga0495588_0044492 | 3300046674 | Bacteria | 2274 |
| 1147 | Ga0495657_0015061 | 3300046675 | Bacteria | 5668 |
| 1148 | Ga0495657_0048063 | 3300046675 | Bacteria | 2880 |
| 1149 | Ga0495657_0096510 | 3300046675 | Bacteria | 1889 |
| 1150 | Ga0495599_0025318 | 3300046678 | Bacteria | 3713 |
| 1151 | Ga0495599_0216475 | 3300046678 | Bacteria | 1173 |
| 1152 | Ga0495599_0364031 | 3300046678 | Bacteria | 865 |
| 1153 | Ga0495623_0004791 | 3300046679 | Bacteria | 8893 |
| 1154 | Ga0495623_0057491 | 3300046679 | Bacteria | 2447 |
| 1155 | Ga0495623_0189932 | 3300046679 | Bacteria | 1188 |
| 1156 | Ga0495646_0038823 | 3300046680 | Bacteria | 2938 |
| 1157 | Ga0495646_0185193 | 3300046680 | Bacteria | 1141 |
| 1158 | Ga0495646_0434089 | 3300046680 | Bacteria | 680 |
| 1159 | Ga0495647_0007286 | 3300046681 | Bacteria | 3699 |
| 1160 | Ga0495647_0007772 | 3300046681 | Bacteria | 3601 |
| 1161 | Ga0495647_0017457 | 3300046681 | Bacteria | 2540 |
| 1162 | Ga0495647_0165297 | 3300046681 | Unclassified | 956 |
| 1163 | Ga0495658_0000477 | 3300046683 | Bacteria | 22157 |
| 1164 | Ga0495658_0002681 | 3300046683 | Bacteria | 8964 |
| 1165 | Ga0495658_0012424 | 3300046683 | Bacteria | 4312 |
| 1166 | Ga0495658_0067838 | 3300046683 | Bacteria | 2064 |
| 1167 | Ga0495658_0169632 | 3300046683 | Unclassified | 1350 |
| 1168 | Ga0495658_0651318 | 3300046683 | Archaea | 675 |
| 1169 | Ga0495613_0012014 | 3300046689 | Bacteria | 6435 |
| 1170 | Ga0495613_0027883 | 3300046689 | Bacteria | 4204 |
| 1171 | Ga0495613_0035174 | 3300046689 | Bacteria | 3719 |
| 1172 | Ga0495613_0082324 | 3300046689 | Bacteria | 2337 |
| 1173 | Ga0495613_0151997 | 3300046689 | Bacteria | 1650 |
| 1174 | Ga0495613_0171905 | 3300046689 | Bacteria | 1537 |
| 1175 | Ga0495624_0005965 | 3300046690 | Bacteria | 8703 |
| 1176 | Ga0495624_0011629 | 3300046690 | Bacteria | 6045 |
| 1177 | Ga0495624_0026113 | 3300046690 | Bacteria | 3829 |
| 1178 | Ga0495589_0136762 | 3300046794 | Unclassified | 1175 |
| 1179 | Ga0495589_0158424 | 3300046794 | Bacteria | 1079 |
| 1180 | Ga0495600_0060012 | 3300046809 | Bacteria | 2483 |
| 1181 | Ga0495600_0182986 | 3300046809 | Bacteria | 1350 |
| 1182 | Ga0495600_0187762 | 3300046809 | Bacteria | 1330 |
| 1183 | Ga0495600_0226368 | 3300046809 | Bacteria | 1195 |
| 1184 | Ga0495581_0004713 | 3300047315 | Bacteria | 7873 |
| 1185 | Ga0495581_0010091 | 3300047315 | Bacteria | 5463 |
| 1186 | Ga0495581_0010557 | 3300047315 | Bacteria | 5339 |
| 1187 | Ga0495581_0012180 | 3300047315 | Bacteria | 4978 |
| 1188 | Ga0495581_0043668 | 3300047315 | Bacteria | 2592 |
| 1189 | Ga0495604_0094893 | 3300047317 | Bacteria | 2204 |
| 1190 | Ga0495604_0207962 | 3300047317 | Unclassified | 1354 |
| 1191 | Ga0495604_0229187 | 3300047317 | Bacteria | 1275 |
| 1192 | Ga0495604_0337871 | 3300047317 | Unclassified | 1003 |
| 1193 | Ga0495674_0001928 | 3300047319 | Bacteria | 20475 |
| 1194 | Ga0495674_0013017 | 3300047319 | Bacteria | 7830 |
| 1195 | Ga0495674_0020329 | 3300047319 | Bacteria | 6148 |
| 1196 | Ga0495674_0092217 | 3300047319 | Bacteria | 2587 |
| 1197 | Ga0495674_0095249 | 3300047319 | Bacteria | 2538 |
| 1198 | Ga0495674_0182686 | 3300047319 | Unclassified | 1746 |
| 1199 | Ga0495674_0323449 | 3300047319 | Bacteria | 1256 |
| 1200 | Ga0495674_0396684 | 3300047319 | Bacteria | 1114 |
| 1201 | Ga0495674_0454988 | 3300047319 | Unclassified | 1028 |
| 1202 | Ga0495676_0007375 | 3300047321 | Bacteria | 10094 |
| 1203 | Ga0495676_0008869 | 3300047321 | Bacteria | 9186 |
| 1204 | Ga0495676_0039732 | 3300047321 | Bacteria | 3892 |
| 1205 | Ga0495676_0067394 | 3300047321 | Bacteria | 2769 |
| 1206 | Ga0495676_0159325 | 3300047321 | Bacteria | 1598 |
| 1207 | Ga0495676_0351462 | 3300047321 | Bacteria | 985 |
| 1208 | Ga0495680_0001918 | 3300047322 | Bacteria | 21832 |
| 1209 | Ga0495680_0002863 | 3300047322 | Bacteria | 17330 |
| 1210 | Ga0495680_0023233 | 3300047322 | Bacteria | 5157 |
| 1211 | Ga0495680_0035097 | 3300047322 | Bacteria | 4043 |
| 1212 | Ga0495683_0170283 | 3300047323 | Bacteria | 1002 |
| 1213 | Ga0495677_0068950 | 3300047445 | Bacteria | 1317 |
| 1214 | Ga0495677_0178389 | 3300047445 | Bacteria | 823 |
| 1215 | Ga0495684_0017343 | 3300047471 | Bacteria | 5541 |
| 1216 | Ga0495684_0058385 | 3300047471 | Bacteria | 2939 |
| 1217 | Ga0495684_0067293 | 3300047471 | Bacteria | 2724 |
| 1218 | Ga0495684_0080217 | 3300047471 | Bacteria | 2477 |
| 1219 | Ga0495684_0096431 | 3300047471 | Bacteria | 2238 |
| 1220 | Ga0495593_0002453 | 3300047673 | Bacteria | 11159 |
| 1221 | Ga0495593_0016019 | 3300047673 | Bacteria | 4232 |
| 1222 | Ga0495593_0096453 | 3300047673 | Bacteria | 1519 |
| 1223 | Ga0495602_0088357 | 3300048088 | Bacteria | 2580 |
| 1224 | Ga0495602_0122659 | 3300048088 | Unclassified | 2088 |
| 1225 | Ga0495602_0138240 | 3300048088 | Bacteria | 1932 |
| 1226 | Ga0495614_0002561 | 3300048089 | Bacteria | 8083 |
| 1227 | Ga0495614_0015876 | 3300048089 | Unclassified | 3280 |
| 1228 | Ga0495614_0024565 | 3300048089 | Bacteria | 2601 |
| 1229 | Ga0495614_0090968 | 3300048089 | Unclassified | 1327 |
| 1230 | Ga0495626_0101351 | 3300048091 | Bacteria | 1255 |
| 1231 | Ga0496100_0001475 | 3300048903 | Bacteria | 11518 |
| 1232 | Ga0496100_0017504 | 3300048903 | Bacteria | 4232 |
| 1233 | Ga0496100_0019881 | 3300048903 | Bacteria | 4016 |
| 1234 | Ga0496100_0049942 | 3300048903 | Bacteria | 2707 |
| 1235 | Ga0496100_0050735 | 3300048903 | Unclassified | 2689 |
| 1236 | Ga0496100_0069499 | 3300048903 | Bacteria | 2345 |
| 1237 | Ga0496100_0073748 | 3300048903 | Bacteria | 2285 |
| 1238 | Ga0496100_0108686 | 3300048903 | Bacteria | 1923 |
| 1239 | Ga0496100_0217962 | 3300048903 | Bacteria | 1399 |
| 1240 | Ga0496100_0222008 | 3300048903 | Bacteria | 1387 |
| 1241 | Ga0496100_0248643 | 3300048903 | Bacteria | 1315 |
| 1242 | Ga0496100_0272832 | 3300048903 | Bacteria | 1258 |
| 1243 | Ga0496100_0326122 | 3300048903 | Bacteria | 1154 |
| 1244 | Ga0496100_0438652 | 3300048903 | Bacteria | 1000 |
| 1245 | Ga0496100_0694413 | 3300048903 | Bacteria | 794 |
| 1246 | Ga0496101_0007713 | 3300048904 | Bacteria | 6990 |
| 1247 | Ga0496101_0008020 | 3300048904 | Bacteria | 6883 |
| 1248 | Ga0496101_0010537 | 3300048904 | Bacteria | 6106 |
| 1249 | Ga0496101_0012675 | 3300048904 | Bacteria | 5634 |
| 1250 | Ga0496101_0015235 | 3300048904 | Bacteria | 5175 |
| 1251 | Ga0496101_0015329 | 3300048904 | Bacteria | 5163 |
| 1252 | Ga0496101_0031551 | 3300048904 | Bacteria | 3726 |
| 1253 | Ga0496101_0042041 | 3300048904 | Bacteria | 3262 |
| 1254 | Ga0496101_0055799 | 3300048904 | Bacteria | 2855 |
| 1255 | Ga0496101_0075160 | 3300048904 | Bacteria | 2486 |
| 1256 | Ga0496101_0138526 | 3300048904 | Unclassified | 1853 |
| 1257 | Ga0496101_0160097 | 3300048904 | Unclassified | 1726 |
| 1258 | Ga0496101_0225615 | 3300048904 | Bacteria | 1455 |
| 1259 | Ga0496101_0459305 | 3300048904 | Bacteria | 1005 |
| 1260 | Ga0496102_0005018 | 3300048905 | Bacteria | 11206 |
| 1261 | Ga0496102_0006410 | 3300048905 | Bacteria | 10032 |
| 1262 | Ga0496102_0009237 | 3300048905 | Bacteria | 8460 |
| 1263 | Ga0496102_0019899 | 3300048905 | Bacteria | 5919 |
| 1264 | Ga0496102_0034806 | 3300048905 | Bacteria | 4532 |
| 1265 | Ga0496102_0103107 | 3300048905 | Bacteria | 2653 |
| 1266 | Ga0496102_0110844 | 3300048905 | Bacteria | 2558 |
| 1267 | Ga0496102_0175055 | 3300048905 | Bacteria | 2020 |
| 1268 | Ga0496102_0180029 | 3300048905 | Bacteria | 1991 |
| 1269 | Ga0496102_0366048 | 3300048905 | Bacteria | 1357 |
| 1270 | Ga0496102_0624643 | 3300048905 | Bacteria | 1000 |
| 1271 | Ga0496102_0643475 | 3300048905 | Bacteria | 983 |
| 1272 | Ga0496103_0001794 | 3300048906 | Bacteria | 14009 |
| 1273 | Ga0496103_0007950 | 3300048906 | Bacteria | 6301 |
| 1274 | Ga0496103_0044591 | 3300048906 | Bacteria | 2733 |
| 1275 | Ga0496103_0061127 | 3300048906 | Unclassified | 2342 |
| 1276 | Ga0496103_0109678 | 3300048906 | Bacteria | 1752 |
| 1277 | Ga0496103_0221664 | 3300048906 | Bacteria | 1216 |
| 1278 | Ga0496103_0228741 | 3300048906 | Unclassified | 1196 |
| 1279 | Ga0496103_0407035 | 3300048906 | Unclassified | 874 |
| 1280 | Ga0496103_0410661 | 3300048906 | Bacteria | 869 |
| 1281 | Ga0496104_0000461 | 3300048907 | Bacteria | 35063 |
| 1282 | Ga0496104_0000494 | 3300048907 | Bacteria | 34055 |
| 1283 | Ga0496104_0011694 | 3300048907 | Bacteria | 7870 |
| 1284 | Ga0496104_0013270 | 3300048907 | Bacteria | 7426 |
| 1285 | Ga0496104_0025462 | 3300048907 | Bacteria | 5454 |
| 1286 | Ga0496104_0048035 | 3300048907 | Bacteria | 4024 |
| 1287 | Ga0496104_0048116 | 3300048907 | Bacteria | 4021 |
| 1288 | Ga0496104_0143755 | 3300048907 | Bacteria | 2291 |
| 1289 | Ga0496104_0192690 | 3300048907 | Bacteria | 1950 |
| 1290 | Ga0496104_0228606 | 3300048907 | Bacteria | 1772 |
| 1291 | Ga0496104_0246772 | 3300048907 | Bacteria | 1698 |
| 1292 | Ga0496104_0263856 | 3300048907 | Bacteria | 1635 |
| 1293 | Ga0496104_0305216 | 3300048907 | Bacteria | 1504 |
| 1294 | Ga0496104_0314598 | 3300048907 | Unclassified | 1479 |
| 1295 | Ga0496104_0337666 | 3300048907 | Bacteria | 1419 |
| 1296 | Ga0496104_0337782 | 3300048907 | Unclassified | 1419 |
| 1297 | Ga0496104_0385445 | 3300048907 | Bacteria | 1314 |
| 1298 | Ga0496105_0000673 | 3300048908 | Bacteria | 22964 |
| 1299 | Ga0496105_0000930 | 3300048908 | Bacteria | 19941 |
| 1300 | Ga0496105_0001972 | 3300048908 | Bacteria | 14767 |
| 1301 | Ga0496105_0010729 | 3300048908 | Bacteria | 7211 |
| 1302 | Ga0496105_0020091 | 3300048908 | Bacteria | 5392 |
| 1303 | Ga0496105_0025579 | 3300048908 | Bacteria | 4807 |
| 1304 | Ga0496105_0044586 | 3300048908 | Unclassified | 3658 |
| 1305 | Ga0496105_0048906 | 3300048908 | Bacteria | 3491 |
| 1306 | Ga0496105_0054206 | 3300048908 | Bacteria | 3311 |
| 1307 | Ga0496105_0076428 | 3300048908 | Bacteria | 2765 |
| 1308 | Ga0496105_0214849 | 3300048908 | Bacteria | 1567 |
| 1309 | Ga0496105_0245973 | 3300048908 | Bacteria | 1450 |
| 1310 | Ga0496105_0287771 | 3300048908 | Bacteria | 1323 |
| 1311 | Ga0496105_0347036 | 3300048908 | Bacteria | 1186 |
| 1312 | Ga0496105_0389499 | 3300048908 | Bacteria | 1108 |
| 1313 | Ga0496105_0412356 | 3300048908 | Bacteria | 1071 |
| 1314 | Ga0496106_0000456 | 3300048909 | Bacteria | 29280 |
| 1315 | Ga0496106_0008749 | 3300048909 | Bacteria | 7485 |
| 1316 | Ga0496106_0012301 | 3300048909 | Bacteria | 6315 |
| 1317 | Ga0496106_0014956 | 3300048909 | Bacteria | 5741 |
| 1318 | Ga0496106_0037415 | 3300048909 | Bacteria | 3630 |
| 1319 | Ga0496106_0039147 | 3300048909 | Bacteria | 3551 |
| 1320 | Ga0496106_0043208 | 3300048909 | Bacteria | 3381 |
| 1321 | Ga0496106_0097556 | 3300048909 | Bacteria | 2275 |
| 1322 | Ga0496106_0098188 | 3300048909 | Bacteria | 2269 |
| 1323 | Ga0496106_0117405 | 3300048909 | Unclassified | 2076 |
| 1324 | Ga0496106_0411097 | 3300048909 | Bacteria | 1087 |
| 1325 | Ga0496106_0485265 | 3300048909 | Bacteria | 993 |
| 1326 | Ga0496106_0661871 | 3300048909 | Unclassified | 834 |
| 1327 | Ga0496107_0000980 | 3300048910 | Bacteria | 16945 |
| 1328 | Ga0496107_0011989 | 3300048910 | Bacteria | 6048 |
| 1329 | Ga0496107_0019088 | 3300048910 | Bacteria | 4835 |
| 1330 | Ga0496107_0021993 | 3300048910 | Bacteria | 4504 |
| 1331 | Ga0496107_0043490 | 3300048910 | Bacteria | 3227 |
| 1332 | Ga0496107_0043609 | 3300048910 | Bacteria | 3223 |
| 1333 | Ga0496107_0045805 | 3300048910 | Unclassified | 3147 |
| 1334 | Ga0496107_0072819 | 3300048910 | Bacteria | 2498 |
| 1335 | Ga0496107_0235465 | 3300048910 | Bacteria | 1362 |
| 1336 | Ga0496108_0003532 | 3300048911 | Bacteria | 12539 |
| 1337 | Ga0496108_0004458 | 3300048911 | Bacteria | 11272 |
| 1338 | Ga0496108_0011668 | 3300048911 | Bacteria | 7150 |
| 1339 | Ga0496108_0025218 | 3300048911 | Bacteria | 4899 |
| 1340 | Ga0496108_0025655 | 3300048911 | Bacteria | 4859 |
| 1341 | Ga0496108_0029090 | 3300048911 | Bacteria | 4573 |
| 1342 | Ga0496108_0052736 | 3300048911 | Bacteria | 3410 |
| 1343 | Ga0496108_0069163 | 3300048911 | Bacteria | 2979 |
| 1344 | Ga0496108_0091374 | 3300048911 | Bacteria | 2588 |
| 1345 | Ga0496108_0119196 | 3300048911 | Bacteria | 2263 |
| 1346 | Ga0496108_0184967 | 3300048911 | Bacteria | 1804 |
| 1347 | Ga0496108_0407703 | 3300048911 | Unclassified | 1187 |
| 1348 | Ga0496108_0432807 | 3300048911 | Unclassified | 1149 |
| 1349 | Ga0496108_0682290 | 3300048911 | Bacteria | 892 |
| 1350 | Ga0496109_0001074 | 3300048912 | Bacteria | 22668 |
| 1351 | Ga0496109_0003058 | 3300048912 | Bacteria | 13944 |
| 1352 | Ga0496109_0003358 | 3300048912 | Bacteria | 13390 |
| 1353 | Ga0496109_0009488 | 3300048912 | Bacteria | 8297 |
| 1354 | Ga0496109_0010424 | 3300048912 | Bacteria | 7937 |
| 1355 | Ga0496109_0032256 | 3300048912 | Bacteria | 4708 |
| 1356 | Ga0496109_0044210 | 3300048912 | Bacteria | 4040 |
| 1357 | Ga0496109_0064767 | 3300048912 | Bacteria | 3344 |
| 1358 | Ga0496109_0080620 | 3300048912 | Bacteria | 2999 |
| 1359 | Ga0496109_0083336 | 3300048912 | Bacteria | 2949 |
| 1360 | Ga0496109_0166118 | 3300048912 | Bacteria | 2069 |
| 1361 | Ga0496109_0185725 | 3300048912 | Unclassified | 1953 |
| 1362 | Ga0496109_0220819 | 3300048912 | Bacteria | 1782 |
| 1363 | Ga0496109_0255278 | 3300048912 | Bacteria | 1651 |
| 1364 | Ga0496109_0473632 | 3300048912 | Unclassified | 1182 |
| 1365 | Ga0496109_0478020 | 3300048912 | Unclassified | 1176 |
| 1366 | Ga0496109_0494366 | 3300048912 | Bacteria | 1155 |
| 1367 | Ga0496109_0663136 | 3300048912 | Bacteria | 980 |
| 1368 | Ga0496110_0000072 | 3300048913 | Bacteria | 51313 |
| 1369 | Ga0496110_0004711 | 3300048913 | Bacteria | 10611 |
| 1370 | Ga0496110_0006848 | 3300048913 | Bacteria | 9057 |
| 1371 | Ga0496110_0009248 | 3300048913 | Bacteria | 7964 |
| 1372 | Ga0496110_0011742 | 3300048913 | Bacteria | 7186 |
| 1373 | Ga0496110_0016180 | 3300048913 | Bacteria | 6221 |
| 1374 | Ga0496110_0028108 | 3300048913 | Bacteria | 4826 |
| 1375 | Ga0496110_0080889 | 3300048913 | Bacteria | 2896 |
| 1376 | Ga0496110_0097611 | 3300048913 | Unclassified | 2633 |
| 1377 | Ga0496110_0131496 | 3300048913 | Bacteria | 2260 |
| 1378 | Ga0496110_0541663 | 3300048913 | Bacteria | 1058 |
| 1379 | Ga0496110_0583391 | 3300048913 | Unclassified | 1015 |
| 1380 | Ga0496110_0816806 | 3300048913 | Unclassified | 837 |
| 1381 | Ga0496111_0001669 | 3300048914 | Bacteria | 12923 |
| 1382 | Ga0496111_0003404 | 3300048914 | Bacteria | 9841 |
| 1383 | Ga0496111_0009077 | 3300048914 | Bacteria | 6619 |
| 1384 | Ga0496111_0016303 | 3300048914 | Bacteria | 5117 |
| 1385 | Ga0496111_0047674 | 3300048914 | Bacteria | 3086 |
| 1386 | Ga0496111_0101301 | 3300048914 | Bacteria | 2116 |
| 1387 | Ga0496111_0119445 | 3300048914 | Bacteria | 1947 |
| 1388 | Ga0496111_0133472 | 3300048914 | Unclassified | 1838 |
| 1389 | Ga0496111_0152670 | 3300048914 | Unclassified | 1713 |
| 1390 | Ga0496111_0196071 | 3300048914 | Bacteria | 1501 |
| 1391 | Ga0496111_0280505 | 3300048914 | Bacteria | 1236 |
| 1392 | Ga0496111_0406941 | 3300048914 | Bacteria | 1005 |
| 1393 | Ga0496112_0000684 | 3300048915 | Bacteria | 23634 |
| 1394 | Ga0496112_0002604 | 3300048915 | Bacteria | 14573 |
| 1395 | Ga0496112_0005435 | 3300048915 | Bacteria | 11019 |
| 1396 | Ga0496112_0008124 | 3300048915 | Bacteria | 9375 |
| 1397 | Ga0496112_0033515 | 3300048915 | Bacteria | 4993 |
| 1398 | Ga0496112_0062620 | 3300048915 | Bacteria | 3670 |
| 1399 | Ga0496112_0341475 | 3300048915 | Unclassified | 1441 |
| 1400 | Ga0496112_0551344 | 3300048915 | Bacteria | 1086 |
| 1401 | Ga0496112_0700041 | 3300048915 | Bacteria | 941 |
| 1402 | Ga0496113_0000076 | 3300048916 | Bacteria | 42925 |
| 1403 | Ga0496113_0000337 | 3300048916 | Bacteria | 22353 |
| 1404 | Ga0496113_0018937 | 3300048916 | Bacteria | 4806 |
| 1405 | Ga0496113_0018975 | 3300048916 | Bacteria | 4802 |
| 1406 | Ga0496113_0065474 | 3300048916 | Bacteria | 2751 |
| 1407 | Ga0496113_0291019 | 3300048916 | Bacteria | 1307 |
| 1408 | Ga0496114_0004595 | 3300048917 | Bacteria | 10722 |
| 1409 | Ga0496114_0017409 | 3300048917 | Bacteria | 5800 |
| 1410 | Ga0496114_0021228 | 3300048917 | Bacteria | 5281 |
| 1411 | Ga0496114_0021672 | 3300048917 | Bacteria | 5228 |
| 1412 | Ga0496114_0044100 | 3300048917 | Bacteria | 3699 |
| 1413 | Ga0496114_0046657 | 3300048917 | Bacteria | 3601 |
| 1414 | Ga0496114_0061063 | 3300048917 | Bacteria | 3152 |
| 1415 | Ga0496114_0075519 | 3300048917 | Unclassified | 2839 |
| 1416 | Ga0496114_0086255 | 3300048917 | Unclassified | 2660 |
| 1417 | Ga0496114_0093474 | 3300048917 | Unclassified | 2557 |
| 1418 | Ga0496114_0099991 | 3300048917 | Bacteria | 2474 |
| 1419 | Ga0496114_0125607 | 3300048917 | Bacteria | 2211 |
| 1420 | Ga0496114_0137945 | 3300048917 | Bacteria | 2110 |
| 1421 | Ga0496114_0159675 | 3300048917 | Bacteria | 1959 |
| 1422 | Ga0496114_0164189 | 3300048917 | Unclassified | 1933 |
| 1423 | Ga0496114_0228804 | 3300048917 | Bacteria | 1633 |
| 1424 | Ga0496114_0377730 | 3300048917 | Bacteria | 1254 |
| 1425 | Ga0496114_0378967 | 3300048917 | Unclassified | 1252 |
| 1426 | Ga0496114_0477456 | 3300048917 | Bacteria | 1103 |
| 1427 | Ga0496114_0515508 | 3300048917 | Unclassified | 1057 |
| 1428 | Ga0496114_0805605 | 3300048917 | Unclassified | 818 |
| 1429 | Ga0496115_0000719 | 3300048918 | Bacteria | 24524 |
| 1430 | Ga0496115_0001259 | 3300048918 | Bacteria | 18182 |
| 1431 | Ga0496115_0001662 | 3300048918 | Bacteria | 15996 |
| 1432 | Ga0496115_0001827 | 3300048918 | Bacteria | 15235 |
| 1433 | Ga0496115_0007268 | 3300048918 | Bacteria | 8145 |
| 1434 | Ga0496115_0011828 | 3300048918 | Bacteria | 6556 |
| 1435 | Ga0496115_0018979 | 3300048918 | Bacteria | 5287 |
| 1436 | Ga0496115_0023795 | 3300048918 | Bacteria | 4756 |
| 1437 | Ga0496115_0061856 | 3300048918 | Bacteria | 3019 |
| 1438 | Ga0496115_0077714 | 3300048918 | Bacteria | 2699 |
| 1439 | Ga0496115_0107668 | 3300048918 | Bacteria | 2288 |
| 1440 | Ga0496115_0206482 | 3300048918 | Unclassified | 1623 |
| 1441 | Ga0496115_0218948 | 3300048918 | Bacteria | 1571 |
| 1442 | Ga0496115_0276782 | 3300048918 | Bacteria | 1378 |
| 1443 | Ga0496115_0389173 | 3300048918 | Bacteria | 1132 |
| 1444 | Ga0496115_0522745 | 3300048918 | Bacteria | 951 |
| 1445 | Ga0496115_0918629 | 3300048918 | Bacteria | 674 |
| 1446 | Ga0501031_0555509 | 3300049568 | Bacteria | 739 |
| 1447 | Ga0501032_0008328 | 3300049569 | Bacteria | 7555 |
| 1448 | Ga0501032_0331679 | 3300049569 | Unclassified | 981 |
| 1449 | Ga0501033_0066856 | 3300049570 | Bacteria | 2643 |
| 1450 | Ga0501033_0499633 | 3300049570 | Unclassified | 841 |
| 1451 | Ga0501034_0130381 | 3300049571 | Bacteria | 2498 |
| 1452 | Ga0501034_0439928 | 3300049571 | Bacteria | 1223 |
| 1453 | Ga0501036_0014658 | 3300049572 | Bacteria | 6532 |
| 1454 | Ga0501036_0044139 | 3300049572 | Bacteria | 3775 |
| 1455 | Ga0501036_0082083 | 3300049572 | Bacteria | 2724 |
| 1456 | Ga0501036_0203390 | 3300049572 | Bacteria | 1665 |
| 1457 | Ga0501036_0536660 | 3300049572 | Unclassified | 972 |
| 1458 | Ga0501036_0539987 | 3300049572 | Unclassified | 969 |
| 1459 | Ga0501037_0035866 | 3300049573 | Bacteria | 3654 |
| 1460 | Ga0501037_0376702 | 3300049573 | Unclassified | 976 |
| 1461 | Ga0501038_0033069 | 3300049574 | Bacteria | 4556 |
| 1462 | Ga0501038_0059269 | 3300049574 | Bacteria | 3279 |
| 1463 | Ga0501038_0088496 | 3300049574 | Bacteria | 2599 |
| 1464 | Ga0501038_0221520 | 3300049574 | Bacteria | 1509 |
| 1465 | Ga0501038_0323996 | 3300049574 | Unclassified | 1205 |
| 1466 | Ga0501038_0697942 | 3300049574 | Bacteria | 760 |
| 1467 | Ga0501039_0003259 | 3300049575 | Bacteria | 12139 |
| 1468 | Ga0501039_0126905 | 3300049575 | Bacteria | 2001 |
| 1469 | Ga0501039_0185388 | 3300049575 | Bacteria | 1636 |
| 1470 | Ga0501039_0287545 | 3300049575 | Bacteria | 1292 |
| 1471 | Ga0501039_0531596 | 3300049575 | Bacteria | 923 |
| 1472 | Ga0501040_0054456 | 3300049576 | Bacteria | 2742 |
| 1473 | Ga0501040_0194580 | 3300049576 | Bacteria | 1439 |
| 1474 | Ga0501040_0229908 | 3300049576 | Bacteria | 1320 |
| 1475 | Ga0501040_0376347 | 3300049576 | Bacteria | 1018 |
| 1476 | Ga0501041_0026401 | 3300049577 | Bacteria | 3494 |
| 1477 | Ga0501041_0042202 | 3300049577 | Bacteria | 2771 |
| 1478 | Ga0501041_0043876 | 3300049577 | Bacteria | 2718 |
| 1479 | Ga0501042_0047826 | 3300049578 | Bacteria | 3050 |
| 1480 | Ga0501042_0092004 | 3300049578 | Bacteria | 2177 |
| 1481 | Ga0501042_0136480 | 3300049578 | Bacteria | 1768 |
| 1482 | Ga0501042_0141523 | 3300049578 | Bacteria | 1735 |
| 1483 | Ga0501042_0245109 | 3300049578 | Bacteria | 1293 |
| 1484 | Ga0501042_0438902 | 3300049578 | Bacteria | 947 |
| 1485 | Ga0501043_0033541 | 3300049579 | Bacteria | 4040 |
| 1486 | Ga0501043_0102568 | 3300049579 | Unclassified | 2248 |
| 1487 | Ga0501046_0063273 | 3300049580 | Bacteria | 2889 |
| 1488 | Ga0501046_0190891 | 3300049580 | Unclassified | 1528 |
| 1489 | Ga0501046_0297804 | 3300049580 | Bacteria | 1179 |
| 1490 | Ga0501047_0544175 | 3300049581 | Bacteria | 986 |
| 1491 | Ga0501048_0006548 | 3300049582 | Bacteria | 8851 |
| 1492 | Ga0501048_0042780 | 3300049582 | Bacteria | 3242 |
| 1493 | Ga0501048_0045766 | 3300049582 | Bacteria | 3124 |
| 1494 | Ga0501048_0063766 | 3300049582 | Bacteria | 2606 |
| 1495 | Ga0501067_0004883 | 3300049583 | Bacteria | 7447 |
| 1496 | Ga0501067_0005212 | 3300049583 | Bacteria | 7225 |
| 1497 | Ga0501067_0010773 | 3300049583 | Bacteria | 5057 |
| 1498 | Ga0501067_0022805 | 3300049583 | Bacteria | 3465 |
| 1499 | Ga0501067_0363851 | 3300049583 | Unclassified | 806 |
| 1500 | Ga0501068_0001390 | 3300049584 | Bacteria | 12856 |
| 1501 | Ga0501068_0005336 | 3300049584 | Bacteria | 7021 |
| 1502 | Ga0501068_0019697 | 3300049584 | Bacteria | 3922 |
| 1503 | Ga0501068_0049547 | 3300049584 | Bacteria | 2537 |
| 1504 | Ga0501068_0459237 | 3300049584 | Bacteria | 824 |
| 1505 | Ga0501069_0000470 | 3300049585 | Bacteria | 18386 |
| 1506 | Ga0501069_0002995 | 3300049585 | Bacteria | 8700 |
| 1507 | Ga0501069_0010273 | 3300049585 | Bacteria | 4955 |
| 1508 | Ga0501069_0028372 | 3300049585 | Bacteria | 3068 |
| 1509 | Ga0501069_0028781 | 3300049585 | Bacteria | 3048 |
| 1510 | Ga0501069_0040377 | 3300049585 | Bacteria | 2579 |
| 1511 | Ga0501069_0047757 | 3300049585 | Bacteria | 2376 |
| 1512 | Ga0501070_0030738 | 3300049586 | Bacteria | 4498 |
| 1513 | Ga0501070_0044521 | 3300049586 | Bacteria | 3693 |
| 1514 | Ga0501070_0073182 | 3300049586 | Bacteria | 2836 |
| 1515 | Ga0501070_0088562 | 3300049586 | Bacteria | 2562 |
| 1516 | Ga0501071_0050788 | 3300049587 | Bacteria | 2987 |
| 1517 | Ga0501071_0071015 | 3300049587 | Bacteria | 2537 |
| 1518 | Ga0501071_0128483 | 3300049587 | Bacteria | 1882 |
| 1519 | Ga0501071_0296317 | 3300049587 | Bacteria | 1225 |
| 1520 | Ga0501071_0593328 | 3300049587 | Bacteria | 851 |
| 1521 | Ga0501072_0002824 | 3300049588 | Bacteria | 13031 |
| 1522 | Ga0501072_0025295 | 3300049588 | Bacteria | 4624 |
| 1523 | Ga0501072_0143027 | 3300049588 | Unclassified | 1907 |
| 1524 | Ga0501072_0193200 | 3300049588 | Bacteria | 1623 |
| 1525 | Ga0501072_0307827 | 3300049588 | Bacteria | 1259 |
| 1526 | Ga0501072_0583698 | 3300049588 | Unclassified | 881 |
| 1527 | Ga0501073_0005950 | 3300049589 | Bacteria | 9101 |
| 1528 | Ga0501073_0028698 | 3300049589 | Bacteria | 3976 |
| 1529 | Ga0501074_0345799 | 3300049590 | Unclassified | 1055 |
| 1530 | Ga0501075_0002854 | 3300049591 | Bacteria | 11587 |
| 1531 | Ga0501075_0007123 | 3300049591 | Bacteria | 7736 |
| 1532 | Ga0501075_0031937 | 3300049591 | Bacteria | 3911 |
| 1533 | Ga0501075_0096489 | 3300049591 | Unclassified | 2243 |
| 1534 | Ga0501075_0141996 | 3300049591 | Unclassified | 1830 |
| 1535 | Ga0501075_0216055 | 3300049591 | Bacteria | 1462 |
| 1536 | Ga0501075_0218019 | 3300049591 | Bacteria | 1455 |
| 1537 | Ga0501076_0007880 | 3300049592 | Bacteria | 7766 |
| 1538 | Ga0501076_0014673 | 3300049592 | Bacteria | 5906 |
| 1539 | Ga0501076_0069004 | 3300049592 | Bacteria | 2824 |
| 1540 | Ga0501076_0138495 | 3300049592 | Bacteria | 1976 |
| 1541 | Ga0501076_0258854 | 3300049592 | Bacteria | 1424 |
| 1542 | Ga0501076_0605929 | 3300049592 | Bacteria | 903 |
| 1543 | Ga0501076_0689121 | 3300049592 | Bacteria | 843 |
| 1544 | Ga0501077_0003598 | 3300049593 | Bacteria | 9315 |
| 1545 | Ga0501077_0004622 | 3300049593 | Bacteria | 8360 |
| 1546 | Ga0501077_0023897 | 3300049593 | Bacteria | 3877 |
| 1547 | Ga0501079_0011587 | 3300049741 | Bacteria | 6731 |
| 1548 | Ga0501079_0045730 | 3300049741 | Bacteria | 3378 |
| 1549 | Ga0501079_0092391 | 3300049741 | Bacteria | 2344 |
| 1550 | Ga0501079_0169654 | 3300049741 | Bacteria | 1701 |
| 1551 | Ga0501079_0532306 | 3300049741 | Bacteria | 924 |
| 1552 | Ga0501080_0093613 | 3300049742 | Bacteria | 2790 |
| 1553 | Ga0501080_0102866 | 3300049742 | Bacteria | 2649 |
| 1554 | Ga0501080_0171437 | 3300049742 | Bacteria | 2001 |
| 1555 | Ga0501080_0244416 | 3300049742 | Bacteria | 1637 |
| 1556 | Ga0501081_0027422 | 3300049743 | Bacteria | 3842 |
| 1557 | Ga0501081_0045929 | 3300049743 | Bacteria | 3000 |
| 1558 | Ga0501081_0170440 | 3300049743 | Bacteria | 1571 |
| 1559 | Ga0501081_0240652 | 3300049743 | Unclassified | 1319 |
| 1560 | Ga0501081_0555829 | 3300049743 | Bacteria | 857 |
| 1561 | Ga0501081_0560939 | 3300049743 | Bacteria | 853 |
| 1562 | Ga0501083_0069609 | 3300049744 | Bacteria | 2341 |
| 1563 | Ga0501083_0428673 | 3300049744 | Unclassified | 860 |
| 1564 | Ga0501035_0051074 | 3300049822 | Bacteria | 3703 |
| 1565 | Ga0501035_0128834 | 3300049822 | Bacteria | 2207 |
| 1566 | Ga0501044_0012250 | 3300049823 | Bacteria | 9285 |
| 1567 | Ga0501044_0118900 | 3300049823 | Bacteria | 2645 |
| 1568 | Ga0501044_0170265 | 3300049823 | Bacteria | 2150 |
| 1569 | Ga0501045_0016656 | 3300049824 | Bacteria | 5222 |
| 1570 | Ga0501045_0026095 | 3300049824 | Bacteria | 4200 |
| 1571 | Ga0501045_0131086 | 3300049824 | Bacteria | 1863 |
| 1572 | Ga0501045_0250076 | 3300049824 | Unclassified | 1319 |
| 1573 | Ga0501045_0273864 | 3300049824 | Bacteria | 1256 |
| 1574 | nmdc:mga00v17_12668_c1 | 3300050491 | Bacteria | 4657 |
| 1575 | nmdc:mga00v17_157302_c1 | 3300050491 | Bacteria | 1462 |
| 1576 | nmdc:mga00v17_170753_c1 | 3300050491 | Bacteria | 1402 |
| 1577 | nmdc:mga0yw44_102161_c1 | 3300050492 | Bacteria | 1827 |
| 1578 | nmdc:mga0yw44_437603_c1 | 3300050492 | Bacteria | 886 |
| 1579 | nmdc:mga06z11_288636_c1 | 3300050494 | Bacteria | 973 |
| 1580 | nmdc:mga06z11_396647_c1 | 3300050494 | Bacteria | 830 |
| 1581 | nmdc:mga05p37_137064_c1 | 3300050507 | Bacteria | 3000 |
| 1582 | nmdc:mga05p37_362703_c1 | 3300050507 | Bacteria | 1703 |
| 1583 | nmdc:mga05p37_55696_c1 | 3300050507 | Bacteria | 4867 |
| 1584 | nmdc:mga05p37_581011_c1 | 3300050507 | Bacteria | 1269 |
| 1585 | nmdc:mga05p37_8342_c1 | 3300050507 | Bacteria | 12252 |
| 1586 | nmdc:mga05p37_86010_c1 | 3300050507 | Unclassified | 3875 |
| 1587 | nmdc:mga09592_31239_c1 | 3300050508 | Bacteria | 4437 |
| 1588 | nmdc:mga09592_321574_c1 | 3300050508 | Bacteria | 1340 |
| 1589 | nmdc:mga09592_93516_c1 | 3300050508 | Bacteria | 2571 |
| 1590 | nmdc:mga0qj67_19618_c1 | 3300050509 | Bacteria | 5168 |
| 1591 | nmdc:mga06r32_130564_c1 | 3300050510 | Bacteria | 2484 |
| 1592 | nmdc:mga06r32_82451_c1 | 3300050510 | Bacteria | 3133 |
| 1593 | nmdc:mga08y16_164117_c1 | 3300050511 | Bacteria | 2308 |
| 1594 | nmdc:mga08y16_20510_c1 | 3300050511 | Bacteria | 6976 |
| 1595 | nmdc:mga08y16_44827_c1 | 3300050511 | Bacteria | 4636 |
| 1596 | nmdc:mga08y16_48252_c1 | 3300050511 | Bacteria | 4456 |
| 1597 | nmdc:mga08y16_54622_c1 | 3300050511 | Bacteria | 4174 |
| 1598 | nmdc:mga08y16_604287_c1 | 3300050511 | Unclassified | 1105 |
| 1599 | nmdc:mga08y16_660968_c1 | 3300050511 | Bacteria | 1048 |
| 1600 | nmdc:mga08y16_81858_c1 | 3300050511 | Bacteria | 3366 |
| 1601 | nmdc:mga0n895_156774_c1 | 3300050512 | Bacteria | 2308 |
| 1602 | nmdc:mga0n895_18573_c1 | 3300050512 | Bacteria | 6438 |
| 1603 | nmdc:mga0n895_313511_c1 | 3300050512 | Bacteria | 1590 |
| 1604 | nmdc:mga0n895_34097_c1 | 3300050512 | Bacteria | 4898 |
| 1605 | nmdc:mga0n895_343713_c1 | 3300050512 | Bacteria | 1511 |
| 1606 | nmdc:mga0n895_35345_c1 | 3300050512 | Bacteria | 4817 |
| 1607 | nmdc:mga0n895_44306_c1 | 3300050512 | Bacteria | 4338 |
| 1608 | nmdc:mga0n895_4522_c1 | 3300050512 | Bacteria | 11441 |
| 1609 | nmdc:mga0n895_566713_c1 | 3300050512 | Bacteria | 1141 |
| 1610 | nmdc:mga0n895_584299_c1 | 3300050512 | Bacteria | 1121 |
| 1611 | nmdc:mga0n895_637339_c1 | 3300050512 | Bacteria | 1066 |
| 1612 | nmdc:mga0n895_966105_c1 | 3300050512 | Bacteria | 835 |
| 1613 | nmdc:mga0rr50_12864_c1 | 3300050513 | Bacteria | 5425 |
| 1614 | nmdc:mga0rr50_159064_c1 | 3300050513 | Bacteria | 1832 |
| 1615 | nmdc:mga0rr50_1603_c1 | 3300050513 | Bacteria | 12461 |
| 1616 | nmdc:mga0rr50_2621_c1 | 3300050513 | Bacteria | 10190 |
| 1617 | nmdc:mga0rr50_285989_c1 | 3300050513 | Bacteria | 1377 |
| 1618 | nmdc:mga0rr50_402333_c1 | 3300050513 | Bacteria | 1157 |
| 1619 | nmdc:mga0rr50_42678_c1 | 3300050513 | Bacteria | 3314 |
| 1620 | nmdc:mga0rr50_567094_c1 | 3300050513 | Unclassified | 967 |
| 1621 | nmdc:mga0rr50_5699_c1 | 3300050513 | Bacteria | 7462 |
| 1622 | nmdc:mga0rr50_597306_c1 | 3300050513 | Bacteria | 941 |
| 1623 | nmdc:mga0rr50_714807_c1 | 3300050513 | Unclassified | 855 |
| 1624 | nmdc:mga0rr50_7541_c1 | 3300050513 | Bacteria | 6720 |
| 1625 | nmdc:mga0rr50_75521_c1 | 3300050513 | Bacteria | 2584 |
| 1626 | nmdc:mga08x19_114908_c1 | 3300050514 | Bacteria | 1799 |
| 1627 | nmdc:mga08x19_201257_c1 | 3300050514 | Bacteria | 1365 |
| 1628 | nmdc:mga08x19_37222_c1 | 3300050514 | Bacteria | 3087 |
| 1629 | nmdc:mga08x19_4916_c1 | 3300050514 | Bacteria | 7892 |
| 1630 | nmdc:mga08x19_59414_c1 | 3300050514 | Unclassified | 2475 |
| 1631 | nmdc:mga08x19_89056_c1 | 3300050514 | Bacteria | 2035 |
| 1632 | nmdc:mga08x19_94200_c1 | 3300050514 | Bacteria | 1980 |
| 1633 | nmdc:mga0a205_121578_c1 | 3300050515 | Bacteria | 2510 |
| 1634 | nmdc:mga0a205_12370_c1 | 3300050515 | Bacteria | 7894 |
| 1635 | nmdc:mga0a205_124485_c1 | 3300050515 | Bacteria | 2478 |
| 1636 | nmdc:mga0a205_147841_c1 | 3300050515 | Bacteria | 2250 |
| 1637 | nmdc:mga0a205_198981_c1 | 3300050515 | Bacteria | 1895 |
| 1638 | nmdc:mga0a205_21940_c1 | 3300050515 | Bacteria | 6040 |
| 1639 | nmdc:mga0a205_48133_c1 | 3300050515 | Bacteria | 4115 |
| 1640 | nmdc:mga0a205_621551_c1 | 3300050515 | Archaea | 933 |
| 1641 | nmdc:mga0a205_636720_c1 | 3300050515 | Bacteria | 918 |
| 1642 | nmdc:mga0a205_642345_c1 | 3300050515 | Unclassified | 913 |
| 1643 | nmdc:mga0a205_86140_c1 | 3300050515 | Unclassified | 3034 |
| 1644 | Ga0495601_0008919 | 3300053077 | Bacteria | 5920 |
| 1645 | Ga0495601_0016720 | 3300053077 | Bacteria | 4448 |
| 1646 | Ga0495601_0026644 | 3300053077 | Bacteria | 3570 |
| 1647 | Ga0495601_0077562 | 3300053077 | Unclassified | 2128 |
| 1648 | Ga0495601_0086752 | 3300053077 | Unclassified | 2011 |
| 1649 | Ga0495601_0184735 | 3300053077 | Bacteria | 1363 |
| 1650 | Ga0495601_0197870 | 3300053077 | Bacteria | 1314 |
| 1651 | Ga0495601_0213992 | 3300053077 | Bacteria | 1259 |
| 1652 | Ga0495601_0407533 | 3300053077 | Bacteria | 881 |
| 1653 | Ga0495612_0006485 | 3300053078 | Bacteria | 4807 |
| 1654 | Ga0495612_0015873 | 3300053078 | Bacteria | 3019 |
| 1655 | Ga0495612_0057381 | 3300053078 | Bacteria | 1608 |
| 1656 | Ga0495612_0058045 | 3300053078 | Bacteria | 1599 |
| 1657 | Ga0495612_0106611 | 3300053078 | Bacteria | 1197 |
| 1658 | Ga0495655_0094649 | 3300053083 | Bacteria | 876 |
| 1659 | Ga0495595_0017315 | 3300053084 | Bacteria | 3100 |
| 1660 | Ga0495595_0045006 | 3300053084 | Bacteria | 2029 |
| 1661 | Ga0495595_0049129 | 3300053084 | Bacteria | 1950 |
| 1662 | Ga0495595_0061153 | 3300053084 | Unclassified | 1763 |
| 1663 | Ga0495619_0002453 | 3300053085 | Bacteria | 12142 |
| 1664 | Ga0495619_0079924 | 3300053085 | Bacteria | 2200 |
| 1665 | Ga0495619_0101937 | 3300053085 | Bacteria | 1955 |
| 1666 | Ga0495619_0205893 | 3300053085 | Bacteria | 1362 |
| 1667 | Ga0495619_0217454 | 3300053085 | Bacteria | 1323 |
| 1668 | Ga0495619_0726657 | 3300053085 | Unclassified | 674 |
| 1669 | Ga0501084_0022478 | 3300054114 | Bacteria | 5262 |
| 1670 | Ga0501084_0102219 | 3300054114 | Bacteria | 2407 |
| 1671 | Ga0501084_0200778 | 3300054114 | Bacteria | 1682 |
| 1672 | Ga0501084_0719135 | 3300054114 | Bacteria | 842 |
| 1673 | Ga0501082_0003529 | 3300060353 | Bacteria | 13659 |
| 1674 | Ga0501082_0082420 | 3300060353 | Bacteria | 2775 |
| 1675 | Ga0501082_0142314 | 3300060353 | Bacteria | 2081 |
| 1676 | Ga0501082_0428303 | 3300060353 | Bacteria | 1155 |
| 1677 | Ga0501082_0694651 | 3300060353 | Bacteria | 890 |
| 1678 | Ga0466962_0052704 | 3300061719 | Bacteria | 1944 |
| 1679 | Ga0530510_0002635 | 3300061734 | Bacteria | 12331 |
| 1680 | Ga0530510_0069616 | 3300061734 | Unclassified | 2553 |
| 1681 | Ga0530510_0096834 | 3300061734 | Bacteria | 2157 |
| 1682 | Ga0530510_0099375 | 3300061734 | Bacteria | 2127 |
| 1683 | Ga0530510_0130250 | 3300061734 | Bacteria | 1850 |
| 1684 | Ga0530510_0157434 | 3300061734 | Bacteria | 1679 |
| 1685 | Ga0530510_0409752 | 3300061734 | Unclassified | 1022 |
| 1686 | Ga0111539_10062716 | |||
| 1687 | ARcpr5yngRDRAFT_c004151 | |||
| 1688 | ARSoilOldRDRAFT_c002807 | |||
| 1689 | ARCol0yngRDRAFT_1001939 | |||
| 1690 | JGI24747J21853_1008829 | |||
| 1691 | JGI24739J22299_10095130 | |||
| 1692 | JGI24739J22299_10105358 | |||
| 1693 | JGI24737J22298_10086158 | |||
| 1694 | JGI24743J22301_10039925 | |||
| 1695 | JGI24743J22301_10061939 | |||
| 1696 | JGI24738J21930_10034049 | |||
| 1697 | JGI24033J26618_1004749 | |||
| 1698 | JGI24751J29686_10024707 | |||
| 1699 | JGI25406J46586_10011902 | |||
| 1700 | JGI25407J50210_10035069 | |||
| 1701 | Ga0070658_10081640 | |||
| 1702 | Ga0070658_10158991 | |||
| 1703 | Ga0070658_10624188 | |||
| 1704 | Ga0070658_10926831 | |||
| 1705 | Ga0070676_10254822 | |||
| 1706 | Ga0070676_10573730 | |||
| 1707 | Ga0070683_100000911 | |||
| 1708 | Ga0070683_100009526 | |||
| 1709 | Ga0070683_100043043 | |||
| 1710 | Ga0070683_100068268 | |||
| 1711 | Ga0070683_100072613 | |||
| 1712 | Ga0070683_100212793 | |||
| 1713 | Ga0070683_100263225 | |||
| 1714 | Ga0070690_100088857 | |||
| 1715 | Ga0070690_100270598 | |||
| 1716 | Ga0070670_100157967 | |||
| 1717 | Ga0068869_100204833 | |||
| 1718 | Ga0070680_100002541 | |||
| 1719 | Ga0070680_100009498 | |||
| 1720 | Ga0070680_100028541 | |||
| 1721 | Ga0070680_100102740 | |||
| 1722 | Ga0070680_100153255 | |||
| 1723 | Ga0070682_100034421 | |||
| 1724 | Ga0070682_100184363 | |||
| 1725 | Ga0070682_100706053 | |||
| 1726 | Ga0068868_100003848 | |||
| 1727 | Ga0068868_100032081 | |||
| 1728 | Ga0068868_100069856 | |||
| 1729 | Ga0068868_100201825 | |||
| 1730 | Ga0068868_100209432 | |||
| 1731 | Ga0068868_100216010 | |||
| 1732 | Ga0068868_100331813 | |||
| 1733 | Ga0070660_100020713 | |||
| 1734 | Ga0070660_100021187 | |||
| 1735 | Ga0070660_100028747 | |||
| 1736 | Ga0070660_100061666 | |||
| 1737 | Ga0070660_100069446 | |||
| 1738 | Ga0070660_100170770 | |||
| 1739 | Ga0070660_100304083 | |||
| 1740 | Ga0070660_100492292 | |||
| 1741 | Ga0070660_100708345 | |||
| 1742 | Ga0070689_100144015 | |||
| 1743 | Ga0070689_100171973 | |||
| 1744 | Ga0070691_10012043 | |||
| 1745 | Ga0070691_10027910 | |||
| 1746 | Ga0070691_10036689 | |||
| 1747 | Ga0070691_10055161 | |||
| 1748 | Ga0070691_10062379 | |||
| 1749 | Ga0070691_10115322 | |||
| 1750 | Ga0070687_100174815 | |||
| 1751 | Ga0070687_100274124 | |||
| 1752 | Ga0070661_100004700 | |||
| 1753 | Ga0070661_100023208 | |||
| 1754 | Ga0070661_100232620 | |||
| 1755 | Ga0070661_100331309 | |||
| 1756 | Ga0070692_10033039 | |||
| 1757 | Ga0070692_10116939 | |||
| 1758 | Ga0070692_10172115 | |||
| 1759 | Ga0070668_100083359 | |||
| 1760 | Ga0070668_100279244 | |||
| 1761 | Ga0070668_100768373 | |||
| 1762 | Ga0070669_100336186 | |||
| 1763 | Ga0070669_100465189 | |||
| 1764 | Ga0070669_100494332 | |||
| 1765 | Ga0070675_100071386 | |||
| 1766 | Ga0070675_100109541 | |||
| 1767 | Ga0070675_100170591 | |||
| 1768 | Ga0070675_100498397 | |||
| 1769 | Ga0070671_100095942 | |||
| 1770 | Ga0070674_100016490 | |||
| 1771 | Ga0070674_100531278 | |||
| 1772 | Ga0070674_100676771 | |||
| 1773 | Ga0070673_100196582 | |||
| 1774 | Ga0070673_100347056 | |||
| 1775 | Ga0070673_100875978 | |||
| 1776 | Ga0070688_100024769 | |||
| 1777 | Ga0070688_100295678 | |||
| 1778 | Ga0070688_100598222 | |||
| 1779 | Ga0070659_100045715 | |||
| 1780 | Ga0070659_100087179 | |||
| 1781 | Ga0070659_100161095 | |||
| 1782 | Ga0070659_100193695 | |||
| 1783 | Ga0070659_100872868 | |||
| 1784 | Ga0070667_100364057 | |||
| 1785 | Ga0070667_100422074 | |||
| 1786 | Ga0070703_10025637 | |||
| 1787 | Ga0070703_10083596 | |||
| 1788 | Ga0070703_10170106 | |||
| 1789 | Ga0070709_10022042 | |||
| 1790 | Ga0070709_10165012 | |||
| 1791 | Ga0070709_10232984 | |||
| 1792 | Ga0070714_100063739 | |||
| 1793 | Ga0070714_100331395 | |||
| 1794 | Ga0070714_100350969 | |||
| 1795 | Ga0070714_100459419 | |||
| 1796 | Ga0070714_100502371 | |||
| 1797 | Ga0070714_100728255 | |||
| 1798 | Ga0070713_100119093 | |||
| 1799 | Ga0070713_100165283 | |||
| 1800 | Ga0070713_100206275 | |||
| 1801 | Ga0070713_100309315 | |||
| 1802 | Ga0070710_10015751 | |||
| 1803 | Ga0070710_10030911 | |||
| 1804 | Ga0070710_10104026 | |||
| 1805 | Ga0070710_10127905 | |||
| 1806 | Ga0070710_10138852 | |||
| 1807 | Ga0070710_10159486 | |||
| 1808 | Ga0070701_10019951 | |||
| 1809 | Ga0070711_100008457 | |||
| 1810 | Ga0070711_100112918 | |||
| 1811 | Ga0070711_100227241 | |||
| 1812 | Ga0070711_100267015 | |||
| 1813 | Ga0070711_100268385 | |||
| 1814 | Ga0070711_100288840 | |||
| 1815 | Ga0070711_100364979 | |||
| 1816 | Ga0070711_100872791 | |||
| 1817 | Ga0070705_100043529 | |||
| 1818 | Ga0070705_100144776 | |||
| 1819 | Ga0070705_100172054 | |||
| 1820 | Ga0070700_100021601 | |||
| 1821 | Ga0070700_100024887 | |||
| 1822 | Ga0070700_100076154 | |||
| 1823 | Ga0070708_100079811 | |||
| 1824 | Ga0070708_100182465 | |||
| 1825 | Ga0070663_100016045 | |||
| 1826 | Ga0070663_100146310 | |||
| 1827 | Ga0070678_100027606 | |||
| 1828 | Ga0070678_100050291 | |||
| 1829 | Ga0070678_100060215 | |||
| 1830 | Ga0070678_100233777 | |||
| 1831 | Ga0070678_100361151 | |||
| 1832 | Ga0070678_100679166 | |||
| 1833 | Ga0070662_100008424 | |||
| 1834 | Ga0070662_100012945 | |||
| 1835 | Ga0070662_100017331 | |||
| 1836 | Ga0070662_100075742 | |||
| 1837 | Ga0070662_100085365 | |||
| 1838 | Ga0070662_100163894 | |||
| 1839 | Ga0070662_100287694 | |||
| 1840 | Ga0070681_10119186 | |||
| 1841 | Ga0070681_10134193 | |||
| 1842 | Ga0070681_10210522 | |||
| 1843 | Ga0070681_10239381 | |||
| 1844 | Ga0070681_10249201 | |||
| 1845 | Ga0070681_10251959 | |||
| 1846 | Ga0070681_10255215 | |||
| 1847 | Ga0070681_10354962 | |||
| 1848 | Ga0070681_10856258 | |||
| 1849 | Ga0068867_100143956 | |||
| 1850 | Ga0068867_100218258 | |||
| 1851 | Ga0068867_100272799 | |||
| 1852 | Ga0068867_100397474 | |||
| 1853 | Ga0070685_10002654 | |||
| 1854 | Ga0070706_100546300 | |||
| 1855 | Ga0070698_100094671 | |||
| 1856 | Ga0070698_100111746 | |||
| 1857 | Ga0070699_100174458 | |||
| 1858 | Ga0070699_100375126 | |||
| 1859 | Ga0070679_100024215 | |||
| 1860 | Ga0070679_100057985 | |||
| 1861 | Ga0070679_100065683 | |||
| 1862 | Ga0070679_100098066 | |||
| 1863 | Ga0070679_100101126 | |||
| 1864 | Ga0070679_100117794 | |||
| 1865 | Ga0070679_100121250 | |||
| 1866 | Ga0070679_100178561 | |||
| 1867 | Ga0070679_100417212 | |||
| 1868 | Ga0070679_101016986 | |||
| 1869 | Ga0070684_100002987 | |||
| 1870 | Ga0070684_100009104 | |||
| 1871 | Ga0070684_100027885 | |||
| 1872 | Ga0070684_100044620 | |||
| 1873 | Ga0070684_100068948 | |||
| 1874 | Ga0070684_100139286 | |||
| 1875 | Ga0070684_100183625 | |||
| 1876 | Ga0070684_100408185 | |||
| 1877 | Ga0070684_101015564 | |||
| 1878 | Ga0070697_100193331 | |||
| 1879 | Ga0070697_100568857 | |||
| 1880 | Ga0068853_100049482 | |||
| 1881 | Ga0068853_100116267 | |||
| 1882 | Ga0068853_100120714 | |||
| 1883 | Ga0070672_100011745 | |||
| 1884 | Ga0070672_100060037 | |||
| 1885 | Ga0070672_100426213 | |||
| 1886 | Ga0070672_100571787 | |||
| 1887 | Ga0070686_100137369 | |||
| 1888 | Ga0070695_100108789 | |||
| 1889 | Ga0070695_100409955 | |||
| 1890 | Ga0070695_100446471 | |||
| 1891 | Ga0070695_100606213 | |||
| 1892 | Ga0070696_100040272 | |||
| 1893 | Ga0070696_100079217 | |||
| 1894 | Ga0070696_100083269 | |||
| 1895 | Ga0070696_100113132 | |||
| 1896 | Ga0070696_100428952 | |||
| 1897 | Ga0070696_100476563 | |||
| 1898 | Ga0070696_100544602 | |||
| 1899 | Ga0070693_100086818 | |||
| 1900 | Ga0070693_100171768 | |||
| 1901 | Ga0070693_100229433 | |||
| 1902 | Ga0070665_100029536 | |||
| 1903 | Ga0070665_100333848 | |||
| 1904 | Ga0070704_100012513 | |||
| 1905 | Ga0070704_100062811 | |||
| 1906 | Ga0070704_100174982 | |||
| 1907 | Ga0068855_100034827 | |||
| 1908 | Ga0068855_100049422 | |||
| 1909 | Ga0068855_100119279 | |||
| 1910 | Ga0068855_100141926 | |||
| 1911 | Ga0068855_100423551 | |||
| 1912 | Ga0068855_100611254 | |||
| 1913 | Ga0070664_100066762 | |||
| 1914 | Ga0070664_100097750 | |||
| 1915 | Ga0070664_100319902 | |||
| 1916 | Ga0070664_100330027 | |||
| 1917 | Ga0070664_100340571 | |||
| 1918 | Ga0070664_100380957 | |||
| 1919 | Ga0068857_100057361 | |||
| 1920 | Ga0068857_100151940 | |||
| 1921 | Ga0068857_100369428 | |||
| 1922 | Ga0068854_100025563 | |||
| 1923 | Ga0068854_100032416 | |||
| 1924 | Ga0068854_100142066 | |||
| 1925 | Ga0068854_100439273 | |||
| 1926 | Ga0068854_100718306 | |||
| 1927 | Ga0068856_100028860 | |||
| 1928 | Ga0068856_100044326 | |||
| 1929 | Ga0068856_100048083 | |||
| 1930 | Ga0068856_100100137 | |||
| 1931 | Ga0068856_100321885 | |||
| 1932 | Ga0068856_100354084 | |||
| 1933 | Ga0068856_100509191 | |||
| 1934 | Ga0068856_100602665 | |||
| 1935 | Ga0070702_100019502 | |||
| 1936 | Ga0070702_100056733 | |||
| 1937 | Ga0070702_100084618 | |||
| 1938 | Ga0068852_100041973 | |||
| 1939 | Ga0068852_100059450 | |||
| 1940 | Ga0068852_100066951 | |||
| 1941 | Ga0068852_100125110 | |||
| 1942 | Ga0068852_100175018 | |||
| 1943 | Ga0068852_100206671 | |||
| 1944 | Ga0068852_100353191 | |||
| 1945 | Ga0068852_100491375 | |||
| 1946 | Ga0068852_101036633 | |||
| 1947 | Ga0068852_101235524 | |||
| 1948 | Ga0068859_100032440 | |||
| 1949 | Ga0068859_100062921 | |||
| 1950 | Ga0068864_100117114 | |||
| 1951 | Ga0068864_100190394 | |||
| 1952 | Ga0068864_100503780 | |||
| 1953 | Ga0068866_10151973 | |||
| 1954 | Ga0068866_10194716 | |||
| 1955 | Ga0068866_10562496 | |||
| 1956 | Ga0068861_100026781 | |||
| 1957 | Ga0068861_100120258 | |||
| 1958 | Ga0068861_100218520 | |||
| 1959 | Ga0068861_100326594 | |||
| 1960 | Ga0068861_100461597 | |||
| 1961 | Ga0068861_100716167 | |||
| 1962 | Ga0068861_100761201 | |||
| 1963 | Ga0068851_10104975 | |||
| 1964 | Ga0068870_10236094 | |||
| 1965 | Ga0068870_10436727 | |||
| 1966 | Ga0068863_100214327 | |||
| 1967 | Ga0068860_100069126 | |||
| 1968 | Ga0068860_100248898 | |||
| 1969 | Ga0068862_100390375 | |||
| 1970 | Ga0081455_10014065 | |||
| 1971 | Ga0081455_10017655 | |||
| 1972 | Ga0081455_10030402 | |||
| 1973 | Ga0081455_10063179 | |||
| 1974 | Ga0081455_10064752 | |||
| 1975 | Ga0081455_10091886 | |||
| 1976 | Ga0081455_10271962 | |||
| 1977 | Ga0081455_10323833 | |||
| 1978 | Ga0081455_10424305 | |||
| 1979 | Ga0081538_10001352 | |||
| 1980 | Ga0081538_10001944 | |||
| 1981 | Ga0081538_10002644 | |||
| 1982 | Ga0081538_10044597 | |||
| 1983 | Ga0081538_10060840 | |||
| 1984 | Ga0081540_1002691 | |||
| 1985 | Ga0081540_1005407 | |||
| 1986 | Ga0081540_1024567 | |||
| 1987 | Ga0081539_10000888 | |||
| 1988 | Ga0070717_10011193 | |||
| 1989 | Ga0070717_10107798 | |||
| 1990 | Ga0070717_10295528 | |||
| 1991 | Ga0075365_10039156 | |||
| 1992 | Ga0075365_10118842 | |||
| 1993 | Ga0075365_10127154 | |||
| 1994 | Ga0075365_10165895 | |||
| 1995 | Ga0075364_10056676 | |||
| 1996 | Ga0075364_10406976 | |||
| 1997 | Ga0075432_10007140 | |||
| 1998 | Ga0075432_10036196 | |||
| 1999 | Ga0075432_10081102 | |||
| 2000 | Ga0075432_10158191 | |||
| 2001 | Ga0075432_10263775 | |||
| 2002 | Ga0070715_10016227 | |||
| 2003 | Ga0070715_10034332 | |||
| 2004 | Ga0070716_100024186 | |||
| 2005 | Ga0070716_100265100 | |||
| 2006 | Ga0070716_100302279 | |||
| 2007 | Ga0070712_100004135 | |||
| 2008 | Ga0070712_100007311 | |||
| 2009 | Ga0070712_100008944 | |||
| 2010 | Ga0070712_100032793 | |||
| 2011 | Ga0070712_100075604 | |||
| 2012 | Ga0070712_100092967 | |||
| 2013 | Ga0070712_100101638 | |||
| 2014 | Ga0070712_100138284 | |||
| 2015 | Ga0070712_100168426 | |||
| 2016 | Ga0070712_100211899 | |||
| 2017 | Ga0070712_100312338 | |||
| 2018 | Ga0070712_100648718 | |||
| 2019 | Ga0075367_10435812 | |||
| 2020 | Ga0097621_100051449 | |||
| 2021 | Ga0097621_100059073 | |||
| 2022 | Ga0097621_100132876 | |||
| 2023 | Ga0068871_100111216 | |||
| 2024 | Ga0068871_100497011 | |||
| 2025 | Ga0068871_100540416 | |||
| 2026 | Ga0075428_100002462 | |||
| 2027 | Ga0075428_100006164 | |||
| 2028 | Ga0075428_100026974 | |||
| 2029 | Ga0075428_100049565 | |||
| 2030 | Ga0075430_100028108 | |||
| 2031 | Ga0075431_100049961 | |||
| 2032 | Ga0075431_100054729 | |||
| 2033 | Ga0075431_100640038 | |||
| 2034 | Ga0075433_10011114 | |||
| 2035 | Ga0075433_10022776 | |||
| 2036 | Ga0075433_10063154 | |||
| 2037 | Ga0075433_10074345 | |||
| 2038 | Ga0075433_10157851 | |||
| 2039 | Ga0075433_10181683 | |||
| 2040 | Ga0075433_10321726 | |||
| 2041 | Ga0075433_10635639 | |||
| 2042 | Ga0075434_100005449 | |||
| 2043 | Ga0075434_100009920 | |||
| 2044 | Ga0075434_100057027 | |||
| 2045 | Ga0075434_100286697 | |||
| 2046 | Ga0075434_100303356 | |||
| 2047 | Ga0075434_100423864 | |||
| 2048 | Ga0075429_100078431 | |||
| 2049 | Ga0075429_100190995 | |||
| 2050 | Ga0075429_100339485 | |||
| 2051 | Ga0075429_100339501 | |||
| 2052 | Ga0068865_100005364 | |||
| 2053 | Ga0068865_100060652 | |||
| 2054 | Ga0068865_100152386 | |||
| 2055 | Ga0068865_100164694 | |||
| 2056 | Ga0068865_100295826 | |||
| 2057 | Ga0075436_100006590 | |||
| 2058 | Ga0075436_100068838 | |||
| 2059 | Ga0075436_100082955 | |||
| 2060 | Ga0075436_100131321 | |||
| 2061 | Ga0075436_100361270 | |||
| 2062 | Ga0097620_100032440 | |||
| 2063 | Ga0097620_100062921 | |||
| 2064 | Ga0075435_100003169 | |||
| 2065 | Ga0075435_100007721 | |||
| 2066 | Ga0075435_100008977 | |||
| 2067 | Ga0075435_100016108 | |||
| 2068 | Ga0075435_100016746 | |||
| 2069 | Ga0075435_100180006 | |||
| 2070 | Ga0075435_100239974 | |||
| 2071 | Ga0075435_100585655 | |||
| 2072 | Ga0075435_100585896 | |||
| 2073 | Ga0105244_10168129 | |||
| 2074 | Ga0105240_10044774 | |||
| 2075 | Ga0105240_10045214 | |||
| 2076 | Ga0105240_10114108 | |||
| 2077 | Ga0105240_10271865 | |||
| 2078 | Ga0111539_10047436 | |||
| 2079 | Ga0111539_10061220 | |||
| 2080 | Ga0111539_10138710 | |||
| 2081 | Ga0111539_10329014 | |||
| 2082 | Ga0111539_10496540 | |||
| 2083 | Ga0111539_10634155 | |||
| 2084 | Ga0111539_11003456 | |||
| 2085 | Ga0105245_10023009 | |||
| 2086 | Ga0105245_10027905 | |||
| 2087 | Ga0105245_10036938 | |||
| 2088 | Ga0105245_10044229 | |||
| 2089 | Ga0105245_10066760 | |||
| 2090 | Ga0105245_10079060 | |||
| 2091 | Ga0105245_10121540 | |||
| 2092 | Ga0105245_10150671 | |||
| 2093 | Ga0105245_10209966 | |||
| 2094 | Ga0105245_10700389 | |||
| 2095 | Ga0105247_10043907 | |||
| 2096 | Ga0105247_10354144 | |||
| 2097 | Ga0114129_10006249 | |||
| 2098 | Ga0114129_10125698 | |||
| 2099 | Ga0114129_10178475 | |||
| 2100 | Ga0114129_10191791 | |||
| 2101 | Ga0114129_10621807 | |||
| 2102 | Ga0114129_11425016 | |||
| 2103 | Ga0105243_10006847 | |||
| 2104 | Ga0105243_10039621 | |||
| 2105 | Ga0105243_10123101 | |||
| 2106 | Ga0105243_10272538 | |||
| 2107 | Ga0105243_10359193 | |||
| 2108 | Ga0105243_10394915 | |||
| 2109 | Ga0105243_10474224 | |||
| 2110 | Ga0105243_10504366 | |||
| 2111 | Ga0105243_10869198 | |||
| 2112 | Ga0105241_10113301 | |||
| 2113 | Ga0105241_10241149 | |||
| 2114 | Ga0105241_10381692 | |||
| 2115 | Ga0105241_10574183 | |||
| 2116 | Ga0105242_10035231 | |||
| 2117 | Ga0105242_10040577 | |||
| 2118 | Ga0105242_10115023 | |||
| 2119 | Ga0105242_10344748 | |||
| 2120 | Ga0105242_10361371 | |||
| 2121 | Ga0105242_11128544 | |||
| 2122 | Ga0105248_10135315 | |||
| 2123 | Ga0105248_10161467 | |||
| 2124 | Ga0105248_10327251 | |||
| 2125 | Ga0105248_10476501 | |||
| 2126 | Ga0105248_10753111 | |||
| 2127 | Ga0105248_10970448 | |||
| 2128 | Ga0105248_11138158 | |||
| 2129 | Ga0105237_10062071 | |||
| 2130 | Ga0105237_10195336 | |||
| 2131 | Ga0105237_10686176 | |||
| 2132 | Ga0105238_10008375 | |||
| 2133 | Ga0105238_10029321 | |||
| 2134 | Ga0105238_10063360 | |||
| 2135 | Ga0105238_10078628 | |||
| 2136 | Ga0105238_10234795 | |||
| 2137 | Ga0105238_10297729 | |||
| 2138 | Ga0105249_10034809 | |||
| 2139 | Ga0105249_10061851 | |||
| 2140 | Ga0105249_10257516 | |||
| 2141 | Ga0105249_10258319 | |||
| 2142 | Ga0105249_10285600 | |||
| 2143 | Ga0105249_11129483 | |||
| 2144 | Ga0105239_10021548 | |||
| 2145 | Ga0105239_10033183 | |||
| 2146 | Ga0105239_10124023 | |||
| 2147 | Ga0105239_10138331 | |||
| 2148 | Ga0105239_10195424 | |||
| 2149 | Ga0105239_10198370 | |||
| 2150 | Ga0105239_10218459 | |||
| 2151 | Ga0105239_10219189 | |||
| 2152 | Ga0105239_10261916 | |||
| 2153 | Ga0105239_10267794 | |||
| 2154 | Ga0105239_10323754 | |||
| 2155 | Ga0105239_10471539 | |||
| 2156 | Ga0105239_10815482 | |||
| 2157 | Ga0105246_10003029 | |||
| 2158 | Ga0105246_10040204 | |||
| 2159 | Ga0105246_10050220 | |||
| 2160 | Ga0105246_10184501 | |||
| 2161 | Ga0105246_10417380 | |||
| 2162 | Ga0105246_10475029 | |||
| 2163 | Ga0105246_10816008 | |||
| 2164 | Ga0157373_10042382 | |||
| 2165 | Ga0157373_10199124 | |||
| 2166 | Ga0157371_10008246 | |||
| 2167 | Ga0157371_10075482 | |||
| 2168 | Ga0157371_10292949 | |||
| 2169 | Ga0157370_10046230 | |||
| 2170 | Ga0157370_10104911 | |||
| 2171 | Ga0157370_10113885 | |||
| 2172 | Ga0157370_10161676 | |||
| 2173 | Ga0157369_10004625 | |||
| 2174 | Ga0157369_10021973 | |||
| 2175 | Ga0157369_10026569 | |||
| 2176 | Ga0157369_10129622 | |||
| 2177 | Ga0157369_10147727 | |||
| 2178 | Ga0157369_10196375 | |||
| 2179 | Ga0157369_10725844 | |||
| 2180 | Ga0157369_10991725 | |||
| 2181 | Ga0157374_10060738 | |||
| 2182 | Ga0157374_10248853 | |||
| 2183 | Ga0157374_10265945 | |||
| 2184 | Ga0157374_10788798 | |||
| 2185 | Ga0157378_10129250 | |||
| 2186 | Ga0157378_10242951 | |||
| 2187 | Ga0157378_10267958 | |||
| 2188 | Ga0157378_10394621 | |||
| 2189 | Ga0157378_10522424 | |||
| 2190 | Ga0163162_10018602 | |||
| 2191 | Ga0163162_10022756 | |||
| 2192 | Ga0163162_10035011 | |||
| 2193 | Ga0163162_10046153 | |||
| 2194 | Ga0163162_10099389 | |||
| 2195 | Ga0163162_10228040 | |||
| 2196 | Ga0163162_10620489 | |||
| 2197 | Ga0157372_10006343 | |||
| 2198 | Ga0157372_10023387 | |||
| 2199 | Ga0157372_10055119 | |||
| 2200 | Ga0157372_10064467 | |||
| 2201 | Ga0157372_10131746 | |||
| 2202 | Ga0157372_10177549 | |||
| 2203 | Ga0157372_10191967 | |||
| 2204 | Ga0157372_10206599 | |||
| 2205 | Ga0157372_10270410 | |||
| 2206 | Ga0157372_10727179 | |||
| 2207 | Ga0157372_10877217 | |||
| 2208 | Ga0157372_10898117 | |||
| 2209 | Ga0157375_10017225 | |||
| 2210 | Ga0157375_10041947 | |||
| 2211 | Ga0157375_10148964 | |||
| 2212 | Ga0157375_10185272 | |||
| 2213 | Ga0157375_10253549 | |||
| 2214 | Ga0157375_10409981 | |||
| 2215 | Ga0157375_10897336 | |||
| 2216 | Ga0157375_10947283 | |||
| 2217 | Ga0157375_11044291 | |||
| 2218 | Ga0157375_11087690 | |||
| 2219 | Ga0163163_10043357 | |||
| 2220 | Ga0163163_10059175 | |||
| 2221 | Ga0163163_10090522 | |||
| 2222 | Ga0163163_10263426 | |||
| 2223 | Ga0157380_10019074 | |||
| 2224 | Ga0157380_10101333 | |||
| 2225 | Ga0157380_10113798 | |||
| 2226 | Ga0157380_11084390 | |||
| 2227 | Ga0182008_10032298 | |||
| 2228 | Ga0157377_10086028 | |||
| 2229 | Ga0157377_10112053 | |||
| 2230 | Ga0157377_10118896 | |||
| 2231 | Ga0157377_10675811 | |||
| 2232 | Ga0157379_10193381 | |||
| 2233 | Ga0157376_10036355 | |||
| 2234 | Ga0157376_10079541 | |||
| 2235 | Ga0157376_10079568 | |||
| 2236 | Ga0157376_10149889 | |||
| 2237 | Ga0157376_10205176 | |||
| 2238 | Ga0157376_10222577 | |||
| 2239 | Ga0163161_10014703 | |||
| 2240 | Ga0163161_10110429 | |||
| 2241 | Ga0163161_10647234 | |||
| 2242 | Ga0197907_10107874 | |||
| 2243 | Ga0197907_10487754 | |||
| 2244 | Ga0197907_10805701 | |||
| 2245 | Ga0197907_11270642 | |||
| 2246 | Ga0206356_10067745 | |||
| 2247 | Ga0206356_10097950 | |||
| 2248 | Ga0206356_10171147 | |||
| 2249 | Ga0206356_10264527 | |||
| 2250 | Ga0206356_10570442 | |||
| 2251 | Ga0206356_10612509 | |||
| 2252 | Ga0206356_11872195 | |||
| 2253 | Ga0206349_1478788 | |||
| 2254 | Ga0206349_1884143 | |||
| 2255 | Ga0206351_10455175 | |||
| 2256 | Ga0206352_11114125 | |||
| 2257 | Ga0206350_10825078 | |||
| 2258 | Ga0206354_10022075 | |||
| 2259 | Ga0206354_10431597 | |||
| 2260 | Ga0206354_10806399 | |||
| 2261 | Ga0206354_10808118 | |||
| 2262 | Ga0206354_11620124 | |||
| 2263 | Ga0206353_10391836 | |||
| 2264 | Ga0206353_10658960 | |||
| 2265 | Ga0206353_11419015 | |||
| 2266 | Ga0206353_11715061 | |||
| 2267 | Ga0224712_10042100 | |||
| 2268 | Ga0224712_10119489 | |||
| 2269 | Ga0224712_10269491 | |||
| 2270 | Ga0207656_10060160 | |||
| 2271 | Ga0207653_10040613 | |||
| 2272 | Ga0207653_10051409 | |||
| 2273 | Ga0207692_10017224 | |||
| 2274 | Ga0207692_10145206 | |||
| 2275 | Ga0207642_10041998 | |||
| 2276 | Ga0207642_10094797 | |||
| 2277 | Ga0207642_10111509 | |||
| 2278 | Ga0207642_10191989 | |||
| 2279 | Ga0207710_10037491 | |||
| 2280 | Ga0207710_10238893 | |||
| 2281 | Ga0207688_10000576 | |||
| 2282 | Ga0207688_10002719 | |||
| 2283 | Ga0207688_10062897 | |||
| 2284 | Ga0207688_10076163 | |||
| 2285 | Ga0207688_10309558 | |||
| 2286 | Ga0207647_10096916 | |||
| 2287 | Ga0207647_10100288 | |||
| 2288 | Ga0207685_10021761 | |||
| 2289 | Ga0207685_10160682 | |||
| 2290 | Ga0207685_10205544 | |||
| 2291 | Ga0207685_10395120 | |||
| 2292 | Ga0207699_10017149 | |||
| 2293 | Ga0207699_10067659 | |||
| 2294 | Ga0207699_10189788 | |||
| 2295 | Ga0207699_10570230 | |||
| 2296 | Ga0207645_10024006 | |||
| 2297 | Ga0207645_10154103 | |||
| 2298 | Ga0207645_10278202 | |||
| 2299 | Ga0207643_10033073 | |||
| 2300 | Ga0207643_10105670 | |||
| 2301 | Ga0207705_10187867 | |||
| 2302 | Ga0207705_10229159 | |||
| 2303 | Ga0207705_10627994 | |||
| 2304 | Ga0207705_10752019 | |||
| 2305 | Ga0207654_10035768 | |||
| 2306 | Ga0207654_10420862 | |||
| 2307 | Ga0207654_10456460 | |||
| 2308 | Ga0207707_10097301 | |||
| 2309 | Ga0207707_10137608 | |||
| 2310 | Ga0207707_10141899 | |||
| 2311 | Ga0207707_10243644 | |||
| 2312 | Ga0207707_10277199 | |||
| 2313 | Ga0207707_10358546 | |||
| 2314 | Ga0207707_10630481 | |||
| 2315 | Ga0207695_10024968 | |||
| 2316 | Ga0207695_10390970 | |||
| 2317 | Ga0207671_10241174 | |||
| 2318 | Ga0207671_10247315 | |||
| 2319 | Ga0207671_10554836 | |||
| 2320 | Ga0207693_10008180 | |||
| 2321 | Ga0207693_10012583 | |||
| 2322 | Ga0207693_10016960 | |||
| 2323 | Ga0207693_10017316 | |||
| 2324 | Ga0207693_10032082 | |||
| 2325 | Ga0207693_10053613 | |||
| 2326 | Ga0207693_10064051 | |||
| 2327 | Ga0207693_10069882 | |||
| 2328 | Ga0207693_10073799 | |||
| 2329 | Ga0207693_10079885 | |||
| 2330 | Ga0207693_10080820 | |||
| 2331 | Ga0207663_10016349 | |||
| 2332 | Ga0207663_10017385 | |||
| 2333 | Ga0207663_10033480 | |||
| 2334 | Ga0207663_10052872 | |||
| 2335 | Ga0207663_10055380 | |||
| 2336 | Ga0207663_10176500 | |||
| 2337 | Ga0207663_10196344 | |||
| 2338 | Ga0207663_10225185 | |||
| 2339 | Ga0207663_10226143 | |||
| 2340 | Ga0207660_10111595 | |||
| 2341 | Ga0207660_10281261 | |||
| 2342 | Ga0207660_10393594 | |||
| 2343 | Ga0207660_10398565 | |||
| 2344 | Ga0207660_10421434 | |||
| 2345 | Ga0207660_10452665 | |||
| 2346 | Ga0207662_10138917 | |||
| 2347 | Ga0207662_10159113 | |||
| 2348 | Ga0207662_10177250 | |||
| 2349 | Ga0207657_10008583 | |||
| 2350 | Ga0207657_10009230 | |||
| 2351 | Ga0207657_10016295 | |||
| 2352 | Ga0207657_10021109 | |||
| 2353 | Ga0207657_10099966 | |||
| 2354 | Ga0207657_10161025 | |||
| 2355 | Ga0207657_10272647 | |||
| 2356 | Ga0207657_10353343 | |||
| 2357 | Ga0207657_10369915 | |||
| 2358 | Ga0207649_10164389 | |||
| 2359 | Ga0207649_10229103 | |||
| 2360 | Ga0207649_10237364 | |||
| 2361 | Ga0207649_10493745 | |||
| 2362 | Ga0207649_10710407 | |||
| 2363 | Ga0207649_10863701 | |||
| 2364 | Ga0207652_10041627 | |||
| 2365 | Ga0207652_10043852 | |||
| 2366 | Ga0207652_10096545 | |||
| 2367 | Ga0207652_10181291 | |||
| 2368 | Ga0207652_10201690 | |||
| 2369 | Ga0207652_10209402 | |||
| 2370 | Ga0207652_10398170 | |||
| 2371 | Ga0207681_10191444 | |||
| 2372 | Ga0207681_10324206 | |||
| 2373 | Ga0207681_10438031 | |||
| 2374 | Ga0207694_10029479 | |||
| 2375 | Ga0207694_10117246 | |||
| 2376 | Ga0207694_10164544 | |||
| 2377 | Ga0207694_10407488 | |||
| 2378 | Ga0207650_10199701 | |||
| 2379 | Ga0207659_10292590 | |||
| 2380 | Ga0207659_10338888 | |||
| 2381 | Ga0207659_10742315 | |||
| 2382 | Ga0207687_10001941 | |||
| 2383 | Ga0207687_10011006 | |||
| 2384 | Ga0207687_10032121 | |||
| 2385 | Ga0207687_10047134 | |||
| 2386 | Ga0207687_10054720 | |||
| 2387 | Ga0207687_10063882 | |||
| 2388 | Ga0207687_10247444 | |||
| 2389 | Ga0207687_10250347 | |||
| 2390 | Ga0207687_10299026 | |||
| 2391 | Ga0207687_10569005 | |||
| 2392 | Ga0207687_10637087 | |||
| 2393 | Ga0207700_10000001 | |||
| 2394 | Ga0207700_10475324 | |||
| 2395 | Ga0207700_10620135 | |||
| 2396 | Ga0207700_10674333 | |||
| 2397 | Ga0207700_10690587 | |||
| 2398 | Ga0207664_10005882 | |||
| 2399 | Ga0207664_10031936 | |||
| 2400 | Ga0207664_10163281 | |||
| 2401 | Ga0207664_10211966 | |||
| 2402 | Ga0207664_10335989 | |||
| 2403 | Ga0207664_10648295 | |||
| 2404 | Ga0207664_10748073 | |||
| 2405 | Ga0207664_10851313 | |||
| 2406 | Ga0207644_10279142 | |||
| 2407 | Ga0207644_10337877 | |||
| 2408 | Ga0207644_10384764 | |||
| 2409 | Ga0207690_10165745 | |||
| 2410 | Ga0207690_10299356 | |||
| 2411 | Ga0207690_10342908 | |||
| 2412 | Ga0207690_10489908 | |||
| 2413 | Ga0207706_10014884 | |||
| 2414 | Ga0207706_10026610 | |||
| 2415 | Ga0207706_10053169 | |||
| 2416 | Ga0207706_10056049 | |||
| 2417 | Ga0207706_10120338 | |||
| 2418 | Ga0207686_10055335 | |||
| 2419 | Ga0207686_10159024 | |||
| 2420 | Ga0207686_10209980 | |||
| 2421 | Ga0207686_10345725 | |||
| 2422 | Ga0207686_10927681 | |||
| 2423 | Ga0207709_10046305 | |||
| 2424 | Ga0207709_10070402 | |||
| 2425 | Ga0207709_10081294 | |||
| 2426 | Ga0207709_10144464 | |||
| 2427 | Ga0207709_10162421 | |||
| 2428 | Ga0207709_10171171 | |||
| 2429 | Ga0207709_10598813 | |||
| 2430 | Ga0207709_10687388 | |||
| 2431 | Ga0207670_10237062 | |||
| 2432 | Ga0207669_10117922 | |||
| 2433 | Ga0207669_10178613 | |||
| 2434 | Ga0207704_10042563 | |||
| 2435 | Ga0207704_10135136 | |||
| 2436 | Ga0207704_10154027 | |||
| 2437 | Ga0207704_10359639 | |||
| 2438 | Ga0207704_10643863 | |||
| 2439 | Ga0207665_10003372 | |||
| 2440 | Ga0207665_10014891 | |||
| 2441 | Ga0207665_10027262 | |||
| 2442 | Ga0207665_10065816 | |||
| 2443 | Ga0207665_10134050 | |||
| 2444 | Ga0207691_10018191 | |||
| 2445 | Ga0207691_10481773 | |||
| 2446 | Ga0207711_10096112 | |||
| 2447 | Ga0207711_10175360 | |||
| 2448 | Ga0207711_10206244 | |||
| 2449 | Ga0207711_10421019 | |||
| 2450 | Ga0207711_10603468 | |||
| 2451 | Ga0207689_10071536 | |||
| 2452 | Ga0207689_10079779 | |||
| 2453 | Ga0207661_10002762 | |||
| 2454 | Ga0207661_10062252 | |||
| 2455 | Ga0207661_10083440 | |||
| 2456 | Ga0207661_10145258 | |||
| 2457 | Ga0207661_10225098 | |||
| 2458 | Ga0207661_10227083 | |||
| 2459 | Ga0207661_10321721 | |||
| 2460 | Ga0207661_10512927 | |||
| 2461 | Ga0207679_10122283 | |||
| 2462 | Ga0207679_10140319 | |||
| 2463 | Ga0207679_10220576 | |||
| 2464 | Ga0207679_10261620 | |||
| 2465 | Ga0207679_10262513 | |||
| 2466 | Ga0207679_10864951 | |||
| 2467 | Ga0207667_10018802 | |||
| 2468 | Ga0207667_10035997 | |||
| 2469 | Ga0207667_10101370 | |||
| 2470 | Ga0207667_10136410 | |||
| 2471 | Ga0207667_10861754 | |||
| 2472 | Ga0207712_10043069 | |||
| 2473 | Ga0207712_10073361 | |||
| 2474 | Ga0207712_10127552 | |||
| 2475 | Ga0207668_10121814 | |||
| 2476 | Ga0207668_10266913 | |||
| 2477 | Ga0207668_10429887 | |||
| 2478 | Ga0207668_10970339 | |||
| 2479 | Ga0207640_10196601 | |||
| 2480 | Ga0207640_10366863 | |||
| 2481 | Ga0207658_10312966 | |||
| 2482 | Ga0207677_10032125 | |||
| 2483 | Ga0207677_10266283 | |||
| 2484 | Ga0207677_10322542 | |||
| 2485 | Ga0207677_10537715 | |||
| 2486 | Ga0207677_10572387 | |||
| 2487 | Ga0207703_11140213 | |||
| 2488 | Ga0207639_10041448 | |||
| 2489 | Ga0207639_10458011 | |||
| 2490 | Ga0207639_10826130 | |||
| 2491 | Ga0207678_10004108 | |||
| 2492 | Ga0207678_10039819 | |||
| 2493 | Ga0207678_10237011 | |||
| 2494 | Ga0207678_10419968 | |||
| 2495 | Ga0207708_10003490 | |||
| 2496 | Ga0207708_10018401 | |||
| 2497 | Ga0207708_10020508 | |||
| 2498 | Ga0207702_10011413 | |||
| 2499 | Ga0207702_10314778 | |||
| 2500 | Ga0207702_10609487 | |||
| 2501 | Ga0207702_10688835 | |||
| 2502 | Ga0207702_10725804 | |||
| 2503 | Ga0207702_10933307 | |||
| 2504 | Ga0207702_11052661 | |||
| 2505 | Ga0207641_10483437 | |||
| 2506 | Ga0207648_10013106 | |||
| 2507 | Ga0207648_10034985 | |||
| 2508 | Ga0207648_10046259 | |||
| 2509 | Ga0207648_10111797 | |||
| 2510 | Ga0207676_10142455 | |||
| 2511 | Ga0207676_10403186 | |||
| 2512 | Ga0207676_10602740 | |||
| 2513 | Ga0207676_10753919 | |||
| 2514 | Ga0207674_10002797 | |||
| 2515 | Ga0207674_10003158 | |||
| 2516 | Ga0207674_10070528 | |||
| 2517 | Ga0207674_10148470 | |||
| 2518 | Ga0207674_10292968 | |||
| 2519 | Ga0207674_10796660 | |||
| 2520 | Ga0207675_100014301 | |||
| 2521 | Ga0207675_100028238 | |||
| 2522 | Ga0207675_100028247 | |||
| 2523 | Ga0207675_100275851 | |||
| 2524 | Ga0207675_100276046 | |||
| 2525 | Ga0207675_100418102 | |||
| 2526 | Ga0207675_100703200 | |||
| 2527 | Ga0207683_10019866 | |||
| 2528 | Ga0207683_10025027 | |||
| 2529 | Ga0207683_10045184 | |||
| 2530 | Ga0207683_10046558 | |||
| 2531 | Ga0207683_10050227 | |||
| 2532 | Ga0207683_10073743 | |||
| 2533 | Ga0207698_10061364 | |||
| 2534 | Ga0207698_10109155 | |||
| 2535 | Ga0207698_10271867 | |||
| 2536 | Ga0207698_10278494 | |||
| 2537 | Ga0207698_10284055 | |||
| 2538 | Ga0207698_10590176 | |||
| 2539 | Ga0207698_10901387 | |||
| 2540 | Ga0207698_10964069 | |||
| 2541 | Ga0209996_1013331 | |||
| 2542 | Ga0209974_10031452 | |||
| 2543 | Ga0207428_10000961 | |||
| 2544 | Ga0207428_10001607 | |||
| 2545 | Ga0207428_10006497 | |||
| 2546 | Ga0207428_10029057 | |||
| 2547 | Ga0207428_10050377 | |||
| 2548 | Ga0207428_10186543 | |||
| 2549 | Ga0207428_10366783 | |||
| 2550 | Ga0268266_10145897 | |||
| 2551 | Ga0268266_10776320 | |||
| 2552 | Ga0268265_10236389 | |||
| 2553 | Ga0268265_10459475 | |||
| 2554 | Ga0268265_10548326 | |||
| 2555 | Ga0268264_10223970 | |||
| 2556 | Ga0268264_11307906 | |||
| 2557 | Ga0265338_10006932 | |||
| 2558 | Ga0265327_10003464 | |||
| 2559 | Ga0307408_100055125 | |||
| 2560 | Ga0307408_101015725 | |||
| 2561 | Ga0307405_10034016 | |||
| 2562 | Ga0307413_10072009 | |||
| 2563 | Ga0307410_10413128 | |||
| 2564 | Ga0307406_10527070 | |||
| 2565 | Ga0307412_10421648 | |||
| 2566 | Ga0307409_100222604 | |||
| 2567 | Ga0307409_100668260 | |||
| 2568 | Ga0307416_100027433 | |||
| 2569 | Ga0307416_100158165 | |||
| 2570 | Ga0307416_100937076 | |||
| 2571 | Ga0307414_10657807 | |||
| 2572 | Ga0307415_100101915 | |||
| 2573 | Ga0307415_100466596 | |||
| 2574 | Ga0373930_0019390 | |||
| 2575 | Ga0373948_0010741 | |||
| 2576 | Ga0373948_0047377 | |||
| 2577 | Ga0373958_0038305 | |||
| 2578 | Ga0373959_0024307 | |||
| 2579 | Ga0373959_0047639 | |||
| 2580 | Ga0373938_0001710 | |||
| 2581 | Ga0373938_0040779 | |||
| 2582 | Ga0373926_0061506 | |||
| 2583 | Ga0373928_0003299 | |||
| 2584 | Ga0373928_0006972 | |||
| 2585 | Ga0373929_0007133 | |||
| 2586 | Ga0373940_0080041 | |||
| 2587 | Ga0373944_0021946 | |||
| 2588 | Ga0373949_0007106 | |||
| 2589 | Ga0373949_0017025 | |||
| 2590 | Ga0373951_0015729 | |||
| 2591 | Ga0373952_0003220 | |||
| 2592 | Ga0373952_0019049 | |||
| 2593 | Ga0373932_0064366 | |||
| 2594 | Ga0373939_0008646 | |||
| 2595 | Ga0373939_0026767 | |||
| 2596 | Ga0373939_0044986 | |||
| 2597 | Ga0373941_0010231 | |||
| 2598 | Ga0373941_0034259 | |||
| 2599 | Ga0373945_0060922 | |||
| 2600 | Ga0373945_0095234 | |||
| 2601 | Ga0373957_0131858 | |||
| 2602 | Ga0373960_0002600 | |||
| 2603 | Ga0373960_0013535 | |||
| 2604 | Ga0373960_0026376 | |||
| 2605 | Ga0373943_0000446 | |||
| 2606 | Ga0373943_0003706 | |||
| 2607 | Ga0373943_0031704 | |||
| 2608 | Ga0373943_0051298 | |||
| 2609 | Ga0373943_0091074 | |||
| 2610 | Ga0373943_0133294 | |||
| 2611 | Ga0373946_0004785 | |||
| 2612 | Ga0373946_0005191 | |||
| 2613 | Ga0373942_0026511 | |||
| 2614 | Ga0373961_0013443 | |||
| 2615 | Ga0373961_0030492 | |||
| 2616 | Ga0373962_0003042 | |||
| 2617 | Ga0373924_0082499 | |||
| 2618 | Ga0373924_0295082 | |||
| 2619 | Ga0373931_0018151 | |||
| 2620 | Ga0373931_0128582 | |||
| 2621 | Ga0373931_0142142 | |||
| 2622 | Ga0373931_0525117 | |||
| 2623 | Ga0373935_0029195 | |||
| 2624 | Ga0373935_0041188 | |||
| 2625 | Ga0373935_0041505 | |||
| 2626 | Ga0373935_0172203 | |||
| 2627 | Ga0373927_0187623 | |||
| 2628 | Ga0373927_0236852 | |||
| 2629 | Ga0373927_0304819 | |||
| 2630 | Ga0373947_0000387 | |||
| 2631 | Ga0373947_0003076 | |||
| 2632 | Ga0373947_0004637 | |||
| 2633 | Ga0373947_0012427 | |||
| 2634 | Ga0373947_0124486 | |||
| 2635 | Ga0373947_0225748 | |||
| 2636 | Ga0373937_0085424 | |||
| 2637 | Ga0373937_0210250 | |||
| 2638 | Ga0373925_0002635 | |||
| 2639 | Ga0373925_0011235 | |||
| 2640 | Ga0373925_0015834 | |||
| 2641 | Ga0373925_0018474 | |||
| 2642 | Ga0373925_0470224 | |||
| 2643 | Ga0373925_0571140 | |||
| 2644 | Ga0395899_0010199 | |||
| 2645 | Ga0395899_0026595 | |||
| 2646 | Ga0395899_0241795 | |||
| 2647 | Ga0395899_0313081 | |||
| 2648 | Ga0395900_0001765 | |||
| 2649 | Ga0395900_0024611 | |||
| 2650 | Ga0395900_0038851 | |||
| 2651 | Ga0395900_0065148 | |||
| 2652 | Ga0395900_0073283 | |||
| 2653 | Ga0395900_0094470 | |||
| 2654 | Ga0395900_0096260 | |||
| 2655 | Ga0395900_0129191 | |||
| 2656 | Ga0395900_0145096 | |||
| 2657 | Ga0395900_0165005 | |||
| 2658 | Ga0395900_0358822 | |||
| 2659 | Ga0395898_0020703 | |||
| 2660 | Ga0395898_0021612 | |||
| 2661 | Ga0395898_0040761 | |||
| 2662 | Ga0395898_0063732 | |||
| 2663 | Ga0395898_0112160 | |||
| 2664 | Ga0395898_0129986 | |||
| 2665 | Ga0395898_0157867 | |||
| 2666 | Ga0395898_0190194 | |||
| 2667 | Ga0395898_0228586 | |||
| 2668 | Ga0395898_0293680 | |||
| 2669 | Ga0395898_0346623 | |||
| 2670 | Ga0395898_0457106 | |||
| 2671 | Ga0395898_0533152 | |||
| 2672 | Ga0395898_0812453 | |||
| 2673 | Ga0395905_0002747 | |||
| 2674 | Ga0395905_0037931 | |||
| 2675 | Ga0395905_0039926 | |||
| 2676 | Ga0395905_0090396 | |||
| 2677 | Ga0395905_0145492 | |||
| 2678 | Ga0395905_0146059 | |||
| 2679 | Ga0395905_0188859 | |||
| 2680 | Ga0395905_0638865 | |||
| 2681 | Ga0395905_0954241 | |||
| 2682 | Ga0395901_0004202 | |||
| 2683 | Ga0395901_0033421 | |||
| 2684 | Ga0395901_0058456 | |||
| 2685 | Ga0395901_0106519 | |||
| 2686 | Ga0395901_0128766 | |||
| 2687 | Ga0395901_0144071 | |||
| 2688 | Ga0395901_0176004 | |||
| 2689 | Ga0395901_0209606 | |||
| 2690 | Ga0395901_0220128 | |||
| 2691 | Ga0395901_0316314 | |||
| 2692 | Ga0395901_0560410 | |||
| 2693 | Ga0395901_0743451 | |||
| 2694 | Ga0439438_060592 | |||
| 2695 | Ga0439461_0049123 | |||
| 2696 | Ga0451793_1843478 | |||
| 2697 | Ga0451800_0491729 | |||
| 2698 | Ga0451802_1410741 | |||
| 2699 | Ga0451835_0095057 | |||
| 2700 | Ga0451841_0601019 | |||
| 2701 | Ga0451853_2781693 | |||
| 2702 | Ga0439448_0064681 | |||
| 2703 | Ga0439454_012833 | |||
| 2704 | Ga0439455_0106311 | |||
| 2705 | Ga0439462_0106059 | |||
| 2706 | Ga0450912_007473 | |||
| 2707 | Ga0450906_012998 | |||
| 2708 | Ga0450908_008473 | |||
| 2709 | Ga0439435_0019544 | |||
| 2710 | Ga0450916_020664 | |||
| 2711 | Ga0466961_0116983 | |||
| 2712 | Ga0466963_0008227 | |||
| 2713 | Ga0466963_0038413 | |||
| 2714 | Ga0466963_0047675 | |||
| 2715 | Ga0466963_0048740 | |||
| 2716 | Ga0466964_0017660 | |||
| 2717 | Ga0466968_0002483 | |||
| 2718 | Ga0466957_0038787 | |||
| 2719 | Ga0466960_0065768 | |||
| 2720 | Ga0466959_0055049 | |||
| 2721 | Ga0451576_0025840 | |||
| 2722 | Ga0466958_0039270 | |||
| 2723 | Ga0466967_0003096 | |||
| 2724 | Ga0466967_0009282 | |||
| 2725 | Ga0466967_0064789 | |||
| 2726 | Ga0466967_0099229 | |||
| 2727 | Ga0466967_0110372 | |||
| 2728 | Ga0466967_0239583 | |||
| 2729 | Ga0466967_0483065 | |||
| 2730 | Ga0466967_0827802 | |||
| 2731 | Ga0466967_0872312 | |||
| 2732 | Ga0466967_1201627 | |||
| 2733 | Ga0495617_120635 | |||
| 2734 | Ga0495592_0187718 | |||
| 2735 | Ga0495592_0261417 | |||
| 2736 | Ga0495603_0000339 | |||
| 2737 | Ga0495603_0010219 | |||
| 2738 | Ga0495603_0048054 | |||
| 2739 | Ga0495603_0139749 | |||
| 2740 | Ga0495603_0263240 | |||
| 2741 | Ga0495603_0322226 | |||
| 2742 | Ga0495629_0000756 | |||
| 2743 | Ga0495629_0105012 | |||
| 2744 | Ga0495629_0133718 | |||
| 2745 | Ga0495629_0176756 | |||
| 2746 | Ga0495629_0185828 | |||
| 2747 | Ga0495641_0000626 | |||
| 2748 | Ga0495641_0009085 | |||
| 2749 | Ga0495651_0052345 | |||
| 2750 | Ga0495651_0194067 | |||
| 2751 | Ga0495651_0238905 | |||
| 2752 | Ga0495653_0009151 | |||
| 2753 | Ga0495653_0034594 | |||
| 2754 | Ga0495653_0084723 | |||
| 2755 | Ga0495653_0090549 | |||
| 2756 | Ga0495653_0356485 | |||
| 2757 | Ga0495653_0516025 | |||
| 2758 | Ga0495653_0543703 | |||
| 2759 | Ga0495580_0098927 | |||
| 2760 | Ga0495580_0158110 | |||
| 2761 | Ga0495580_0212312 | |||
| 2762 | Ga0495580_0285844 | |||
| 2763 | Ga0495582_0001691 | |||
| 2764 | Ga0495582_0004256 | |||
| 2765 | Ga0495582_0007425 | |||
| 2766 | Ga0495582_0030194 | |||
| 2767 | Ga0495582_0032842 | |||
| 2768 | Ga0495639_0000390 | |||
| 2769 | Ga0495639_0000932 | |||
| 2770 | Ga0495639_0006417 | |||
| 2771 | Ga0495639_0078952 | |||
| 2772 | Ga0495662_0001935 | |||
| 2773 | Ga0495662_0010854 | |||
| 2774 | Ga0495662_0034980 | |||
| 2775 | Ga0495664_0006141 | |||
| 2776 | Ga0495664_0181767 | |||
| 2777 | Ga0495594_0001020 | |||
| 2778 | Ga0495594_0191687 | |||
| 2779 | Ga0495607_0320033 | |||
| 2780 | Ga0495608_0031672 | |||
| 2781 | Ga0495608_0035495 | |||
| 2782 | Ga0495618_0015162 | |||
| 2783 | Ga0495618_0067762 | |||
| 2784 | Ga0495618_0126627 | |||
| 2785 | Ga0495618_0144683 | |||
| 2786 | Ga0495628_0547974 | |||
| 2787 | Ga0495630_0006174 | |||
| 2788 | Ga0495630_0011353 | |||
| 2789 | Ga0495630_0015527 | |||
| 2790 | Ga0495630_0038463 | |||
| 2791 | Ga0495630_0269249 | |||
| 2792 | Ga0495630_0305056 | |||
| 2793 | Ga0495630_0461030 | |||
| 2794 | Ga0495666_0002371 | |||
| 2795 | Ga0495666_0068093 | |||
| 2796 | Ga0495666_0074018 | |||
| 2797 | Ga0495666_0081208 | |||
| 2798 | Ga0495652_0125804 | |||
| 2799 | Ga0495652_0129266 | |||
| 2800 | Ga0495652_0243857 | |||
| 2801 | Ga0495652_0312101 | |||
| 2802 | Ga0495652_0417761 | |||
| 2803 | Ga0495665_0001013 | |||
| 2804 | Ga0495665_0005059 | |||
| 2805 | Ga0495665_0033964 | |||
| 2806 | Ga0495640_0008914 | |||
| 2807 | Ga0495640_0039874 | |||
| 2808 | Ga0495640_0049800 | |||
| 2809 | Ga0495640_0385773 | |||
| 2810 | Ga0495586_0265469 | |||
| 2811 | Ga0495587_0134726 | |||
| 2812 | Ga0495587_0165161 | |||
| 2813 | Ga0495645_0282942 | |||
| 2814 | Ga0495622_0134656 | |||
| 2815 | Ga0495667_0019358 | |||
| 2816 | Ga0495667_0055301 | |||
| 2817 | Ga0495667_0062901 | |||
| 2818 | Ga0495667_0299529 | |||
| 2819 | Ga0495668_0187250 | |||
| 2820 | Ga0495634_0023836 | |||
| 2821 | Ga0495634_0028213 | |||
| 2822 | Ga0495634_0034230 | |||
| 2823 | Ga0495634_0137783 | |||
| 2824 | Ga0495634_0304611 | |||
| 2825 | Ga0495635_0022086 | |||
| 2826 | Ga0495635_0023627 | |||
| 2827 | Ga0495635_0052541 | |||
| 2828 | Ga0495635_0116442 | |||
| 2829 | Ga0495635_0159386 | |||
| 2830 | Ga0495588_0000863 | |||
| 2831 | Ga0495588_0044492 | |||
| 2832 | Ga0495657_0015061 | |||
| 2833 | Ga0495657_0048063 | |||
| 2834 | Ga0495657_0096510 | |||
| 2835 | Ga0495599_0025318 | |||
| 2836 | Ga0495599_0216475 | |||
| 2837 | Ga0495599_0364031 | |||
| 2838 | Ga0495623_0004791 | |||
| 2839 | Ga0495623_0057491 | |||
| 2840 | Ga0495623_0189932 | |||
| 2841 | Ga0495646_0038823 | |||
| 2842 | Ga0495646_0185193 | |||
| 2843 | Ga0495646_0434089 | |||
| 2844 | Ga0495647_0007286 | |||
| 2845 | Ga0495647_0007772 | |||
| 2846 | Ga0495647_0017457 | |||
| 2847 | Ga0495647_0165297 | |||
| 2848 | Ga0495658_0000477 | |||
| 2849 | Ga0495658_0002681 | |||
| 2850 | Ga0495658_0012424 | |||
| 2851 | Ga0495658_0067838 | |||
| 2852 | Ga0495658_0169632 | |||
| 2853 | Ga0495658_0651318 | |||
| 2854 | Ga0495613_0012014 | |||
| 2855 | Ga0495613_0027883 | |||
| 2856 | Ga0495613_0035174 | |||
| 2857 | Ga0495613_0082324 | |||
| 2858 | Ga0495613_0151997 | |||
| 2859 | Ga0495613_0171905 | |||
| 2860 | Ga0495624_0005965 | |||
| 2861 | Ga0495624_0011629 | |||
| 2862 | Ga0495624_0026113 | |||
| 2863 | Ga0495589_0136762 | |||
| 2864 | Ga0495589_0158424 | |||
| 2865 | Ga0495600_0060012 | |||
| 2866 | Ga0495600_0182986 | |||
| 2867 | Ga0495600_0187762 | |||
| 2868 | Ga0495600_0226368 | |||
| 2869 | Ga0495581_0004713 | |||
| 2870 | Ga0495581_0010091 | |||
| 2871 | Ga0495581_0010557 | |||
| 2872 | Ga0495581_0012180 | |||
| 2873 | Ga0495581_0043668 | |||
| 2874 | Ga0495604_0094893 | |||
| 2875 | Ga0495604_0207962 | |||
| 2876 | Ga0495604_0229187 | |||
| 2877 | Ga0495604_0337871 | |||
| 2878 | Ga0495674_0001928 | |||
| 2879 | Ga0495674_0013017 | |||
| 2880 | Ga0495674_0020329 | |||
| 2881 | Ga0495674_0092217 | |||
| 2882 | Ga0495674_0095249 | |||
| 2883 | Ga0495674_0182686 | |||
| 2884 | Ga0495674_0323449 | |||
| 2885 | Ga0495674_0396684 | |||
| 2886 | Ga0495674_0454988 | |||
| 2887 | Ga0495676_0007375 | |||
| 2888 | Ga0495676_0008869 | |||
| 2889 | Ga0495676_0039732 | |||
| 2890 | Ga0495676_0067394 | |||
| 2891 | Ga0495676_0159325 | |||
| 2892 | Ga0495676_0351462 | |||
| 2893 | Ga0495680_0001918 | |||
| 2894 | Ga0495680_0002863 | |||
| 2895 | Ga0495680_0023233 | |||
| 2896 | Ga0495680_0035097 | |||
| 2897 | Ga0495683_0170283 | |||
| 2898 | Ga0495677_0068950 | |||
| 2899 | Ga0495677_0178389 | |||
| 2900 | Ga0495684_0017343 | |||
| 2901 | Ga0495684_0058385 | |||
| 2902 | Ga0495684_0067293 | |||
| 2903 | Ga0495684_0080217 | |||
| 2904 | Ga0495684_0096431 | |||
| 2905 | Ga0495593_0002453 | |||
| 2906 | Ga0495593_0016019 | |||
| 2907 | Ga0495593_0096453 | |||
| 2908 | Ga0495602_0088357 | |||
| 2909 | Ga0495602_0122659 | |||
| 2910 | Ga0495602_0138240 | |||
| 2911 | Ga0495614_0002561 | |||
| 2912 | Ga0495614_0015876 | |||
| 2913 | Ga0495614_0024565 | |||
| 2914 | Ga0495614_0090968 | |||
| 2915 | Ga0495626_0101351 | |||
| 2916 | Ga0496100_0001475 | |||
| 2917 | Ga0496100_0017504 | |||
| 2918 | Ga0496100_0019881 | |||
| 2919 | Ga0496100_0049942 | |||
| 2920 | Ga0496100_0050735 | |||
| 2921 | Ga0496100_0069499 | |||
| 2922 | Ga0496100_0073748 | |||
| 2923 | Ga0496100_0108686 | |||
| 2924 | Ga0496100_0217962 | |||
| 2925 | Ga0496100_0222008 | |||
| 2926 | Ga0496100_0248643 | |||
| 2927 | Ga0496100_0272832 | |||
| 2928 | Ga0496100_0326122 | |||
| 2929 | Ga0496100_0438652 | |||
| 2930 | Ga0496100_0694413 | |||
| 2931 | Ga0496101_0007713 | |||
| 2932 | Ga0496101_0008020 | |||
| 2933 | Ga0496101_0010537 | |||
| 2934 | Ga0496101_0012675 | |||
| 2935 | Ga0496101_0015235 | |||
| 2936 | Ga0496101_0015329 | |||
| 2937 | Ga0496101_0031551 | |||
| 2938 | Ga0496101_0042041 | |||
| 2939 | Ga0496101_0055799 | |||
| 2940 | Ga0496101_0075160 | |||
| 2941 | Ga0496101_0138526 | |||
| 2942 | Ga0496101_0160097 | |||
| 2943 | Ga0496101_0225615 | |||
| 2944 | Ga0496101_0459305 | |||
| 2945 | Ga0496102_0005018 | |||
| 2946 | Ga0496102_0006410 | |||
| 2947 | Ga0496102_0009237 | |||
| 2948 | Ga0496102_0019899 | |||
| 2949 | Ga0496102_0034806 | |||
| 2950 | Ga0496102_0103107 | |||
| 2951 | Ga0496102_0110844 | |||
| 2952 | Ga0496102_0175055 | |||
| 2953 | Ga0496102_0180029 | |||
| 2954 | Ga0496102_0366048 | |||
| 2955 | Ga0496102_0624643 | |||
| 2956 | Ga0496102_0643475 | |||
| 2957 | Ga0496103_0001794 | |||
| 2958 | Ga0496103_0007950 | |||
| 2959 | Ga0496103_0044591 | |||
| 2960 | Ga0496103_0061127 | |||
| 2961 | Ga0496103_0109678 | |||
| 2962 | Ga0496103_0221664 | |||
| 2963 | Ga0496103_0228741 | |||
| 2964 | Ga0496103_0407035 | |||
| 2965 | Ga0496103_0410661 | |||
| 2966 | Ga0496104_0000461 | |||
| 2967 | Ga0496104_0000494 | |||
| 2968 | Ga0496104_0011694 | |||
| 2969 | Ga0496104_0013270 | |||
| 2970 | Ga0496104_0025462 | |||
| 2971 | Ga0496104_0048035 | |||
| 2972 | Ga0496104_0048116 | |||
| 2973 | Ga0496104_0143755 | |||
| 2974 | Ga0496104_0192690 | |||
| 2975 | Ga0496104_0228606 | |||
| 2976 | Ga0496104_0246772 | |||
| 2977 | Ga0496104_0263856 | |||
| 2978 | Ga0496104_0305216 | |||
| 2979 | Ga0496104_0314598 | |||
| 2980 | Ga0496104_0337666 | |||
| 2981 | Ga0496104_0337782 | |||
| 2982 | Ga0496104_0385445 | |||
| 2983 | Ga0496105_0000673 | |||
| 2984 | Ga0496105_0000930 | |||
| 2985 | Ga0496105_0001972 | |||
| 2986 | Ga0496105_0010729 | |||
| 2987 | Ga0496105_0020091 | |||
| 2988 | Ga0496105_0025579 | |||
| 2989 | Ga0496105_0044586 | |||
| 2990 | Ga0496105_0048906 | |||
| 2991 | Ga0496105_0054206 | |||
| 2992 | Ga0496105_0076428 | |||
| 2993 | Ga0496105_0214849 | |||
| 2994 | Ga0496105_0245973 | |||
| 2995 | Ga0496105_0287771 | |||
| 2996 | Ga0496105_0347036 | |||
| 2997 | Ga0496105_0389499 | |||
| 2998 | Ga0496105_0412356 | |||
| 2999 | Ga0496106_0000456 | |||
| 3000 | Ga0496106_0008749 | |||
| 3001 | Ga0496106_0012301 | |||
| 3002 | Ga0496106_0014956 | |||
| 3003 | Ga0496106_0037415 | |||
| 3004 | Ga0496106_0039147 | |||
| 3005 | Ga0496106_0043208 | |||
| 3006 | Ga0496106_0097556 | |||
| 3007 | Ga0496106_0098188 | |||
| 3008 | Ga0496106_0117405 | |||
| 3009 | Ga0496106_0411097 | |||
| 3010 | Ga0496106_0485265 | |||
| 3011 | Ga0496106_0661871 | |||
| 3012 | Ga0496107_0000980 | |||
| 3013 | Ga0496107_0011989 | |||
| 3014 | Ga0496107_0019088 | |||
| 3015 | Ga0496107_0021993 | |||
| 3016 | Ga0496107_0043490 | |||
| 3017 | Ga0496107_0043609 | |||
| 3018 | Ga0496107_0045805 | |||
| 3019 | Ga0496107_0072819 | |||
| 3020 | Ga0496107_0235465 | |||
| 3021 | Ga0496108_0003532 | |||
| 3022 | Ga0496108_0004458 | |||
| 3023 | Ga0496108_0011668 | |||
| 3024 | Ga0496108_0025218 | |||
| 3025 | Ga0496108_0025655 | |||
| 3026 | Ga0496108_0029090 | |||
| 3027 | Ga0496108_0052736 | |||
| 3028 | Ga0496108_0069163 | |||
| 3029 | Ga0496108_0091374 | |||
| 3030 | Ga0496108_0119196 | |||
| 3031 | Ga0496108_0184967 | |||
| 3032 | Ga0496108_0407703 | |||
| 3033 | Ga0496108_0432807 | |||
| 3034 | Ga0496108_0682290 | |||
| 3035 | Ga0496109_0001074 | |||
| 3036 | Ga0496109_0003058 | |||
| 3037 | Ga0496109_0003358 | |||
| 3038 | Ga0496109_0009488 | |||
| 3039 | Ga0496109_0010424 | |||
| 3040 | Ga0496109_0032256 | |||
| 3041 | Ga0496109_0044210 | |||
| 3042 | Ga0496109_0064767 | |||
| 3043 | Ga0496109_0080620 | |||
| 3044 | Ga0496109_0083336 | |||
| 3045 | Ga0496109_0166118 | |||
| 3046 | Ga0496109_0185725 | |||
| 3047 | Ga0496109_0220819 | |||
| 3048 | Ga0496109_0255278 | |||
| 3049 | Ga0496109_0473632 | |||
| 3050 | Ga0496109_0478020 | |||
| 3051 | Ga0496109_0494366 | |||
| 3052 | Ga0496109_0663136 | |||
| 3053 | Ga0496110_0000072 | |||
| 3054 | Ga0496110_0004711 | |||
| 3055 | Ga0496110_0006848 | |||
| 3056 | Ga0496110_0009248 | |||
| 3057 | Ga0496110_0011742 | |||
| 3058 | Ga0496110_0016180 | |||
| 3059 | Ga0496110_0028108 | |||
| 3060 | Ga0496110_0080889 | |||
| 3061 | Ga0496110_0097611 | |||
| 3062 | Ga0496110_0131496 | |||
| 3063 | Ga0496110_0541663 | |||
| 3064 | Ga0496110_0583391 | |||
| 3065 | Ga0496110_0816806 | |||
| 3066 | Ga0496111_0001669 | |||
| 3067 | Ga0496111_0003404 | |||
| 3068 | Ga0496111_0009077 | |||
| 3069 | Ga0496111_0016303 | |||
| 3070 | Ga0496111_0047674 | |||
| 3071 | Ga0496111_0101301 | |||
| 3072 | Ga0496111_0119445 | |||
| 3073 | Ga0496111_0133472 | |||
| 3074 | Ga0496111_0152670 | |||
| 3075 | Ga0496111_0196071 | |||
| 3076 | Ga0496111_0280505 | |||
| 3077 | Ga0496111_0406941 | |||
| 3078 | Ga0496112_0000684 | |||
| 3079 | Ga0496112_0002604 | |||
| 3080 | Ga0496112_0005435 | |||
| 3081 | Ga0496112_0008124 | |||
| 3082 | Ga0496112_0033515 | |||
| 3083 | Ga0496112_0062620 | |||
| 3084 | Ga0496112_0341475 | |||
| 3085 | Ga0496112_0551344 | |||
| 3086 | Ga0496112_0700041 | |||
| 3087 | Ga0496113_0000076 | |||
| 3088 | Ga0496113_0000337 | |||
| 3089 | Ga0496113_0018937 | |||
| 3090 | Ga0496113_0018975 | |||
| 3091 | Ga0496113_0065474 | |||
| 3092 | Ga0496113_0291019 | |||
| 3093 | Ga0496114_0004595 | |||
| 3094 | Ga0496114_0017409 | |||
| 3095 | Ga0496114_0021228 | |||
| 3096 | Ga0496114_0021672 | |||
| 3097 | Ga0496114_0044100 | |||
| 3098 | Ga0496114_0046657 | |||
| 3099 | Ga0496114_0061063 | |||
| 3100 | Ga0496114_0075519 | |||
| 3101 | Ga0496114_0086255 | |||
| 3102 | Ga0496114_0093474 | |||
| 3103 | Ga0496114_0099991 | |||
| 3104 | Ga0496114_0125607 | |||
| 3105 | Ga0496114_0137945 | |||
| 3106 | Ga0496114_0159675 | |||
| 3107 | Ga0496114_0164189 | |||
| 3108 | Ga0496114_0228804 | |||
| 3109 | Ga0496114_0377730 | |||
| 3110 | Ga0496114_0378967 | |||
| 3111 | Ga0496114_0477456 | |||
| 3112 | Ga0496114_0515508 | |||
| 3113 | Ga0496114_0805605 | |||
| 3114 | Ga0496115_0000719 | |||
| 3115 | Ga0496115_0001259 | |||
| 3116 | Ga0496115_0001662 | |||
| 3117 | Ga0496115_0001827 | |||
| 3118 | Ga0496115_0007268 | |||
| 3119 | Ga0496115_0011828 | |||
| 3120 | Ga0496115_0018979 | |||
| 3121 | Ga0496115_0023795 | |||
| 3122 | Ga0496115_0061856 | |||
| 3123 | Ga0496115_0077714 | |||
| 3124 | Ga0496115_0107668 | |||
| 3125 | Ga0496115_0206482 | |||
| 3126 | Ga0496115_0218948 | |||
| 3127 | Ga0496115_0276782 | |||
| 3128 | Ga0496115_0389173 | |||
| 3129 | Ga0496115_0522745 | |||
| 3130 | Ga0496115_0918629 | |||
| 3131 | Ga0501031_0555509 | |||
| 3132 | Ga0501032_0008328 | |||
| 3133 | Ga0501032_0331679 | |||
| 3134 | Ga0501033_0066856 | |||
| 3135 | Ga0501033_0499633 | |||
| 3136 | Ga0501034_0130381 | |||
| 3137 | Ga0501034_0439928 | |||
| 3138 | Ga0501036_0014658 | |||
| 3139 | Ga0501036_0044139 | |||
| 3140 | Ga0501036_0082083 | |||
| 3141 | Ga0501036_0203390 | |||
| 3142 | Ga0501036_0536660 | |||
| 3143 | Ga0501036_0539987 | |||
| 3144 | Ga0501037_0035866 | |||
| 3145 | Ga0501037_0376702 | |||
| 3146 | Ga0501038_0033069 | |||
| 3147 | Ga0501038_0059269 | |||
| 3148 | Ga0501038_0088496 | |||
| 3149 | Ga0501038_0221520 | |||
| 3150 | Ga0501038_0323996 | |||
| 3151 | Ga0501038_0697942 | |||
| 3152 | Ga0501039_0003259 | |||
| 3153 | Ga0501039_0126905 | |||
| 3154 | Ga0501039_0185388 | |||
| 3155 | Ga0501039_0287545 | |||
| 3156 | Ga0501039_0531596 | |||
| 3157 | Ga0501040_0054456 | |||
| 3158 | Ga0501040_0194580 | |||
| 3159 | Ga0501040_0229908 | |||
| 3160 | Ga0501040_0376347 | |||
| 3161 | Ga0501041_0026401 | |||
| 3162 | Ga0501041_0042202 | |||
| 3163 | Ga0501041_0043876 | |||
| 3164 | Ga0501042_0047826 | |||
| 3165 | Ga0501042_0092004 | |||
| 3166 | Ga0501042_0136480 | |||
| 3167 | Ga0501042_0141523 | |||
| 3168 | Ga0501042_0245109 | |||
| 3169 | Ga0501042_0438902 | |||
| 3170 | Ga0501043_0033541 | |||
| 3171 | Ga0501043_0102568 | |||
| 3172 | Ga0501046_0063273 | |||
| 3173 | Ga0501046_0190891 | |||
| 3174 | Ga0501046_0297804 | |||
| 3175 | Ga0501047_0544175 | |||
| 3176 | Ga0501048_0006548 | |||
| 3177 | Ga0501048_0042780 | |||
| 3178 | Ga0501048_0045766 | |||
| 3179 | Ga0501048_0063766 | |||
| 3180 | Ga0501067_0004883 | |||
| 3181 | Ga0501067_0005212 | |||
| 3182 | Ga0501067_0010773 | |||
| 3183 | Ga0501067_0022805 | |||
| 3184 | Ga0501067_0363851 | |||
| 3185 | Ga0501068_0001390 | |||
| 3186 | Ga0501068_0005336 | |||
| 3187 | Ga0501068_0019697 | |||
| 3188 | Ga0501068_0049547 | |||
| 3189 | Ga0501068_0459237 | |||
| 3190 | Ga0501069_0000470 | |||
| 3191 | Ga0501069_0002995 | |||
| 3192 | Ga0501069_0010273 | |||
| 3193 | Ga0501069_0028372 | |||
| 3194 | Ga0501069_0028781 | |||
| 3195 | Ga0501069_0040377 | |||
| 3196 | Ga0501069_0047757 | |||
| 3197 | Ga0501070_0030738 | |||
| 3198 | Ga0501070_0044521 | |||
| 3199 | Ga0501070_0073182 | |||
| 3200 | Ga0501070_0088562 | |||
| 3201 | Ga0501071_0050788 | |||
| 3202 | Ga0501071_0071015 | |||
| 3203 | Ga0501071_0128483 | |||
| 3204 | Ga0501071_0296317 | |||
| 3205 | Ga0501071_0593328 | |||
| 3206 | Ga0501072_0002824 | |||
| 3207 | Ga0501072_0025295 | |||
| 3208 | Ga0501072_0143027 | |||
| 3209 | Ga0501072_0193200 | |||
| 3210 | Ga0501072_0307827 | |||
| 3211 | Ga0501072_0583698 | |||
| 3212 | Ga0501073_0005950 | |||
| 3213 | Ga0501073_0028698 | |||
| 3214 | Ga0501074_0345799 | |||
| 3215 | Ga0501075_0002854 | |||
| 3216 | Ga0501075_0007123 | |||
| 3217 | Ga0501075_0031937 | |||
| 3218 | Ga0501075_0096489 | |||
| 3219 | Ga0501075_0141996 | |||
| 3220 | Ga0501075_0216055 | |||
| 3221 | Ga0501075_0218019 | |||
| 3222 | Ga0501076_0007880 | |||
| 3223 | Ga0501076_0014673 | |||
| 3224 | Ga0501076_0069004 | |||
| 3225 | Ga0501076_0138495 | |||
| 3226 | Ga0501076_0258854 | |||
| 3227 | Ga0501076_0605929 | |||
| 3228 | Ga0501076_0689121 | |||
| 3229 | Ga0501077_0003598 | |||
| 3230 | Ga0501077_0004622 | |||
| 3231 | Ga0501077_0023897 | |||
| 3232 | Ga0501079_0011587 | |||
| 3233 | Ga0501079_0045730 | |||
| 3234 | Ga0501079_0092391 | |||
| 3235 | Ga0501079_0169654 | |||
| 3236 | Ga0501079_0532306 | |||
| 3237 | Ga0501080_0093613 | |||
| 3238 | Ga0501080_0102866 | |||
| 3239 | Ga0501080_0171437 | |||
| 3240 | Ga0501080_0244416 | |||
| 3241 | Ga0501081_0027422 | |||
| 3242 | Ga0501081_0045929 | |||
| 3243 | Ga0501081_0170440 | |||
| 3244 | Ga0501081_0240652 | |||
| 3245 | Ga0501081_0555829 | |||
| 3246 | Ga0501081_0560939 | |||
| 3247 | Ga0501083_0069609 | |||
| 3248 | Ga0501083_0428673 | |||
| 3249 | Ga0501035_0051074 | |||
| 3250 | Ga0501035_0128834 | |||
| 3251 | Ga0501044_0012250 | |||
| 3252 | Ga0501044_0118900 | |||
| 3253 | Ga0501044_0170265 | |||
| 3254 | Ga0501045_0016656 | |||
| 3255 | Ga0501045_0026095 | |||
| 3256 | Ga0501045_0131086 | |||
| 3257 | Ga0501045_0250076 | |||
| 3258 | Ga0501045_0273864 | |||
| 3259 | nmdc:mga00v17_12668_c1 | |||
| 3260 | nmdc:mga00v17_157302_c1 | |||
| 3261 | nmdc:mga00v17_170753_c1 | |||
| 3262 | nmdc:mga0yw44_102161_c1 | |||
| 3263 | nmdc:mga0yw44_437603_c1 | |||
| 3264 | nmdc:mga06z11_288636_c1 | |||
| 3265 | nmdc:mga06z11_396647_c1 | |||
| 3266 | nmdc:mga05p37_137064_c1 | |||
| 3267 | nmdc:mga05p37_362703_c1 | |||
| 3268 | nmdc:mga05p37_55696_c1 | |||
| 3269 | nmdc:mga05p37_581011_c1 | |||
| 3270 | nmdc:mga05p37_8342_c1 | |||
| 3271 | nmdc:mga05p37_86010_c1 | |||
| 3272 | nmdc:mga09592_31239_c1 | |||
| 3273 | nmdc:mga09592_321574_c1 | |||
| 3274 | nmdc:mga09592_93516_c1 | |||
| 3275 | nmdc:mga0qj67_19618_c1 | |||
| 3276 | nmdc:mga06r32_130564_c1 | |||
| 3277 | nmdc:mga06r32_82451_c1 | |||
| 3278 | nmdc:mga08y16_164117_c1 | |||
| 3279 | nmdc:mga08y16_20510_c1 | |||
| 3280 | nmdc:mga08y16_44827_c1 | |||
| 3281 | nmdc:mga08y16_48252_c1 | |||
| 3282 | nmdc:mga08y16_54622_c1 | |||
| 3283 | nmdc:mga08y16_604287_c1 | |||
| 3284 | nmdc:mga08y16_660968_c1 | |||
| 3285 | nmdc:mga08y16_81858_c1 | |||
| 3286 | nmdc:mga0n895_156774_c1 | |||
| 3287 | nmdc:mga0n895_18573_c1 | |||
| 3288 | nmdc:mga0n895_313511_c1 | |||
| 3289 | nmdc:mga0n895_34097_c1 | |||
| 3290 | nmdc:mga0n895_343713_c1 | |||
| 3291 | nmdc:mga0n895_35345_c1 | |||
| 3292 | nmdc:mga0n895_44306_c1 | |||
| 3293 | nmdc:mga0n895_4522_c1 | |||
| 3294 | nmdc:mga0n895_566713_c1 | |||
| 3295 | nmdc:mga0n895_584299_c1 | |||
| 3296 | nmdc:mga0n895_637339_c1 | |||
| 3297 | nmdc:mga0n895_966105_c1 | |||
| 3298 | nmdc:mga0rr50_12864_c1 | |||
| 3299 | nmdc:mga0rr50_159064_c1 | |||
| 3300 | nmdc:mga0rr50_1603_c1 | |||
| 3301 | nmdc:mga0rr50_2621_c1 | |||
| 3302 | nmdc:mga0rr50_285989_c1 | |||
| 3303 | nmdc:mga0rr50_402333_c1 | |||
| 3304 | nmdc:mga0rr50_42678_c1 | |||
| 3305 | nmdc:mga0rr50_567094_c1 | |||
| 3306 | nmdc:mga0rr50_5699_c1 | |||
| 3307 | nmdc:mga0rr50_597306_c1 | |||
| 3308 | nmdc:mga0rr50_714807_c1 | |||
| 3309 | nmdc:mga0rr50_7541_c1 | |||
| 3310 | nmdc:mga0rr50_75521_c1 | |||
| 3311 | nmdc:mga08x19_114908_c1 | |||
| 3312 | nmdc:mga08x19_201257_c1 | |||
| 3313 | nmdc:mga08x19_37222_c1 | |||
| 3314 | nmdc:mga08x19_4916_c1 | |||
| 3315 | nmdc:mga08x19_59414_c1 | |||
| 3316 | nmdc:mga08x19_89056_c1 | |||
| 3317 | nmdc:mga08x19_94200_c1 | |||
| 3318 | nmdc:mga0a205_121578_c1 | |||
| 3319 | nmdc:mga0a205_12370_c1 | |||
| 3320 | nmdc:mga0a205_124485_c1 | |||
| 3321 | nmdc:mga0a205_147841_c1 | |||
| 3322 | nmdc:mga0a205_198981_c1 | |||
| 3323 | nmdc:mga0a205_21940_c1 | |||
| 3324 | nmdc:mga0a205_48133_c1 | |||
| 3325 | nmdc:mga0a205_621551_c1 | |||
| 3326 | nmdc:mga0a205_636720_c1 | |||
| 3327 | nmdc:mga0a205_642345_c1 | |||
| 3328 | nmdc:mga0a205_86140_c1 | |||
| 3329 | Ga0495601_0008919 | |||
| 3330 | Ga0495601_0016720 | |||
| 3331 | Ga0495601_0026644 | |||
| 3332 | Ga0495601_0077562 | |||
| 3333 | Ga0495601_0086752 | |||
| 3334 | Ga0495601_0184735 | |||
| 3335 | Ga0495601_0197870 | |||
| 3336 | Ga0495601_0213992 | |||
| 3337 | Ga0495601_0407533 | |||
| 3338 | Ga0495612_0006485 | |||
| 3339 | Ga0495612_0015873 | |||
| 3340 | Ga0495612_0057381 | |||
| 3341 | Ga0495612_0058045 | |||
| 3342 | Ga0495612_0106611 | |||
| 3343 | Ga0495655_0094649 | |||
| 3344 | Ga0495595_0017315 | |||
| 3345 | Ga0495595_0045006 | |||
| 3346 | Ga0495595_0049129 | |||
| 3347 | Ga0495595_0061153 | |||
| 3348 | Ga0495619_0002453 | |||
| 3349 | Ga0495619_0079924 | |||
| 3350 | Ga0495619_0101937 | |||
| 3351 | Ga0495619_0205893 | |||
| 3352 | Ga0495619_0217454 | |||
| 3353 | Ga0495619_0726657 | |||
| 3354 | Ga0501084_0022478 | |||
| 3355 | Ga0501084_0102219 | |||
| 3356 | Ga0501084_0200778 | |||
| 3357 | Ga0501084_0719135 | |||
| 3358 | Ga0501082_0003529 | |||
| 3359 | Ga0501082_0082420 | |||
| 3360 | Ga0501082_0142314 | |||
| 3361 | Ga0501082_0428303 | |||
| 3362 | Ga0501082_0694651 | |||
| 3363 | Ga0466962_0052704 | |||
| 3364 | Ga0530510_0002635 | |||
| 3365 | Ga0530510_0069616 | |||
| 3366 | Ga0530510_0096834 | |||
| 3367 | Ga0530510_0099375 | |||
| 3368 | Ga0530510_0130250 | |||
| 3369 | Ga0530510_0157434 | |||
| 3370 | Ga0530510_0409752 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2avp-assembly1.cif.gz_A | crystal structure of an 8 repeat consensus tpr superhelix | 0.9194 | 121 | 187 |
| 1na3-assembly2.cif.gz_B | design of stable alpha-helical arrays from an idealized tpr motif | 0.904 | 120 | 190 |
| 5a31-assembly1.cif.gz_J | structure of the human apc-cdh1-hsl1-ubch10 complex. | 0.899 | 123 | 186 |
| 4ui9-assembly1.cif.gz_J | atomic structure of the human anaphase-promoting complex | 0.899 | 123 | 186 |
| 1na3-assembly1.cif.gz_A | design of stable alpha-helical arrays from an idealized tpr motif | 0.8982 | 120 | 190 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6H657_109_266_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.943 | 123 | 186 | 1.25.40.10 |
| af_G3UYY4_1785_1856_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9381 | 120 | 184 | 1.25.40.10 |
| af_Q86TZ1_442_519_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9336 | 119 | 184 | 1.25.40.10 |
| af_A4I5Y0_716_784_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9318 | 121 | 186 | 1.25.40.10 |
| af_Q4DHE6_84_178_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9306 | 121 | 184 | 1.25.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538ICF3-F1-model_v4 | Cupin domain-containing protein | 0.968 | 25 | 205 |
|
| AF-A0A538ICF3-F1-model_v4 | Cupin domain-containing protein | 0.9526 | 25 | 205 |
|
| AF-A0A7W0T7X3-F1-model_v4 | Cupin domain-containing protein | 0.9421 | 21 | 117 |
|
| AF-A0A7W0SUB2-F1-model_v4 | Cupin domain-containing protein | 0.9347 | 1 | 212 |
|
| AF-A0A1F2ST92-F1-model_v4 | Uncharacterized protein | 0.9189 | 120 | 212 |
|