F495362

General Info

Members Datasets Scaffolds Average Seq Length
1692 681 1505 444

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8047710418|8047719884
Length 496
Sequence NQANAADKAYEESLGGGTRTESVSDASTGTDTSAAGSDSRDADARAGDARADEASTIAAGPSVDVADSRQTTEGTVYTVTGGDWDEVLADAAGDERIVMNLGPQHPSTHGVLRLVLELEGESVTQARSVIGYLHTGIEKNLEYRNWTQGVTFVTRMDYLAPLHNEAAYCMSVEKLLGVEVPQRAQVIRVLLMELNRISSHLVALATGGMELGALTGMTAGFREREEVLHLLEHLTGLRMNHAFIRPGGVAQDLPADAVEKIRSFLKIMDKRLPDYDKLLTGQPIWRNRLAGVGYLPVDACLALGITGPILRSAGLPWDLRKVEPYSGYETYDFDVPTSNAADSFARYLMRVEEIHQSLRLVRQAVDRLEPGPVMVEDAKIAWPAQLTIGSDGMGNSLEHVRKIMGQSMESLIHHFKLVTEGFDVPAGQVYVPIESPRGELGYHVVSDGGTRPFRVHVREPSFVNLQSMPAMCEGGMVADVIASVASIDPVMGGCDR

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2506783011 Frankia datiscae Dg1 Isolate Nodule
3 2508501039 Frankia saprophytica CN3 Isolate Nodule
4 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
5 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
6 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
7 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
8 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
9 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
10 2517572101 Frankia sp. DC12 Isolate Nodule
11 2527291627 Frankia casuarinae Thr Isolate Nodule
12 2527291629 Frankia sp. BMG5.23 Isolate Nodule
13 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
14 2547132424 Nocardia nova SH22a Isolate Unclassified
15 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
16 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
17 2558860280 Kutzneria sp. 744 Isolate Unclassified
18 2576861822 Frankia sp. CeD Isolate Nodule
19 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
20 2582580736 Prauserella sp. Am3 Isolate Unclassified
21 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
22 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
23 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
24 2619618881 Frankia sp. ACN1ag Isolate Unclassified
25 2619619003 Frankia sp. CpI1-P Isolate Nodule
26 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
27 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
28 2626541554 Frankia sp. AvcI.1 Isolate Nodule
29 2643221578 Streptomyces sp. Root63 Isolate Unclassified
30 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
31 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
32 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
33 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
34 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
35 2643221692 Nocardia sp. Root136 Isolate Unclassified
36 2643221714 Streptomyces sp. Root264 Isolate Unclassified
37 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
38 2671180195 Frankia sp. CcI49 Isolate Nodule
39 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
40 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
41 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
42 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
43 2684623036 Frankia sp. CgIM4 Isolate Nodule
44 2687453737 Frankia sp. BMG5.36 Isolate Nodule
45 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
46 2710264753 Frankia sp. KB5 Isolate Nodule
47 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
48 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
49 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
50 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
51 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
52 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
53 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
54 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
55 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
56 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
57 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
58 2773857922 Frankia sp. CcI49 Isolate Nodule
59 2773857924 Frankia sp. CgIS1 Isolate Nodule
60 2773857933 Frankia sp. BMG5.30 Isolate Nodule
61 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
62 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
63 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
64 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
65 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
66 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
67 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
68 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
69 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
70 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
71 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
72 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
73 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
74 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
75 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
76 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
77 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
78 2855683550 Micromonospora sp. RP3T Isolate Unclassified
79 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
80 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
81 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
82 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
83 2858868258 Micromonospora sp. MH33 Isolate Unclassified
84 2858882152 Micromonospora noduli MED15 Isolate Nodule
85 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
86 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
87 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
88 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
89 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
90 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
91 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
92 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
93 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
94 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
95 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
96 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
97 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
98 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
99 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
100 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
101 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
102 2867369537 Streptomyces sp. Z26 Isolate Unclassified
103 2867475112 Streptomyces sp. TM32 Isolate Unclassified
104 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
105 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
106 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
107 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
108 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
109 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
110 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
111 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
112 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
113 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
114 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
115 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
116 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
117 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
118 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
119 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
120 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
121 2891562705 Microbispora tritici MT50 Isolate Unclassified
122 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
123 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
124 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
125 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
126 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
127 2902582711 Micromonospora sp. AP08 Isolate Unclassified
128 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
129 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
130 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
131 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
132 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
133 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
134 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
135 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
136 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
137 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
138 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
139 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
140 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
141 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
142 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
143 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
144 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
145 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
146 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
147 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
148 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
149 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
150 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
151 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
152 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
153 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
154 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
155 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
156 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
157 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
158 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
159 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
160 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
161 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
162 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
163 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
164 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
165 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
166 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
167 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
168 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
169 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
170 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
171 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
172 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
173 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
174 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
175 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
176 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
177 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
178 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
179 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
180 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
181 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
182 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
183 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
184 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
185 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
186 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
187 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
188 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
189 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
190 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
191 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
192 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
193 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
194 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
195 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
196 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
197 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
198 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
199 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
200 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
201 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
202 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
203 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
204 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
205 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
206 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
207 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
208 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
209 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
210 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
211 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
212 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
213 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
214 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
215 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
216 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
217 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
218 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
219 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
220 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
221 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
222 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
223 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
224 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
225 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
226 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
227 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
228 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
229 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
230 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
231 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
232 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
233 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
234 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
235 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
236 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
237 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
238 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
239 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
240 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
241 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
242 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
243 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
244 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
245 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
246 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
247 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
248 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
249 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
250 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
251 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
252 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
253 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
254 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
255 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
256 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
257 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
258 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
259 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
260 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
261 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
262 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
263 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
264 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
265 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
266 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
267 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
268 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
269 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
270 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
271 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
272 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
273 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
274 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
275 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
276 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
277 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
278 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
279 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
280 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
281 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
282 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
283 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
284 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
285 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
286 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
287 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
288 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
289 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
290 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
291 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
292 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
293 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
294 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
295 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
296 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
297 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
298 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
299 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
300 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
301 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
302 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
303 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
304 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
305 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
306 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
308 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
309 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
310 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
311 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
312 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
313 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
314 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
315 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
378 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
381 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
385 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
386 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
387 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
388 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
389 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
390 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
391 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
392 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
393 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
394 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
395 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
396 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
397 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
398 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
399 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
400 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
401 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
402 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
403 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
404 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
405 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
406 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
407 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
408 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
409 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
410 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
411 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
412 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
413 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
414 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
415 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
416 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
418 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
419 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
420 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
421 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
422 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
423 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
424 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
425 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
426 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
427 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
428 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
429 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
430 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
431 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
432 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
433 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
434 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
435 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
436 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
437 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
438 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
439 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
440 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
441 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
442 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
443 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
444 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
445 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
446 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
448 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
449 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
450 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
451 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
452 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
453 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
454 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
455 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
456 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
457 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
458 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
459 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
460 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
461 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
462 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
463 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
464 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
465 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
466 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
467 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
468 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
469 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
470 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
471 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
472 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
473 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
474 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
475 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
476 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
477 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
478 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
479 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
480 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
481 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
482 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
483 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
484 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
485 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
486 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
487 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
488 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
489 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
490 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
491 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
492 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
493 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
494 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
495 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
496 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
497 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
498 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
499 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
500 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
501 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
502 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
503 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
504 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
505 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
506 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
507 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
508 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
509 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
510 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
511 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
512 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
513 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
514 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
515 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
516 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
517 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
518 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
519 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
520 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
521 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
522 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
523 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
524 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
525 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
526 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
527 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
528 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
529 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
530 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
531 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
532 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
533 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
534 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
535 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
536 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
537 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
538 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
539 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
540 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
541 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
542 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
543 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
544 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
545 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
546 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
547 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
548 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
549 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
550 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
551 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
552 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
553 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
554 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
555 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
556 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
557 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
558 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
559 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
560 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
561 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
562 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
563 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
564 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
565 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
566 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
567 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
568 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
569 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
570 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
571 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
572 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
573 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
574 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
575 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
576 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
577 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
578 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
579 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
580 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
581 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
582 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
583 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
584 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
585 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
586 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
587 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
588 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
589 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
590 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
591 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
592 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
593 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
594 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
595 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
596 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
597 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
598 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
599 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
600 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
601 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
602 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
603 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
604 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
605 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
606 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
607 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
608 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
609 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
610 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
611 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
612 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
613 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
614 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
615 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
616 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
617 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
618 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
619 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
620 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
621 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
622 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
623 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
624 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
625 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
626 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
627 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
628 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
629 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
630 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
631 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
632 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
633 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
634 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
635 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
636 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
637 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
638 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
639 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
640 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
641 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
642 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
643 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
644 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
645 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
646 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
647 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
648 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
649 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
650 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
651 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
652 637000116 Frankia casuarinae CcI3 Isolate Nodule
653 649633069 Micromonospora sp. L5 Isolate Unclassified
654 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
655 8002775197 Frankia nepalensis CN7 Isolate Nodule
656 8002784119 Frankia sp. AgB1.9 Isolate Nodule
657 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
658 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
659 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
660 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
661 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
662 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
663 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
664 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
665 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
666 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
667 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
668 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
669 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
670 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
671 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
672 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
673 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
674 8054920844 Frankia tisae Agncl-8 Isolate Nodule
675 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
676 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
677 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
678 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
679 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
680 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
681 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.53
Metatranscriptomes 1.48
Isolates 10.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.55
Nodule 1.95
Rhizoplane 6.68
Rhizosphere 75.3
Stem 0
Stem Tuber 0.12
Unclassified 12.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1007077 3300000549 Bacteria 1384
2 JGI24752J21851_1003471 3300001976 Bacteria 2073
3 JGI24737J22298_10019288 3300001990 Bacteria 2182
4 JGI24743J22301_10007272 3300001991 Bacteria 1915
5 JGI24735J21928_10011371 3300002067 Bacteria 2825
6 JGI24745J21846_1003962 3300002073 Bacteria 1568
7 JGI24738J21930_10014650 3300002075 Bacteria 1680
8 JGI24744J21845_10000088 3300002077 Bacteria 11973
9 JGI24744J21845_10001304 3300002077 Bacteria 4925
10 JGI24742J22300_10000442 3300002244 Bacteria 6102
11 JGI24751J29686_10005336 3300002459 Bacteria 2616
12 JGI24751J29686_10016334 3300002459 Bacteria 1531
13 JGI25406J46586_10001934 3300003203 Bacteria 9774
14 JGI25406J46586_10015066 3300003203 Bacteria 3270
15 JGI25406J46586_10021225 3300003203 Bacteria 2610
16 JGI25160J50197_1021813 3300003354 Bacteria 1892
17 JGI25404J52841_10000389 3300003659 Bacteria 6058
18 Ga0055540_1000003 3300003792 Bacteria 428375
19 Ga0055540_1011637 3300003792 Bacteria 2819
20 Ga0070658_10000319 3300005327 Bacteria 41203
21 Ga0070658_10000776 3300005327 Bacteria 27421
22 Ga0070658_10010607 3300005327 Bacteria 7382
23 Ga0070658_10027200 3300005327 Bacteria 4592
24 Ga0070658_10045247 3300005327 Bacteria 3559
25 Ga0070676_10011568 3300005328 Bacteria 4800
26 Ga0070683_100017452 3300005329 Bacteria 6344
27 Ga0070683_100025549 3300005329 Bacteria 5306
28 Ga0070683_100074305 3300005329 Bacteria 3175
29 Ga0070683_100110779 3300005329 Bacteria 2589
30 Ga0070683_100151142 3300005329 Bacteria 2201
31 Ga0070690_100021350 3300005330 Bacteria 3952
32 Ga0070670_100046760 3300005331 Bacteria 3722
33 Ga0070670_100065296 3300005331 Bacteria 3123
34 Ga0068869_100001172 3300005334 Bacteria 15378
35 Ga0068869_100003836 3300005334 Bacteria 9270
36 Ga0068869_100015543 3300005334 Bacteria 5109
37 Ga0068869_100041488 3300005334 Bacteria 3296
38 Ga0068869_100086618 3300005334 Bacteria 2348
39 Ga0068869_100097501 3300005334 Bacteria 2220
40 Ga0070666_10017287 3300005335 Bacteria 4622
41 Ga0070666_10038699 3300005335 Bacteria 3174
42 Ga0070666_10076122 3300005335 Bacteria 2289
43 Ga0070680_100000061 3300005336 Bacteria 56357
44 Ga0070680_100000142 3300005336 Bacteria 43698
45 Ga0070682_100013085 3300005337 Bacteria 4767
46 Ga0070682_100015617 3300005337 Bacteria 4403
47 Ga0070682_100024558 3300005337 Bacteria 3588
48 Ga0070682_100034343 3300005337 Bacteria 3088
49 Ga0068868_100001480 3300005338 Bacteria 16204
50 Ga0068868_100016132 3300005338 Bacteria 5541
51 Ga0068868_100044260 3300005338 Bacteria 3480
52 Ga0068868_100052582 3300005338 Bacteria 3207
53 Ga0068868_100093418 3300005338 Bacteria 2426
54 Ga0068868_100095458 3300005338 Bacteria 2400
55 Ga0068868_100125388 3300005338 Bacteria 2097
56 Ga0070660_100009555 3300005339 Bacteria 6828
57 Ga0070660_100056785 3300005339 Bacteria 3030
58 Ga0070660_100093165 3300005339 Bacteria 2378
59 Ga0070689_100025866 3300005340 Bacteria 4412
60 Ga0070689_100026796 3300005340 Bacteria 4342
61 Ga0070691_10004160 3300005341 Bacteria 6570
62 Ga0070691_10056891 3300005341 Bacteria 1876
63 Ga0070687_100010502 3300005343 Bacteria 4007
64 Ga0070687_100066214 3300005343 Bacteria 1924
65 Ga0070661_100038413 3300005344 Bacteria 3485
66 Ga0070692_10010462 3300005345 Bacteria 4222
67 Ga0070692_10027337 3300005345 Bacteria 2827
68 Ga0070692_10038183 3300005345 Bacteria 2446
69 Ga0070668_100001192 3300005347 Bacteria 18433
70 Ga0070668_100001297 3300005347 Bacteria 17872
71 Ga0070668_100024803 3300005347 Bacteria 4545
72 Ga0070668_100030442 3300005347 Bacteria 4103
73 Ga0070668_100046862 3300005347 Bacteria 3322
74 Ga0070669_100004569 3300005353 Bacteria 9993
75 Ga0070669_100022235 3300005353 Bacteria 4535
76 Ga0070675_100000392 3300005354 Bacteria 29617
77 Ga0070675_100010873 3300005354 Bacteria 7118
78 Ga0070671_100001259 3300005355 Bacteria 18984
79 Ga0070671_100001780 3300005355 Bacteria 16356
80 Ga0070674_100000187 3300005356 Bacteria 29321
81 Ga0070674_100123412 3300005356 Bacteria 1920
82 Ga0070673_100022227 3300005364 Bacteria 4614
83 Ga0070673_100245360 3300005364 Bacteria 1559
84 Ga0070688_100057304 3300005365 Bacteria 2449
85 Ga0070659_100023288 3300005366 Bacteria 4738
86 Ga0070659_100032701 3300005366 Bacteria 4036
87 Ga0070659_100054109 3300005366 Bacteria 3161
88 Ga0070659_100107419 3300005366 Bacteria 2250
89 Ga0070667_100000056 3300005367 Bacteria 150952
90 Ga0070667_100000854 3300005367 Bacteria 28370
91 Ga0070667_100003985 3300005367 Bacteria 12518
92 Ga0070667_100012230 3300005367 Bacteria 7100
93 Ga0070667_100051103 3300005367 Bacteria 3484
94 Ga0070667_100134697 3300005367 Bacteria 2159
95 Ga0070703_10009742 3300005406 Bacteria 2710
96 Ga0070709_10045596 3300005434 Bacteria 2721
97 Ga0070714_100000011 3300005435 Bacteria 231268
98 Ga0070714_100006750 3300005435 Bacteria 8894
99 Ga0070714_100086997 3300005435 Bacteria 2732
100 Ga0070714_100110626 3300005435 Bacteria 2432
101 Ga0070714_100163353 3300005435 Bacteria 2016
102 Ga0070713_100003953 3300005436 Bacteria 9851
103 Ga0070713_100106097 3300005436 Bacteria 2442
104 Ga0070713_100152745 3300005436 Bacteria 2055
105 Ga0070710_10000264 3300005437 Bacteria 24986
106 Ga0070710_10000277 3300005437 Bacteria 24255
107 Ga0070701_10000584 3300005438 Bacteria 12705
108 Ga0070701_10003695 3300005438 Bacteria 6104
109 Ga0070711_100000493 3300005439 Bacteria 20558
110 Ga0070711_100154332 3300005439 Bacteria 1734
111 Ga0070705_100004099 3300005440 Bacteria 7115
112 Ga0070700_100000046 3300005441 Bacteria 91380
113 Ga0070700_100003730 3300005441 Bacteria 7875
114 Ga0070700_100005557 3300005441 Bacteria 6683
115 Ga0070700_100026657 3300005441 Bacteria 3417
116 Ga0070700_100090058 3300005441 Bacteria 2000
117 Ga0070694_100024042 3300005444 Bacteria 3929
118 Ga0070708_100000671 3300005445 Bacteria 26000
119 Ga0070708_100008205 3300005445 Bacteria 8381
120 Ga0070663_100015215 3300005455 Bacteria 4959
121 Ga0070663_100046120 3300005455 Bacteria 3082
122 Ga0070663_100065685 3300005455 Bacteria 2627
123 Ga0070678_100000280 3300005456 Bacteria 23679
124 Ga0070678_100059459 3300005456 Bacteria 2809
125 Ga0070662_100001491 3300005457 Bacteria 14399
126 Ga0070681_10000077 3300005458 Bacteria 72675
127 Ga0070681_10001025 3300005458 Bacteria 23693
128 Ga0070681_10071491 3300005458 Bacteria 3434
129 Ga0068867_100002048 3300005459 Bacteria 14123
130 Ga0068867_100003687 3300005459 Bacteria 10780
131 Ga0070685_10018850 3300005466 Bacteria 3717
132 Ga0070706_100009403 3300005467 Bacteria 9102
133 Ga0070706_100021841 3300005467 Bacteria 5894
134 Ga0070706_100028028 3300005467 Bacteria 5182
135 Ga0070706_100066875 3300005467 Bacteria 3324
136 Ga0070706_100085150 3300005467 Bacteria 2929
137 Ga0070706_100167265 3300005467 Bacteria 2053
138 Ga0070707_100001912 3300005468 Bacteria 19958
139 Ga0070707_100180704 3300005468 Bacteria 2056
140 Ga0070698_100008833 3300005471 Bacteria 10839
141 Ga0070698_100045276 3300005471 Bacteria 4504
142 Ga0070698_100053032 3300005471 Bacteria 4122
143 Ga0070679_100000135 3300005530 Bacteria 59584
144 Ga0070679_100001551 3300005530 Bacteria 20538
145 Ga0070679_100040221 3300005530 Bacteria 4651
146 Ga0070679_100067837 3300005530 Bacteria 3558
147 Ga0070679_100167285 3300005530 Bacteria 2172
148 Ga0070684_100003821 3300005535 Bacteria 11391
149 Ga0070684_100088166 3300005535 Bacteria 2756
150 Ga0070697_100002048 3300005536 Bacteria 15439
151 Ga0068853_100001367 3300005539 Bacteria 17604
152 Ga0068853_100017068 3300005539 Bacteria 5987
153 Ga0068853_100044645 3300005539 Bacteria 3794
154 Ga0070672_100003670 3300005543 Bacteria 9972
155 Ga0070695_100021815 3300005545 Bacteria 3924
156 Ga0070695_100036124 3300005545 Bacteria 3108
157 Ga0070696_100002977 3300005546 Bacteria 11251
158 Ga0070696_100030003 3300005546 Bacteria 3720
159 Ga0070693_100009341 3300005547 Bacteria 4874
160 Ga0070665_100001617 3300005548 Bacteria 25940
161 Ga0070665_100006813 3300005548 Bacteria 11618
162 Ga0070665_100056517 3300005548 Bacteria 3934
163 Ga0070665_100075774 3300005548 Bacteria 3371
164 Ga0070665_100113871 3300005548 Bacteria 2708
165 Ga0070665_100160653 3300005548 Bacteria 2249
166 Ga0070704_100001052 3300005549 Bacteria 14260
167 Ga0070704_100129626 3300005549 Bacteria 1952
168 Ga0068855_100010555 3300005563 Bacteria 11138
169 Ga0068855_100038437 3300005563 Bacteria 5687
170 Ga0068855_100050888 3300005563 Bacteria 4880
171 Ga0070664_100020153 3300005564 Bacteria 5491
172 Ga0070664_100031931 3300005564 Bacteria 4404
173 Ga0068857_100033853 3300005577 Bacteria 4519
174 Ga0068857_100057168 3300005577 Bacteria 3462
175 Ga0068854_100000458 3300005578 Bacteria 25182
176 Ga0068854_100069551 3300005578 Bacteria 2570
177 Ga0068856_100023376 3300005614 Bacteria 6009
178 Ga0068856_100068491 3300005614 Bacteria 3508
179 Ga0068856_100077717 3300005614 Bacteria 3289
180 Ga0068856_100081444 3300005614 Bacteria 3211
181 Ga0068856_100093039 3300005614 Bacteria 3000
182 Ga0068856_100139694 3300005614 Bacteria 2429
183 Ga0070702_100000308 3300005615 Bacteria 16864
184 Ga0070702_100016071 3300005615 Bacteria 3833
185 Ga0068852_100020000 3300005616 Bacteria 5315
186 Ga0068852_100046729 3300005616 Bacteria 3690
187 Ga0068859_100000596 3300005617 Bacteria 36034
188 Ga0068859_100000751 3300005617 Bacteria 32654
189 Ga0068859_100061973 3300005617 Bacteria 3769
190 Ga0068859_100064675 3300005617 Bacteria 3690
191 Ga0068859_100245302 3300005617 Bacteria 1881
192 Ga0068864_100010645 3300005618 Bacteria 7603
193 Ga0068864_100049976 3300005618 Bacteria 3598
194 Ga0068864_100143695 3300005618 Bacteria 2154
195 Ga0068866_10000187 3300005718 Bacteria 29090
196 Ga0068866_10039686 3300005718 Bacteria 2326
197 Ga0068866_10066629 3300005718 Bacteria 1888
198 Ga0068861_100000195 3300005719 Bacteria 32550
199 Ga0068861_100009645 3300005719 Bacteria 6669
200 Ga0068851_10044148 3300005834 Bacteria 2249
201 Ga0068863_100000345 3300005841 Bacteria 47228
202 Ga0068863_100001182 3300005841 Bacteria 26109
203 Ga0068863_100002092 3300005841 Bacteria 19783
204 Ga0068863_100009630 3300005841 Bacteria 9424
205 Ga0068863_100009994 3300005841 Bacteria 9236
206 Ga0068863_100014417 3300005841 Bacteria 7614
207 Ga0068863_100066840 3300005841 Bacteria 3400
208 Ga0068863_100076174 3300005841 Bacteria 3174
209 Ga0068863_100115358 3300005841 Bacteria 2559
210 Ga0068863_100249428 3300005841 Bacteria 1714
211 Ga0068858_100000010 3300005842 Bacteria 234748
212 Ga0068858_100000013 3300005842 Bacteria 216466
213 Ga0068858_100013843 3300005842 Bacteria 7610
214 Ga0068858_100047379 3300005842 Bacteria 3985
215 Ga0068858_100068586 3300005842 Bacteria 3286
216 Ga0068858_100070309 3300005842 Bacteria 3244
217 Ga0068858_100102867 3300005842 Bacteria 2664
218 Ga0068860_100000054 3300005843 Bacteria 206114
219 Ga0068860_100000092 3300005843 Bacteria 150190
220 Ga0068860_100001932 3300005843 Bacteria 21940
221 Ga0068860_100122269 3300005843 Bacteria 2493
222 Ga0068860_100184455 3300005843 Bacteria 2017
223 Ga0068860_100187925 3300005843 Bacteria 1998
224 Ga0068862_100000035 3300005844 Bacteria 174953
225 Ga0068862_100000358 3300005844 Bacteria 49480
226 Ga0068862_100033018 3300005844 Bacteria 4372
227 Ga0068862_100036238 3300005844 Bacteria 4181
228 Ga0081455_10000071 3300005937 Bacteria 110373
229 Ga0081455_10000262 3300005937 Bacteria 69313
230 Ga0081455_10001346 3300005937 Bacteria 30424
231 Ga0081455_10015182 3300005937 Bacteria 7494
232 Ga0081455_10015517 3300005937 Bacteria 7396
233 Ga0081455_10015911 3300005937 Bacteria 7282
234 Ga0081538_10000050 3300005981 Bacteria 110501
235 Ga0081538_10022725 3300005981 Bacteria 4534
236 Ga0081538_10070670 3300005981 Bacteria 1926
237 Ga0081540_1000522 3300005983 Bacteria 37453
238 Ga0081540_1000903 3300005983 Bacteria 26812
239 Ga0081540_1000912 3300005983 Bacteria 26643
240 Ga0081540_1002205 3300005983 Bacteria 16090
241 Ga0081540_1015235 3300005983 Bacteria 4874
242 Ga0081540_1028790 3300005983 Bacteria 3109
243 Ga0081539_10000086 3300005985 Bacteria 217801
244 Ga0081539_10000763 3300005985 Bacteria 63498
245 Ga0081539_10003492 3300005985 Bacteria 19204
246 Ga0081539_10004406 3300005985 Bacteria 15592
247 Ga0081539_10005222 3300005985 Bacteria 13439
248 Ga0081539_10010250 3300005985 Bacteria 7655
249 Ga0081539_10036577 3300005985 Bacteria 2937
250 Ga0081539_10044321 3300005985 Bacteria 2569
251 Ga0081539_10072764 3300005985 Bacteria 1836
252 Ga0070717_10040433 3300006028 Bacteria 3798
253 Ga0070717_10049357 3300006028 Bacteria 3455
254 Ga0070717_10161596 3300006028 Bacteria 1943
255 Ga0075365_10031640 3300006038 Bacteria 3395
256 Ga0075365_10040457 3300006038 Bacteria 3040
257 Ga0075365_10072687 3300006038 Bacteria 2317
258 Ga0075363_100019672 3300006048 Bacteria 3378
259 Ga0075363_100040686 3300006048 Bacteria 2450
260 Ga0075363_100058072 3300006048 Bacteria 2078
261 Ga0075364_10001965 3300006051 Bacteria 11452
262 Ga0075364_10003691 3300006051 Bacteria 8739
263 Ga0075364_10017939 3300006051 Bacteria 4426
264 Ga0075364_10051014 3300006051 Bacteria 2701
265 Ga0070715_10005907 3300006163 Bacteria 4123
266 Ga0070716_100007171 3300006173 Bacteria 5480
267 Ga0070716_100025356 3300006173 Bacteria 3163
268 Ga0070716_100116427 3300006173 Bacteria 1665
269 Ga0070712_100001061 3300006175 Bacteria 16610
270 Ga0070712_100009444 3300006175 Bacteria 6146
271 Ga0070712_100110988 3300006175 Bacteria 2046
272 Ga0075362_10021385 3300006177 Bacteria 2714
273 Ga0075369_10002244 3300006186 Bacteria 6854
274 Ga0075369_10006357 3300006186 Bacteria 4463
275 Ga0075369_10044254 3300006186 Bacteria 1912
276 Ga0075369_10046171 3300006186 Bacteria 1875
277 Ga0097621_100036611 3300006237 Bacteria 3927
278 Ga0075370_10001448 3300006353 Bacteria 10304
279 Ga0075370_10034607 3300006353 Bacteria 2832
280 Ga0075370_10063851 3300006353 Bacteria 2099
281 Ga0068871_100011221 3300006358 Bacteria 6566
282 Ga0068871_100093095 3300006358 Bacteria 2514
283 Ga0075428_100000610 3300006844 Bacteria 36472
284 Ga0075428_100007051 3300006844 Bacteria 12454
285 Ga0075428_100007414 3300006844 Bacteria 12158
286 Ga0075428_100030689 3300006844 Bacteria 5943
287 Ga0075428_100174888 3300006844 Bacteria 2326
288 Ga0075428_100311879 3300006844 Bacteria 1691
289 Ga0075428_100400186 3300006844 Bacteria 1472
290 Ga0075430_100007092 3300006846 Bacteria 9450
291 Ga0075430_100015607 3300006846 Bacteria 6467
292 Ga0075430_100034036 3300006846 Bacteria 4324
293 Ga0075430_100041690 3300006846 Bacteria 3883
294 Ga0075430_100067840 3300006846 Bacteria 2994
295 Ga0075431_100012865 3300006847 Bacteria 8445
296 Ga0075431_100056189 3300006847 Bacteria 4060
297 Ga0075431_100060345 3300006847 Bacteria 3913
298 Ga0075431_100068233 3300006847 Bacteria 3669
299 Ga0075431_100171475 3300006847 Bacteria 2229
300 Ga0075433_10007460 3300006852 Bacteria 8684
301 Ga0075434_100032312 3300006871 Bacteria 5161
302 Ga0075434_100291348 3300006871 Bacteria 1652
303 Ga0075429_100009820 3300006880 Bacteria 8298
304 Ga0075429_100016282 3300006880 Bacteria 6444
305 Ga0075429_100022283 3300006880 Bacteria 5495
306 Ga0075429_100051551 3300006880 Bacteria 3581
307 Ga0075429_100144942 3300006880 Bacteria 2079
308 Ga0068865_100003084 3300006881 Bacteria 9971
309 Ga0068865_100006359 3300006881 Bacteria 7199
310 Ga0068865_100053951 3300006881 Bacteria 2791
311 Ga0075436_100050482 3300006914 Bacteria 2871
312 Ga0097620_100000596 3300006931 Bacteria 36034
313 Ga0097620_100000751 3300006931 Bacteria 32654
314 Ga0097620_100061974 3300006931 Bacteria 3769
315 Ga0097620_100064675 3300006931 Bacteria 3690
316 Ga0097620_100245303 3300006931 Bacteria 1881
317 Ga0105251_10030178 3300009011 Bacteria 2725
318 Ga0105251_10053826 3300009011 Bacteria 1912
319 Ga0105250_10018756 3300009092 Bacteria 2800
320 Ga0105240_10003639 3300009093 Bacteria 23876
321 Ga0105240_10037111 3300009093 Bacteria 6264
322 Ga0105240_10194704 3300009093 Bacteria 2381
323 Ga0105240_10354671 3300009093 Bacteria 1663
324 Ga0111539_10001504 3300009094 Bacteria 31141
325 Ga0111539_10002724 3300009094 Bacteria 23442
326 Ga0111539_10009764 3300009094 Bacteria 12113
327 Ga0111539_10100066 3300009094 Bacteria 3404
328 Ga0105245_10000870 3300009098 Bacteria 27352
329 Ga0105245_10005605 3300009098 Bacteria 11030
330 Ga0105245_10005886 3300009098 Bacteria 10772
331 Ga0105245_10018820 3300009098 Bacteria 6043
332 Ga0105245_10097087 3300009098 Bacteria 2720
333 Ga0105245_10176509 3300009098 Bacteria 2038
334 Ga0105245_10263285 3300009098 Bacteria 1679
335 Ga0105247_10000038 3300009101 Bacteria 164083
336 Ga0105247_10000062 3300009101 Bacteria 126437
337 Ga0105247_10000637 3300009101 Bacteria 28051
338 Ga0105247_10009210 3300009101 Bacteria 6005
339 Ga0105247_10018328 3300009101 Bacteria 4200
340 Ga0105247_10022164 3300009101 Bacteria 3824
341 Ga0114129_10000852 3300009147 Bacteria 39505
342 Ga0114129_10001274 3300009147 Bacteria 33664
343 Ga0114129_10001724 3300009147 Bacteria 29818
344 Ga0114129_10091266 3300009147 Bacteria 4221
345 Ga0114129_10118258 3300009147 Bacteria 3651
346 Ga0114129_10185214 3300009147 Bacteria 2830
347 Ga0105243_10001020 3300009148 Bacteria 25871
348 Ga0105243_10021920 3300009148 Bacteria 4852
349 Ga0105243_10194003 3300009148 Bacteria 1776
350 Ga0105241_10025845 3300009174 Bacteria 4365
351 Ga0105241_10133231 3300009174 Bacteria 2014
352 Ga0105242_10000650 3300009176 Bacteria 27213
353 Ga0105242_10027971 3300009176 Bacteria 4483
354 Ga0105242_10041014 3300009176 Bacteria 3731
355 Ga0105242_10092703 3300009176 Bacteria 2545
356 Ga0105242_10103959 3300009176 Bacteria 2410
357 Ga0105242_10135768 3300009176 Bacteria 2129
358 Ga0105248_10000035 3300009177 Bacteria 187578
359 Ga0105248_10000036 3300009177 Bacteria 187421
360 Ga0105248_10003863 3300009177 Bacteria 16573
361 Ga0105248_10011321 3300009177 Bacteria 9832
362 Ga0105248_10033866 3300009177 Bacteria 5707
363 Ga0105248_10039835 3300009177 Bacteria 5266
364 Ga0105248_10045424 3300009177 Bacteria 4926
365 Ga0105248_10049682 3300009177 Bacteria 4704
366 Ga0105248_10075304 3300009177 Bacteria 3793
367 Ga0105248_10134247 3300009177 Bacteria 2792
368 Ga0105248_10201205 3300009177 Bacteria 2244
369 Ga0105248_10238833 3300009177 Bacteria 2045
370 Ga0105248_10241017 3300009177 Bacteria 2036
371 Ga0105237_10000467 3300009545 Bacteria 57237
372 Ga0105237_10014748 3300009545 Bacteria 8156
373 Ga0105237_10014930 3300009545 Bacteria 8099
374 Ga0105237_10044770 3300009545 Bacteria 4456
375 Ga0105238_10032638 3300009551 Bacteria 5298
376 Ga0105238_10085210 3300009551 Bacteria 3148
377 Ga0105238_10307532 3300009551 Bacteria 1570
378 Ga0105249_10000046 3300009553 Bacteria 176363
379 Ga0105249_10001186 3300009553 Bacteria 23057
380 Ga0105249_10005191 3300009553 Bacteria 11241
381 Ga0105249_10118937 3300009553 Bacteria 2508
382 Ga0099796_10029146 3300010159 Bacteria 1778
383 Ga0105239_10003093 3300010375 Bacteria 20661
384 Ga0105239_10008819 3300010375 Bacteria 11412
385 Ga0105239_10016946 3300010375 Bacteria 8054
386 Ga0105239_10147161 3300010375 Bacteria 2628
387 Ga0105239_10323128 3300010375 Bacteria 1740
388 Ga0105246_10014319 3300011119 Bacteria 4987
389 Ga0105246_10040638 3300011119 Bacteria 3140
390 Ga0105246_10062558 3300011119 Bacteria 2593
391 Ga0105246_10083890 3300011119 Bacteria 2278
392 Ga0105246_10094152 3300011119 Bacteria 2166
393 Ga0157373_10026116 3300013100 Bacteria 4221
394 Ga0157373_10034275 3300013100 Bacteria 3646
395 Ga0157371_10056311 3300013102 Bacteria 2789
396 Ga0157370_10014109 3300013104 Bacteria 8196
397 Ga0157370_10016416 3300013104 Bacteria 7496
398 Ga0157370_10040559 3300013104 Bacteria 4495
399 Ga0157370_10132940 3300013104 Bacteria 2320
400 Ga0157369_10000890 3300013105 Bacteria 38122
401 Ga0157369_10010203 3300013105 Bacteria 10717
402 Ga0157369_10048565 3300013105 Bacteria 4605
403 Ga0157369_10065749 3300013105 Bacteria 3902
404 Ga0157369_10098846 3300013105 Bacteria 3111
405 Ga0157369_10100808 3300013105 Bacteria 3078
406 Ga0157369_10235375 3300013105 Bacteria 1914
407 Ga0157369_10269053 3300013105 Bacteria 1776
408 Ga0157374_10203151 3300013296 Bacteria 1941
409 Ga0157378_10029056 3300013297 Bacteria 4879
410 Ga0163162_10001609 3300013306 Bacteria 21131
411 Ga0163162_10054540 3300013306 Bacteria 4021
412 Ga0163162_10094916 3300013306 Bacteria 3069
413 Ga0157372_10000069 3300013307 Bacteria 110621
414 Ga0157372_10004145 3300013307 Bacteria 15520
415 Ga0157372_10081467 3300013307 Bacteria 3663
416 Ga0157372_10252452 3300013307 Bacteria 2047
417 Ga0157372_10256371 3300013307 Bacteria 2031
418 Ga0157372_10466967 3300013307 Bacteria 1471
419 Ga0157375_10000419 3300013308 Bacteria 38685
420 Ga0157375_10097169 3300013308 Bacteria 3019
421 Ga0163163_10008079 3300014325 Bacteria 9322
422 Ga0163163_10013354 3300014325 Bacteria 7517
423 Ga0163163_10041882 3300014325 Bacteria 4481
424 Ga0163163_10095860 3300014325 Bacteria 2987
425 Ga0163163_10109215 3300014325 Bacteria 2793
426 Ga0163163_10141080 3300014325 Bacteria 2452
427 Ga0157380_10015814 3300014326 Bacteria 5551
428 Ga0157380_10056783 3300014326 Bacteria 3115
429 Ga0157380_10162506 3300014326 Bacteria 1943
430 Ga0157377_10003983 3300014745 Bacteria 6737
431 Ga0157377_10037198 3300014745 Bacteria 2681
432 Ga0157379_10000012 3300014968 Bacteria 110577
433 Ga0157379_10008843 3300014968 Bacteria 8783
434 Ga0157379_10020489 3300014968 Bacteria 5847
435 Ga0157379_10045149 3300014968 Bacteria 3934
436 Ga0157379_10185118 3300014968 Bacteria 1882
437 Ga0157376_10003944 3300014969 Bacteria 10264
438 Ga0182007_10006330 3300015262 Bacteria 5091
439 Ga0183367_1002 3300015688 Bacteria 1101531
440 Ga0163161_10004818 3300017792 Bacteria 9403
441 Ga0163161_10021838 3300017792 Bacteria 4501
442 Ga0163161_10025906 3300017792 Bacteria 4152
443 Ga0197907_10125209 3300020069 Bacteria 3972
444 Ga0197907_10824310 3300020069 Bacteria 2432
445 Ga0197907_11041682 3300020069 Bacteria 2109
446 Ga0206356_11084540 3300020070 Bacteria 3024
447 Ga0206356_11251781 3300020070 Bacteria 3419
448 Ga0206356_11557117 3300020070 Bacteria 2360
449 Ga0206355_1061250 3300020076 Bacteria 1620
450 Ga0206351_10970124 3300020077 Bacteria 2115
451 Ga0206352_11163761 3300020078 Bacteria 1641
452 Ga0206350_11654720 3300020080 Bacteria 2983
453 Ga0206353_10041609 3300020082 Bacteria 2329
454 Ga0206353_10184723 3300020082 Bacteria 3671
455 Ga0206353_10976662 3300020082 Bacteria 5738
456 Ga0154015_1539966 3300020610 Bacteria 2439
457 Ga0154015_1634210 3300020610 Bacteria 1709
458 Ga0154015_1690007 3300020610 Bacteria 2383
459 Ga0213873_10000037 3300021358 Bacteria 34798
460 Ga0213876_10000793 3300021384 Bacteria 21431
461 Ga0213876_10019769 3300021384 Bacteria 3557
462 Ga0213876_10075381 3300021384 Bacteria 1781
463 Ga0213875_10002364 3300021388 Bacteria 11366
464 Ga0213875_10010278 3300021388 Bacteria 4690
465 Ga0213875_10011142 3300021388 Bacteria 4482
466 Ga0213875_10016187 3300021388 Bacteria 3618
467 Ga0213875_10017198 3300021388 Bacteria 3498
468 Ga0213875_10023525 3300021388 Bacteria 2942
469 Ga0213875_10035752 3300021388 Bacteria 2343
470 Ga0224712_10000640 3300022467 Bacteria 7152
471 Ga0224712_10000868 3300022467 Bacteria 6453
472 Ga0224712_10001321 3300022467 Bacteria 5648
473 Ga0224712_10002852 3300022467 Bacteria 4361
474 Ga0224712_10003615 3300022467 Bacteria 4050
475 Ga0224712_10008703 3300022467 Bacteria 3023
476 Ga0224712_10021348 3300022467 Bacteria 2215
477 Ga0228598_1007224 3300024227 Bacteria 2270
478 Ga0209758_1005072 3300025297 Bacteria 10434
479 Ga0207426_1002674 3300025302 Bacteria 10931
480 Ga0207426_1004723 3300025302 Bacteria 6516
481 Ga0209051_1000011 3300025303 Bacteria 610828
482 Ga0209051_1000620 3300025303 Bacteria 40785
483 Ga0209051_1000933 3300025303 Bacteria 28862
484 Ga0209051_1001428 3300025303 Bacteria 20451
485 Ga0209051_1042780 3300025303 Bacteria 1597
486 Ga0207713_1047252 3300025735 Bacteria 1743
487 Ga0207653_10019979 3300025885 Bacteria 2117
488 Ga0207692_10000049 3300025898 Bacteria 35853
489 Ga0207692_10006547 3300025898 Bacteria 4728
490 Ga0207692_10041273 3300025898 Bacteria 2283
491 Ga0207642_10000726 3300025899 Bacteria 10182
492 Ga0207642_10008157 3300025899 Bacteria 3579
493 Ga0207710_10000017 3300025900 Bacteria 370962
494 Ga0207710_10000048 3300025900 Bacteria 189597
495 Ga0207710_10000060 3300025900 Bacteria 168230
496 Ga0207710_10000890 3300025900 Bacteria 15991
497 Ga0207710_10017562 3300025900 Bacteria 3034
498 Ga0207710_10018265 3300025900 Bacteria 2981
499 Ga0207688_10000177 3300025901 Bacteria 28125
500 Ga0207688_10000985 3300025901 Bacteria 14533
501 Ga0207688_10001785 3300025901 Bacteria 11428
502 Ga0207688_10003133 3300025901 Bacteria 9023
503 Ga0207688_10069288 3300025901 Bacteria 1999
504 Ga0207688_10089663 3300025901 Bacteria 1765
505 Ga0207680_10004709 3300025903 Bacteria 6485
506 Ga0207680_10019714 3300025903 Bacteria 3612
507 Ga0207680_10055310 3300025903 Bacteria 2391
508 Ga0207680_10074674 3300025903 Bacteria 2112
509 Ga0207647_10041404 3300025904 Bacteria 2896
510 Ga0207647_10052506 3300025904 Bacteria 2516
511 Ga0207685_10001985 3300025905 Bacteria 4542
512 Ga0207685_10028071 3300025905 Bacteria 1977
513 Ga0207699_10044380 3300025906 Bacteria 2587
514 Ga0207699_10066505 3300025906 Bacteria 2188
515 Ga0207699_10071370 3300025906 Bacteria 2123
516 Ga0207645_10022095 3300025907 Bacteria 4144
517 Ga0207643_10000335 3300025908 Bacteria 32120
518 Ga0207643_10012832 3300025908 Bacteria 4529
519 Ga0207705_10000676 3300025909 Bacteria 28263
520 Ga0207705_10002002 3300025909 Bacteria 15842
521 Ga0207705_10014666 3300025909 Bacteria 5638
522 Ga0207705_10020763 3300025909 Bacteria 4687
523 Ga0207705_10020946 3300025909 Bacteria 4665
524 Ga0207705_10061174 3300025909 Bacteria 2720
525 Ga0207705_10138892 3300025909 Bacteria 1813
526 Ga0207684_10002893 3300025910 Bacteria 17012
527 Ga0207684_10143592 3300025910 Bacteria 2053
528 Ga0207707_10000089 3300025912 Bacteria 90919
529 Ga0207707_10009801 3300025912 Bacteria 8308
530 Ga0207707_10010633 3300025912 Bacteria 7993
531 Ga0207695_10017340 3300025913 Bacteria 8383
532 Ga0207695_10027984 3300025913 Bacteria 6264
533 Ga0207671_10038644 3300025914 Bacteria 3537
534 Ga0207671_10056241 3300025914 Bacteria 2915
535 Ga0207693_10000339 3300025915 Bacteria 43073
536 Ga0207693_10001185 3300025915 Bacteria 23283
537 Ga0207693_10029887 3300025915 Bacteria 4300
538 Ga0207693_10067864 3300025915 Bacteria 2792
539 Ga0207693_10075462 3300025915 Bacteria 2640
540 Ga0207693_10083640 3300025915 Bacteria 2500
541 Ga0207693_10118340 3300025915 Bacteria 2080
542 Ga0207693_10157566 3300025915 Bacteria 1786
543 Ga0207693_10170474 3300025915 Bacteria 1714
544 Ga0207663_10035253 3300025916 Bacteria 3000
545 Ga0207663_10062232 3300025916 Bacteria 2371
546 Ga0207660_10000115 3300025917 Bacteria 46447
547 Ga0207660_10000815 3300025917 Bacteria 20585
548 Ga0207660_10163950 3300025917 Bacteria 1717
549 Ga0207660_10194254 3300025917 Bacteria 1582
550 Ga0207662_10013813 3300025918 Bacteria 4520
551 Ga0207662_10020422 3300025918 Bacteria 3780
552 Ga0207662_10084502 3300025918 Bacteria 1942
553 Ga0207657_10002680 3300025919 Bacteria 19204
554 Ga0207657_10014660 3300025919 Bacteria 7638
555 Ga0207657_10020276 3300025919 Bacteria 6287
556 Ga0207657_10062164 3300025919 Bacteria 3198
557 Ga0207657_10084696 3300025919 Bacteria 2656
558 Ga0207657_10129847 3300025919 Bacteria 2066
559 Ga0207649_10004339 3300025920 Bacteria 7701
560 Ga0207649_10150627 3300025920 Bacteria 1602
561 Ga0207652_10000015 3300025921 Bacteria 193042
562 Ga0207652_10010364 3300025921 Bacteria 7504
563 Ga0207652_10016837 3300025921 Bacteria 5974
564 Ga0207652_10037921 3300025921 Bacteria 4081
565 Ga0207652_10047432 3300025921 Bacteria 3669
566 Ga0207646_10022954 3300025922 Bacteria 5736
567 Ga0207681_10000788 3300025923 Bacteria 20865
568 Ga0207694_10023506 3300025924 Bacteria 4679
569 Ga0207650_10007490 3300025925 Bacteria 7443
570 Ga0207650_10077853 3300025925 Bacteria 2507
571 Ga0207650_10208497 3300025925 Bacteria 1569
572 Ga0207659_10012720 3300025926 Bacteria 5369
573 Ga0207659_10014966 3300025926 Bacteria 5015
574 Ga0207687_10003312 3300025927 Bacteria 10883
575 Ga0207687_10024289 3300025927 Bacteria 4048
576 Ga0207687_10034677 3300025927 Bacteria 3427
577 Ga0207687_10077886 3300025927 Bacteria 2385
578 Ga0207687_10153233 3300025927 Bacteria 1761
579 Ga0207700_10063014 3300025928 Bacteria 2818
580 Ga0207700_10065136 3300025928 Bacteria 2779
581 Ga0207700_10122586 3300025928 Bacteria 2110
582 Ga0207700_10124281 3300025928 Bacteria 2096
583 Ga0207664_10000001 3300025929 Bacteria 724213
584 Ga0207664_10003864 3300025929 Bacteria 10068
585 Ga0207664_10016390 3300025929 Bacteria 5406
586 Ga0207664_10028564 3300025929 Bacteria 4240
587 Ga0207664_10044386 3300025929 Bacteria 3480
588 Ga0207664_10065900 3300025929 Bacteria 2901
589 Ga0207664_10130771 3300025929 Bacteria 2113
590 Ga0207664_10142941 3300025929 Bacteria 2026
591 Ga0207644_10000976 3300025931 Bacteria 18277
592 Ga0207644_10003155 3300025931 Bacteria 10607
593 Ga0207644_10107041 3300025931 Bacteria 2109
594 Ga0207690_10000171 3300025932 Bacteria 50511
595 Ga0207690_10022295 3300025932 Bacteria 3937
596 Ga0207706_10002589 3300025933 Bacteria 17618
597 Ga0207706_10007779 3300025933 Bacteria 9895
598 Ga0207706_10053435 3300025933 Bacteria 3566
599 Ga0207686_10001637 3300025934 Bacteria 12508
600 Ga0207686_10017197 3300025934 Bacteria 4072
601 Ga0207686_10070814 3300025934 Bacteria 2242
602 Ga0207686_10104898 3300025934 Bacteria 1894
603 Ga0207709_10001393 3300025935 Bacteria 16930
604 Ga0207709_10005302 3300025935 Bacteria 7335
605 Ga0207709_10008671 3300025935 Bacteria 5610
606 Ga0207670_10044191 3300025936 Bacteria 2947
607 Ga0207670_10142032 3300025936 Bacteria 1771
608 Ga0207669_10000205 3300025937 Bacteria 26813
609 Ga0207669_10003947 3300025937 Bacteria 6471
610 Ga0207704_10000618 3300025938 Bacteria 15725
611 Ga0207704_10005569 3300025938 Bacteria 5806
612 Ga0207704_10107026 3300025938 Bacteria 1880
613 Ga0207665_10006357 3300025939 Bacteria 7837
614 Ga0207665_10009000 3300025939 Bacteria 6552
615 Ga0207665_10019025 3300025939 Bacteria 4511
616 Ga0207665_10041528 3300025939 Bacteria 3072
617 Ga0207665_10043041 3300025939 Bacteria 3019
618 Ga0207665_10095785 3300025939 Bacteria 2063
619 Ga0207691_10000365 3300025940 Bacteria 45542
620 Ga0207691_10014980 3300025940 Bacteria 7383
621 Ga0207691_10123103 3300025940 Bacteria 2296
622 Ga0207711_10000073 3300025941 Bacteria 107878
623 Ga0207711_10000747 3300025941 Bacteria 31851
624 Ga0207711_10001409 3300025941 Bacteria 22525
625 Ga0207711_10006606 3300025941 Bacteria 9769
626 Ga0207711_10009126 3300025941 Bacteria 8280
627 Ga0207711_10010854 3300025941 Bacteria 7570
628 Ga0207711_10016330 3300025941 Bacteria 6168
629 Ga0207711_10099817 3300025941 Bacteria 2567
630 Ga0207711_10125273 3300025941 Bacteria 2297
631 Ga0207711_10160682 3300025941 Bacteria 2033
632 Ga0207689_10002913 3300025942 Bacteria 15796
633 Ga0207689_10006800 3300025942 Bacteria 10062
634 Ga0207689_10047196 3300025942 Bacteria 3558
635 Ga0207689_10071434 3300025942 Bacteria 2851
636 Ga0207661_10001912 3300025944 Bacteria 14292
637 Ga0207661_10025154 3300025944 Bacteria 4523
638 Ga0207661_10026607 3300025944 Bacteria 4410
639 Ga0207661_10064146 3300025944 Bacteria 2977
640 Ga0207661_10076749 3300025944 Bacteria 2745
641 Ga0207661_10123955 3300025944 Bacteria 2204
642 Ga0207661_10187600 3300025944 Bacteria 1811
643 Ga0207661_10234549 3300025944 Bacteria 1626
644 Ga0207679_10006663 3300025945 Bacteria 7313
645 Ga0207679_10024111 3300025945 Bacteria 4168
646 Ga0207679_10037555 3300025945 Bacteria 3444
647 Ga0207679_10260636 3300025945 Bacteria 1478
648 Ga0207667_10009549 3300025949 Bacteria 11416
649 Ga0207667_10027730 3300025949 Bacteria 6160
650 Ga0207667_10102345 3300025949 Bacteria 2955
651 Ga0207667_10146731 3300025949 Bacteria 2429
652 Ga0207667_10230340 3300025949 Bacteria 1897
653 Ga0207651_10040572 3300025960 Bacteria 3081
654 Ga0207651_10209457 3300025960 Bacteria 1568
655 Ga0207712_10000042 3300025961 Bacteria 176338
656 Ga0207712_10015171 3300025961 Bacteria 4966
657 Ga0207712_10076219 3300025961 Bacteria 2427
658 Ga0207712_10210514 3300025961 Bacteria 1548
659 Ga0207668_10000918 3300025972 Bacteria 17752
660 Ga0207668_10002531 3300025972 Bacteria 10674
661 Ga0207668_10003383 3300025972 Bacteria 9352
662 Ga0207668_10006483 3300025972 Bacteria 6920
663 Ga0207668_10011491 3300025972 Bacteria 5383
664 Ga0207668_10030292 3300025972 Bacteria 3555
665 Ga0207640_10003652 3300025981 Bacteria 8297
666 Ga0207640_10010659 3300025981 Bacteria 5184
667 Ga0207640_10068543 3300025981 Bacteria 2378
668 Ga0207658_10000449 3300025986 Bacteria 38511
669 Ga0207658_10005595 3300025986 Bacteria 8596
670 Ga0207658_10053121 3300025986 Bacteria 2992
671 Ga0207658_10076757 3300025986 Bacteria 2547
672 Ga0207658_10188247 3300025986 Bacteria 1713
673 Ga0207677_10003695 3300026023 Bacteria 8117
674 Ga0207677_10011197 3300026023 Bacteria 5104
675 Ga0207677_10027876 3300026023 Bacteria 3565
676 Ga0207677_10035072 3300026023 Bacteria 3254
677 Ga0207677_10036316 3300026023 Bacteria 3210
678 Ga0207677_10038832 3300026023 Bacteria 3124
679 Ga0207677_10043595 3300026023 Bacteria 2984
680 Ga0207703_10000002 3300026035 Bacteria 600711
681 Ga0207703_10000009 3300026035 Bacteria 343983
682 Ga0207703_10002964 3300026035 Bacteria 14391
683 Ga0207703_10061458 3300026035 Bacteria 3075
684 Ga0207639_10005809 3300026041 Bacteria 8358
685 Ga0207639_10045082 3300026041 Bacteria 3320
686 Ga0207639_10047931 3300026041 Bacteria 3232
687 Ga0207639_10050377 3300026041 Bacteria 3162
688 Ga0207639_10061070 3300026041 Bacteria 2909
689 Ga0207678_10000657 3300026067 Bacteria 31782
690 Ga0207678_10002619 3300026067 Bacteria 16406
691 Ga0207678_10008350 3300026067 Bacteria 9130
692 Ga0207678_10008815 3300026067 Bacteria 8876
693 Ga0207678_10037057 3300026067 Bacteria 4244
694 Ga0207678_10051777 3300026067 Bacteria 3544
695 Ga0207678_10121879 3300026067 Bacteria 2225
696 Ga0207708_10000002 3300026075 Bacteria 411071
697 Ga0207708_10000208 3300026075 Bacteria 46487
698 Ga0207708_10005701 3300026075 Bacteria 9204
699 Ga0207708_10013101 3300026075 Bacteria 6188
700 Ga0207702_10004196 3300026078 Bacteria 12876
701 Ga0207702_10009828 3300026078 Bacteria 8022
702 Ga0207702_10017665 3300026078 Bacteria 5902
703 Ga0207702_10096501 3300026078 Bacteria 2600
704 Ga0207702_10143824 3300026078 Bacteria 2161
705 Ga0207702_10239809 3300026078 Bacteria 1698
706 Ga0207641_10001094 3300026088 Bacteria 27248
707 Ga0207641_10001703 3300026088 Bacteria 21401
708 Ga0207641_10002959 3300026088 Bacteria 15363
709 Ga0207641_10013167 3300026088 Bacteria 6781
710 Ga0207641_10014228 3300026088 Bacteria 6519
711 Ga0207641_10057479 3300026088 Bacteria 3308
712 Ga0207641_10237589 3300026088 Bacteria 1696
713 Ga0207648_10000623 3300026089 Bacteria 39688
714 Ga0207648_10002531 3300026089 Bacteria 19612
715 Ga0207676_10003163 3300026095 Bacteria 11746
716 Ga0207674_10013076 3300026116 Bacteria 9241
717 Ga0207674_10015850 3300026116 Bacteria 8264
718 Ga0207674_10201721 3300026116 Bacteria 1938
719 Ga0207674_10300114 3300026116 Bacteria 1555
720 Ga0207675_100001672 3300026118 Bacteria 22194
721 Ga0207675_100022173 3300026118 Bacteria 5913
722 Ga0207675_100033946 3300026118 Bacteria 4755
723 Ga0207675_100115421 3300026118 Bacteria 2537
724 Ga0207683_10000539 3300026121 Bacteria 35044
725 Ga0207683_10000857 3300026121 Bacteria 27885
726 Ga0207683_10001164 3300026121 Bacteria 23801
727 Ga0207683_10001504 3300026121 Bacteria 21012
728 Ga0207683_10055797 3300026121 Bacteria 3465
729 Ga0207683_10068459 3300026121 Bacteria 3134
730 Ga0207698_10014728 3300026142 Bacteria 5209
731 Ga0207698_10040729 3300026142 Bacteria 3455
732 Ga0207698_10309789 3300026142 Bacteria 1474
733 Ga0207428_10005680 3300027907 Bacteria 11590
734 Ga0207428_10022479 3300027907 Bacteria 5321
735 Ga0207428_10030910 3300027907 Bacteria 4424
736 Ga0268266_10003190 3300028379 Bacteria 16606
737 Ga0268266_10005174 3300028379 Bacteria 12290
738 Ga0268266_10014863 3300028379 Bacteria 6684
739 Ga0268266_10084004 3300028379 Bacteria 2780
740 Ga0268266_10106405 3300028379 Bacteria 2479
741 Ga0268266_10146164 3300028379 Bacteria 2126
742 Ga0268265_10000051 3300028380 Bacteria 174968
743 Ga0268265_10000156 3300028380 Bacteria 83798
744 Ga0268265_10015530 3300028380 Bacteria 5213
745 Ga0268265_10036439 3300028380 Bacteria 3603
746 Ga0268264_10000097 3300028381 Bacteria 229722
747 Ga0268264_10000108 3300028381 Bacteria 208791
748 Ga0268264_10004939 3300028381 Bacteria 11297
749 Ga0268264_10075422 3300028381 Bacteria 2868
750 Ga0268264_10091589 3300028381 Bacteria 2623
751 Ga0307515_10000038 3300028794 Bacteria 331376
752 Ga0307515_10019047 3300028794 Bacteria 12384
753 Ga0307515_10033888 3300028794 Bacteria 8389
754 Ga0307515_10037382 3300028794 Bacteria 7810
755 Ga0307515_10070295 3300028794 Bacteria 4767
756 Ga0265338_10017927 3300028800 Bacteria 7604
757 Ga0265338_10038060 3300028800 Bacteria 4565
758 Ga0307511_10000590 3300030521 Bacteria 38846
759 Ga0307511_10002042 3300030521 Bacteria 21169
760 Ga0307512_10006290 3300030522 Bacteria 12063
761 Ga0307512_10024887 3300030522 Bacteria 5316
762 Ga0307512_10045352 3300030522 Bacteria 3602
763 Ga0316180_1157808 3300030736 Bacteria 2010
764 Ga0316183_1115972 3300030742 Bacteria 2236
765 Ga0265325_10003221 3300031241 Bacteria 10740
766 Ga0265325_10005156 3300031241 Bacteria 8125
767 Ga0265340_10019334 3300031247 Bacteria 3507
768 Ga0265339_10008767 3300031249 Bacteria 6409
769 Ga0265339_10049576 3300031249 Bacteria 2299
770 Ga0265327_10000021 3300031251 Bacteria 417788
771 Ga0265327_10000071 3300031251 Bacteria 215502
772 Ga0307513_10000002 3300031456 Bacteria 842612
773 Ga0307513_10007971 3300031456 Bacteria 13620
774 Ga0307513_10009861 3300031456 Bacteria 12056
775 Ga0307513_10015380 3300031456 Bacteria 9277
776 Ga0307513_10094607 3300031456 Bacteria 3032
777 Ga0307509_10015278 3300031507 Bacteria 8971
778 Ga0307509_10048348 3300031507 Bacteria 4569
779 Ga0307509_10149351 3300031507 Bacteria 2256
780 Ga0307408_100189282 3300031548 Bacteria 1657
781 Ga0307508_10000506 3300031616 Bacteria 46624
782 Ga0307508_10001775 3300031616 Bacteria 23968
783 Ga0307508_10070716 3300031616 Bacteria 3063
784 Ga0307514_10006847 3300031649 Bacteria 9870
785 Ga0307514_10075008 3300031649 Bacteria 2523
786 Ga0265314_10006663 3300031711 Bacteria 10148
787 Ga0265342_10042943 3300031712 Bacteria 2729
788 Ga0316576_10001518 3300031727 Bacteria 12548
789 Ga0316576_10004023 3300031727 Bacteria 8750
790 Ga0316576_10017633 3300031727 Bacteria 4856
791 Ga0316576_10114347 3300031727 Bacteria 2024
792 Ga0316578_10010142 3300031728 Bacteria 4876
793 Ga0316578_10069683 3300031728 Bacteria 2081
794 Ga0307516_10002871 3300031730 Bacteria 22675
795 Ga0307516_10093745 3300031730 Bacteria 2827
796 Ga0307516_10094321 3300031730 Bacteria 2817
797 Ga0307405_10000804 3300031731 Bacteria 12338
798 Ga0307405_10024124 3300031731 Bacteria 3469
799 Ga0307405_10127210 3300031731 Bacteria 1754
800 Ga0307413_10000862 3300031824 Bacteria 10698
801 Ga0307413_10018416 3300031824 Bacteria 3664
802 Ga0307413_10034067 3300031824 Bacteria 2907
803 Ga0307413_10160841 3300031824 Bacteria 1577
804 Ga0307518_10004772 3300031838 Bacteria 9704
805 Ga0307410_10015291 3300031852 Bacteria 4547
806 Ga0307410_10024255 3300031852 Bacteria 3787
807 Ga0307410_10045221 3300031852 Bacteria 2930
808 Ga0307410_10054371 3300031852 Bacteria 2714
809 Ga0307410_10096536 3300031852 Bacteria 2110
810 Ga0307410_10111554 3300031852 Bacteria 1979
811 Ga0307406_10004254 3300031901 Bacteria 7791
812 Ga0307406_10075140 3300031901 Bacteria 2228
813 Ga0307406_10082326 3300031901 Bacteria 2143
814 Ga0307406_10131537 3300031901 Bacteria 1757
815 Ga0307406_10181694 3300031901 Bacteria 1532
816 Ga0307407_10002514 3300031903 Bacteria 7194
817 Ga0307407_10003337 3300031903 Bacteria 6563
818 Ga0307409_100000406 3300031995 Bacteria 18400
819 Ga0307409_100000409 3300031995 Bacteria 18204
820 Ga0307409_100012688 3300031995 Bacteria 5382
821 Ga0307409_100089208 3300031995 Bacteria 2520
822 Ga0307409_100156524 3300031995 Bacteria 1986
823 Ga0307409_100256598 3300031995 Bacteria 1602
824 Ga0307416_100005536 3300032002 Bacteria 7769
825 Ga0307416_100006145 3300032002 Bacteria 7484
826 Ga0307416_100007073 3300032002 Bacteria 7088
827 Ga0307414_10089640 3300032004 Bacteria 2280
828 Ga0307414_10106356 3300032004 Bacteria 2124
829 Ga0307415_100000021 3300032126 Bacteria 67460
830 Ga0307415_100000422 3300032126 Bacteria 18141
831 Ga0307415_100003770 3300032126 Bacteria 7768
832 Ga0307415_100004822 3300032126 Bacteria 7070
833 Ga0307415_100039753 3300032126 Bacteria 3112
834 Ga0307415_100052948 3300032126 Bacteria 2763
835 Ga0316585_10004353 3300032137 Bacteria 3938
836 Ga0316580_10019075 3300032139 Bacteria 2111
837 Ga0316593_10000889 3300032168 Bacteria 6090
838 Ga0307507_10000732 3300033179 Bacteria 72083
839 Ga0307507_10016917 3300033179 Bacteria 8430
840 Ga0307507_10020822 3300033179 Bacteria 7326
841 Ga0307510_10055624 3300033180 Bacteria 4131
842 Ga0307510_10089223 3300033180 Bacteria 2937
843 Ga0307510_10116839 3300033180 Bacteria 2387
844 Ga0316214_1001544 3300033545 Bacteria 2712
845 Ga0373959_0014790 3300034820 Bacteria 1425
846 Ga0373926_0009791 3300035083 Bacteria 3202
847 Ga0373934_0003190 3300035086 Bacteria 5994
848 Ga0373944_0007599 3300035089 Bacteria 2909
849 Ga0373949_0005321 3300035090 Bacteria 2875
850 Ga0373951_0000115 3300035091 Bacteria 30473
851 Ga0373923_0001801 3300035111 Bacteria 6330
852 Ga0373936_0000466 3300035113 Bacteria 13640
853 Ga0373936_0051674 3300035113 Bacteria 1663
854 Ga0373945_0001125 3300035116 Bacteria 8082
855 Ga0373945_0005546 3300035116 Bacteria 4043
856 Ga0373953_0001306 3300035117 Bacteria 7137
857 Ga0373953_0002560 3300035117 Bacteria 5499
858 Ga0373953_0025343 3300035117 Bacteria 2265
859 Ga0373954_0025370 3300035118 Bacteria 2708
860 Ga0373956_0003065 3300035119 Bacteria 6767
861 Ga0373956_0033163 3300035119 Bacteria 2269
862 Ga0373960_0004283 3300035121 Bacteria 3259
863 Ga0373943_0001264 3300035170 Bacteria 11318
864 Ga0373946_0001321 3300035171 Bacteria 8568
865 Ga0373955_0003782 3300035172 Bacteria 6663
866 Ga0373955_0040542 3300035172 Bacteria 2491
867 Ga0373942_0000196 3300035207 Bacteria 15484
868 Ga0373942_0012372 3300035207 Bacteria 2037
869 Ga0373962_0011117 3300035242 Bacteria 2252
870 Ga0316574_0024953 3300035398 Bacteria 3584
871 Ga0316574_0058180 3300035398 Bacteria 2421
872 Ga0316574_0061945 3300035398 Bacteria 2350
873 Ga0373924_0005485 3300035410 Bacteria 4495
874 Ga0373924_0013950 3300035410 Bacteria 3027
875 Ga0373931_0008885 3300035691 Bacteria 4785
876 Ga0373931_0048658 3300035691 Bacteria 2248
877 Ga0373935_0004907 3300035692 Bacteria 7858
878 Ga0373935_0014322 3300035692 Bacteria 4786
879 Ga0373935_0015818 3300035692 Bacteria 4565
880 Ga0373935_0029064 3300035692 Bacteria 3420
881 Ga0373935_0151391 3300035692 Bacteria 1574
882 Ga0373927_0002894 3300035695 Bacteria 12485
883 Ga0373927_0093639 3300035695 Bacteria 1952
884 Ga0373933_0013288 3300035724 Bacteria 4561
885 Ga0373947_0000039 3300035725 Bacteria 63474
886 Ga0373947_0003402 3300035725 Bacteria 9414
887 Ga0373947_0009537 3300035725 Bacteria 5571
888 Ga0373937_0053491 3300036401 Bacteria 3703
889 Ga0373937_0070973 3300036401 Bacteria 3212
890 Ga0373937_0086281 3300036401 Bacteria 2905
891 Ga0265778_000400 3300036457 Bacteria 3373
892 Ga0316582_0097304 3300036647 Bacteria 1945
893 Ga0316584_0000281 3300036712 Bacteria 26040
894 Ga0316584_0005744 3300036712 Bacteria 8359
895 Ga0316584_0071624 3300036712 Bacteria 2597
896 Ga0316584_0102955 3300036712 Bacteria 2138
897 Ga0373925_0000006 3300037068 Bacteria 278942
898 Ga0373925_0050996 3300037068 Bacteria 3087
899 Ga0395899_0053281 3300037312 Bacteria 2996
900 Ga0395900_0003901 3300037418 Bacteria 15934
901 Ga0395900_0008791 3300037418 Bacteria 10378
902 Ga0395900_0042604 3300037418 Bacteria 4678
903 Ga0395900_0182565 3300037418 Bacteria 2131
904 Ga0395898_0011400 3300037466 Bacteria 9232
905 Ga0395898_0035335 3300037466 Bacteria 4971
906 Ga0395898_0119080 3300037466 Bacteria 2529
907 Ga0395898_0136410 3300037466 Bacteria 2349
908 Ga0395905_0023889 3300037471 Bacteria 5771
909 Ga0395905_0087531 3300037471 Bacteria 2920
910 Ga0395905_0254809 3300037471 Bacteria 1639
911 Ga0436364_0238775 3300037853 Bacteria 6929
912 Ga0436364_0516238 3300037853 Bacteria 122645
913 Ga0436364_0696641 3300037853 Bacteria 19004
914 Ga0436364_0735260 3300037853 Bacteria 16919
915 Ga0436364_0823558 3300037853 Bacteria 25963
916 Ga0436364_1039945 3300037853 Bacteria 3520
917 Ga0436364_1051432 3300037853 Bacteria 7404
918 Ga0436364_1086504 3300037853 Bacteria 29464
919 Ga0436364_1291536 3300037853 Bacteria 16625
920 Ga0395901_0033677 3300038443 Bacteria 5289
921 Ga0436365_0447055 3300039437 Bacteria 3724
922 Ga0436365_0567091 3300039437 Bacteria 46375
923 Ga0436365_0574117 3300039437 Bacteria 5877
924 Ga0436365_0939033 3300039437 Bacteria 60216
925 Ga0436365_1050647 3300039437 Bacteria 21064
926 Ga0436365_1284454 3300039437 Bacteria 8745
927 Ga0436365_1908396 3300039437 Bacteria 15438
928 Ga0436363_0129189 3300039450 Bacteria 2074
929 Ga0436363_0464660 3300039450 Bacteria 2418
930 Ga0436363_1431793 3300039450 Bacteria 2059
931 Ga0436362_0884990 3300039453 Bacteria 27774
932 Ga0439436_0000647 3300041404 Bacteria 9264
933 Ga0439436_0002022 3300041404 Bacteria 6033
934 Ga0439439_0010546 3300041406 Bacteria 2211
935 Ga0439461_0001991 3300041410 Bacteria 3230
936 Ga0439466_0004599 3300041411 Bacteria 5300
937 Ga0439465_0008298 3300041413 Bacteria 3278
938 Ga0439465_0009044 3300041413 Bacteria 3139
939 Ga0451789_0957144 3300041443 Bacteria 1201
940 Ga0451793_0254203 3300041452 Bacteria 6453
941 Ga0451795_0111892 3300041456 Bacteria 2768
942 Ga0451853_2614358 3300041512 Bacteria 3913
943 Ga0439431_0005807 3300041997 Bacteria 2725
944 Ga0439433_0001382 3300041999 Bacteria 4990
945 Ga0439433_0009801 3300041999 Bacteria 2091
946 Ga0439442_002424 3300042002 Bacteria 3662
947 Ga0439445_0003352 3300042004 Bacteria 3597
948 Ga0439432_020825 3300042006 Bacteria 2177
949 Ga0439457_000479 3300042014 Bacteria 11535
950 Ga0439457_004100 3300042014 Bacteria 3854
951 Ga0450894_000878 3300042131 Bacteria 4808
952 Ga0450899_000129 3300042135 Bacteria 7101
953 Ga0439459_0000473 3300042438 Bacteria 5243
954 Ga0451577_0066941 3300042876 Bacteria 3203
955 Ga0466969_0000632 3300044656 Bacteria 19011
956 Ga0466969_0002576 3300044656 Bacteria 9685
957 Ga0466969_0004118 3300044656 Bacteria 7717
958 Ga0466969_0049407 3300044656 Bacteria 2076
959 Ga0466972_0002173 3300044658 Bacteria 9628
960 Ga0466972_0011396 3300044658 Bacteria 4462
961 Ga0466972_0014915 3300044658 Bacteria 3888
962 Ga0466972_0028907 3300044658 Bacteria 2731
963 Ga0466972_0039438 3300044658 Bacteria 2304
964 Ga0466972_0057374 3300044658 Bacteria 1870
965 Ga0466965_0000194 3300044683 Bacteria 18907
966 Ga0466965_0007146 3300044683 Bacteria 5114
967 Ga0466965_0024585 3300044683 Bacteria 2915
968 Ga0466965_0024726 3300044683 Bacteria 2906
969 Ga0466965_0026949 3300044683 Bacteria 2787
970 Ga0466966_0001302 3300044684 Bacteria 15981
971 Ga0466966_0006474 3300044684 Bacteria 7751
972 Ga0466966_0061797 3300044684 Bacteria 2362
973 Ga0466966_0080943 3300044684 Bacteria 2022
974 Ga0466961_0001660 3300044693 Bacteria 13839
975 Ga0466961_0002350 3300044693 Bacteria 11760
976 Ga0466961_0002892 3300044693 Bacteria 10653
977 Ga0466961_0005797 3300044693 Bacteria 7823
978 Ga0466961_0021171 3300044693 Bacteria 4186
979 Ga0466961_0024210 3300044693 Bacteria 3905
980 Ga0466961_0029146 3300044693 Bacteria 3548
981 Ga0466961_0049882 3300044693 Bacteria 2674
982 Ga0466961_0062349 3300044693 Bacteria 2369
983 Ga0466961_0073870 3300044693 Bacteria 2162
984 Ga0466963_0001094 3300044694 Bacteria 14129
985 Ga0466963_0003573 3300044694 Bacteria 8931
986 Ga0466963_0010639 3300044694 Bacteria 5579
987 Ga0466963_0016897 3300044694 Bacteria 4545
988 Ga0466963_0019383 3300044694 Bacteria 4265
989 Ga0466963_0032161 3300044694 Bacteria 3396
990 Ga0466963_0034188 3300044694 Bacteria 3307
991 Ga0466963_0040311 3300044694 Bacteria 3061
992 Ga0466963_0074602 3300044694 Bacteria 2288
993 Ga0466963_0083359 3300044694 Bacteria 2168
994 Ga0466964_0019639 3300044706 Bacteria 2599
995 Ga0466964_0024386 3300044706 Bacteria 2358
996 Ga0466964_0025198 3300044706 Bacteria 2321
997 Ga0466964_0071300 3300044706 Bacteria 1470
998 Ga0466971_0000892 3300044719 Bacteria 12211
999 Ga0466971_0003748 3300044719 Bacteria 6508
1000 Ga0466971_0008516 3300044719 Bacteria 4474
1001 Ga0466971_0028339 3300044719 Bacteria 2506
1002 Ga0466971_0045012 3300044719 Bacteria 1982
1003 Ga0466968_0003734 3300044735 Bacteria 5645
1004 Ga0466968_0003834 3300044735 Bacteria 5579
1005 Ga0466968_0016662 3300044735 Bacteria 2929
1006 Ga0466968_0061106 3300044735 Bacteria 1625
1007 Ga0466970_0014696 3300044765 Bacteria 4021
1008 Ga0466970_0022106 3300044765 Bacteria 3320
1009 Ga0466970_0032443 3300044765 Bacteria 2759
1010 Ga0466970_0051351 3300044765 Bacteria 2200
1011 Ga0466970_0054821 3300044765 Bacteria 2129
1012 Ga0466970_0067744 3300044765 Bacteria 1917
1013 Ga0466957_0012041 3300044842 Bacteria 5000
1014 Ga0466957_0013266 3300044842 Bacteria 4779
1015 Ga0466960_0000703 3300044901 Bacteria 11662
1016 Ga0466960_0001139 3300044901 Bacteria 9536
1017 Ga0466960_0001775 3300044901 Bacteria 7915
1018 Ga0466960_0004561 3300044901 Bacteria 5432
1019 Ga0466960_0007316 3300044901 Bacteria 4477
1020 Ga0466960_0036259 3300044901 Bacteria 2309
1021 Ga0466959_0000877 3300045049 Bacteria 17736
1022 Ga0466959_0006347 3300045049 Bacteria 8181
1023 Ga0466959_0018130 3300045049 Bacteria 5165
1024 Ga0466959_0038655 3300045049 Bacteria 3526
1025 Ga0466959_0059597 3300045049 Bacteria 2780
1026 Ga0466959_0084429 3300045049 Bacteria 2286
1027 Ga0466959_0089585 3300045049 Bacteria 2210
1028 Ga0466959_0093383 3300045049 Bacteria 2159
1029 Ga0466959_0099313 3300045049 Bacteria 2084
1030 Ga0451576_0128588 3300045051 Bacteria 2640
1031 Ga0466958_0003068 3300045836 Bacteria 8566
1032 Ga0466958_0009782 3300045836 Bacteria 5350
1033 Ga0466958_0011259 3300045836 Bacteria 5035
1034 Ga0466958_0011623 3300045836 Bacteria 4962
1035 Ga0466958_0019285 3300045836 Bacteria 3969
1036 Ga0466958_0028208 3300045836 Bacteria 3327
1037 Ga0466958_0034449 3300045836 Bacteria 3020
1038 Ga0466958_0041184 3300045836 Bacteria 2778
1039 Ga0466958_0042780 3300045836 Bacteria 2728
1040 Ga0466958_0070299 3300045836 Bacteria 2142
1041 Ga0466958_0087654 3300045836 Bacteria 1922
1042 Ga0466967_0000595 3300045976 Bacteria 17954
1043 Ga0466967_0001175 3300045976 Bacteria 14690
1044 Ga0466967_0001407 3300045976 Bacteria 13915
1045 Ga0466967_0002012 3300045976 Bacteria 12383
1046 Ga0466967_0002261 3300045976 Bacteria 11871
1047 Ga0466967_0005637 3300045976 Bacteria 8713
1048 Ga0466967_0009226 3300045976 Bacteria 7304
1049 Ga0466967_0009250 3300045976 Bacteria 7297
1050 Ga0466967_0009629 3300045976 Bacteria 7182
1051 Ga0466967_0009645 3300045976 Bacteria 7179
1052 Ga0466967_0010064 3300045976 Bacteria 7067
1053 Ga0466967_0017233 3300045976 Bacteria 5728
1054 Ga0466967_0055472 3300045976 Bacteria 3490
1055 Ga0466967_0059846 3300045976 Bacteria 3373
1056 Ga0466967_0102881 3300045976 Bacteria 2613
1057 Ga0466967_0147542 3300045976 Bacteria 2195
1058 Ga0466967_0181544 3300045976 Bacteria 1985
1059 Ga0466967_0266619 3300045976 Bacteria 1640
1060 Ga0495627_008543 3300046453 Bacteria 3829
1061 Ga0495592_0094071 3300046454 Bacteria 2145
1062 Ga0495603_0009235 3300046455 Bacteria 5959
1063 Ga0495603_0014289 3300046455 Bacteria 4803
1064 Ga0495603_0027419 3300046455 Bacteria 3438
1065 Ga0495629_0002245 3300046459 Bacteria 14890
1066 Ga0495629_0032233 3300046459 Bacteria 3710
1067 Ga0495629_0075214 3300046459 Bacteria 2359
1068 Ga0495629_0122824 3300046459 Bacteria 1809
1069 Ga0495641_0007399 3300046461 Bacteria 6864
1070 Ga0495641_0009246 3300046461 Bacteria 5873
1071 Ga0495651_0017471 3300046462 Bacteria 5555
1072 Ga0495653_0004573 3300046463 Bacteria 11182
1073 Ga0495653_0022314 3300046463 Bacteria 5123
1074 Ga0495653_0066800 3300046463 Bacteria 2703
1075 Ga0495653_0125370 3300046463 Bacteria 1824
1076 Ga0495653_0158387 3300046463 Bacteria 1574
1077 Ga0495650_0016688 3300046471 Bacteria 3707
1078 Ga0495639_0003954 3300046475 Bacteria 6365
1079 Ga0495639_0028677 3300046475 Bacteria 2467
1080 Ga0495639_0062309 3300046475 Bacteria 1711
1081 Ga0495662_0002349 3300046476 Bacteria 9532
1082 Ga0495664_0008545 3300046477 Bacteria 5708
1083 Ga0495664_0065266 3300046477 Bacteria 2169
1084 Ga0495585_0017360 3300046492 Bacteria 4157
1085 Ga0495594_0001342 3300046499 Bacteria 12775
1086 Ga0495594_0045170 3300046499 Bacteria 2418
1087 Ga0495607_0027985 3300046501 Bacteria 3480
1088 Ga0495607_0070996 3300046501 Bacteria 1943
1089 Ga0495583_0014310 3300046506 Bacteria 4383
1090 Ga0495583_0069052 3300046506 Bacteria 1557
1091 Ga0495606_0001359 3300046507 Bacteria 33075
1092 Ga0495606_0021271 3300046507 Bacteria 4754
1093 Ga0495606_0026257 3300046507 Bacteria 4153
1094 Ga0495608_0012884 3300046511 Bacteria 5802
1095 Ga0495608_0058655 3300046511 Bacteria 2537
1096 Ga0495616_0004473 3300046513 Bacteria 8801
1097 Ga0495620_0070009 3300046515 Bacteria 1437
1098 Ga0495628_0055179 3300046516 Bacteria 3130
1099 Ga0495628_0095450 3300046516 Bacteria 2297
1100 Ga0495628_0225663 3300046516 Bacteria 1405
1101 Ga0495630_0008465 3300046517 Bacteria 7383
1102 Ga0495630_0018073 3300046517 Bacteria 5174
1103 Ga0495631_0003096 3300046518 Bacteria 9166
1104 Ga0495637_0015812 3300046520 Bacteria 3534
1105 Ga0495648_0021577 3300046524 Bacteria 4455
1106 Ga0495666_0003647 3300046526 Bacteria 7781
1107 Ga0495652_0018073 3300046529 Bacteria 6290
1108 Ga0495652_0086307 3300046529 Bacteria 2577
1109 Ga0495654_0032188 3300046530 Bacteria 2659
1110 Ga0495665_0010808 3300046531 Bacteria 4941
1111 Ga0495665_0015610 3300046531 Bacteria 4087
1112 Ga0495640_0045514 3300046533 Bacteria 3044
1113 Ga0495640_0046303 3300046533 Bacteria 3014
1114 Ga0495586_0008930 3300046535 Bacteria 5334
1115 Ga0495587_0000907 3300046536 Bacteria 19603
1116 Ga0495609_0007988 3300046538 Bacteria 5225
1117 Ga0495597_0028324 3300046542 Bacteria 2564
1118 Ga0495622_0006694 3300046557 Bacteria 5342
1119 Ga0495667_0018746 3300046559 Bacteria 4670
1120 Ga0495667_0038390 3300046559 Bacteria 3188
1121 Ga0495668_0000519 3300046616 Bacteria 47924
1122 Ga0495668_0064041 3300046616 Bacteria 2024
1123 Ga0495634_0008927 3300046642 Bacteria 7422
1124 Ga0495634_0057874 3300046642 Bacteria 2586
1125 Ga0495634_0091681 3300046642 Bacteria 1972
1126 Ga0495611_0030633 3300046648 Bacteria 2366
1127 Ga0495625_0001636 3300046660 Bacteria 26330
1128 Ga0495625_0044373 3300046660 Bacteria 3218
1129 Ga0495635_0036284 3300046663 Bacteria 3417
1130 Ga0495635_0055499 3300046663 Bacteria 2729
1131 Ga0495635_0087728 3300046663 Bacteria 2129
1132 Ga0495661_0007473 3300046665 Bacteria 7619
1133 Ga0495588_0020166 3300046674 Bacteria 3273
1134 Ga0495657_0053190 3300046675 Bacteria 2710
1135 Ga0495657_0066629 3300046675 Bacteria 2365
1136 Ga0495657_0080018 3300046675 Bacteria 2115
1137 Ga0495599_0027522 3300046678 Bacteria 3563
1138 Ga0495623_0012970 3300046679 Bacteria 5394
1139 Ga0495623_0026038 3300046679 Bacteria 3767
1140 Ga0495646_0002906 3300046680 Bacteria 10616
1141 Ga0495646_0082841 3300046680 Bacteria 1866
1142 Ga0495646_0177897 3300046680 Bacteria 1169
1143 Ga0495658_0029170 3300046683 Bacteria 2983
1144 Ga0495658_0074911 3300046683 Bacteria 1974
1145 Ga0495669_0019460 3300046684 Bacteria 2930
1146 Ga0495613_0003081 3300046689 Bacteria 12453
1147 Ga0495613_0007268 3300046689 Bacteria 8244
1148 Ga0495624_0000535 3300046690 Bacteria 29778
1149 Ga0495624_0011184 3300046690 Bacteria 6175
1150 Ga0495649_0036673 3300046694 Bacteria 2693
1151 Ga0495589_0068244 3300046794 Bacteria 1739
1152 Ga0495589_0068308 3300046794 Bacteria 1739
1153 Ga0495600_0005439 3300046809 Bacteria 7677
1154 Ga0495600_0021071 3300046809 Bacteria 4171
1155 Ga0495600_0119154 3300046809 Bacteria 1717
1156 Ga0495660_0055775 3300046810 Bacteria 2137
1157 Ga0495581_0003107 3300047315 Bacteria 9509
1158 Ga0495581_0068143 3300047315 Bacteria 2058
1159 Ga0495604_0115329 3300047317 Bacteria 1952
1160 Ga0495636_0021632 3300047318 Bacteria 2597
1161 Ga0495674_0001362 3300047319 Bacteria 23834
1162 Ga0495674_0055153 3300047319 Bacteria 3487
1163 Ga0495674_0157529 3300047319 Bacteria 1901
1164 Ga0495672_0024614 3300047320 Bacteria 3874
1165 Ga0495676_0028819 3300047321 Bacteria 4736
1166 Ga0495676_0058754 3300047321 Bacteria 3024
1167 Ga0495680_0022892 3300047322 Bacteria 5202
1168 Ga0495680_0034707 3300047322 Bacteria 4069
1169 Ga0495680_0037991 3300047322 Bacteria 3852
1170 Ga0495680_0042878 3300047322 Bacteria 3586
1171 Ga0495687_001147 3300047443 Bacteria 25643
1172 Ga0495687_003306 3300047443 Bacteria 11824
1173 Ga0495687_024126 3300047443 Bacteria 2895
1174 Ga0495675_0034556 3300047444 Bacteria 3227
1175 Ga0495685_008578 3300047447 Bacteria 3396
1176 Ga0495684_0000973 3300047471 Bacteria 23335
1177 Ga0495684_0023120 3300047471 Bacteria 4780
1178 Ga0495684_0042296 3300047471 Bacteria 3490
1179 Ga0495684_0047712 3300047471 Bacteria 3275
1180 Ga0495684_0106123 3300047471 Bacteria 2122
1181 Ga0495686_0000637 3300047472 Bacteria 48296
1182 Ga0495686_0042822 3300047472 Bacteria 2875
1183 Ga0495593_0013292 3300047673 Bacteria 4698
1184 Ga0495614_0017285 3300048089 Bacteria 3134
1185 Ga0495614_0082573 3300048089 Bacteria 1393
1186 Ga0495615_0005916 3300048090 Bacteria 2233
1187 Ga0495626_0001401 3300048091 Bacteria 19307
1188 Ga0495626_0007219 3300048091 Bacteria 6208
1189 Ga0496100_0000067 3300048903 Bacteria 58703
1190 Ga0496100_0000461 3300048903 Bacteria 19507
1191 Ga0496100_0002943 3300048903 Bacteria 8762
1192 Ga0496100_0015097 3300048903 Bacteria 4504
1193 Ga0496100_0065715 3300048903 Bacteria 2404
1194 Ga0496100_0147500 3300048903 Bacteria 1674
1195 Ga0496100_0173793 3300048903 Bacteria 1553
1196 Ga0496101_0000099 3300048904 Bacteria 90235
1197 Ga0496101_0001394 3300048904 Bacteria 14462
1198 Ga0496101_0045811 3300048904 Bacteria 3134
1199 Ga0496101_0117477 3300048904 Bacteria 2008
1200 Ga0496102_0000013 3300048905 Bacteria 311668
1201 Ga0496102_0000048 3300048905 Bacteria 179713
1202 Ga0496102_0000175 3300048905 Bacteria 87026
1203 Ga0496102_0000390 3300048905 Bacteria 51759
1204 Ga0496102_0003032 3300048905 Bacteria 14221
1205 Ga0496102_0011278 3300048905 Bacteria 7701
1206 Ga0496102_0027616 3300048905 Bacteria 5068
1207 Ga0496102_0046711 3300048905 Bacteria 3932
1208 Ga0496102_0064426 3300048905 Bacteria 3357
1209 Ga0496102_0073478 3300048905 Bacteria 3142
1210 Ga0496102_0081793 3300048905 Bacteria 2978
1211 Ga0496102_0089145 3300048905 Bacteria 2853
1212 Ga0496102_0127161 3300048905 Bacteria 2383
1213 Ga0496103_0000018 3300048906 Bacteria 239585
1214 Ga0496103_0000039 3300048906 Bacteria 174284
1215 Ga0496103_0000116 3300048906 Bacteria 86969
1216 Ga0496103_0011446 3300048906 Bacteria 5258
1217 Ga0496104_0007024 3300048907 Bacteria 9927
1218 Ga0496104_0040322 3300048907 Bacteria 4376
1219 Ga0496104_0051650 3300048907 Bacteria 3880
1220 Ga0496104_0133115 3300048907 Bacteria 2388
1221 Ga0496105_0012606 3300048908 Bacteria 6695
1222 Ga0496105_0020163 3300048908 Bacteria 5384
1223 Ga0496105_0020716 3300048908 Bacteria 5315
1224 Ga0496105_0024253 3300048908 Bacteria 4929
1225 Ga0496105_0092674 3300048908 Bacteria 2494
1226 Ga0496105_0112736 3300048908 Bacteria 2244
1227 Ga0496105_0134693 3300048908 Bacteria 2035
1228 Ga0496106_0000424 3300048909 Bacteria 30065
1229 Ga0496106_0001155 3300048909 Bacteria 19580
1230 Ga0496106_0002018 3300048909 Bacteria 15276
1231 Ga0496106_0008649 3300048909 Bacteria 7534
1232 Ga0496106_0019812 3300048909 Bacteria 4987
1233 Ga0496106_0020907 3300048909 Bacteria 4857
1234 Ga0496106_0101504 3300048909 Bacteria 2232
1235 Ga0496107_0000079 3300048910 Bacteria 46405
1236 Ga0496107_0000254 3300048910 Bacteria 28236
1237 Ga0496107_0026359 3300048910 Bacteria 4119
1238 Ga0496107_0027103 3300048910 Bacteria 4068
1239 Ga0496108_0000035 3300048911 Bacteria 154937
1240 Ga0496108_0000959 3300048911 Bacteria 22428
1241 Ga0496108_0003817 3300048911 Bacteria 12072
1242 Ga0496108_0005688 3300048911 Bacteria 10091
1243 Ga0496108_0057509 3300048911 Bacteria 3268
1244 Ga0496108_0065466 3300048911 Bacteria 3064
1245 Ga0496108_0067004 3300048911 Bacteria 3028
1246 Ga0496108_0177067 3300048911 Bacteria 1846
1247 Ga0496109_0000159 3300048912 Bacteria 66124
1248 Ga0496109_0004668 3300048912 Bacteria 11441
1249 Ga0496109_0008285 3300048912 Bacteria 8824
1250 Ga0496109_0012040 3300048912 Bacteria 7452
1251 Ga0496109_0015418 3300048912 Bacteria 6660
1252 Ga0496109_0054048 3300048912 Bacteria 3664
1253 Ga0496109_0069929 3300048912 Bacteria 3220
1254 Ga0496109_0075199 3300048912 Bacteria 3105
1255 Ga0496109_0076274 3300048912 Bacteria 3083
1256 Ga0496109_0118222 3300048912 Bacteria 2467
1257 Ga0496110_0000220 3300048913 Bacteria 37013
1258 Ga0496110_0004660 3300048913 Bacteria 10661
1259 Ga0496110_0008200 3300048913 Bacteria 8395
1260 Ga0496110_0011646 3300048913 Bacteria 7211
1261 Ga0496110_0014056 3300048913 Bacteria 6636
1262 Ga0496110_0026145 3300048913 Bacteria 4992
1263 Ga0496110_0027265 3300048913 Bacteria 4895
1264 Ga0496110_0074940 3300048913 Bacteria 3006
1265 Ga0496110_0080252 3300048913 Bacteria 2906
1266 Ga0496111_0000527 3300048914 Bacteria 19793
1267 Ga0496111_0000575 3300048914 Bacteria 19168
1268 Ga0496111_0000817 3300048914 Bacteria 16718
1269 Ga0496111_0003344 3300048914 Bacteria 9916
1270 Ga0496111_0028049 3300048914 Bacteria 3988
1271 Ga0496111_0037721 3300048914 Bacteria 3460
1272 Ga0496112_0004865 3300048915 Bacteria 11480
1273 Ga0496112_0009854 3300048915 Bacteria 8632
1274 Ga0496112_0061906 3300048915 Bacteria 3690
1275 Ga0496112_0068854 3300048915 Bacteria 3495
1276 Ga0496112_0130578 3300048915 Bacteria 2483
1277 Ga0496112_0131147 3300048915 Bacteria 2477
1278 Ga0496112_0194690 3300048915 Bacteria 1988
1279 Ga0496112_0249612 3300048915 Bacteria 1726
1280 Ga0496113_0004876 3300048916 Bacteria 8308
1281 Ga0496113_0049946 3300048916 Bacteria 3116
1282 Ga0496113_0092889 3300048916 Bacteria 2328
1283 Ga0496113_0115480 3300048916 Bacteria 2094
1284 Ga0496114_0000116 3300048917 Bacteria 57632
1285 Ga0496114_0000286 3300048917 Bacteria 36864
1286 Ga0496114_0011013 3300048917 Bacteria 7211
1287 Ga0496114_0027001 3300048917 Bacteria 4703
1288 Ga0496114_0036877 3300048917 Bacteria 4041
1289 Ga0496114_0040866 3300048917 Bacteria 3841
1290 Ga0496114_0050348 3300048917 Bacteria 3467
1291 Ga0496114_0072131 3300048917 Bacteria 2903
1292 Ga0496114_0140787 3300048917 Bacteria 2088
1293 Ga0496115_0002425 3300048918 Bacteria 13379
1294 Ga0496115_0002960 3300048918 Bacteria 12217
1295 Ga0496115_0049446 3300048918 Bacteria 3366
1296 Ga0496115_0060345 3300048918 Bacteria 3055
1297 Ga0496115_0104371 3300048918 Bacteria 2326
1298 Ga0496116_0000173 3300048919 Bacteria 129928
1299 Ga0496116_0000182 3300048919 Bacteria 125343
1300 Ga0496116_0001408 3300048919 Bacteria 27021
1301 Ga0496116_0002098 3300048919 Bacteria 21291
1302 Ga0496117_0000144 3300048920 Bacteria 153831
1303 Ga0496117_0000278 3300048920 Bacteria 95496
1304 Ga0496117_0001155 3300048920 Bacteria 39752
1305 Ga0496117_0005163 3300048920 Bacteria 13934
1306 Ga0496117_0041649 3300048920 Bacteria 3361
1307 Ga0496117_0072589 3300048920 Bacteria 2299
1308 Ga0496118_0000165 3300048921 Bacteria 119376
1309 Ga0496118_0000466 3300048921 Bacteria 67173
1310 Ga0496118_0019168 3300048921 Bacteria 6125
1311 Ga0496118_0022954 3300048921 Bacteria 5436
1312 Ga0496118_0094561 3300048921 Bacteria 2043
1313 Ga0496119_0000449 3300048922 Bacteria 56334
1314 Ga0496119_0001560 3300048922 Bacteria 27295
1315 Ga0496119_0002247 3300048922 Bacteria 21487
1316 Ga0496119_0003552 3300048922 Bacteria 16090
1317 Ga0496119_0004224 3300048922 Bacteria 14409
1318 Ga0496119_0009347 3300048922 Bacteria 8431
1319 Ga0496119_0015383 3300048922 Bacteria 5896
1320 Ga0496119_0051687 3300048922 Bacteria 2523
1321 Ga0496120_0000663 3300048923 Bacteria 50609
1322 Ga0496120_0002291 3300048923 Bacteria 19857
1323 Ga0496120_0012354 3300048923 Bacteria 5818
1324 Ga0496120_0029616 3300048923 Bacteria 3341
1325 Ga0496121_0000016 3300048924 Bacteria 562911
1326 Ga0496121_0009172 3300048924 Bacteria 11436
1327 Ga0496121_0015653 3300048924 Bacteria 7913
1328 Ga0496121_0016297 3300048924 Bacteria 7684
1329 Ga0496121_0112226 3300048924 Bacteria 2077
1330 Ga0496122_0000284 3300048925 Bacteria 113244
1331 Ga0496122_0017733 3300048925 Bacteria 6628
1332 Ga0496122_0018799 3300048925 Bacteria 6355
1333 Ga0496123_0008217 3300048926 Bacteria 9623
1334 Ga0496123_0028056 3300048926 Bacteria 4176
1335 Ga0496124_0000015 3300048927 Bacteria 460700
1336 Ga0496124_0005946 3300048927 Bacteria 13489
1337 Ga0496125_0000021 3300048928 Bacteria 460688
1338 Ga0496125_0007725 3300048928 Bacteria 11390
1339 Ga0496125_0032094 3300048928 Bacteria 4669
1340 Ga0496126_0000015 3300048929 Bacteria 663212
1341 Ga0496126_0000039 3300048929 Bacteria 347353
1342 Ga0496126_0000075 3300048929 Bacteria 235121
1343 Ga0496126_0000677 3300048929 Bacteria 62685
1344 Ga0496126_0000807 3300048929 Bacteria 56090
1345 Ga0496126_0003990 3300048929 Bacteria 18027
1346 Ga0496126_0008063 3300048929 Bacteria 11413
1347 Ga0496126_0041523 3300048929 Bacteria 4256
1348 Ga0496126_0045712 3300048929 Bacteria 4022
1349 Ga0496126_0067728 3300048929 Bacteria 3189
1350 Ga0496126_0071524 3300048929 Bacteria 3087
1351 Ga0495682_0015944 3300049460 Bacteria 2845
1352 Ga0501031_0000144 3300049568 Bacteria 40113
1353 Ga0501031_0008167 3300049568 Bacteria 6813
1354 Ga0501032_0002470 3300049569 Bacteria 14437
1355 Ga0501032_0007497 3300049569 Bacteria 7969
1356 Ga0501032_0011513 3300049569 Bacteria 6354
1357 Ga0501032_0039210 3300049569 Bacteria 3222
1358 Ga0501033_0002503 3300049570 Bacteria 15572
1359 Ga0501034_0001101 3300049571 Bacteria 38016
1360 Ga0501034_0007303 3300049571 Bacteria 11778
1361 Ga0501034_0059693 3300049571 Bacteria 3831
1362 Ga0501034_0091706 3300049571 Bacteria 3035
1363 Ga0501034_0290035 3300049571 Bacteria 1575
1364 Ga0501036_0003893 3300049572 Bacteria 11980
1365 Ga0501036_0007139 3300049572 Bacteria 9097
1366 Ga0501037_0000796 3300049573 Bacteria 23665
1367 Ga0501037_0003517 3300049573 Bacteria 11374
1368 Ga0501037_0003564 3300049573 Bacteria 11291
1369 Ga0501037_0087309 3300049573 Bacteria 2257
1370 Ga0501038_0001310 3300049574 Bacteria 22652
1371 Ga0501038_0002811 3300049574 Bacteria 16213
1372 Ga0501038_0003820 3300049574 Bacteria 14007
1373 Ga0501038_0008860 3300049574 Bacteria 9233
1374 Ga0501039_0001985 3300049575 Bacteria 15168
1375 Ga0501039_0004366 3300049575 Bacteria 10657
1376 Ga0501039_0081386 3300049575 Bacteria 2521
1377 Ga0501040_0008828 3300049576 Bacteria 6551
1378 Ga0501041_0018104 3300049577 Bacteria 4195
1379 Ga0501042_0118887 3300049578 Bacteria 1902
1380 Ga0501043_0000990 3300049579 Bacteria 25039
1381 Ga0501043_0006893 3300049579 Bacteria 9066
1382 Ga0501043_0038202 3300049579 Bacteria 3775
1383 Ga0501043_0113935 3300049579 Bacteria 2123
1384 Ga0501046_0000427 3300049580 Bacteria 42168
1385 Ga0501046_0002722 3300049580 Bacteria 16457
1386 Ga0501046_0077417 3300049580 Bacteria 2575
1387 Ga0501047_0002484 3300049581 Bacteria 17594
1388 Ga0501047_0034364 3300049581 Bacteria 4894
1389 Ga0501047_0060268 3300049581 Bacteria 3663
1390 Ga0501047_0071012 3300049581 Bacteria 3352
1391 Ga0501047_0076929 3300049581 Bacteria 3211
1392 Ga0501048_0000026 3300049582 Bacteria 66602
1393 Ga0501048_0002590 3300049582 Bacteria 13851
1394 Ga0501048_0004211 3300049582 Bacteria 10963
1395 Ga0501067_0010708 3300049583 Bacteria 5073
1396 Ga0501067_0056142 3300049583 Bacteria 2182
1397 Ga0501067_0067902 3300049583 Bacteria 1974
1398 Ga0501068_0008200 3300049584 Bacteria 5808
1399 Ga0501069_0000223 3300049585 Bacteria 25278
1400 Ga0501069_0000515 3300049585 Bacteria 17655
1401 Ga0501070_0000766 3300049586 Bacteria 29273
1402 Ga0501070_0001165 3300049586 Bacteria 23519
1403 Ga0501070_0001589 3300049586 Bacteria 20181
1404 Ga0501070_0001682 3300049586 Bacteria 19594
1405 Ga0501070_0002601 3300049586 Bacteria 15774
1406 Ga0501070_0003370 3300049586 Bacteria 13863
1407 Ga0501070_0003504 3300049586 Bacteria 13581
1408 Ga0501070_0038098 3300049586 Bacteria 4012
1409 Ga0501071_0013695 3300049587 Bacteria 5532
1410 Ga0501072_0003695 3300049588 Bacteria 11541
1411 Ga0501074_0008363 3300049590 Bacteria 7501
1412 Ga0501074_0014120 3300049590 Bacteria 5806
1413 Ga0501076_0073923 3300049592 Bacteria 2730
1414 Ga0501079_0000093 3300049741 Bacteria 43802
1415 Ga0501080_0000266 3300049742 Bacteria 39496
1416 Ga0501080_0003067 3300049742 Bacteria 14750
1417 Ga0501080_0009512 3300049742 Bacteria 8868
1418 Ga0501080_0010586 3300049742 Bacteria 8441
1419 Ga0501080_0016463 3300049742 Bacteria 6828
1420 Ga0501080_0170999 3300049742 Bacteria 2004
1421 Ga0501083_0030883 3300049744 Bacteria 3677
1422 Ga0501035_0001097 3300049822 Bacteria 28352
1423 Ga0501035_0001386 3300049822 Bacteria 24909
1424 Ga0501035_0016730 3300049822 Bacteria 6762
1425 Ga0501035_0021620 3300049822 Bacteria 5915
1426 Ga0501035_0044132 3300049822 Bacteria 4015
1427 Ga0501035_0177973 3300049822 Bacteria 1834
1428 Ga0501044_0001367 3300049823 Bacteria 28613
1429 Ga0501044_0004810 3300049823 Bacteria 15100
1430 Ga0501044_0008934 3300049823 Bacteria 10952
1431 Ga0501044_0010160 3300049823 Bacteria 10228
1432 Ga0501044_0100053 3300049823 Bacteria 2918
1433 Ga0501045_0035134 3300049824 Bacteria 3639
1434 Ga0501045_0077109 3300049824 Bacteria 2456
1435 Ga0501045_0128149 3300049824 Bacteria 1886
1436 nmdc:mga03683_3089_c1 3300050489 Bacteria 5293
1437 nmdc:mga03n38_78836_c1 3300050490 Bacteria 1543
1438 nmdc:mga00v17_152149_c1 3300050491 Bacteria 1487
1439 nmdc:mga00v17_2947_c1 3300050491 Bacteria 8733
1440 nmdc:mga00v17_48988_c1 3300050491 Bacteria 2561
1441 nmdc:mga00v17_5845_c1 3300050491 Bacteria 6496
1442 nmdc:mga0yw44_147755_c1 3300050492 Bacteria 1531
1443 nmdc:mga0yw44_172183_c1 3300050492 Bacteria 1422
1444 nmdc:mga0yw44_25015_c1 3300050492 Bacteria 3388
1445 nmdc:mga0yw44_66507_c1 3300050492 Bacteria 2224
1446 nmdc:mga0yw44_70038_c1 3300050492 Bacteria 2174
1447 nmdc:mga07m45_101866_c1 3300050496 Bacteria 1211
1448 nmdc:mga07m45_34034_c1 3300050496 Bacteria 2831
1449 nmdc:mga07m45_36181_c1 3300050496 Bacteria 2749
1450 nmdc:mga07m45_62048_c1 3300050496 Bacteria 2118
1451 nmdc:mga05p37_110473_c1 3300050507 Bacteria 3382
1452 nmdc:mga05p37_12466_c1 3300050507 Bacteria 10154
1453 nmdc:mga05p37_160331_c1 3300050507 Bacteria 2748
1454 nmdc:mga05p37_188068_c1 3300050507 Bacteria 2509
1455 nmdc:mga05p37_2735_c1 3300050507 Bacteria 20505
1456 nmdc:mga05p37_43393_c1 3300050507 Bacteria 5532
1457 nmdc:mga05p37_610624_c1 3300050507 Bacteria 1229
1458 nmdc:mga09592_115355_c1 3300050508 Bacteria 2305
1459 nmdc:mga09592_120387_c1 3300050508 Bacteria 2254
1460 nmdc:mga09592_138562_c1 3300050508 Bacteria 2096
1461 nmdc:mga09592_16095_c1 3300050508 Bacteria 6113
1462 nmdc:mga09592_46742_c1 3300050508 Bacteria 3646
1463 nmdc:mga09592_80423_c1 3300050508 Bacteria 2775
1464 nmdc:mga09592_87_c3 3300050508 Bacteria 23142
1465 nmdc:mga0qj67_509_c1 3300050509 Bacteria 23236
1466 nmdc:mga06r32_162003_c1 3300050510 Bacteria 2219
1467 nmdc:mga06r32_172091_c1 3300050510 Bacteria 2149
1468 nmdc:mga06r32_1913_c1 3300050510 Bacteria 18545
1469 nmdc:mga06r32_692_c3 3300050510 Bacteria 10179
1470 nmdc:mga08y16_28599_c1 3300050511 Bacteria 5876
1471 nmdc:mga08y16_39956_c1 3300050511 Bacteria 4921
1472 nmdc:mga08y16_41095_c1 3300050511 Bacteria 4845
1473 nmdc:mga08x19_52346_c1 3300050514 Bacteria 2625
1474 nmdc:mga08x19_5990_c1 3300050514 Bacteria 7190
1475 nmdc:mga0a205_12444_c1 3300050515 Bacteria 7870
1476 nmdc:mga0sz30_21727_c1 3300050516 Bacteria 2599
1477 nmdc:mga0sz30_5944_c1 3300050516 Bacteria 4501
1478 Ga0495601_0000602 3300053077 Bacteria 19111
1479 Ga0495601_0010705 3300053077 Bacteria 5470
1480 Ga0495612_0000929 3300053078 Bacteria 11998
1481 Ga0500635_0021790 3300053080 Bacteria 1979
1482 Ga0495619_0005371 3300053085 Bacteria 8113
1483 Ga0495619_0054104 3300053085 Bacteria 2656
1484 Ga0500643_003109 3300053087 Bacteria 8148
1485 Ga0500646_0000357 3300053090 Bacteria 13753
1486 Ga0500646_0029241 3300053090 Bacteria 1508
1487 Ga0500583_0003525 3300053092 Bacteria 4939
1488 Ga0500583_0071248 3300053092 Bacteria 1662
1489 Ga0500559_0004201 3300053136 Bacteria 6901
1490 Ga0500568_0000706 3300053139 Bacteria 23977
1491 Ga0500573_0088921 3300053140 Bacteria 1747
1492 Ga0500577_0074856 3300053142 Bacteria 1337
1493 Ga0500588_0004867 3300053146 Bacteria 2939
1494 Ga0500616_0009263 3300053153 Bacteria 6001
1495 Ga0500627_0006875 3300053158 Bacteria 3913
1496 Ga0500645_000032 3300053730 Bacteria 119506
1497 Ga0501084_0000239 3300054114 Bacteria 41470
1498 Ga0501084_0035629 3300054114 Bacteria 4160
1499 Ga0466962_0000056 3300061719 Bacteria 46579
1500 Ga0466962_0006087 3300061719 Bacteria 5802
1501 Ga0466962_0009800 3300061719 Bacteria 4596
1502 Ga0466962_0018078 3300061719 Bacteria 3391
1503 Ga0466962_0018089 3300061719 Bacteria 3389
1504 Ga0466962_0019198 3300061719 Bacteria 3282
1505 Ga0530510_0051283 3300061734 Bacteria 2981

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050507 nmdc:mga05p37_610624_c1 nmdc:mga05p37_610624_c1_105_1214 367
2 3300046680 Ga0495646_0177897 Ga0495646_0177897_21_1151 369
3 3300025901 Ga0207688_10089663 Ga0207688_100896633 376
4 3300041443 Ga0451789_0957144 Ga0451789_0957144_20_1171 381
5 3300048089 Ga0495614_0082573 Ga0495614_0082573_198_1373 383
6 3300046533 Ga0495640_0046303 Ga0495640_0046303_1825_2997 386
7 3300050492 nmdc:mga0yw44_70038_c1 nmdc:mga0yw44_70038_c1_973_2148 386
8 3300050496 nmdc:mga07m45_101866_c1 nmdc:mga07m45_101866_c1_17_1183 386
9 3300005334 Ga0068869_100097501 Ga0068869_1000975012 389
10 3300032168 Ga0316593_10000889 Ga0316593_100008899 389
11 3300048920 Ga0496117_0000278 Ga0496117_0000278_31936_33189 389
12 3300006844 Ga0075428_100000610 Ga0075428_10000061032 390
13 3300009094 Ga0111539_10001504 Ga0111539_1000150415 390
14 3300027907 Ga0207428_10022479 Ga0207428_100224792 390
15 3300045051 Ga0451576_0128588 Ga0451576_0128588_469_1644 390
16 3300050511 nmdc:mga08y16_28599_c1 nmdc:mga08y16_28599_c1_3572_4747 390
17 3300025907 Ga0207645_10022095 Ga0207645_100220952 396
18 3300049571 Ga0501034_0290035 Ga0501034_0290035_11_1213 400
19 3300005340 Ga0070689_100025866 Ga0070689_1000258662 401
20 3300025936 Ga0207670_10044191 Ga0207670_100441912 401
21 3300044658 Ga0466972_0011396 Ga0466972_0011396_1784_3094 404
22 3300044683 Ga0466965_0024726 Ga0466965_0024726_715_2025 404
23 3300044693 Ga0466961_0005797 Ga0466961_0005797_5984_7294 404
24 3300044706 Ga0466964_0025198 Ga0466964_0025198_509_1819 404
25 3300044719 Ga0466971_0008516 Ga0466971_0008516_2459_3769 404
26 3300044765 Ga0466970_0014696 Ga0466970_0014696_1714_3024 404
27 3300045836 Ga0466958_0028208 Ga0466958_0028208_975_2285 404
28 3300061719 Ga0466962_0019198 Ga0466962_0019198_538_1848 404
29 3300005467 Ga0070706_100167265 Ga0070706_1001672652 406
30 3300006844 Ga0075428_100174888 Ga0075428_1001748883 406
31 3300025910 Ga0207684_10143592 Ga0207684_101435922 406
32 3300009093 Ga0105240_10354671 Ga0105240_103546711 407
33 3300045976 Ga0466967_0181544 Ga0466967_0181544_352_1707 407
34 3300050491 nmdc:mga00v17_48988_c1 nmdc:mga00v17_48988_c1_81_1343 407
35 3300048916 Ga0496113_0092889 Ga0496113_0092889_704_1957 408
36 3300021384 Ga0213876_10075381 Ga0213876_100753812 409
37 3300039437 Ga0436365_1050647 Ga0436365_1050647_2124_3422 409
38 3300046516 Ga0495628_0225663 Ga0495628_0225663_120_1394 411
39 iso_pu_bacteria 2643221715 2644636244 411
40 3300048904 Ga0496101_0117477 Ga0496101_0117477_464_1774 413
41 3300048909 Ga0496106_0020907 Ga0496106_0020907_2641_3951 413
42 3300053140 Ga0500573_0088921 Ga0500573_0088921_269_1528 413
43 3300050492 nmdc:mga0yw44_147755_c1 nmdc:mga0yw44_147755_c1_22_1296 414
44 3300021384 Ga0213876_10019769 Ga0213876_100197695 415
45 3300037853 Ga0436364_1291536 Ga0436364_1291536_1032_2372 415
46 3300039437 Ga0436365_0447055 Ga0436365_0447055_408_1748 415
47 3300044693 Ga0466961_0021171 Ga0466961_0021171_1681_2982 416
48 3300005985 Ga0081539_10044321 Ga0081539_100443213 417
49 3300009098 Ga0105245_10263285 Ga0105245_102632852 417
50 3300037418 Ga0395900_0042604 Ga0395900_0042604_2902_4179 417
51 3300037471 Ga0395905_0087531 Ga0395905_0087531_678_1955 417
52 iso_pu_bacteria 2551306166 2552108222 418
53 3300048911 Ga0496108_0065466 Ga0496108_0065466_1612_2910 419
54 3300050492 nmdc:mga0yw44_172183_c1 nmdc:mga0yw44_172183_c1_23_1312 419
55 3300035695 Ga0373927_0093639 Ga0373927_0093639_556_1824 420
56 3300045976 Ga0466967_0000595 Ga0466967_0000595_7565_8830 420
57 3300046694 Ga0495649_0036673 Ga0495649_0036673_294_1634 420
58 3300048925 Ga0496122_0018799 Ga0496122_0018799_1462_2787 420
59 3300048926 Ga0496123_0028056 Ga0496123_0028056_2008_3333 420
60 3300021388 Ga0213875_10011142 Ga0213875_100111425 421
61 3300037853 Ga0436364_0238775 Ga0436364_0238775_4776_6155 421
62 iso_pu_bacteria 2902792274 2902799087 421
63 iso_pu_bacteria 2902799365 2902804385 421
64 iso_pu_bacteria 2974315732 2974319899 421
65 3300005353 Ga0070669_100004569 Ga0070669_1000045698 422
66 3300005367 Ga0070667_100000056 Ga0070667_100000056103 422
67 3300005445 Ga0070708_100008205 Ga0070708_1000082053 422
68 3300005467 Ga0070706_100009403 Ga0070706_1000094037 422
69 3300005468 Ga0070707_100001912 Ga0070707_10000191215 422
70 3300005548 Ga0070665_100006813 Ga0070665_1000068133 422
71 3300005617 Ga0068859_100000751 Ga0068859_1000007513 422
72 3300005841 Ga0068863_100002092 Ga0068863_1000020927 422
73 3300005843 Ga0068860_100000092 Ga0068860_10000009253 422
74 3300005844 Ga0068862_100000035 Ga0068862_10000003555 422
75 3300006931 Ga0097620_100000751 Ga0097620_1000007513 422
76 3300009101 Ga0105247_10000062 Ga0105247_10000062105 422
77 3300009177 Ga0105248_10000036 Ga0105248_10000036102 422
78 3300009553 Ga0105249_10000046 Ga0105249_10000046124 422
79 3300013306 Ga0163162_10054540 Ga0163162_100545403 422
80 3300014325 Ga0163163_10041882 Ga0163163_100418822 422
81 3300014325 Ga0163163_10141080 Ga0163163_101410801 422
82 3300025900 Ga0207710_10000060 Ga0207710_10000060104 422
83 3300025910 Ga0207684_10002893 Ga0207684_100028937 422
84 3300025922 Ga0207646_10022954 Ga0207646_100229544 422
85 3300025923 Ga0207681_10000788 Ga0207681_1000078818 422
86 3300025941 Ga0207711_10000073 Ga0207711_1000007385 422
87 3300025961 Ga0207712_10000042 Ga0207712_1000004257 422
88 3300026088 Ga0207641_10001094 Ga0207641_1000109416 422
89 3300028379 Ga0268266_10005174 Ga0268266_1000517414 422
90 3300028380 Ga0268265_10000051 Ga0268265_10000051125 422
91 3300028381 Ga0268264_10000108 Ga0268264_1000010882 422
92 3300048903 Ga0496100_0002943 Ga0496100_0002943_7238_8536 422
93 3300048905 Ga0496102_0000390 Ga0496102_0000390_10718_12016 422
94 3300048915 Ga0496112_0061906 Ga0496112_0061906_204_1487 422
95 3300048919 Ga0496116_0002098 Ga0496116_0002098_18439_19737 422
96 3300048920 Ga0496117_0001155 Ga0496117_0001155_11283_12581 422
97 3300048921 Ga0496118_0000165 Ga0496118_0000165_27044_28342 422
98 3300048922 Ga0496119_0003552 Ga0496119_0003552_9564_10862 422
99 3300048924 Ga0496121_0009172 Ga0496121_0009172_8178_9476 422
100 3300048928 Ga0496125_0007725 Ga0496125_0007725_387_1685 422
101 3300048929 Ga0496126_0000807 Ga0496126_0000807_23239_24537 422
102 3300050491 nmdc:mga00v17_152149_c1 nmdc:mga00v17_152149_c1_51_1382 422
103 iso_pu_bacteria 2751185725 2753037140 422
104 iso_pu_bacteria 2751185792 2753325009 422
105 iso_pu_bacteria 2902810491 2902812382 422
106 3300005329 Ga0070683_100017452 Ga0070683_1000174523 423
107 3300005435 Ga0070714_100086997 Ga0070714_1000869972 423
108 3300005436 Ga0070713_100106097 Ga0070713_1001060971 423
109 3300005535 Ga0070684_100003821 Ga0070684_1000038215 423
110 3300006038 Ga0075365_10031640 Ga0075365_100316403 423
111 3300006353 Ga0075370_10001448 Ga0075370_100014483 423
112 3300025928 Ga0207700_10122586 Ga0207700_101225862 423
113 3300025929 Ga0207664_10065900 Ga0207664_100659002 423
114 3300025929 Ga0207664_10130771 Ga0207664_101307712 423
115 3300025944 Ga0207661_10001912 Ga0207661_100019129 423
116 3300031251 Ga0265327_10000071 Ga0265327_10000071149 423
117 3300033180 Ga0307510_10089223 Ga0307510_100892232 423
118 3300046531 Ga0495665_0010808 Ga0495665_0010808_3108_4424 423
119 3300050491 nmdc:mga00v17_5845_c1 nmdc:mga00v17_5845_c1_831_2174 423
120 3300050496 nmdc:mga07m45_36181_c1 nmdc:mga07m45_36181_c1_66_1409 423
121 iso_pu_bacteria 2643221687 2644489440 423
122 iso_pu_bacteria 2738543011 2739239476 423
123 iso_pu_bacteria 2856741275 2856746188 423
124 iso_pu_bacteria 2889300758 2889301895 423
125 iso_pu_bacteria 2891395885 2891402637 423
126 iso_pu_bacteria 2891562705 2891562734 423
127 iso_pu_bacteria 2902837492 2902842205 423
128 iso_pu_bacteria 2932398195 2932400111 423
129 iso_pu_bacteria 2939582691 2939586276 423
130 iso_pu_bacteria 2939743619 2939747105 423
131 3300044706 Ga0466964_0024386 Ga0466964_0024386_282_1583 424
132 3300045049 Ga0466959_0038655 Ga0466959_0038655_519_1820 424
133 3300045836 Ga0466958_0087654 Ga0466958_0087654_501_1802 424
134 iso_pu_bacteria 2738541308 2738891357 424
135 iso_pu_bacteria 2891554331 2891554964 424
136 3300005563 Ga0068855_100038437 Ga0068855_1000384374 425
137 3300006038 Ga0075365_10040457 Ga0075365_100404573 425
138 3300006051 Ga0075364_10003691 Ga0075364_100036912 425
139 3300006186 Ga0075369_10006357 Ga0075369_100063573 425
140 3300009098 Ga0105245_10097087 Ga0105245_100970871 425
141 3300009545 Ga0105237_10000467 Ga0105237_1000046711 425
142 3300010375 Ga0105239_10003093 Ga0105239_1000309313 425
143 3300021388 Ga0213875_10016187 Ga0213875_100161873 425
144 3300025303 Ga0209051_1042780 Ga0209051_10427801 425
145 3300025914 Ga0207671_10056241 Ga0207671_100562412 425
146 3300025935 Ga0207709_10005302 Ga0207709_100053023 425
147 3300025949 Ga0207667_10102345 Ga0207667_101023453 425
148 3300031251 Ga0265327_10000021 Ga0265327_10000021124 425
149 3300037853 Ga0436364_1051432 Ga0436364_1051432_1267_2565 425
150 3300039437 Ga0436365_0939033 Ga0436365_0939033_45585_46883 425
151 3300046506 Ga0495583_0069052 Ga0495583_0069052_236_1546 425
152 3300046507 Ga0495606_0026257 Ga0495606_0026257_2616_3926 425
153 3300046663 Ga0495635_0087728 Ga0495635_0087728_583_1902 425
154 3300047320 Ga0495672_0024614 Ga0495672_0024614_121_1419 425
155 3300048921 Ga0496118_0019168 Ga0496118_0019168_1361_2659 425
156 3300048929 Ga0496126_0071524 Ga0496126_0071524_1336_2634 425
157 3300049569 Ga0501032_0007497 Ga0501032_0007497_1892_3190 425
158 3300049571 Ga0501034_0007303 Ga0501034_0007303_2178_3476 425
159 3300049572 Ga0501036_0003893 Ga0501036_0003893_5392_6690 425
160 3300049573 Ga0501037_0000796 Ga0501037_0000796_7766_9064 425
161 3300049574 Ga0501038_0002811 Ga0501038_0002811_7637_8935 425
162 3300049575 Ga0501039_0004366 Ga0501039_0004366_8173_9471 425
163 3300049579 Ga0501043_0000990 Ga0501043_0000990_17082_18380 425
164 3300049583 Ga0501067_0067902 Ga0501067_0067902_532_1830 425
165 3300049586 Ga0501070_0000766 Ga0501070_0000766_20145_21443 425
166 3300049823 Ga0501044_0100053 Ga0501044_0100053_1324_2643 425
167 3300050490 nmdc:mga03n38_78836_c1 nmdc:mga03n38_78836_c1_193_1491 425
168 3300050492 nmdc:mga0yw44_25015_c1 nmdc:mga0yw44_25015_c1_1525_2823 425
169 3300050516 nmdc:mga0sz30_21727_c1 nmdc:mga0sz30_21727_c1_852_2150 425
170 3300053080 Ga0500635_0021790 Ga0500635_0021790_261_1559 425
171 3300053087 Ga0500643_003109 Ga0500643_003109_4078_5388 425
172 3300053153 Ga0500616_0009263 Ga0500616_0009263_3660_4973 425
173 3300053158 Ga0500627_0006875 Ga0500627_0006875_139_1437 425
174 3300053730 Ga0500645_000032 Ga0500645_000032_108608_109906 425
175 iso_pu_bacteria 2738543034 2739362096 425
176 iso_pu_bacteria 2884693830 2884694345 425
177 iso_pu_bacteria 2895427314 2895435587 425
178 iso_pu_bacteria 2895442618 2895444240 425
179 3300009176 Ga0105242_10092703 Ga0105242_100927033 426
180 3300025931 Ga0207644_10107041 Ga0207644_101070412 426
181 3300025972 Ga0207668_10000918 Ga0207668_1000091819 426
182 3300048903 Ga0496100_0000461 Ga0496100_0000461_10529_11842 426
183 3300048909 Ga0496106_0002018 Ga0496106_0002018_1799_3112 426
184 3300048910 Ga0496107_0026359 Ga0496107_0026359_404_1717 426
185 3300053142 Ga0500577_0074856 Ga0500577_0074856_11_1324 426
186 iso_pu_bacteria 2643221692 2644516049 426
187 iso_pu_bacteria 2899370129 2899370663 426
188 iso_pu_bacteria 3001119090 3001120186 426
189 3300003792 Ga0055540_1011637 Ga0055540_10116372 427
190 3300025303 Ga0209051_1000620 Ga0209051_100062020 427
191 3300025303 Ga0209051_1000933 Ga0209051_100093317 427
192 3300025303 Ga0209051_1001428 Ga0209051_10014289 427
193 3300026041 Ga0207639_10005809 Ga0207639_100058095 427
194 3300041456 Ga0451795_0111892 Ga0451795_0111892_851_2167 427
195 3300042438 Ga0439459_0000473 Ga0439459_0000473_2295_3593 427
196 3300047472 Ga0495686_0000637 Ga0495686_0000637_28740_30056 427
197 3300050516 nmdc:mga0sz30_5944_c1 nmdc:mga0sz30_5944_c1_424_1740 427
198 iso_pu_bacteria 2738543005 2739205419 427
199 3300002459 JGI24751J29686_10016334 JGI24751J29686_100163341 428
200 3300003792 Ga0055540_1000003 Ga0055540_100000312 428
201 3300005335 Ga0070666_10017287 Ga0070666_100172872 428
202 3300005347 Ga0070668_100024803 Ga0070668_1000248033 428
203 3300005367 Ga0070667_100000854 Ga0070667_10000085420 428
204 3300005842 Ga0068858_100068586 Ga0068858_1000685863 428
205 3300005981 Ga0081538_10070670 Ga0081538_100706702 428
206 3300006038 Ga0075365_10072687 Ga0075365_100726873 428
207 3300006186 Ga0075369_10044254 Ga0075369_100442542 428
208 3300006353 Ga0075370_10063851 Ga0075370_100638512 428
209 3300009177 Ga0105248_10075304 Ga0105248_100753044 428
210 3300009551 Ga0105238_10085210 Ga0105238_100852103 428
211 3300011119 Ga0105246_10040638 Ga0105246_100406382 428
212 3300013104 Ga0157370_10040559 Ga0157370_100405593 428
213 3300013306 Ga0163162_10094916 Ga0163162_100949162 428
214 3300014325 Ga0163163_10013354 Ga0163163_100133545 428
215 3300014969 Ga0157376_10003944 Ga0157376_100039445 428
216 3300025303 Ga0209051_1000011 Ga0209051_1000011584 428
217 3300025903 Ga0207680_10004709 Ga0207680_100047095 428
218 3300025916 Ga0207663_10062232 Ga0207663_100622322 428
219 3300025939 Ga0207665_10019025 Ga0207665_100190255 428
220 3300025941 Ga0207711_10099817 Ga0207711_100998172 428
221 3300025961 Ga0207712_10076219 Ga0207712_100762192 428
222 3300025972 Ga0207668_10030292 Ga0207668_100302923 428
223 3300025986 Ga0207658_10000449 Ga0207658_1000044924 428
224 3300025986 Ga0207658_10005595 Ga0207658_1000559512 428
225 3300026023 Ga0207677_10035072 Ga0207677_100350722 428
226 3300026078 Ga0207702_10239809 Ga0207702_102398092 428
227 3300026116 Ga0207674_10201721 Ga0207674_102017212 428
228 3300028379 Ga0268266_10003190 Ga0268266_1000319019 428
229 3300028379 Ga0268266_10084004 Ga0268266_100840043 428
230 3300028381 Ga0268264_10075422 Ga0268264_100754223 428
231 3300035083 Ga0373926_0009791 Ga0373926_0009791_1394_2704 428
232 3300035410 Ga0373924_0013950 Ga0373924_0013950_1000_2328 428
233 3300035692 Ga0373935_0004907 Ga0373935_0004907_5207_6517 428
234 3300035725 Ga0373947_0000039 Ga0373947_0000039_26154_27464 428
235 3300044658 Ga0466972_0028907 Ga0466972_0028907_95_1414 428
236 3300044735 Ga0466968_0016662 Ga0466968_0016662_445_1764 428
237 3300044765 Ga0466970_0054821 Ga0466970_0054821_636_1955 428
238 3300045836 Ga0466958_0042780 Ga0466958_0042780_798_2117 428
239 3300046454 Ga0495592_0094071 Ga0495592_0094071_153_1481 428
240 3300046463 Ga0495653_0022314 Ga0495653_0022314_2791_4119 428
241 3300046529 Ga0495652_0018073 Ga0495652_0018073_3057_4385 428
242 3300046533 Ga0495640_0045514 Ga0495640_0045514_336_1664 428
243 3300046536 Ga0495587_0000907 Ga0495587_0000907_5297_6625 428
244 3300046675 Ga0495657_0066629 Ga0495657_0066629_168_1496 428
245 3300046679 Ga0495623_0026038 Ga0495623_0026038_2115_3443 428
246 3300046809 Ga0495600_0005439 Ga0495600_0005439_2129_3457 428
247 3300047444 Ga0495675_0034556 Ga0495675_0034556_348_1676 428
248 3300047471 Ga0495684_0042296 Ga0495684_0042296_847_2196 428
249 3300048903 Ga0496100_0000067 Ga0496100_0000067_31510_32838 428
250 3300048904 Ga0496101_0000099 Ga0496101_0000099_36949_38277 428
251 3300048905 Ga0496102_0046711 Ga0496102_0046711_849_2177 428
252 3300048906 Ga0496103_0000116 Ga0496103_0000116_9038_10366 428
253 3300048907 Ga0496104_0133115 Ga0496104_0133115_938_2266 428
254 3300048908 Ga0496105_0020163 Ga0496105_0020163_511_1839 428
255 3300048909 Ga0496106_0101504 Ga0496106_0101504_515_1843 428
256 3300048910 Ga0496107_0000254 Ga0496107_0000254_15743_17071 428
257 3300048911 Ga0496108_0000959 Ga0496108_0000959_4370_5698 428
258 3300048911 Ga0496108_0005688 Ga0496108_0005688_7957_9285 428
259 3300048911 Ga0496108_0067004 Ga0496108_0067004_16_1335 428
260 3300048912 Ga0496109_0000159 Ga0496109_0000159_26264_27592 428
261 3300048913 Ga0496110_0008200 Ga0496110_0008200_2481_3809 428
262 3300048914 Ga0496111_0003344 Ga0496111_0003344_6204_7532 428
263 3300048915 Ga0496112_0130578 Ga0496112_0130578_255_1583 428
264 3300048915 Ga0496112_0131147 Ga0496112_0131147_72_1391 428
265 3300048917 Ga0496114_0000116 Ga0496114_0000116_36938_38266 428
266 3300048919 Ga0496116_0001408 Ga0496116_0001408_13924_15252 428
267 3300048920 Ga0496117_0072589 Ga0496117_0072589_548_1876 428
268 3300048921 Ga0496118_0094561 Ga0496118_0094561_296_1624 428
269 3300048922 Ga0496119_0004224 Ga0496119_0004224_2487_3815 428
270 3300048924 Ga0496121_0000016 Ga0496121_0000016_340103_341431 428
271 3300048925 Ga0496122_0000284 Ga0496122_0000284_54022_55350 428
272 3300048926 Ga0496123_0008217 Ga0496123_0008217_888_2216 428
273 3300048927 Ga0496124_0000015 Ga0496124_0000015_36959_38287 428
274 3300048928 Ga0496125_0000021 Ga0496125_0000021_422414_423742 428
275 3300048929 Ga0496126_0000015 Ga0496126_0000015_422414_423742 428
276 3300049571 Ga0501034_0059693 Ga0501034_0059693_1723_3042 428
277 3300049574 Ga0501038_0008860 Ga0501038_0008860_7228_8580 428
278 3300049580 Ga0501046_0077417 Ga0501046_0077417_182_1534 428
279 3300049581 Ga0501047_0076929 Ga0501047_0076929_1469_2821 428
280 3300049822 Ga0501035_0044132 Ga0501035_0044132_2147_3499 428
281 3300049824 Ga0501045_0035134 Ga0501045_0035134_795_2147 428
282 3300050492 nmdc:mga0yw44_66507_c1 nmdc:mga0yw44_66507_c1_621_1949 428
283 3300050496 nmdc:mga07m45_62048_c1 nmdc:mga07m45_62048_c1_234_1553 428
284 3300050514 nmdc:mga08x19_52346_c1 nmdc:mga08x19_52346_c1_944_2272 428
285 3300053077 Ga0495601_0000602 Ga0495601_0000602_5548_6897 428
286 iso_pu_bacteria 2928142448 2928144866 428
287 3300006880 Ga0075429_100144942 Ga0075429_1001449422 429
288 3300044683 Ga0466965_0024585 Ga0466965_0024585_682_2004 429
289 3300048916 Ga0496113_0049946 Ga0496113_0049946_1620_2927 429
290 3300048925 Ga0496122_0017733 Ga0496122_0017733_1287_2594 429
291 3300048929 Ga0496126_0003990 Ga0496126_0003990_5979_7286 429
292 iso_pu_bacteria 2558860280 2559428650 429
293 iso_pu_bacteria 2862281513 2862286751 429
294 iso_pu_bacteria 2919713450 2919713859 429
295 iso_pu_bacteria 3002998708 3003000808 429
296 3300005327 Ga0070658_10000319 Ga0070658_1000031916 430
297 3300005336 Ga0070680_100000061 Ga0070680_1000000618 430
298 3300005458 Ga0070681_10001025 Ga0070681_100010258 430
299 3300005530 Ga0070679_100001551 Ga0070679_10000155113 430
300 3300005937 Ga0081455_10015911 Ga0081455_100159116 430
301 3300006844 Ga0075428_100400186 Ga0075428_1004001861 430
302 3300020070 Ga0206356_11084540 Ga0206356_110845403 430
303 3300020077 Ga0206351_10970124 Ga0206351_109701241 430
304 3300025909 Ga0207705_10002002 Ga0207705_100020023 430
305 3300025917 Ga0207660_10000115 Ga0207660_1000011518 430
306 3300046471 Ga0495650_0016688 Ga0495650_0016688_2378_3694 430
307 3300050510 nmdc:mga06r32_172091_c1 nmdc:mga06r32_172091_c1_813_2120 430
308 iso_pu_bacteria 2547132424 2548696252 430
309 iso_pu_bacteria 2842134933 2842138788 430
310 iso_pu_bacteria 2866612099 2866617239 430
311 iso_pu_bacteria 2899370129 2899373771 430
312 iso_pu_bacteria 2917736166 2917741264 430
313 iso_pu_bacteria 2956939328 2956941385 430
314 3300039450 Ga0436363_1431793 Ga0436363_1431793_326_1666 431
315 3300048918 Ga0496115_0060345 Ga0496115_0060345_519_1856 431
316 iso_pu_bacteria 2582581312 2585299412 431
317 iso_pu_bacteria 2643221578 2643902794 431
318 iso_pu_bacteria 2643221601 2644017233 431
319 iso_pu_bacteria 2643221631 2644173806 431
320 iso_pu_bacteria 2643221673 2644404697 431
321 iso_pu_bacteria 2643221678 2644439217 431
322 iso_pu_bacteria 2795385470 2795781345 431
323 iso_pu_bacteria 2808606359 2808843222 431
324 iso_pu_bacteria 2808606375 2808912807 431
325 iso_pu_bacteria 2808606375 2808921570 431
326 iso_pu_bacteria 2808606982 2811845203 431
327 iso_pu_bacteria 2811994879 2812356826 431
328 iso_pu_bacteria 2816332139 2816505690 431
329 iso_pu_bacteria 2862290372 2862292202 431
330 iso_pu_bacteria 2875391855 2875395928 431
331 iso_pu_bacteria 2912715099 2912718568 431
332 iso_pu_bacteria 2929212328 2929214389 431
333 iso_pu_bacteria 2946045630 2946048707 431
334 iso_pu_bacteria 2946064051 2946069045 431
335 iso_pu_bacteria 8025478263 8025480867 431
336 iso_pu_bacteria 8033684223 8033686785 431
337 iso_pu_bacteria 8053945823 8053948518 431
338 3300005471 Ga0070698_100008833 Ga0070698_1000088335 432
339 3300005539 Ga0068853_100017068 Ga0068853_1000170686 432
340 3300005937 Ga0081455_10015182 Ga0081455_100151827 432
341 3300005937 Ga0081455_10015517 Ga0081455_100155174 432
342 3300005981 Ga0081538_10022725 Ga0081538_100227253 432
343 3300009147 Ga0114129_10091266 Ga0114129_100912663 432
344 3300009551 Ga0105238_10032638 Ga0105238_100326384 432
345 3300013307 Ga0157372_10466967 Ga0157372_104669671 432
346 3300020069 Ga0197907_11041682 Ga0197907_110416822 432
347 3300025915 Ga0207693_10118340 Ga0207693_101183402 432
348 3300025924 Ga0207694_10023506 Ga0207694_100235063 432
349 3300026041 Ga0207639_10050377 Ga0207639_100503772 432
350 3300030521 Ga0307511_10000590 Ga0307511_1000059025 432
351 3300035119 Ga0373956_0033163 Ga0373956_0033163_415_1788 432
352 3300044656 Ga0466969_0004118 Ga0466969_0004118_1512_2834 432
353 3300044684 Ga0466966_0080943 Ga0466966_0080943_376_1698 432
354 3300044693 Ga0466961_0029146 Ga0466961_0029146_1767_3089 432
355 3300044735 Ga0466968_0003834 Ga0466968_0003834_2693_4021 432
356 3300045049 Ga0466959_0099313 Ga0466959_0099313_209_1531 432
357 3300046501 Ga0495607_0070996 Ga0495607_0070996_223_1602 432
358 3300049581 Ga0501047_0060268 Ga0501047_0060268_691_2010 432
359 3300049581 Ga0501047_0071012 Ga0501047_0071012_877_2223 432
360 3300049822 Ga0501035_0001386 Ga0501035_0001386_19545_20864 432
361 3300049823 Ga0501044_0001367 Ga0501044_0001367_22641_23960 432
362 3300050507 nmdc:mga05p37_188068_c1 nmdc:mga05p37_188068_c1_119_1432 432
363 iso_pu_bacteria 2867475112 2867479151 432
364 iso_pu_bacteria 2883821847 2883826516 432
365 iso_pu_bacteria 2912723979 2912730885 432
366 iso_pu_bacteria 3006425503 3006427226 432
367 3300001990 JGI24737J22298_10019288 JGI24737J22298_100192882 433
368 3300001991 JGI24743J22301_10007272 JGI24743J22301_100072722 433
369 3300002073 JGI24745J21846_1003962 JGI24745J21846_10039622 433
370 3300002075 JGI24738J21930_10014650 JGI24738J21930_100146502 433
371 3300002077 JGI24744J21845_10000088 JGI24744J21845_100000886 433
372 3300002244 JGI24742J22300_10000442 JGI24742J22300_100004423 433
373 3300005329 Ga0070683_100074305 Ga0070683_1000743052 433
374 3300005330 Ga0070690_100021350 Ga0070690_1000213505 433
375 3300005334 Ga0068869_100003836 Ga0068869_1000038363 433
376 3300005335 Ga0070666_10076122 Ga0070666_100761222 433
377 3300005337 Ga0070682_100015617 Ga0070682_1000156172 433
378 3300005338 Ga0068868_100001480 Ga0068868_10000148010 433
379 3300005338 Ga0068868_100052582 Ga0068868_1000525823 433
380 3300005338 Ga0068868_100095458 Ga0068868_1000954582 433
381 3300005339 Ga0070660_100056785 Ga0070660_1000567853 433
382 3300005340 Ga0070689_100026796 Ga0070689_1000267962 433
383 3300005341 Ga0070691_10004160 Ga0070691_100041603 433
384 3300005343 Ga0070687_100010502 Ga0070687_1000105023 433
385 3300005347 Ga0070668_100001192 Ga0070668_1000011929 433
386 3300005353 Ga0070669_100022235 Ga0070669_1000222353 433
387 3300005356 Ga0070674_100000187 Ga0070674_10000018722 433
388 3300005356 Ga0070674_100123412 Ga0070674_1001234122 433
389 3300005364 Ga0070673_100245360 Ga0070673_1002453602 433
390 3300005367 Ga0070667_100003985 Ga0070667_10000398510 433
391 3300005437 Ga0070710_10000277 Ga0070710_1000027713 433
392 3300005438 Ga0070701_10000584 Ga0070701_1000058413 433
393 3300005439 Ga0070711_100000493 Ga0070711_1000004939 433
394 3300005440 Ga0070705_100004099 Ga0070705_1000040997 433
395 3300005441 Ga0070700_100003730 Ga0070700_1000037306 433
396 3300005444 Ga0070694_100024042 Ga0070694_1000240426 433
397 3300005455 Ga0070663_100065685 Ga0070663_1000656852 433
398 3300005456 Ga0070678_100000280 Ga0070678_10000028021 433
399 3300005457 Ga0070662_100001491 Ga0070662_1000014916 433
400 3300005459 Ga0068867_100002048 Ga0068867_1000020487 433
401 3300005467 Ga0070706_100021841 Ga0070706_1000218415 433
402 3300005467 Ga0070706_100028028 Ga0070706_1000280285 433
403 3300005535 Ga0070684_100088166 Ga0070684_1000881662 433
404 3300005539 Ga0068853_100001367 Ga0068853_10000136715 433
405 3300005545 Ga0070695_100021815 Ga0070695_1000218153 433
406 3300005546 Ga0070696_100002977 Ga0070696_1000029771 433
407 3300005549 Ga0070704_100001052 Ga0070704_10000105210 433
408 3300005578 Ga0068854_100000458 Ga0068854_10000045818 433
409 3300005615 Ga0070702_100000308 Ga0070702_1000003082 433
410 3300005617 Ga0068859_100064675 Ga0068859_1000646754 433
411 3300005718 Ga0068866_10000187 Ga0068866_1000018721 433
412 3300005718 Ga0068866_10066629 Ga0068866_100666292 433
413 3300005719 Ga0068861_100000195 Ga0068861_10000019521 433
414 3300005842 Ga0068858_100070309 Ga0068858_1000703092 433
415 3300005843 Ga0068860_100001932 Ga0068860_1000019328 433
416 3300005844 Ga0068862_100033018 Ga0068862_1000330184 433
417 3300005985 Ga0081539_10072764 Ga0081539_100727642 433
418 3300006028 Ga0070717_10049357 Ga0070717_100493573 433
419 3300006048 Ga0075363_100040686 Ga0075363_1000406863 433
420 3300006048 Ga0075363_100058072 Ga0075363_1000580722 433
421 3300006051 Ga0075364_10001965 Ga0075364_100019658 433
422 3300006051 Ga0075364_10017939 Ga0075364_100179395 433
423 3300006051 Ga0075364_10051014 Ga0075364_100510142 433
424 3300006163 Ga0070715_10005907 Ga0070715_100059073 433
425 3300006173 Ga0070716_100007171 Ga0070716_1000071714 433
426 3300006175 Ga0070712_100001061 Ga0070712_10000106114 433
427 3300006177 Ga0075362_10021385 Ga0075362_100213853 433
428 3300006186 Ga0075369_10002244 Ga0075369_100022443 433
429 3300006186 Ga0075369_10046171 Ga0075369_100461712 433
430 3300006353 Ga0075370_10034607 Ga0075370_100346073 433
431 3300006358 Ga0068871_100093095 Ga0068871_1000930952 433
432 3300006844 Ga0075428_100030689 Ga0075428_1000306896 433
433 3300006846 Ga0075430_100034036 Ga0075430_1000340362 433
434 3300006847 Ga0075431_100171475 Ga0075431_1001714752 433
435 3300006881 Ga0068865_100003084 Ga0068865_1000030842 433
436 3300006931 Ga0097620_100064675 Ga0097620_1000646754 433
437 3300009094 Ga0111539_10100066 Ga0111539_101000663 433
438 3300009098 Ga0105245_10000870 Ga0105245_1000087014 433
439 3300009101 Ga0105247_10000637 Ga0105247_1000063716 433
440 3300009147 Ga0114129_10185214 Ga0114129_101852143 433
441 3300009148 Ga0105243_10001020 Ga0105243_100010209 433
442 3300009176 Ga0105242_10000650 Ga0105242_1000065013 433
443 3300009177 Ga0105248_10201205 Ga0105248_102012052 433
444 3300009177 Ga0105248_10238833 Ga0105248_102388331 433
445 3300009553 Ga0105249_10001186 Ga0105249_1000118621 433
446 3300010375 Ga0105239_10008819 Ga0105239_100088199 433
447 3300010375 Ga0105239_10147161 Ga0105239_101471612 433
448 3300011119 Ga0105246_10083890 Ga0105246_100838902 433
449 3300013296 Ga0157374_10203151 Ga0157374_102031512 433
450 3300013297 Ga0157378_10029056 Ga0157378_100290562 433
451 3300013306 Ga0163162_10001609 Ga0163162_100016097 433
452 3300013307 Ga0157372_10004145 Ga0157372_100041459 433
453 3300013308 Ga0157375_10000419 Ga0157375_1000041923 433
454 3300014326 Ga0157380_10056783 Ga0157380_100567832 433
455 3300015262 Ga0182007_10006330 Ga0182007_100063304 433
456 3300017792 Ga0163161_10004818 Ga0163161_100048184 433
457 3300017792 Ga0163161_10021838 Ga0163161_100218382 433
458 3300017792 Ga0163161_10025906 Ga0163161_100259062 433
459 3300025898 Ga0207692_10006547 Ga0207692_100065476 433
460 3300025899 Ga0207642_10000726 Ga0207642_1000072615 433
461 3300025900 Ga0207710_10000890 Ga0207710_1000089010 433
462 3300025901 Ga0207688_10000177 Ga0207688_100001778 433
463 3300025901 Ga0207688_10001785 Ga0207688_100017854 433
464 3300025903 Ga0207680_10074674 Ga0207680_100746742 433
465 3300025905 Ga0207685_10001985 Ga0207685_100019853 433
466 3300025914 Ga0207671_10038644 Ga0207671_100386443 433
467 3300025915 Ga0207693_10000339 Ga0207693_1000033940 433
468 3300025918 Ga0207662_10013813 Ga0207662_100138135 433
469 3300025918 Ga0207662_10020422 Ga0207662_100204223 433
470 3300025919 Ga0207657_10129847 Ga0207657_101298472 433
471 3300025920 Ga0207649_10150627 Ga0207649_101506272 433
472 3300025927 Ga0207687_10003312 Ga0207687_100033123 433
473 3300025932 Ga0207690_10022295 Ga0207690_100222954 433
474 3300025933 Ga0207706_10002589 Ga0207706_1000258913 433
475 3300025934 Ga0207686_10001637 Ga0207686_100016379 433
476 3300025935 Ga0207709_10001393 Ga0207709_100013936 433
477 3300025936 Ga0207670_10142032 Ga0207670_101420322 433
478 3300025937 Ga0207669_10000205 Ga0207669_1000020517 433
479 3300025938 Ga0207704_10000618 Ga0207704_1000061811 433
480 3300025939 Ga0207665_10006357 Ga0207665_100063578 433
481 3300025941 Ga0207711_10009126 Ga0207711_100091265 433
482 3300025941 Ga0207711_10125273 Ga0207711_101252732 433
483 3300025944 Ga0207661_10064146 Ga0207661_100641463 433
484 3300025944 Ga0207661_10187600 Ga0207661_101876002 433
485 3300025960 Ga0207651_10209457 Ga0207651_102094571 433
486 3300025961 Ga0207712_10015171 Ga0207712_100151713 433
487 3300025972 Ga0207668_10006483 Ga0207668_100064833 433
488 3300025972 Ga0207668_10011491 Ga0207668_100114916 433
489 3300025981 Ga0207640_10003652 Ga0207640_100036524 433
490 3300025986 Ga0207658_10053121 Ga0207658_100531213 433
491 3300026023 Ga0207677_10011197 Ga0207677_100111977 433
492 3300026023 Ga0207677_10036316 Ga0207677_100363162 433
493 3300026035 Ga0207703_10002964 Ga0207703_1000296412 433
494 3300026041 Ga0207639_10047931 Ga0207639_100479312 433
495 3300026067 Ga0207678_10037057 Ga0207678_100370576 433
496 3300026067 Ga0207678_10051777 Ga0207678_100517772 433
497 3300026089 Ga0207648_10000623 Ga0207648_1000062336 433
498 3300026118 Ga0207675_100001672 Ga0207675_10000167210 433
499 3300026118 Ga0207675_100033946 Ga0207675_1000339463 433
500 3300026121 Ga0207683_10000539 Ga0207683_1000053910 433
501 3300026142 Ga0207698_10309789 Ga0207698_103097891 433
502 3300028379 Ga0268266_10106405 Ga0268266_101064053 433
503 3300028380 Ga0268265_10015530 Ga0268265_100155307 433
504 3300028381 Ga0268264_10004939 Ga0268264_1000493916 433
505 3300028794 Ga0307515_10033888 Ga0307515_100338887 433
506 3300030521 Ga0307511_10002042 Ga0307511_1000204216 433
507 3300030522 Ga0307512_10006290 Ga0307512_1000629012 433
508 3300031456 Ga0307513_10007971 Ga0307513_100079715 433
509 3300031507 Ga0307509_10149351 Ga0307509_101493512 433
510 3300031731 Ga0307405_10127210 Ga0307405_101272102 433
511 3300031824 Ga0307413_10018416 Ga0307413_100184162 433
512 3300031852 Ga0307410_10024255 Ga0307410_100242551 433
513 3300031852 Ga0307410_10054371 Ga0307410_100543713 433
514 3300035398 Ga0316574_0061945 Ga0316574_0061945_974_2311 433
515 3300041410 Ga0439461_0001991 Ga0439461_0001991_1122_2456 433
516 3300041411 Ga0439466_0004599 Ga0439466_0004599_2483_3817 433
517 3300041413 Ga0439465_0008298 Ga0439465_0008298_1915_3255 433
518 3300041413 Ga0439465_0009044 Ga0439465_0009044_1417_2751 433
519 3300041997 Ga0439431_0005807 Ga0439431_0005807_123_1457 433
520 3300042004 Ga0439445_0003352 Ga0439445_0003352_194_1528 433
521 3300044694 Ga0466963_0010639 Ga0466963_0010639_1336_2643 433
522 3300044694 Ga0466963_0016897 Ga0466963_0016897_786_2111 433
523 3300044694 Ga0466963_0040311 Ga0466963_0040311_459_1784 433
524 3300044842 Ga0466957_0012041 Ga0466957_0012041_3300_4607 433
525 3300044901 Ga0466960_0001775 Ga0466960_0001775_3990_5315 433
526 3300045836 Ga0466958_0011259 Ga0466958_0011259_188_1495 433
527 3300045836 Ga0466958_0019285 Ga0466958_0019285_807_2132 433
528 3300045976 Ga0466967_0001175 Ga0466967_0001175_8021_9346 433
529 3300045976 Ga0466967_0009226 Ga0466967_0009226_1201_2526 433
530 3300046455 Ga0495603_0027419 Ga0495603_0027419_1422_2753 433
531 3300047319 Ga0495674_0055153 Ga0495674_0055153_448_1779 433
532 3300047443 Ga0495687_003306 Ga0495687_003306_9066_10403 433
533 3300048903 Ga0496100_0173793 Ga0496100_0173793_131_1465 433
534 3300048904 Ga0496101_0001394 Ga0496101_0001394_1726_3060 433
535 3300048905 Ga0496102_0003032 Ga0496102_0003032_9751_11085 433
536 3300048905 Ga0496102_0089145 Ga0496102_0089145_1182_2516 433
537 3300048905 Ga0496102_0127161 Ga0496102_0127161_56_1390 433
538 3300048909 Ga0496106_0000424 Ga0496106_0000424_13447_14781 433
539 3300048910 Ga0496107_0000079 Ga0496107_0000079_28549_29883 433
540 3300048912 Ga0496109_0069929 Ga0496109_0069929_1210_2544 433
541 3300048912 Ga0496109_0075199 Ga0496109_0075199_1558_2889 433
542 3300048913 Ga0496110_0014056 Ga0496110_0014056_4547_5881 433
543 3300048913 Ga0496110_0074940 Ga0496110_0074940_1446_2750 433
544 3300048915 Ga0496112_0004865 Ga0496112_0004865_3716_5047 433
545 3300048915 Ga0496112_0009854 Ga0496112_0009854_4788_6122 433
546 3300048915 Ga0496112_0249612 Ga0496112_0249612_205_1536 433
547 3300048917 Ga0496114_0011013 Ga0496114_0011013_5074_6408 433
548 3300048917 Ga0496114_0140787 Ga0496114_0140787_30_1364 433
549 3300048918 Ga0496115_0002425 Ga0496115_0002425_10780_12114 433
550 3300048929 Ga0496126_0008063 Ga0496126_0008063_6006_7331 433
551 3300049569 Ga0501032_0011513 Ga0501032_0011513_496_1821 433
552 3300049571 Ga0501034_0001101 Ga0501034_0001101_10228_11553 433
553 3300049573 Ga0501037_0003517 Ga0501037_0003517_9983_11308 433
554 3300049576 Ga0501040_0008828 Ga0501040_0008828_1128_2462 433
555 3300049577 Ga0501041_0018104 Ga0501041_0018104_2350_3684 433
556 3300049578 Ga0501042_0118887 Ga0501042_0118887_550_1884 433
557 3300049579 Ga0501043_0113935 Ga0501043_0113935_719_2044 433
558 3300049580 Ga0501046_0002722 Ga0501046_0002722_7567_8892 433
559 3300049581 Ga0501047_0002484 Ga0501047_0002484_5003_6328 433
560 3300049582 Ga0501048_0002590 Ga0501048_0002590_2082_3407 433
561 3300049586 Ga0501070_0001682 Ga0501070_0001682_11437_12762 433
562 3300049588 Ga0501072_0003695 Ga0501072_0003695_4688_6022 433
563 3300049592 Ga0501076_0073923 Ga0501076_0073923_410_1744 433
564 3300049742 Ga0501080_0009512 Ga0501080_0009512_4840_6165 433
565 3300049822 Ga0501035_0001097 Ga0501035_0001097_2045_3370 433
566 3300049822 Ga0501035_0177973 Ga0501035_0177973_96_1424 433
567 3300049823 Ga0501044_0004810 Ga0501044_0004810_1638_2963 433
568 3300050489 nmdc:mga03683_3089_c1 nmdc:mga03683_3089_c1_2479_3819 433
569 3300050491 nmdc:mga00v17_2947_c1 nmdc:mga00v17_2947_c1_92_1432 433
570 3300050496 nmdc:mga07m45_34034_c1 nmdc:mga07m45_34034_c1_658_2001 433
571 3300050508 nmdc:mga09592_115355_c1 nmdc:mga09592_115355_c1_256_1563 433
572 3300050510 nmdc:mga06r32_162003_c1 nmdc:mga06r32_162003_c1_378_1712 433
573 3300054114 Ga0501084_0035629 Ga0501084_0035629_2692_4026 433
574 3300061734 Ga0530510_0051283 Ga0530510_0051283_522_1856 433
575 iso_pu_bacteria 2501939600 2501945555 433
576 iso_pu_bacteria 2515154088 2515497893 433
577 iso_pu_bacteria 2515154129 2515720789 433
578 iso_pu_bacteria 2515154137 2515759014 433
579 iso_pu_bacteria 2515154155 2515852236 433
580 iso_pu_bacteria 2515154202 2516085727 433
581 iso_pu_bacteria 2515154203 2516090690 433
582 iso_pu_bacteria 2585427649 2586064689 433
583 iso_pu_bacteria 2622736626 2623586153 433
584 iso_pu_bacteria 2772190715 2772641348 433
585 iso_pu_bacteria 2818991472 2819741114 433
586 iso_pu_bacteria 2831935698 2831938277 433
587 iso_pu_bacteria 2832004796 2832009697 433
588 iso_pu_bacteria 2855670206 2855676681 433
589 iso_pu_bacteria 2855676851 2855683271 433
590 iso_pu_bacteria 2855683550 2855685019 433
591 iso_pu_bacteria 2856858025 2856860054 433
592 iso_pu_bacteria 2857288857 2857295018 433
593 iso_pu_bacteria 2858848962 2858852275 433
594 iso_pu_bacteria 2858868258 2858868911 433
595 iso_pu_bacteria 2858882152 2858888208 433
596 iso_pu_bacteria 2858888857 2858890386 433
597 iso_pu_bacteria 2858895516 2858898961 433
598 iso_pu_bacteria 2858902515 2858905233 433
599 iso_pu_bacteria 2866065130 2866068993 433
600 iso_pu_bacteria 2867302475 2867304310 433
601 iso_pu_bacteria 2867312974 2867313640 433
602 iso_pu_bacteria 2867319477 2867322535 433
603 iso_pu_bacteria 2867369537 2867373116 433
604 iso_pu_bacteria 2867507094 2867509696 433
605 iso_pu_bacteria 2869048445 2869052138 433
606 iso_pu_bacteria 2869061728 2869061989 433
607 iso_pu_bacteria 2869068681 2869073967 433
608 iso_pu_bacteria 2880495981 2880498227 433
609 iso_pu_bacteria 2887478801 2887483547 433
610 iso_pu_bacteria 2902582711 2902587479 433
611 iso_pu_bacteria 2915768154 2915773507 433
612 iso_pu_bacteria 2929219909 2929220268 433
613 iso_pu_bacteria 2929226422 2929226803 433
614 iso_pu_bacteria 2990088156 2990091294 433
615 iso_pu_bacteria 2996221748 2996226236 433
616 iso_pu_bacteria 649633069 649810539 433
617 iso_pu_bacteria 8003830390 8003834810 433
618 iso_pu_bacteria 8003856774 8003860826 433
619 iso_pu_bacteria 8003870546 8003875000 433
620 iso_pu_bacteria 8054704163 8054707202 433
621 iso_pu_bacteria 8054727385 8054728157 433
622 iso_pu_bacteria 8054734606 8054736481 433
623 iso_pu_bacteria 8055412473 8055415592 433
624 3300005435 Ga0070714_100006750 Ga0070714_1000067503 434
625 3300005530 Ga0070679_100067837 Ga0070679_1000678373 434
626 3300005616 Ga0068852_100046729 Ga0068852_1000467292 434
627 3300005985 Ga0081539_10036577 Ga0081539_100365773 434
628 3300006844 Ga0075428_100311879 Ga0075428_1003118792 434
629 3300006846 Ga0075430_100067840 Ga0075430_1000678402 434
630 3300021388 Ga0213875_10002364 Ga0213875_100023647 434
631 3300025918 Ga0207662_10084502 Ga0207662_100845022 434
632 3300025925 Ga0207650_10208497 Ga0207650_102084972 434
633 3300025929 Ga0207664_10003864 Ga0207664_1000386412 434
634 3300025940 Ga0207691_10123103 Ga0207691_101231032 434
635 3300025942 Ga0207689_10047196 Ga0207689_100471963 434
636 3300025949 Ga0207667_10146731 Ga0207667_101467312 434
637 3300026142 Ga0207698_10014728 Ga0207698_100147284 434
638 3300028794 Ga0307515_10037382 Ga0307515_100373827 434
639 3300030522 Ga0307512_10024887 Ga0307512_100248874 434
640 3300031838 Ga0307518_10004772 Ga0307518_100047723 434
641 3300031901 Ga0307406_10181694 Ga0307406_101816942 434
642 3300033179 Ga0307507_10016917 Ga0307507_100169175 434
643 3300033180 Ga0307510_10116839 Ga0307510_101168393 434
644 3300035207 Ga0373942_0000196 Ga0373942_0000196_4237_5553 434
645 3300037853 Ga0436364_0823558 Ga0436364_0823558_3621_4955 434
646 3300039437 Ga0436365_1908396 Ga0436365_1908396_6174_7511 434
647 3300041512 Ga0451853_2614358 Ga0451853_2614358_212_1525 434
648 3300044656 Ga0466969_0049407 Ga0466969_0049407_216_1532 434
649 3300044683 Ga0466965_0007146 Ga0466965_0007146_1854_3176 434
650 3300044693 Ga0466961_0002892 Ga0466961_0002892_399_1715 434
651 3300044694 Ga0466963_0019383 Ga0466963_0019383_2307_3629 434
652 3300044719 Ga0466971_0003748 Ga0466971_0003748_769_2091 434
653 3300044765 Ga0466970_0051351 Ga0466970_0051351_716_2035 434
654 3300044842 Ga0466957_0013266 Ga0466957_0013266_2541_3863 434
655 3300045976 Ga0466967_0002012 Ga0466967_0002012_7403_8725 434
656 3300045976 Ga0466967_0055472 Ga0466967_0055472_975_2321 434
657 3300045976 Ga0466967_0266619 Ga0466967_0266619_34_1359 434
658 3300048917 Ga0496114_0000286 Ga0496114_0000286_32925_34319 434
659 3300049586 Ga0501070_0002601 Ga0501070_0002601_1108_2433 434
660 3300050508 nmdc:mga09592_120387_c1 nmdc:mga09592_120387_c1_289_1605 434
661 3300053136 Ga0500559_0004201 Ga0500559_0004201_1405_2748 434
662 3300061719 Ga0466962_0018089 Ga0466962_0018089_1062_2384 434
663 iso_pu_bacteria 2558860112 2558912601 434
664 iso_pu_bacteria 2675903059 2676484056 434
665 iso_pu_bacteria 2775506925 2776371566 434
666 iso_pu_bacteria 2795385472 2795791688 434
667 iso_pu_bacteria 2808606522 2809586083 434
668 iso_pu_bacteria 2862705112 2862710215 434
669 iso_pu_bacteria 2863067949 2863070217 434
670 iso_pu_bacteria 2866552031 2866555677 434
671 iso_pu_bacteria 2880489317 2880494103 434
672 iso_pu_bacteria 8008485437 8008490388 434
673 iso_pu_bacteria 8025524527 8025529690 434
674 iso_pu_bacteria 8055157932 8055160552 434
675 3300002067 JGI24735J21928_10011371 JGI24735J21928_100113712 435
676 3300005327 Ga0070658_10010607 Ga0070658_100106075 435
677 3300005618 Ga0068864_100010645 Ga0068864_1000106456 435
678 3300005841 Ga0068863_100066840 Ga0068863_1000668403 435
679 3300005842 Ga0068858_100047379 Ga0068858_1000473793 435
680 3300005843 Ga0068860_100187925 Ga0068860_1001879252 435
681 3300006844 Ga0075428_100007051 Ga0075428_10000705112 435
682 3300006844 Ga0075428_100007414 Ga0075428_10000741412 435
683 3300006846 Ga0075430_100015607 Ga0075430_1000156074 435
684 3300006846 Ga0075430_100041690 Ga0075430_1000416902 435
685 3300006847 Ga0075431_100012865 Ga0075431_1000128657 435
686 3300006847 Ga0075431_100060345 Ga0075431_1000603454 435
687 3300006880 Ga0075429_100009820 Ga0075429_1000098205 435
688 3300006880 Ga0075429_100016282 Ga0075429_1000162825 435
689 3300009011 Ga0105251_10030178 Ga0105251_100301782 435
690 3300009092 Ga0105250_10018756 Ga0105250_100187562 435
691 3300009147 Ga0114129_10000852 Ga0114129_100008524 435
692 3300009177 Ga0105248_10039835 Ga0105248_100398354 435
693 3300014325 Ga0163163_10008079 Ga0163163_100080794 435
694 3300015688 Ga0183367_1002 Ga0183367_1002881 435
695 3300025735 Ga0207713_1047252 Ga0207713_10472522 435
696 3300025909 Ga0207705_10014666 Ga0207705_100146666 435
697 3300025915 Ga0207693_10067864 Ga0207693_100678642 435
698 3300025927 Ga0207687_10077886 Ga0207687_100778862 435
699 3300026035 Ga0207703_10061458 Ga0207703_100614582 435
700 3300026088 Ga0207641_10013167 Ga0207641_100131673 435
701 3300026121 Ga0207683_10055797 Ga0207683_100557973 435
702 3300031456 Ga0307513_10009861 Ga0307513_100098618 435
703 3300031548 Ga0307408_100189282 Ga0307408_1001892822 435
704 3300031649 Ga0307514_10006847 Ga0307514_100068476 435
705 3300031824 Ga0307413_10000862 Ga0307413_100008624 435
706 3300031852 Ga0307410_10096536 Ga0307410_100965362 435
707 3300031901 Ga0307406_10082326 Ga0307406_100823262 435
708 3300032002 Ga0307416_100006145 Ga0307416_1000061454 435
709 3300032004 Ga0307414_10106356 Ga0307414_101063562 435
710 3300033180 Ga0307510_10055624 Ga0307510_100556243 435
711 3300035117 Ga0373953_0002560 Ga0373953_0002560_895_2214 435
712 3300035398 Ga0316574_0058180 Ga0316574_0058180_457_1833 435
713 3300036401 Ga0373937_0086281 Ga0373937_0086281_1129_2448 435
714 3300036712 Ga0316584_0000281 Ga0316584_0000281_821_2197 435
715 3300037312 Ga0395899_0053281 Ga0395899_0053281_1295_2614 435
716 3300037418 Ga0395900_0008791 Ga0395900_0008791_5080_6399 435
717 3300037466 Ga0395898_0011400 Ga0395898_0011400_4905_6224 435
718 3300037466 Ga0395898_0136410 Ga0395898_0136410_907_2229 435
719 3300037471 Ga0395905_0023889 Ga0395905_0023889_201_1520 435
720 3300038443 Ga0395901_0033677 Ga0395901_0033677_1745_3064 435
721 3300041404 Ga0439436_0000647 Ga0439436_0000647_6463_7785 435
722 3300041406 Ga0439439_0010546 Ga0439439_0010546_153_1475 435
723 3300041999 Ga0439433_0001382 Ga0439433_0001382_2952_4274 435
724 3300042014 Ga0439457_000479 Ga0439457_000479_129_1451 435
725 3300044694 Ga0466963_0032161 Ga0466963_0032161_402_1712 435
726 3300046459 Ga0495629_0032233 Ga0495629_0032233_125_1447 435
727 3300046459 Ga0495629_0122824 Ga0495629_0122824_337_1653 435
728 3300046499 Ga0495594_0045170 Ga0495594_0045170_16_1332 435
729 3300046684 Ga0495669_0019460 Ga0495669_0019460_266_1573 435
730 3300046689 Ga0495613_0003081 Ga0495613_0003081_4460_5782 435
731 3300047318 Ga0495636_0021632 Ga0495636_0021632_1220_2542 435
732 3300048909 Ga0496106_0008649 Ga0496106_0008649_1180_2556 435
733 3300048913 Ga0496110_0011646 Ga0496110_0011646_68_1384 435
734 3300048914 Ga0496111_0000575 Ga0496111_0000575_53_1369 435
735 3300050507 nmdc:mga05p37_160331_c1 nmdc:mga05p37_160331_c1_265_1584 435
736 3300050507 nmdc:mga05p37_2735_c1 nmdc:mga05p37_2735_c1_17386_18699 435
737 3300050508 nmdc:mga09592_16095_c1 nmdc:mga09592_16095_c1_555_1874 435
738 3300050508 nmdc:mga09592_87_c3 nmdc:mga09592_87_c3_1969_3282 435
739 3300050509 nmdc:mga0qj67_509_c1 nmdc:mga0qj67_509_c1_1849_3162 435
740 3300050510 nmdc:mga06r32_1913_c1 nmdc:mga06r32_1913_c1_15384_16697 435
741 3300053085 Ga0495619_0054104 Ga0495619_0054104_154_1473 435
742 3300053090 Ga0500646_0000357 Ga0500646_0000357_8804_10120 435
743 3300053090 Ga0500646_0029241 Ga0500646_0029241_145_1461 435
744 3300053092 Ga0500583_0003525 Ga0500583_0003525_2575_3891 435
745 3300053146 Ga0500588_0004867 Ga0500588_0004867_842_2158 435
746 iso_pu_bacteria 2767802112 2768643398 435
747 iso_pu_bacteria 2867346516 2867351643 435
748 iso_pu_bacteria 2870782633 2870788453 435
749 iso_pu_bacteria 8001781756 8001789401 435
750 iso_pu_bacteria 8054472261 8054473473 435
751 iso_pu_bacteria 8056054917 8056060064 435
752 iso_pu_bacteria 8056207758 8056212431 435
753 3300003203 JGI25406J46586_10001934 JGI25406J46586_100019349 436
754 3300003354 JGI25160J50197_1021813 JGI25160J50197_10218132 436
755 3300005329 Ga0070683_100025549 Ga0070683_1000255495 436
756 3300005329 Ga0070683_100151142 Ga0070683_1001511422 436
757 3300005331 Ga0070670_100065296 Ga0070670_1000652963 436
758 3300005334 Ga0068869_100015543 Ga0068869_1000155434 436
759 3300005334 Ga0068869_100041488 Ga0068869_1000414883 436
760 3300005337 Ga0070682_100024558 Ga0070682_1000245581 436
761 3300005338 Ga0068868_100016132 Ga0068868_1000161322 436
762 3300005347 Ga0070668_100046862 Ga0070668_1000468623 436
763 3300005354 Ga0070675_100000392 Ga0070675_10000039223 436
764 3300005355 Ga0070671_100001259 Ga0070671_10000125911 436
765 3300005366 Ga0070659_100107419 Ga0070659_1001074192 436
766 3300005367 Ga0070667_100012230 Ga0070667_1000122304 436
767 3300005435 Ga0070714_100000011 Ga0070714_10000001166 436
768 3300005435 Ga0070714_100110626 Ga0070714_1001106262 436
769 3300005436 Ga0070713_100152745 Ga0070713_1001527452 436
770 3300005441 Ga0070700_100000046 Ga0070700_10000004639 436
771 3300005441 Ga0070700_100026657 Ga0070700_1000266572 436
772 3300005456 Ga0070678_100059459 Ga0070678_1000594592 436
773 3300005545 Ga0070695_100036124 Ga0070695_1000361243 436
774 3300005546 Ga0070696_100030003 Ga0070696_1000300033 436
775 3300005548 Ga0070665_100001617 Ga0070665_10000161726 436
776 3300005548 Ga0070665_100056517 Ga0070665_1000565171 436
777 3300005548 Ga0070665_100075774 Ga0070665_1000757744 436
778 3300005549 Ga0070704_100129626 Ga0070704_1001296262 436
779 3300005563 Ga0068855_100010555 Ga0068855_1000105556 436
780 3300005563 Ga0068855_100050888 Ga0068855_1000508883 436
781 3300005564 Ga0070664_100020153 Ga0070664_1000201536 436
782 3300005614 Ga0068856_100068491 Ga0068856_1000684913 436
783 3300005614 Ga0068856_100093039 Ga0068856_1000930392 436
784 3300005616 Ga0068852_100020000 Ga0068852_1000200004 436
785 3300005841 Ga0068863_100000345 Ga0068863_1000003453 436
786 3300005841 Ga0068863_100014417 Ga0068863_1000144175 436
787 3300005841 Ga0068863_100076174 Ga0068863_1000761742 436
788 3300005843 Ga0068860_100000054 Ga0068860_100000054182 436
789 3300005843 Ga0068860_100122269 Ga0068860_1001222692 436
790 3300005843 Ga0068860_100184455 Ga0068860_1001844552 436
791 3300005844 Ga0068862_100036238 Ga0068862_1000362383 436
792 3300005937 Ga0081455_10000262 Ga0081455_1000026256 436
793 3300005937 Ga0081455_10001346 Ga0081455_1000134615 436
794 3300005937 Ga0081455_10015517 Ga0081455_100155173 436
795 3300005983 Ga0081540_1002205 Ga0081540_10022058 436
796 3300005983 Ga0081540_1015235 Ga0081540_10152354 436
797 3300005985 Ga0081539_10000086 Ga0081539_10000086166 436
798 3300006048 Ga0075363_100019672 Ga0075363_1000196723 436
799 3300006175 Ga0070712_100009444 Ga0070712_1000094444 436
800 3300006846 Ga0075430_100007092 Ga0075430_1000070925 436
801 3300006847 Ga0075431_100056189 Ga0075431_1000561894 436
802 3300006871 Ga0075434_100291348 Ga0075434_1002913481 436
803 3300006881 Ga0068865_100053951 Ga0068865_1000539513 436
804 3300009093 Ga0105240_10003639 Ga0105240_1000363915 436
805 3300009093 Ga0105240_10194704 Ga0105240_101947042 436
806 3300009094 Ga0111539_10002724 Ga0111539_100027244 436
807 3300009098 Ga0105245_10005605 Ga0105245_100056053 436
808 3300009101 Ga0105247_10000038 Ga0105247_10000038120 436
809 3300009101 Ga0105247_10009210 Ga0105247_100092104 436
810 3300009174 Ga0105241_10025845 Ga0105241_100258454 436
811 3300009176 Ga0105242_10103959 Ga0105242_101039593 436
812 3300009177 Ga0105248_10045424 Ga0105248_100454243 436
813 3300009177 Ga0105248_10134247 Ga0105248_101342472 436
814 3300009545 Ga0105237_10014748 Ga0105237_100147486 436
815 3300010375 Ga0105239_10323128 Ga0105239_103231282 436
816 3300011119 Ga0105246_10062558 Ga0105246_100625583 436
817 3300013104 Ga0157370_10014109 Ga0157370_100141096 436
818 3300013104 Ga0157370_10016416 Ga0157370_100164162 436
819 3300013105 Ga0157369_10048565 Ga0157369_100485654 436
820 3300013105 Ga0157369_10065749 Ga0157369_100657493 436
821 3300013307 Ga0157372_10000069 Ga0157372_100000699 436
822 3300013308 Ga0157375_10097169 Ga0157375_100971693 436
823 3300014325 Ga0163163_10095860 Ga0163163_100958603 436
824 3300014326 Ga0157380_10162506 Ga0157380_101625061 436
825 3300014745 Ga0157377_10003983 Ga0157377_100039837 436
826 3300014968 Ga0157379_10008843 Ga0157379_100088432 436
827 3300014968 Ga0157379_10045149 Ga0157379_100451492 436
828 3300020069 Ga0197907_10824310 Ga0197907_108243102 436
829 3300020610 Ga0154015_1539966 Ga0154015_15399662 436
830 3300021388 Ga0213875_10017198 Ga0213875_100171983 436
831 3300022467 Ga0224712_10008703 Ga0224712_100087032 436
832 3300025297 Ga0209758_1005072 Ga0209758_100507211 436
833 3300025302 Ga0207426_1002674 Ga0207426_10026748 436
834 3300025302 Ga0207426_1004723 Ga0207426_10047237 436
835 3300025900 Ga0207710_10000017 Ga0207710_1000001759 436
836 3300025900 Ga0207710_10017562 Ga0207710_100175624 436
837 3300025901 Ga0207688_10000985 Ga0207688_100009855 436
838 3300025903 Ga0207680_10019714 Ga0207680_100197143 436
839 3300025904 Ga0207647_10041404 Ga0207647_100414043 436
840 3300025906 Ga0207699_10071370 Ga0207699_100713702 436
841 3300025913 Ga0207695_10017340 Ga0207695_100173403 436
842 3300025915 Ga0207693_10001185 Ga0207693_1000118511 436
843 3300025916 Ga0207663_10035253 Ga0207663_100352533 436
844 3300025919 Ga0207657_10062164 Ga0207657_100621642 436
845 3300025925 Ga0207650_10077853 Ga0207650_100778532 436
846 3300025926 Ga0207659_10014966 Ga0207659_100149665 436
847 3300025927 Ga0207687_10034677 Ga0207687_100346772 436
848 3300025928 Ga0207700_10124281 Ga0207700_101242812 436
849 3300025929 Ga0207664_10000001 Ga0207664_10000001444 436
850 3300025929 Ga0207664_10044386 Ga0207664_100443863 436
851 3300025931 Ga0207644_10000976 Ga0207644_1000097611 436
852 3300025933 Ga0207706_10007779 Ga0207706_100077794 436
853 3300025938 Ga0207704_10107026 Ga0207704_101070262 436
854 3300025939 Ga0207665_10009000 Ga0207665_100090002 436
855 3300025941 Ga0207711_10006606 Ga0207711_100066063 436
856 3300025941 Ga0207711_10016330 Ga0207711_100163304 436
857 3300025942 Ga0207689_10071434 Ga0207689_100714343 436
858 3300025944 Ga0207661_10026607 Ga0207661_100266073 436
859 3300025944 Ga0207661_10076749 Ga0207661_100767492 436
860 3300025945 Ga0207679_10006663 Ga0207679_100066634 436
861 3300025945 Ga0207679_10260636 Ga0207679_102606362 436
862 3300025949 Ga0207667_10009549 Ga0207667_100095496 436
863 3300025949 Ga0207667_10027730 Ga0207667_100277304 436
864 3300025961 Ga0207712_10210514 Ga0207712_102105141 436
865 3300025981 Ga0207640_10068543 Ga0207640_100685433 436
866 3300025986 Ga0207658_10076757 Ga0207658_100767572 436
867 3300026023 Ga0207677_10038832 Ga0207677_100388323 436
868 3300026023 Ga0207677_10043595 Ga0207677_100435953 436
869 3300026067 Ga0207678_10008815 Ga0207678_100088153 436
870 3300026075 Ga0207708_10000002 Ga0207708_1000000256 436
871 3300026078 Ga0207702_10009828 Ga0207702_100098287 436
872 3300026088 Ga0207641_10001703 Ga0207641_1000170310 436
873 3300026088 Ga0207641_10057479 Ga0207641_100574793 436
874 3300026088 Ga0207641_10237589 Ga0207641_102375892 436
875 3300026116 Ga0207674_10015850 Ga0207674_100158506 436
876 3300026118 Ga0207675_100115421 Ga0207675_1001154212 436
877 3300026121 Ga0207683_10001164 Ga0207683_1000116410 436
878 3300027907 Ga0207428_10030910 Ga0207428_100309101 436
879 3300028379 Ga0268266_10014863 Ga0268266_100148636 436
880 3300028379 Ga0268266_10146164 Ga0268266_101461642 436
881 3300028380 Ga0268265_10036439 Ga0268265_100364392 436
882 3300028381 Ga0268264_10000097 Ga0268264_1000009745 436
883 3300028381 Ga0268264_10091589 Ga0268264_100915893 436
884 3300031727 Ga0316576_10004023 Ga0316576_100040238 436
885 3300031727 Ga0316576_10017633 Ga0316576_100176333 436
886 3300031727 Ga0316576_10114347 Ga0316576_101143472 436
887 3300031728 Ga0316578_10069683 Ga0316578_100696831 436
888 3300031731 Ga0307405_10000804 Ga0307405_100008049 436
889 3300031731 Ga0307405_10024124 Ga0307405_100241243 436
890 3300031824 Ga0307413_10034067 Ga0307413_100340672 436
891 3300031824 Ga0307413_10160841 Ga0307413_101608411 436
892 3300031901 Ga0307406_10075140 Ga0307406_100751401 436
893 3300031901 Ga0307406_10131537 Ga0307406_101315372 436
894 3300031903 Ga0307407_10002514 Ga0307407_100025144 436
895 3300031995 Ga0307409_100000409 Ga0307409_10000040922 436
896 3300031995 Ga0307409_100012688 Ga0307409_1000126882 436
897 3300032002 Ga0307416_100007073 Ga0307416_1000070732 436
898 3300032126 Ga0307415_100000021 Ga0307415_1000000215 436
899 3300032126 Ga0307415_100003770 Ga0307415_1000037703 436
900 3300032126 Ga0307415_100004822 Ga0307415_1000048225 436
901 3300032126 Ga0307415_100052948 Ga0307415_1000529482 436
902 3300032139 Ga0316580_10019075 Ga0316580_100190752 436
903 3300034820 Ga0373959_0014790 Ga0373959_0014790_90_1406 436
904 3300035207 Ga0373942_0012372 Ga0373942_0012372_224_1540 436
905 3300035691 Ga0373931_0048658 Ga0373931_0048658_96_1412 436
906 3300036647 Ga0316582_0097304 Ga0316582_0097304_248_1636 436
907 3300036712 Ga0316584_0102955 Ga0316584_0102955_445_1833 436
908 3300037418 Ga0395900_0182565 Ga0395900_0182565_780_2111 436
909 3300037466 Ga0395898_0119080 Ga0395898_0119080_65_1396 436
910 3300037853 Ga0436364_0696641 Ga0436364_0696641_1539_2885 436
911 3300042131 Ga0450894_000878 Ga0450894_000878_138_1478 436
912 3300042135 Ga0450899_000129 Ga0450899_000129_4631_5971 436
913 3300042876 Ga0451577_0066941 Ga0451577_0066941_815_2158 436
914 3300044658 Ga0466972_0039438 Ga0466972_0039438_697_2049 436
915 3300044658 Ga0466972_0057374 Ga0466972_0057374_357_1676 436
916 3300044683 Ga0466965_0026949 Ga0466965_0026949_747_2099 436
917 3300044684 Ga0466966_0006474 Ga0466966_0006474_4876_6204 436
918 3300044693 Ga0466961_0024210 Ga0466961_0024210_1330_2655 436
919 3300044694 Ga0466963_0003573 Ga0466963_0003573_4002_5330 436
920 3300044694 Ga0466963_0074602 Ga0466963_0074602_636_1964 436
921 3300044735 Ga0466968_0061106 Ga0466968_0061106_100_1425 436
922 3300044765 Ga0466970_0022106 Ga0466970_0022106_1678_3003 436
923 3300044765 Ga0466970_0032443 Ga0466970_0032443_1229_2581 436
924 3300044901 Ga0466960_0001139 Ga0466960_0001139_7948_9288 436
925 3300044901 Ga0466960_0007316 Ga0466960_0007316_830_2170 436
926 3300045049 Ga0466959_0018130 Ga0466959_0018130_337_1662 436
927 3300045836 Ga0466958_0009782 Ga0466958_0009782_2960_4285 436
928 3300045836 Ga0466958_0034449 Ga0466958_0034449_55_1374 436
929 3300045976 Ga0466967_0001407 Ga0466967_0001407_6671_7999 436
930 3300045976 Ga0466967_0002261 Ga0466967_0002261_8518_9837 436
931 3300045976 Ga0466967_0005637 Ga0466967_0005637_7077_8405 436
932 3300045976 Ga0466967_0017233 Ga0466967_0017233_3603_4931 436
933 3300045976 Ga0466967_0102881 Ga0466967_0102881_1108_2433 436
934 3300046453 Ga0495627_008543 Ga0495627_008543_1604_2947 436
935 3300046455 Ga0495603_0014289 Ga0495603_0014289_1492_2835 436
936 3300046459 Ga0495629_0075214 Ga0495629_0075214_141_1475 436
937 3300046492 Ga0495585_0017360 Ga0495585_0017360_2099_3442 436
938 3300046499 Ga0495594_0001342 Ga0495594_0001342_5021_6364 436
939 3300046501 Ga0495607_0027985 Ga0495607_0027985_1422_2765 436
940 3300046506 Ga0495583_0014310 Ga0495583_0014310_688_2031 436
941 3300046507 Ga0495606_0021271 Ga0495606_0021271_2444_3787 436
942 3300046513 Ga0495616_0004473 Ga0495616_0004473_5239_6582 436
943 3300046515 Ga0495620_0070009 Ga0495620_0070009_68_1411 436
944 3300046518 Ga0495631_0003096 Ga0495631_0003096_3459_4802 436
945 3300046520 Ga0495637_0015812 Ga0495637_0015812_1196_2539 436
946 3300046530 Ga0495654_0032188 Ga0495654_0032188_1095_2438 436
947 3300046538 Ga0495609_0007988 Ga0495609_0007988_1567_2910 436
948 3300046542 Ga0495597_0028324 Ga0495597_0028324_1195_2538 436
949 3300046557 Ga0495622_0006694 Ga0495622_0006694_3455_4798 436
950 3300046616 Ga0495668_0064041 Ga0495668_0064041_312_1655 436
951 3300046648 Ga0495611_0030633 Ga0495611_0030633_99_1442 436
952 3300046660 Ga0495625_0044373 Ga0495625_0044373_1197_2540 436
953 3300046665 Ga0495661_0007473 Ga0495661_0007473_531_1874 436
954 3300046794 Ga0495589_0068244 Ga0495589_0068244_370_1713 436
955 3300046810 Ga0495660_0055775 Ga0495660_0055775_727_2070 436
956 3300047321 Ga0495676_0028819 Ga0495676_0028819_1470_2813 436
957 3300047443 Ga0495687_001147 Ga0495687_001147_9323_10666 436
958 3300047443 Ga0495687_024126 Ga0495687_024126_679_2022 436
959 3300047447 Ga0495685_008578 Ga0495685_008578_1084_2427 436
960 3300047472 Ga0495686_0042822 Ga0495686_0042822_1357_2700 436
961 3300048091 Ga0495626_0007219 Ga0495626_0007219_260_1603 436
962 3300048903 Ga0496100_0015097 Ga0496100_0015097_312_1640 436
963 3300048903 Ga0496100_0065715 Ga0496100_0065715_723_2039 436
964 3300048904 Ga0496101_0045811 Ga0496101_0045811_1165_2493 436
965 3300048905 Ga0496102_0000013 Ga0496102_0000013_10259_11581 436
966 3300048905 Ga0496102_0000048 Ga0496102_0000048_44442_45770 436
967 3300048905 Ga0496102_0000175 Ga0496102_0000175_15422_16735 436
968 3300048905 Ga0496102_0073478 Ga0496102_0073478_1147_2463 436
969 3300048906 Ga0496103_0000018 Ga0496103_0000018_70313_71641 436
970 3300048906 Ga0496103_0000039 Ga0496103_0000039_83786_85108 436
971 3300048907 Ga0496104_0007024 Ga0496104_0007024_1644_2960 436
972 3300048908 Ga0496105_0012606 Ga0496105_0012606_3585_4913 436
973 3300048908 Ga0496105_0024253 Ga0496105_0024253_1634_2950 436
974 3300048908 Ga0496105_0092674 Ga0496105_0092674_750_2066 436
975 3300048911 Ga0496108_0003817 Ga0496108_0003817_7966_9282 436
976 3300048912 Ga0496109_0004668 Ga0496109_0004668_8692_10020 436
977 3300048912 Ga0496109_0008285 Ga0496109_0008285_4019_5335 436
978 3300048912 Ga0496109_0012040 Ga0496109_0012040_3817_5133 436
979 3300048912 Ga0496109_0015418 Ga0496109_0015418_3624_4943 436
980 3300048913 Ga0496110_0004660 Ga0496110_0004660_2012_3340 436
981 3300048913 Ga0496110_0026145 Ga0496110_0026145_851_2179 436
982 3300048914 Ga0496111_0028049 Ga0496111_0028049_1605_2921 436
983 3300048914 Ga0496111_0037721 Ga0496111_0037721_947_2275 436
984 3300048916 Ga0496113_0115480 Ga0496113_0115480_130_1458 436
985 3300048917 Ga0496114_0027001 Ga0496114_0027001_3159_4565 436
986 3300048917 Ga0496114_0072131 Ga0496114_0072131_1278_2594 436
987 3300048918 Ga0496115_0002960 Ga0496115_0002960_1010_2326 436
988 3300048919 Ga0496116_0000173 Ga0496116_0000173_114898_116226 436
989 3300048920 Ga0496117_0000144 Ga0496117_0000144_47355_48683 436
990 3300048921 Ga0496118_0000466 Ga0496118_0000466_13929_15257 436
991 3300048922 Ga0496119_0000449 Ga0496119_0000449_21151_22470 436
992 3300048922 Ga0496119_0001560 Ga0496119_0001560_3297_4625 436
993 3300048922 Ga0496119_0002247 Ga0496119_0002247_1077_2429 436
994 3300048923 Ga0496120_0000663 Ga0496120_0000663_43169_44521 436
995 3300048923 Ga0496120_0002291 Ga0496120_0002291_15119_16447 436
996 3300048923 Ga0496120_0012354 Ga0496120_0012354_3739_5058 436
997 3300048924 Ga0496121_0015653 Ga0496121_0015653_1306_2634 436
998 3300048924 Ga0496121_0112226 Ga0496121_0112226_214_1566 436
999 3300048927 Ga0496124_0005946 Ga0496124_0005946_11730_13058 436
1000 3300048928 Ga0496125_0032094 Ga0496125_0032094_1370_2698 436
1001 3300048929 Ga0496126_0000677 Ga0496126_0000677_13988_15316 436
1002 3300049460 Ga0495682_0015944 Ga0495682_0015944_672_2015 436
1003 3300049568 Ga0501031_0000144 Ga0501031_0000144_5670_7022 436
1004 3300049568 Ga0501031_0008167 Ga0501031_0008167_5101_6414 436
1005 3300049569 Ga0501032_0002470 Ga0501032_0002470_324_1637 436
1006 3300049569 Ga0501032_0039210 Ga0501032_0039210_1161_2513 436
1007 3300049570 Ga0501033_0002503 Ga0501033_0002503_11067_12419 436
1008 3300049571 Ga0501034_0091706 Ga0501034_0091706_1450_2802 436
1009 3300049572 Ga0501036_0007139 Ga0501036_0007139_448_1800 436
1010 3300049573 Ga0501037_0003564 Ga0501037_0003564_7543_8895 436
1011 3300049573 Ga0501037_0087309 Ga0501037_0087309_606_1919 436
1012 3300049574 Ga0501038_0001310 Ga0501038_0001310_8607_9920 436
1013 3300049574 Ga0501038_0003820 Ga0501038_0003820_9524_10876 436
1014 3300049575 Ga0501039_0001985 Ga0501039_0001985_3455_4807 436
1015 3300049575 Ga0501039_0081386 Ga0501039_0081386_578_1918 436
1016 3300049579 Ga0501043_0006893 Ga0501043_0006893_1929_3281 436
1017 3300049579 Ga0501043_0038202 Ga0501043_0038202_1650_2963 436
1018 3300049580 Ga0501046_0000427 Ga0501046_0000427_1564_2916 436
1019 3300049581 Ga0501047_0034364 Ga0501047_0034364_2833_4185 436
1020 3300049582 Ga0501048_0000026 Ga0501048_0000026_12784_14097 436
1021 3300049582 Ga0501048_0004211 Ga0501048_0004211_1450_2802 436
1022 3300049583 Ga0501067_0056142 Ga0501067_0056142_640_1992 436
1023 3300049584 Ga0501068_0008200 Ga0501068_0008200_3297_4649 436
1024 3300049585 Ga0501069_0000515 Ga0501069_0000515_14642_15994 436
1025 3300049586 Ga0501070_0003504 Ga0501070_0003504_11069_12421 436
1026 3300049587 Ga0501071_0013695 Ga0501071_0013695_2183_3535 436
1027 3300049590 Ga0501074_0008363 Ga0501074_0008363_1000_2352 436
1028 3300049742 Ga0501080_0010586 Ga0501080_0010586_3829_5181 436
1029 3300049742 Ga0501080_0170999 Ga0501080_0170999_75_1406 436
1030 3300049744 Ga0501083_0030883 Ga0501083_0030883_444_1796 436
1031 3300049822 Ga0501035_0016730 Ga0501035_0016730_3315_4628 436
1032 3300049822 Ga0501035_0021620 Ga0501035_0021620_710_2062 436
1033 3300049823 Ga0501044_0008934 Ga0501044_0008934_1161_2513 436
1034 3300050508 nmdc:mga09592_138562_c1 nmdc:mga09592_138562_c1_521_1840 436
1035 3300050510 nmdc:mga06r32_692_c3 nmdc:mga06r32_692_c3_2741_4057 436
1036 3300050511 nmdc:mga08y16_39956_c1 nmdc:mga08y16_39956_c1_2984_4303 436
1037 3300054114 Ga0501084_0000239 Ga0501084_0000239_3259_4611 436
1038 iso_pu_bacteria 2582581314 2585319173 436
1039 iso_pu_bacteria 2643221714 2644633404 436
1040 iso_pu_bacteria 2861520306 2861525285 436
1041 iso_pu_bacteria 2863404153 2863411672 436
1042 iso_pu_bacteria 2873151551 2873154783 436
1043 iso_pu_bacteria 2915358134 2915362918 436
1044 iso_pu_bacteria 3006493962 3006499684 436
1045 iso_pu_bacteria 8002784119 8002789843 436
1046 iso_pu_bacteria 8008574985 8008577896 436
1047 iso_pu_bacteria 8056667051 8056669307 436
1048 iso_pu_bacteria 8056829672 8056833865 436
1049 iso_pu_bacteria 8057568493 8057574016 436
1050 3300001976 JGI24752J21851_1003471 JGI24752J21851_10034712 437
1051 3300002459 JGI24751J29686_10005336 JGI24751J29686_100053361 437
1052 3300003203 JGI25406J46586_10015066 JGI25406J46586_100150663 437
1053 3300003203 JGI25406J46586_10021225 JGI25406J46586_100212252 437
1054 3300005328 Ga0070676_10011568 Ga0070676_100115683 437
1055 3300005331 Ga0070670_100046760 Ga0070670_1000467603 437
1056 3300005334 Ga0068869_100001172 Ga0068869_10000117217 437
1057 3300005337 Ga0070682_100034343 Ga0070682_1000343433 437
1058 3300005338 Ga0068868_100125388 Ga0068868_1001253882 437
1059 3300005339 Ga0070660_100009555 Ga0070660_1000095553 437
1060 3300005341 Ga0070691_10056891 Ga0070691_100568911 437
1061 3300005343 Ga0070687_100066214 Ga0070687_1000662142 437
1062 3300005344 Ga0070661_100038413 Ga0070661_1000384133 437
1063 3300005345 Ga0070692_10010462 Ga0070692_100104622 437
1064 3300005347 Ga0070668_100001297 Ga0070668_1000012973 437
1065 3300005354 Ga0070675_100010873 Ga0070675_1000108733 437
1066 3300005355 Ga0070671_100001780 Ga0070671_10000178011 437
1067 3300005364 Ga0070673_100022227 Ga0070673_1000222273 437
1068 3300005366 Ga0070659_100023288 Ga0070659_1000232884 437
1069 3300005367 Ga0070667_100051103 Ga0070667_1000511032 437
1070 3300005367 Ga0070667_100134697 Ga0070667_1001346972 437
1071 3300005435 Ga0070714_100163353 Ga0070714_1001633532 437
1072 3300005436 Ga0070713_100003953 Ga0070713_1000039537 437
1073 3300005441 Ga0070700_100090058 Ga0070700_1000900582 437
1074 3300005455 Ga0070663_100015215 Ga0070663_1000152154 437
1075 3300005458 Ga0070681_10071491 Ga0070681_100714913 437
1076 3300005530 Ga0070679_100040221 Ga0070679_1000402214 437
1077 3300005547 Ga0070693_100009341 Ga0070693_1000093413 437
1078 3300005548 Ga0070665_100113871 Ga0070665_1001138713 437
1079 3300005548 Ga0070665_100160653 Ga0070665_1001606532 437
1080 3300005577 Ga0068857_100057168 Ga0068857_1000571683 437
1081 3300005614 Ga0068856_100077717 Ga0068856_1000777172 437
1082 3300005614 Ga0068856_100081444 Ga0068856_1000814443 437
1083 3300005615 Ga0070702_100016071 Ga0070702_1000160714 437
1084 3300005617 Ga0068859_100000596 Ga0068859_10000059613 437
1085 3300005617 Ga0068859_100245302 Ga0068859_1002453022 437
1086 3300005618 Ga0068864_100143695 Ga0068864_1001436952 437
1087 3300005834 Ga0068851_10044148 Ga0068851_100441482 437
1088 3300005841 Ga0068863_100001182 Ga0068863_10000118214 437
1089 3300005841 Ga0068863_100009630 Ga0068863_1000096305 437
1090 3300005841 Ga0068863_100009994 Ga0068863_1000099948 437
1091 3300005842 Ga0068858_100000010 Ga0068858_10000001070 437
1092 3300005842 Ga0068858_100000013 Ga0068858_1000000139 437
1093 3300005842 Ga0068858_100013843 Ga0068858_1000138433 437
1094 3300005842 Ga0068858_100102867 Ga0068858_1001028672 437
1095 3300005844 Ga0068862_100000358 Ga0068862_10000035832 437
1096 3300005981 Ga0081538_10000050 Ga0081538_1000005078 437
1097 3300005983 Ga0081540_1000903 Ga0081540_100090328 437
1098 3300005983 Ga0081540_1000912 Ga0081540_100091214 437
1099 3300005983 Ga0081540_1028790 Ga0081540_10287903 437
1100 3300005985 Ga0081539_10000763 Ga0081539_1000076317 437
1101 3300005985 Ga0081539_10003492 Ga0081539_1000349212 437
1102 3300005985 Ga0081539_10004406 Ga0081539_100044068 437
1103 3300005985 Ga0081539_10005222 Ga0081539_100052223 437
1104 3300005985 Ga0081539_10010250 Ga0081539_100102505 437
1105 3300006237 Ga0097621_100036611 Ga0097621_1000366113 437
1106 3300006358 Ga0068871_100011221 Ga0068871_1000112216 437
1107 3300006847 Ga0075431_100068233 Ga0075431_1000682332 437
1108 3300006852 Ga0075433_10007460 Ga0075433_100074608 437
1109 3300006871 Ga0075434_100032312 Ga0075434_1000323123 437
1110 3300006880 Ga0075429_100022283 Ga0075429_1000222835 437
1111 3300006880 Ga0075429_100051551 Ga0075429_1000515512 437
1112 3300006914 Ga0075436_100050482 Ga0075436_1000504822 437
1113 3300006931 Ga0097620_100000596 Ga0097620_10000059613 437
1114 3300006931 Ga0097620_100245303 Ga0097620_1002453032 437
1115 3300009011 Ga0105251_10053826 Ga0105251_100538261 437
1116 3300009094 Ga0111539_10009764 Ga0111539_100097642 437
1117 3300009098 Ga0105245_10005886 Ga0105245_100058862 437
1118 3300009098 Ga0105245_10176509 Ga0105245_101765092 437
1119 3300009101 Ga0105247_10018328 Ga0105247_100183283 437
1120 3300009101 Ga0105247_10022164 Ga0105247_100221642 437
1121 3300009147 Ga0114129_10001274 Ga0114129_1000127421 437
1122 3300009147 Ga0114129_10001724 Ga0114129_100017249 437
1123 3300009147 Ga0114129_10118258 Ga0114129_101182587 437
1124 3300009148 Ga0105243_10194003 Ga0105243_101940032 437
1125 3300009174 Ga0105241_10133231 Ga0105241_101332312 437
1126 3300009176 Ga0105242_10135768 Ga0105242_101357682 437
1127 3300009177 Ga0105248_10000035 Ga0105248_1000003555 437
1128 3300009177 Ga0105248_10003863 Ga0105248_1000386311 437
1129 3300009177 Ga0105248_10033866 Ga0105248_100338666 437
1130 3300009177 Ga0105248_10049682 Ga0105248_100496822 437
1131 3300009177 Ga0105248_10241017 Ga0105248_102410172 437
1132 3300009551 Ga0105238_10307532 Ga0105238_103075322 437
1133 3300009553 Ga0105249_10005191 Ga0105249_100051913 437
1134 3300011119 Ga0105246_10014319 Ga0105246_100143193 437
1135 3300013100 Ga0157373_10026116 Ga0157373_100261163 437
1136 3300013104 Ga0157370_10132940 Ga0157370_101329402 437
1137 3300013105 Ga0157369_10010203 Ga0157369_100102039 437
1138 3300013105 Ga0157369_10235375 Ga0157369_102353752 437
1139 3300013307 Ga0157372_10081467 Ga0157372_100814673 437
1140 3300013307 Ga0157372_10256371 Ga0157372_102563711 437
1141 3300014968 Ga0157379_10000012 Ga0157379_10000012112 437
1142 3300014968 Ga0157379_10020489 Ga0157379_100204894 437
1143 3300014968 Ga0157379_10185118 Ga0157379_101851182 437
1144 3300020070 Ga0206356_11251781 Ga0206356_112517812 437
1145 3300020070 Ga0206356_11557117 Ga0206356_115571171 437
1146 3300020076 Ga0206355_1061250 Ga0206355_10612502 437
1147 3300020078 Ga0206352_11163761 Ga0206352_111637612 437
1148 3300020080 Ga0206350_11654720 Ga0206350_116547202 437
1149 3300020082 Ga0206353_10041609 Ga0206353_100416093 437
1150 3300020082 Ga0206353_10184723 Ga0206353_101847233 437
1151 3300020082 Ga0206353_10976662 Ga0206353_109766622 437
1152 3300020610 Ga0154015_1634210 Ga0154015_16342101 437
1153 3300021384 Ga0213876_10000793 Ga0213876_1000079312 437
1154 3300022467 Ga0224712_10002852 Ga0224712_100028523 437
1155 3300022467 Ga0224712_10003615 Ga0224712_100036154 437
1156 3300022467 Ga0224712_10021348 Ga0224712_100213481 437
1157 3300025900 Ga0207710_10000048 Ga0207710_1000004891 437
1158 3300025900 Ga0207710_10018265 Ga0207710_100182652 437
1159 3300025901 Ga0207688_10069288 Ga0207688_100692881 437
1160 3300025904 Ga0207647_10052506 Ga0207647_100525062 437
1161 3300025906 Ga0207699_10044380 Ga0207699_100443802 437
1162 3300025908 Ga0207643_10000335 Ga0207643_100003356 437
1163 3300025909 Ga0207705_10020763 Ga0207705_100207633 437
1164 3300025909 Ga0207705_10061174 Ga0207705_100611741 437
1165 3300025912 Ga0207707_10009801 Ga0207707_100098014 437
1166 3300025915 Ga0207693_10157566 Ga0207693_101575662 437
1167 3300025915 Ga0207693_10170474 Ga0207693_101704742 437
1168 3300025917 Ga0207660_10194254 Ga0207660_101942541 437
1169 3300025919 Ga0207657_10014660 Ga0207657_100146607 437
1170 3300025919 Ga0207657_10020276 Ga0207657_100202767 437
1171 3300025920 Ga0207649_10004339 Ga0207649_100043392 437
1172 3300025921 Ga0207652_10010364 Ga0207652_100103646 437
1173 3300025921 Ga0207652_10037921 Ga0207652_100379212 437
1174 3300025921 Ga0207652_10047432 Ga0207652_100474323 437
1175 3300025925 Ga0207650_10007490 Ga0207650_100074906 437
1176 3300025926 Ga0207659_10012720 Ga0207659_100127202 437
1177 3300025927 Ga0207687_10024289 Ga0207687_100242892 437
1178 3300025928 Ga0207700_10063014 Ga0207700_100630142 437
1179 3300025929 Ga0207664_10028564 Ga0207664_100285643 437
1180 3300025931 Ga0207644_10003155 Ga0207644_100031552 437
1181 3300025934 Ga0207686_10104898 Ga0207686_101048982 437
1182 3300025939 Ga0207665_10095785 Ga0207665_100957851 437
1183 3300025940 Ga0207691_10014980 Ga0207691_100149802 437
1184 3300025941 Ga0207711_10000747 Ga0207711_1000074712 437
1185 3300025941 Ga0207711_10001409 Ga0207711_1000140911 437
1186 3300025941 Ga0207711_10160682 Ga0207711_101606822 437
1187 3300025942 Ga0207689_10002913 Ga0207689_100029132 437
1188 3300025944 Ga0207661_10123955 Ga0207661_101239553 437
1189 3300025945 Ga0207679_10024111 Ga0207679_100241113 437
1190 3300025945 Ga0207679_10037555 Ga0207679_100375553 437
1191 3300025949 Ga0207667_10230340 Ga0207667_102303402 437
1192 3300025972 Ga0207668_10003383 Ga0207668_100033838 437
1193 3300025986 Ga0207658_10188247 Ga0207658_101882471 437
1194 3300026035 Ga0207703_10000002 Ga0207703_10000002197 437
1195 3300026035 Ga0207703_10000009 Ga0207703_100000099 437
1196 3300026041 Ga0207639_10061070 Ga0207639_100610704 437
1197 3300026067 Ga0207678_10008350 Ga0207678_100083502 437
1198 3300026067 Ga0207678_10121879 Ga0207678_101218792 437
1199 3300026075 Ga0207708_10005701 Ga0207708_100057013 437
1200 3300026078 Ga0207702_10017665 Ga0207702_100176654 437
1201 3300026088 Ga0207641_10002959 Ga0207641_100029595 437
1202 3300026088 Ga0207641_10014228 Ga0207641_100142289 437
1203 3300026095 Ga0207676_10003163 Ga0207676_100031632 437
1204 3300026116 Ga0207674_10300114 Ga0207674_103001142 437
1205 3300026121 Ga0207683_10000857 Ga0207683_1000085721 437
1206 3300026121 Ga0207683_10068459 Ga0207683_100684592 437
1207 3300027907 Ga0207428_10005680 Ga0207428_1000568010 437
1208 3300028380 Ga0268265_10000156 Ga0268265_1000015669 437
1209 3300028794 Ga0307515_10000038 Ga0307515_10000038131 437
1210 3300028794 Ga0307515_10019047 Ga0307515_100190478 437
1211 3300028794 Ga0307515_10070295 Ga0307515_100702954 437
1212 3300028800 Ga0265338_10017927 Ga0265338_100179272 437
1213 3300028800 Ga0265338_10038060 Ga0265338_100380604 437
1214 3300030522 Ga0307512_10045352 Ga0307512_100453522 437
1215 3300030736 Ga0316180_1157808 Ga0316180_11578081 437
1216 3300031241 Ga0265325_10005156 Ga0265325_100051564 437
1217 3300031247 Ga0265340_10019334 Ga0265340_100193342 437
1218 3300031249 Ga0265339_10049576 Ga0265339_100495763 437
1219 3300031456 Ga0307513_10015380 Ga0307513_100153805 437
1220 3300031507 Ga0307509_10015278 Ga0307509_100152785 437
1221 3300031507 Ga0307509_10048348 Ga0307509_100483482 437
1222 3300031616 Ga0307508_10000506 Ga0307508_1000050639 437
1223 3300031616 Ga0307508_10001775 Ga0307508_1000177512 437
1224 3300031616 Ga0307508_10070716 Ga0307508_100707163 437
1225 3300031649 Ga0307514_10075008 Ga0307514_100750082 437
1226 3300031730 Ga0307516_10002871 Ga0307516_1000287110 437
1227 3300031730 Ga0307516_10093745 Ga0307516_100937453 437
1228 3300031730 Ga0307516_10094321 Ga0307516_100943213 437
1229 3300031995 Ga0307409_100089208 Ga0307409_1000892081 437
1230 3300031995 Ga0307409_100256598 Ga0307409_1002565982 437
1231 3300032137 Ga0316585_10004353 Ga0316585_100043533 437
1232 3300033179 Ga0307507_10000732 Ga0307507_1000073249 437
1233 3300033179 Ga0307507_10020822 Ga0307507_100208222 437
1234 3300033545 Ga0316214_1001544 Ga0316214_10015442 437
1235 3300035091 Ga0373951_0000115 Ga0373951_0000115_14374_15714 437
1236 3300035117 Ga0373953_0025343 Ga0373953_0025343_543_1916 437
1237 3300035172 Ga0373955_0040542 Ga0373955_0040542_977_2350 437
1238 3300035692 Ga0373935_0015818 Ga0373935_0015818_2205_3548 437
1239 3300035692 Ga0373935_0151391 Ga0373935_0151391_45_1418 437
1240 3300035724 Ga0373933_0013288 Ga0373933_0013288_3063_4436 437
1241 3300036401 Ga0373937_0070973 Ga0373937_0070973_1426_2799 437
1242 3300036712 Ga0316584_0071624 Ga0316584_0071624_1170_2552 437
1243 3300037068 Ga0373925_0000006 Ga0373925_0000006_197538_198902 437
1244 3300037466 Ga0395898_0035335 Ga0395898_0035335_1806_3146 437
1245 3300037471 Ga0395905_0254809 Ga0395905_0254809_251_1591 437
1246 3300039437 Ga0436365_0567091 Ga0436365_0567091_13177_14529 437
1247 3300041452 Ga0451793_0254203 Ga0451793_0254203_2412_3842 437
1248 3300042006 Ga0439432_020825 Ga0439432_020825_760_2088 437
1249 3300044656 Ga0466969_0002576 Ga0466969_0002576_2490_3866 437
1250 3300044693 Ga0466961_0062349 Ga0466961_0062349_929_2302 437
1251 3300044719 Ga0466971_0045012 Ga0466971_0045012_23_1399 437
1252 3300046462 Ga0495651_0017471 Ga0495651_0017471_745_2118 437
1253 3300046463 Ga0495653_0125370 Ga0495653_0125370_422_1795 437
1254 3300046475 Ga0495639_0062309 Ga0495639_0062309_361_1689 437
1255 3300046507 Ga0495606_0001359 Ga0495606_0001359_28412_29737 437
1256 3300046524 Ga0495648_0021577 Ga0495648_0021577_275_1636 437
1257 3300046616 Ga0495668_0000519 Ga0495668_0000519_13809_15134 437
1258 3300046642 Ga0495634_0057874 Ga0495634_0057874_390_1763 437
1259 3300046660 Ga0495625_0001636 Ga0495625_0001636_13939_15264 437
1260 3300046663 Ga0495635_0055499 Ga0495635_0055499_496_1965 437
1261 3300046674 Ga0495588_0020166 Ga0495588_0020166_228_1559 437
1262 3300046675 Ga0495657_0080018 Ga0495657_0080018_299_1672 437
1263 3300046680 Ga0495646_0082841 Ga0495646_0082841_197_1666 437
1264 3300046683 Ga0495658_0074911 Ga0495658_0074911_488_1957 437
1265 3300046809 Ga0495600_0119154 Ga0495600_0119154_158_1630 437
1266 3300047315 Ga0495581_0068143 Ga0495581_0068143_282_1751 437
1267 3300047317 Ga0495604_0115329 Ga0495604_0115329_137_1510 437
1268 3300047319 Ga0495674_0157529 Ga0495674_0157529_295_1668 437
1269 3300047322 Ga0495680_0042878 Ga0495680_0042878_687_2060 437
1270 3300047471 Ga0495684_0047712 Ga0495684_0047712_1069_2442 437
1271 3300048091 Ga0495626_0001401 Ga0495626_0001401_4266_5591 437
1272 3300048903 Ga0496100_0147500 Ga0496100_0147500_313_1659 437
1273 3300048905 Ga0496102_0027616 Ga0496102_0027616_129_1598 437
1274 3300048905 Ga0496102_0064426 Ga0496102_0064426_1364_2710 437
1275 3300048905 Ga0496102_0081793 Ga0496102_0081793_1122_2480 437
1276 3300048907 Ga0496104_0040322 Ga0496104_0040322_2896_4242 437
1277 3300048907 Ga0496104_0051650 Ga0496104_0051650_1224_2693 437
1278 3300048908 Ga0496105_0020716 Ga0496105_0020716_1456_2925 437
1279 3300048908 Ga0496105_0134693 Ga0496105_0134693_207_1553 437
1280 3300048909 Ga0496106_0001155 Ga0496106_0001155_14187_15533 437
1281 3300048910 Ga0496107_0027103 Ga0496107_0027103_110_1456 437
1282 3300048911 Ga0496108_0000035 Ga0496108_0000035_87355_88680 437
1283 3300048911 Ga0496108_0177067 Ga0496108_0177067_77_1423 437
1284 3300048912 Ga0496109_0054048 Ga0496109_0054048_880_2349 437
1285 3300048912 Ga0496109_0118222 Ga0496109_0118222_887_2233 437
1286 3300048913 Ga0496110_0000220 Ga0496110_0000220_16718_18187 437
1287 3300048913 Ga0496110_0027265 Ga0496110_0027265_2971_4317 437
1288 3300048914 Ga0496111_0000527 Ga0496111_0000527_3699_5168 437
1289 3300048914 Ga0496111_0000817 Ga0496111_0000817_13913_15259 437
1290 3300048915 Ga0496112_0068854 Ga0496112_0068854_455_1801 437
1291 3300048916 Ga0496113_0004876 Ga0496113_0004876_1036_2382 437
1292 3300048917 Ga0496114_0040866 Ga0496114_0040866_2156_3622 437
1293 3300048917 Ga0496114_0050348 Ga0496114_0050348_867_2336 437
1294 3300048918 Ga0496115_0049446 Ga0496115_0049446_1604_2950 437
1295 3300048918 Ga0496115_0104371 Ga0496115_0104371_496_1860 437
1296 3300048919 Ga0496116_0000182 Ga0496116_0000182_86185_87543 437
1297 3300048920 Ga0496117_0005163 Ga0496117_0005163_4696_6054 437
1298 3300048920 Ga0496117_0041649 Ga0496117_0041649_1128_2486 437
1299 3300048921 Ga0496118_0022954 Ga0496118_0022954_364_1722 437
1300 3300048922 Ga0496119_0009347 Ga0496119_0009347_3779_5137 437
1301 3300048922 Ga0496119_0015383 Ga0496119_0015383_4036_5406 437
1302 3300048922 Ga0496119_0051687 Ga0496119_0051687_424_1788 437
1303 3300048923 Ga0496120_0029616 Ga0496120_0029616_1279_2637 437
1304 3300048924 Ga0496121_0016297 Ga0496121_0016297_2126_3496 437
1305 3300048929 Ga0496126_0041523 Ga0496126_0041523_957_2282 437
1306 3300048929 Ga0496126_0045712 Ga0496126_0045712_1499_2821 437
1307 3300048929 Ga0496126_0067728 Ga0496126_0067728_941_2305 437
1308 3300049586 Ga0501070_0038098 Ga0501070_0038098_1134_2480 437
1309 3300049824 Ga0501045_0077109 Ga0501045_0077109_368_1717 437
1310 3300049824 Ga0501045_0128149 Ga0501045_0128149_510_1865 437
1311 3300050507 nmdc:mga05p37_110473_c1 nmdc:mga05p37_110473_c1_1675_3000 437
1312 3300050507 nmdc:mga05p37_12466_c1 nmdc:mga05p37_12466_c1_4900_6261 437
1313 3300050507 nmdc:mga05p37_43393_c1 nmdc:mga05p37_43393_c1_183_1529 437
1314 3300050508 nmdc:mga09592_46742_c1 nmdc:mga09592_46742_c1_2114_3439 437
1315 3300050508 nmdc:mga09592_80423_c1 nmdc:mga09592_80423_c1_866_2212 437
1316 3300050511 nmdc:mga08y16_41095_c1 nmdc:mga08y16_41095_c1_433_1779 437
1317 3300050514 nmdc:mga08x19_5990_c1 nmdc:mga08x19_5990_c1_1998_3344 437
1318 3300050515 nmdc:mga0a205_12444_c1 nmdc:mga0a205_12444_c1_3079_4425 437
1319 3300053092 Ga0500583_0071248 Ga0500583_0071248_212_1570 437
1320 iso_pu_bacteria 2508501039 2508670694 437
1321 iso_pu_bacteria 2517572101 2517762484 437
1322 iso_pu_bacteria 2579778521 2579854552 437
1323 iso_pu_bacteria 2619618881 2619853809 437
1324 iso_pu_bacteria 2619619003 2620349509 437
1325 iso_pu_bacteria 2626541554 2626634845 437
1326 iso_pu_bacteria 2671180195 2671835795 437
1327 iso_pu_bacteria 2675902999 2676201272 437
1328 iso_pu_bacteria 2675903058 2676474608 437
1329 iso_pu_bacteria 2684623035 2686539648 437
1330 iso_pu_bacteria 2687453737 2689960499 437
1331 iso_pu_bacteria 2687453743 2689992300 437
1332 iso_pu_bacteria 2751185782 2753271021 437
1333 iso_pu_bacteria 2773857921 2774845848 437
1334 iso_pu_bacteria 2773857922 2774853951 437
1335 iso_pu_bacteria 2827628540 2827632918 437
1336 iso_pu_bacteria 2862382967 2862387248 437
1337 iso_pu_bacteria 2895880812 2895884875 437
1338 iso_pu_bacteria 8002775197 8002781598 437
1339 iso_pu_bacteria 8008558824 8008566431 437
1340 3300002077 JGI24744J21845_10001304 JGI24744J21845_100013042 438
1341 3300003659 JGI25404J52841_10000389 JGI25404J52841_100003896 438
1342 3300005327 Ga0070658_10027200 Ga0070658_100272005 438
1343 3300005327 Ga0070658_10045247 Ga0070658_100452472 438
1344 3300005337 Ga0070682_100013085 Ga0070682_1000130856 438
1345 3300005338 Ga0068868_100044260 Ga0068868_1000442602 438
1346 3300005347 Ga0070668_100030442 Ga0070668_1000304422 438
1347 3300005366 Ga0070659_100054109 Ga0070659_1000541092 438
1348 3300005437 Ga0070710_10000264 Ga0070710_100002644 438
1349 3300005438 Ga0070701_10003695 Ga0070701_100036956 438
1350 3300005439 Ga0070711_100154332 Ga0070711_1001543321 438
1351 3300005441 Ga0070700_100005557 Ga0070700_1000055576 438
1352 3300005445 Ga0070708_100000671 Ga0070708_10000067117 438
1353 3300005455 Ga0070663_100046120 Ga0070663_1000461201 438
1354 3300005459 Ga0068867_100003687 Ga0068867_1000036879 438
1355 3300005466 Ga0070685_10018850 Ga0070685_100188503 438
1356 3300005467 Ga0070706_100066875 Ga0070706_1000668753 438
1357 3300005467 Ga0070706_100085150 Ga0070706_1000851504 438
1358 3300005468 Ga0070707_100180704 Ga0070707_1001807041 438
1359 3300005471 Ga0070698_100053032 Ga0070698_1000530323 438
1360 3300005543 Ga0070672_100003670 Ga0070672_1000036708 438
1361 3300005578 Ga0068854_100069551 Ga0068854_1000695512 438
1362 3300005614 Ga0068856_100023376 Ga0068856_1000233764 438
1363 3300005614 Ga0068856_100139694 Ga0068856_1001396942 438
1364 3300005718 Ga0068866_10039686 Ga0068866_100396862 438
1365 3300005719 Ga0068861_100009645 Ga0068861_1000096453 438
1366 3300005841 Ga0068863_100249428 Ga0068863_1002494282 438
1367 3300005937 Ga0081455_10000071 Ga0081455_1000007166 438
1368 3300005983 Ga0081540_1000522 Ga0081540_100052224 438
1369 3300006028 Ga0070717_10040433 Ga0070717_100404331 438
1370 3300006028 Ga0070717_10161596 Ga0070717_101615962 438
1371 3300006173 Ga0070716_100116427 Ga0070716_1001164272 438
1372 3300006175 Ga0070712_100110988 Ga0070712_1001109882 438
1373 3300006881 Ga0068865_100006359 Ga0068865_1000063594 438
1374 3300009093 Ga0105240_10037111 Ga0105240_100371115 438
1375 3300009098 Ga0105245_10018820 Ga0105245_100188203 438
1376 3300009148 Ga0105243_10021920 Ga0105243_100219202 438
1377 3300009176 Ga0105242_10027971 Ga0105242_100279712 438
1378 3300009177 Ga0105248_10011321 Ga0105248_100113218 438
1379 3300009545 Ga0105237_10014930 Ga0105237_100149305 438
1380 3300009553 Ga0105249_10118937 Ga0105249_101189371 438
1381 3300010375 Ga0105239_10016946 Ga0105239_100169462 438
1382 3300011119 Ga0105246_10094152 Ga0105246_100941522 438
1383 3300013100 Ga0157373_10034275 Ga0157373_100342753 438
1384 3300014326 Ga0157380_10015814 Ga0157380_100158143 438
1385 3300014745 Ga0157377_10037198 Ga0157377_100371982 438
1386 3300021358 Ga0213873_10000037 Ga0213873_100000376 438
1387 3300021388 Ga0213875_10010278 Ga0213875_100102784 438
1388 3300021388 Ga0213875_10023525 Ga0213875_100235252 438
1389 3300021388 Ga0213875_10035752 Ga0213875_100357522 438
1390 3300022467 Ga0224712_10000640 Ga0224712_100006405 438
1391 3300024227 Ga0228598_1007224 Ga0228598_10072243 438
1392 3300025898 Ga0207692_10000049 Ga0207692_1000004918 438
1393 3300025899 Ga0207642_10008157 Ga0207642_100081574 438
1394 3300025908 Ga0207643_10012832 Ga0207643_100128323 438
1395 3300025909 Ga0207705_10020946 Ga0207705_100209465 438
1396 3300025913 Ga0207695_10027984 Ga0207695_100279845 438
1397 3300025915 Ga0207693_10075462 Ga0207693_100754622 438
1398 3300025915 Ga0207693_10083640 Ga0207693_100836403 438
1399 3300025929 Ga0207664_10142941 Ga0207664_101429412 438
1400 3300025934 Ga0207686_10017197 Ga0207686_100171972 438
1401 3300025935 Ga0207709_10008671 Ga0207709_100086716 438
1402 3300025937 Ga0207669_10003947 Ga0207669_100039476 438
1403 3300025938 Ga0207704_10005569 Ga0207704_100055694 438
1404 3300025940 Ga0207691_10000365 Ga0207691_100003658 438
1405 3300025941 Ga0207711_10010854 Ga0207711_100108547 438
1406 3300025944 Ga0207661_10025154 Ga0207661_100251542 438
1407 3300025944 Ga0207661_10234549 Ga0207661_102345492 438
1408 3300025960 Ga0207651_10040572 Ga0207651_100405722 438
1409 3300025972 Ga0207668_10002531 Ga0207668_100025315 438
1410 3300025981 Ga0207640_10010659 Ga0207640_100106592 438
1411 3300026023 Ga0207677_10027876 Ga0207677_100278763 438
1412 3300026041 Ga0207639_10045082 Ga0207639_100450822 438
1413 3300026067 Ga0207678_10000657 Ga0207678_1000065718 438
1414 3300026075 Ga0207708_10000208 Ga0207708_1000020840 438
1415 3300026078 Ga0207702_10004196 Ga0207702_100041965 438
1416 3300026078 Ga0207702_10096501 Ga0207702_100965012 438
1417 3300026089 Ga0207648_10002531 Ga0207648_1000253112 438
1418 3300026142 Ga0207698_10040729 Ga0207698_100407293 438
1419 3300031456 Ga0307513_10094607 Ga0307513_100946073 438
1420 3300031852 Ga0307410_10015291 Ga0307410_100152913 438
1421 3300031852 Ga0307410_10111554 Ga0307410_101115541 438
1422 3300031901 Ga0307406_10004254 Ga0307406_100042544 438
1423 3300031903 Ga0307407_10003337 Ga0307407_100033376 438
1424 3300031995 Ga0307409_100000406 Ga0307409_1000004067 438
1425 3300031995 Ga0307409_100156524 Ga0307409_1001565242 438
1426 3300032002 Ga0307416_100005536 Ga0307416_1000055367 438
1427 3300032004 Ga0307414_10089640 Ga0307414_100896402 438
1428 3300032126 Ga0307415_100000422 Ga0307415_10000042210 438
1429 3300032126 Ga0307415_100039753 Ga0307415_1000397532 438
1430 3300036457 Ga0265778_000400 Ga0265778_000400_1778_3130 438
1431 3300037853 Ga0436364_0516238 Ga0436364_0516238_68341_69771 438
1432 3300037853 Ga0436364_0735260 Ga0436364_0735260_14985_16352 438
1433 3300037853 Ga0436364_1039945 Ga0436364_1039945_182_1549 438
1434 3300037853 Ga0436364_1086504 Ga0436364_1086504_132_1553 438
1435 3300039437 Ga0436365_0574117 Ga0436365_0574117_1092_2522 438
1436 3300039437 Ga0436365_1284454 Ga0436365_1284454_4782_6176 438
1437 3300039450 Ga0436363_0464660 Ga0436363_0464660_145_1518 438
1438 3300039453 Ga0436362_0884990 Ga0436362_0884990_18707_20101 438
1439 3300044656 Ga0466969_0000632 Ga0466969_0000632_11488_12888 438
1440 3300044658 Ga0466972_0002173 Ga0466972_0002173_4133_5518 438
1441 3300044658 Ga0466972_0014915 Ga0466972_0014915_997_2334 438
1442 3300044683 Ga0466965_0000194 Ga0466965_0000194_14123_15460 438
1443 3300044684 Ga0466966_0001302 Ga0466966_0001302_10647_12041 438
1444 3300044684 Ga0466966_0061797 Ga0466966_0061797_127_1527 438
1445 3300044693 Ga0466961_0002350 Ga0466961_0002350_2258_3658 438
1446 3300044693 Ga0466961_0073870 Ga0466961_0073870_195_1538 438
1447 3300044694 Ga0466963_0001094 Ga0466963_0001094_355_1749 438
1448 3300044694 Ga0466963_0034188 Ga0466963_0034188_715_2061 438
1449 3300044694 Ga0466963_0083359 Ga0466963_0083359_659_2002 438
1450 3300044706 Ga0466964_0071300 Ga0466964_0071300_63_1400 438
1451 3300044719 Ga0466971_0000892 Ga0466971_0000892_10691_12091 438
1452 3300044719 Ga0466971_0028339 Ga0466971_0028339_459_1802 438
1453 3300044735 Ga0466968_0003734 Ga0466968_0003734_2019_3365 438
1454 3300044901 Ga0466960_0000703 Ga0466960_0000703_9403_10740 438
1455 3300044901 Ga0466960_0004561 Ga0466960_0004561_328_1713 438
1456 3300044901 Ga0466960_0036259 Ga0466960_0036259_624_1979 438
1457 3300045049 Ga0466959_0000877 Ga0466959_0000877_12074_13474 438
1458 3300045049 Ga0466959_0006347 Ga0466959_0006347_802_2196 438
1459 3300045836 Ga0466958_0003068 Ga0466958_0003068_3461_4855 438
1460 3300045836 Ga0466958_0011623 Ga0466958_0011623_16_1359 438
1461 3300045836 Ga0466958_0041184 Ga0466958_0041184_1309_2709 438
1462 3300045976 Ga0466967_0009250 Ga0466967_0009250_2601_3956 438
1463 3300045976 Ga0466967_0009629 Ga0466967_0009629_1935_3299 438
1464 3300045976 Ga0466967_0147542 Ga0466967_0147542_574_1929 438
1465 3300046794 Ga0495589_0068308 Ga0495589_0068308_387_1715 438
1466 3300048090 Ga0495615_0005916 Ga0495615_0005916_871_2202 438
1467 3300048905 Ga0496102_0011278 Ga0496102_0011278_385_1758 438
1468 3300048906 Ga0496103_0011446 Ga0496103_0011446_1933_3306 438
1469 3300048911 Ga0496108_0057509 Ga0496108_0057509_1190_2566 438
1470 3300048912 Ga0496109_0076274 Ga0496109_0076274_1385_2761 438
1471 3300048915 Ga0496112_0194690 Ga0496112_0194690_130_1506 438
1472 3300048929 Ga0496126_0000039 Ga0496126_0000039_294529_295872 438
1473 3300048929 Ga0496126_0000075 Ga0496126_0000075_132953_134353 438
1474 3300049583 Ga0501067_0010708 Ga0501067_0010708_2882_4228 438
1475 3300061719 Ga0466962_0000056 Ga0466962_0000056_16772_18172 438
1476 3300061719 Ga0466962_0006087 Ga0466962_0006087_61_1404 438
1477 3300061719 Ga0466962_0009800 Ga0466962_0009800_1835_3229 438
1478 3300061719 Ga0466962_0018078 Ga0466962_0018078_340_1695 438
1479 iso_pu_bacteria 2506783011 2506868573 438
1480 iso_pu_bacteria 2527291627 2528206638 438
1481 iso_pu_bacteria 2527291629 2528212030 438
1482 iso_pu_bacteria 2546825537 2546946947 438
1483 iso_pu_bacteria 2576861822 2579747544 438
1484 iso_pu_bacteria 2582580736 2583148894 438
1485 iso_pu_bacteria 2622736605 2623497715 438
1486 iso_pu_bacteria 2684623036 2686543539 438
1487 iso_pu_bacteria 2710264753 2710602608 438
1488 iso_pu_bacteria 2751185734 2753069843 438
1489 iso_pu_bacteria 2773857924 2774867069 438
1490 iso_pu_bacteria 2773857933 2774902955 438
1491 iso_pu_bacteria 2791354901 2791914400 438
1492 iso_pu_bacteria 2870721527 2870727646 438
1493 iso_pu_bacteria 2891326441 2891331593 438
1494 iso_pu_bacteria 2899359706 2899364797 438
1495 iso_pu_bacteria 637000116 637877870 438
1496 iso_pu_bacteria 8003314358 8003316403 438
1497 iso_pu_bacteria 8047710418 8047719884 438
1498 iso_pu_bacteria 8054913762 8054920573 438
1499 iso_pu_bacteria 8054920844 8054922604 438
1500 3300005327 Ga0070658_10000776 Ga0070658_100007762 439
1501 3300005329 Ga0070683_100110779 Ga0070683_1001107792 439
1502 3300005334 Ga0068869_100086618 Ga0068869_1000866182 439
1503 3300005335 Ga0070666_10038699 Ga0070666_100386992 439
1504 3300005336 Ga0070680_100000142 Ga0070680_1000001429 439
1505 3300005338 Ga0068868_100093418 Ga0068868_1000934183 439
1506 3300005339 Ga0070660_100093165 Ga0070660_1000931652 439
1507 3300005345 Ga0070692_10027337 Ga0070692_100273373 439
1508 3300005345 Ga0070692_10038183 Ga0070692_100381833 439
1509 3300005365 Ga0070688_100057304 Ga0070688_1000573043 439
1510 3300005366 Ga0070659_100032701 Ga0070659_1000327013 439
1511 3300005406 Ga0070703_10009742 Ga0070703_100097422 439
1512 3300005458 Ga0070681_10000077 Ga0070681_1000007723 439
1513 3300005471 Ga0070698_100045276 Ga0070698_1000452763 439
1514 3300005530 Ga0070679_100000135 Ga0070679_1000001354 439
1515 3300005530 Ga0070679_100167285 Ga0070679_1001672852 439
1516 3300005536 Ga0070697_100002048 Ga0070697_1000020489 439
1517 3300005539 Ga0068853_100044645 Ga0068853_1000446453 439
1518 3300005564 Ga0070664_100031931 Ga0070664_1000319313 439
1519 3300005577 Ga0068857_100033853 Ga0068857_1000338532 439
1520 3300005617 Ga0068859_100061973 Ga0068859_1000619732 439
1521 3300005618 Ga0068864_100049976 Ga0068864_1000499762 439
1522 3300005841 Ga0068863_100115358 Ga0068863_1001153583 439
1523 3300006931 Ga0097620_100061974 Ga0097620_1000619743 439
1524 3300009176 Ga0105242_10041014 Ga0105242_100410145 439
1525 3300009545 Ga0105237_10044770 Ga0105237_100447705 439
1526 3300010159 Ga0099796_10029146 Ga0099796_100291461 439
1527 3300013102 Ga0157371_10056311 Ga0157371_100563113 439
1528 3300013105 Ga0157369_10000890 Ga0157369_100008904 439
1529 3300013105 Ga0157369_10098846 Ga0157369_100988463 439
1530 3300013105 Ga0157369_10100808 Ga0157369_101008082 439
1531 3300013105 Ga0157369_10269053 Ga0157369_102690532 439
1532 3300013307 Ga0157372_10252452 Ga0157372_102524522 439
1533 3300014325 Ga0163163_10109215 Ga0163163_101092152 439
1534 3300020069 Ga0197907_10125209 Ga0197907_101252093 439
1535 3300020610 Ga0154015_1690007 Ga0154015_16900072 439
1536 3300022467 Ga0224712_10000868 Ga0224712_100008684 439
1537 3300022467 Ga0224712_10001321 Ga0224712_100013212 439
1538 3300025885 Ga0207653_10019979 Ga0207653_100199792 439
1539 3300025901 Ga0207688_10003133 Ga0207688_100031334 439
1540 3300025903 Ga0207680_10055310 Ga0207680_100553102 439
1541 3300025909 Ga0207705_10000676 Ga0207705_100006763 439
1542 3300025909 Ga0207705_10138892 Ga0207705_101388922 439
1543 3300025912 Ga0207707_10000089 Ga0207707_1000008923 439
1544 3300025912 Ga0207707_10010633 Ga0207707_100106334 439
1545 3300025917 Ga0207660_10000815 Ga0207660_1000081513 439
1546 3300025917 Ga0207660_10163950 Ga0207660_101639502 439
1547 3300025919 Ga0207657_10002680 Ga0207657_1000268014 439
1548 3300025919 Ga0207657_10084696 Ga0207657_100846963 439
1549 3300025921 Ga0207652_10000015 Ga0207652_1000001581 439
1550 3300025921 Ga0207652_10016837 Ga0207652_100168375 439
1551 3300025927 Ga0207687_10153233 Ga0207687_101532332 439
1552 3300025932 Ga0207690_10000171 Ga0207690_1000017123 439
1553 3300025933 Ga0207706_10053435 Ga0207706_100534353 439
1554 3300025934 Ga0207686_10070814 Ga0207686_100708142 439
1555 3300025939 Ga0207665_10041528 Ga0207665_100415283 439
1556 3300025942 Ga0207689_10006800 Ga0207689_100068004 439
1557 3300026023 Ga0207677_10003695 Ga0207677_100036959 439
1558 3300026067 Ga0207678_10002619 Ga0207678_100026192 439
1559 3300026075 Ga0207708_10013101 Ga0207708_100131014 439
1560 3300026078 Ga0207702_10143824 Ga0207702_101438242 439
1561 3300026116 Ga0207674_10013076 Ga0207674_100130768 439
1562 3300026118 Ga0207675_100022173 Ga0207675_1000221732 439
1563 3300026121 Ga0207683_10001504 Ga0207683_1000150410 439
1564 3300030742 Ga0316183_1115972 Ga0316183_11159722 439
1565 3300031241 Ga0265325_10003221 Ga0265325_100032213 439
1566 3300031249 Ga0265339_10008767 Ga0265339_100087674 439
1567 3300031456 Ga0307513_10000002 Ga0307513_10000002505 439
1568 3300031711 Ga0265314_10006663 Ga0265314_100066638 439
1569 3300031712 Ga0265342_10042943 Ga0265342_100429432 439
1570 3300031727 Ga0316576_10001518 Ga0316576_100015182 439
1571 3300031728 Ga0316578_10010142 Ga0316578_100101422 439
1572 3300031852 Ga0307410_10045221 Ga0307410_100452212 439
1573 3300035090 Ga0373949_0005321 Ga0373949_0005321_145_1524 439
1574 3300035111 Ga0373923_0001801 Ga0373923_0001801_4072_5451 439
1575 3300035113 Ga0373936_0000466 Ga0373936_0000466_4151_5530 439
1576 3300035116 Ga0373945_0001125 Ga0373945_0001125_2467_3846 439
1577 3300035117 Ga0373953_0001306 Ga0373953_0001306_4087_5466 439
1578 3300035118 Ga0373954_0025370 Ga0373954_0025370_1064_2443 439
1579 3300035119 Ga0373956_0003065 Ga0373956_0003065_3258_4637 439
1580 3300035121 Ga0373960_0004283 Ga0373960_0004283_187_1566 439
1581 3300035171 Ga0373946_0001321 Ga0373946_0001321_1532_2911 439
1582 3300035172 Ga0373955_0003782 Ga0373955_0003782_131_1510 439
1583 3300035242 Ga0373962_0011117 Ga0373962_0011117_725_2104 439
1584 3300035398 Ga0316574_0024953 Ga0316574_0024953_827_2152 439
1585 3300035410 Ga0373924_0005485 Ga0373924_0005485_1959_3338 439
1586 3300035691 Ga0373931_0008885 Ga0373931_0008885_2338_3717 439
1587 3300035692 Ga0373935_0014322 Ga0373935_0014322_987_2366 439
1588 3300035725 Ga0373947_0009537 Ga0373947_0009537_2429_3808 439
1589 3300036712 Ga0316584_0005744 Ga0316584_0005744_610_1935 439
1590 3300037418 Ga0395900_0003901 Ga0395900_0003901_2775_4109 439
1591 3300039450 Ga0436363_0129189 Ga0436363_0129189_369_1724 439
1592 3300041404 Ga0439436_0002022 Ga0439436_0002022_1001_2338 439
1593 3300041999 Ga0439433_0009801 Ga0439433_0009801_255_1595 439
1594 3300042002 Ga0439442_002424 Ga0439442_002424_1315_2655 439
1595 3300042014 Ga0439457_004100 Ga0439457_004100_205_1545 439
1596 3300044693 Ga0466961_0001660 Ga0466961_0001660_538_1896 439
1597 3300044693 Ga0466961_0049882 Ga0466961_0049882_1202_2557 439
1598 3300044706 Ga0466964_0019639 Ga0466964_0019639_715_2043 439
1599 3300044765 Ga0466970_0067744 Ga0466970_0067744_167_1489 439
1600 3300045049 Ga0466959_0059597 Ga0466959_0059597_475_1839 439
1601 3300045049 Ga0466959_0084429 Ga0466959_0084429_95_1450 439
1602 3300045049 Ga0466959_0089585 Ga0466959_0089585_375_1709 439
1603 3300045049 Ga0466959_0093383 Ga0466959_0093383_691_2043 439
1604 3300045836 Ga0466958_0070299 Ga0466958_0070299_179_1507 439
1605 3300045976 Ga0466967_0009645 Ga0466967_0009645_3036_4364 439
1606 3300045976 Ga0466967_0010064 Ga0466967_0010064_3541_4878 439
1607 3300045976 Ga0466967_0059846 Ga0466967_0059846_1201_2532 439
1608 3300046455 Ga0495603_0009235 Ga0495603_0009235_498_1877 439
1609 3300046459 Ga0495629_0002245 Ga0495629_0002245_9755_11134 439
1610 3300046461 Ga0495641_0009246 Ga0495641_0009246_3962_5341 439
1611 3300046463 Ga0495653_0004573 Ga0495653_0004573_2449_3828 439
1612 3300046475 Ga0495639_0003954 Ga0495639_0003954_4896_6275 439
1613 3300046476 Ga0495662_0002349 Ga0495662_0002349_4146_5525 439
1614 3300046477 Ga0495664_0065266 Ga0495664_0065266_258_1637 439
1615 3300046511 Ga0495608_0012884 Ga0495608_0012884_2003_3382 439
1616 3300046516 Ga0495628_0095450 Ga0495628_0095450_386_1765 439
1617 3300046517 Ga0495630_0008465 Ga0495630_0008465_908_2287 439
1618 3300046526 Ga0495666_0003647 Ga0495666_0003647_4209_5588 439
1619 3300046531 Ga0495665_0015610 Ga0495665_0015610_2449_3828 439
1620 3300046535 Ga0495586_0008930 Ga0495586_0008930_3049_4428 439
1621 3300046559 Ga0495667_0038390 Ga0495667_0038390_780_2159 439
1622 3300046642 Ga0495634_0008927 Ga0495634_0008927_5658_7037 439
1623 3300046678 Ga0495599_0027522 Ga0495599_0027522_1405_2784 439
1624 3300046679 Ga0495623_0012970 Ga0495623_0012970_2389_3768 439
1625 3300046680 Ga0495646_0002906 Ga0495646_0002906_5225_6604 439
1626 3300046683 Ga0495658_0029170 Ga0495658_0029170_298_1677 439
1627 3300046689 Ga0495613_0007268 Ga0495613_0007268_406_1785 439
1628 3300046690 Ga0495624_0000535 Ga0495624_0000535_6178_7557 439
1629 3300046809 Ga0495600_0021071 Ga0495600_0021071_1763_3142 439
1630 3300047315 Ga0495581_0003107 Ga0495581_0003107_4141_5520 439
1631 3300047322 Ga0495680_0022892 Ga0495680_0022892_258_1637 439
1632 3300047471 Ga0495684_0023120 Ga0495684_0023120_2449_3828 439
1633 3300047673 Ga0495593_0013292 Ga0495593_0013292_2540_3919 439
1634 3300048089 Ga0495614_0017285 Ga0495614_0017285_566_1945 439
1635 3300048908 Ga0496105_0112736 Ga0496105_0112736_523_1902 439
1636 3300048909 Ga0496106_0019812 Ga0496106_0019812_2635_4014 439
1637 3300048913 Ga0496110_0080252 Ga0496110_0080252_1172_2551 439
1638 3300048917 Ga0496114_0036877 Ga0496114_0036877_1067_2446 439
1639 3300049585 Ga0501069_0000223 Ga0501069_0000223_12467_13828 439
1640 3300049586 Ga0501070_0001165 Ga0501070_0001165_10962_12323 439
1641 3300049586 Ga0501070_0001589 Ga0501070_0001589_1461_2831 439
1642 3300049586 Ga0501070_0003370 Ga0501070_0003370_12289_13650 439
1643 3300049590 Ga0501074_0014120 Ga0501074_0014120_1058_2428 439
1644 3300049741 Ga0501079_0000093 Ga0501079_0000093_21168_22538 439
1645 3300049742 Ga0501080_0000266 Ga0501080_0000266_10814_12175 439
1646 3300049742 Ga0501080_0003067 Ga0501080_0003067_8694_10064 439
1647 3300049742 Ga0501080_0016463 Ga0501080_0016463_1017_2378 439
1648 3300049823 Ga0501044_0010160 Ga0501044_0010160_7581_8942 439
1649 3300053077 Ga0495601_0010705 Ga0495601_0010705_908_2287 439
1650 3300053078 Ga0495612_0000929 Ga0495612_0000929_9087_10466 439
1651 3300053085 Ga0495619_0005371 Ga0495619_0005371_2726_4105 439
1652 3300053139 Ga0500568_0000706 Ga0500568_0000706_135_1493 439
1653 3300000549 LJQas_1007077 LJQas_10070771 440
1654 3300005434 Ga0070709_10045596 Ga0070709_100455962 440
1655 3300006173 Ga0070716_100025356 Ga0070716_1000253562 440
1656 3300025898 Ga0207692_10041273 Ga0207692_100412732 440
1657 3300025905 Ga0207685_10028071 Ga0207685_100280712 440
1658 3300025906 Ga0207699_10066505 Ga0207699_100665052 440
1659 3300025915 Ga0207693_10029887 Ga0207693_100298874 440
1660 3300025928 Ga0207700_10065136 Ga0207700_100651363 440
1661 3300025929 Ga0207664_10016390 Ga0207664_100163902 440
1662 3300025939 Ga0207665_10043041 Ga0207665_100430413 440
1663 3300035086 Ga0373934_0003190 Ga0373934_0003190_3819_5198 440
1664 3300035089 Ga0373944_0007599 Ga0373944_0007599_41_1420 440
1665 3300035113 Ga0373936_0051674 Ga0373936_0051674_198_1577 440
1666 3300035116 Ga0373945_0005546 Ga0373945_0005546_152_1531 440
1667 3300035170 Ga0373943_0001264 Ga0373943_0001264_2971_4350 440
1668 3300035692 Ga0373935_0029064 Ga0373935_0029064_1917_3296 440
1669 3300035695 Ga0373927_0002894 Ga0373927_0002894_4293_5672 440
1670 3300035725 Ga0373947_0003402 Ga0373947_0003402_5999_7378 440
1671 3300036401 Ga0373937_0053491 Ga0373937_0053491_1077_2456 440
1672 3300037068 Ga0373925_0050996 Ga0373925_0050996_439_1818 440
1673 3300046461 Ga0495641_0007399 Ga0495641_0007399_935_2314 440
1674 3300046463 Ga0495653_0066800 Ga0495653_0066800_149_1528 440
1675 3300046463 Ga0495653_0158387 Ga0495653_0158387_139_1518 440
1676 3300046475 Ga0495639_0028677 Ga0495639_0028677_400_1779 440
1677 3300046477 Ga0495664_0008545 Ga0495664_0008545_3671_5050 440
1678 3300046511 Ga0495608_0058655 Ga0495608_0058655_721_2100 440
1679 3300046516 Ga0495628_0055179 Ga0495628_0055179_752_2131 440
1680 3300046517 Ga0495630_0018073 Ga0495630_0018073_1751_3130 440
1681 3300046529 Ga0495652_0086307 Ga0495652_0086307_766_2145 440
1682 3300046559 Ga0495667_0018746 Ga0495667_0018746_1807_3186 440
1683 3300046642 Ga0495634_0091681 Ga0495634_0091681_232_1611 440
1684 3300046663 Ga0495635_0036284 Ga0495635_0036284_1860_3239 440
1685 3300046675 Ga0495657_0053190 Ga0495657_0053190_318_1697 440
1686 3300046690 Ga0495624_0011184 Ga0495624_0011184_4270_5649 440
1687 3300047319 Ga0495674_0001362 Ga0495674_0001362_20976_22355 440
1688 3300047321 Ga0495676_0058754 Ga0495676_0058754_1112_2491 440
1689 3300047322 Ga0495680_0034707 Ga0495680_0034707_1669_3048 440
1690 3300047322 Ga0495680_0037991 Ga0495680_0037991_1504_2883 440
1691 3300047471 Ga0495684_0000973 Ga0495684_0000973_20472_21851 440
1692 3300047471 Ga0495684_0106123 Ga0495684_0106123_329_1708 440

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00346

Complex1_49kDa

Respiratory-chain NADH dehydrogenase, 49 Kd subunit

210

496

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e9h-assembly1.cif.gz_D mycobacterial respiratory complex i, fully-inserted quinone 0.9709 40 440
8e73-assembly1.cif.gz_S2 vigna radiata supercomplex i+iii2 (full bridge) 0.968 56 440
7qsn-assembly1.cif.gz_D bovine complex i in lipid nanodisc, deactive-apo 0.9654 61 440
7ard-assembly1.cif.gz_D cryo-em structure of polytomella complex-i (complete composition) 0.9647 44 440
8bq6-assembly1.cif.gz_D cryo-em structure of the arabidopsis thaliana i+iii2 supercomplex (complete conformation 2 composition) 0.9634 42 440
ID Description Score Start End Superfamily
af_P9WJH5_38_440_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.9708 40 440 1.10.645.10
af_P9WJH5_38_440_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.9637 40 440 1.10.645.10
af_P33599_211_596_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.9538 42 440 1.10.645.10
af_P33599_211_596_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.9466 42 440 1.10.645.10
af_P16431_180_537_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.9465 42 431 1.10.645.10
ID Description Score Start End GO Terms
AF-A0A6G3WKU9-F1-model_v4 NADH dehydrogenase subunit D 0.9889 157 325 GO:0016651
GO:0048038
GO:0051287
AF-A0A5K1HSC0-F1-model_v4 NADH-quinone oxidoreductase subunit D domain-containing protein 0.9881 195 319 GO:0009535
GO:0016651
GO:0048038
GO:0051287
AF-A0A7V9PQV1-F1-model_v4 NADH-quinone oxidoreductase subunit D (EC 1.6.5.11) 0.9854 58 440 GO:0016651
GO:0048038
GO:0051287
AF-A0A5Q0UUT2-F1-model_v4 NADH-plastoquinone oxidoreductase subunit 7 0.9853 106 321 GO:0009535
GO:0016651
GO:0048038
GO:0051287
AF-A0A4R2U8P3-F1-model_v4 deleted 0.9851 86 440

Feature Viewer

pLDDT pTM Quality
87.49 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map