F495362
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1692 | 681 | 1505 | 444 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8047710418|8047719884 |
| Length | 496 |
| Sequence | NQANAADKAYEESLGGGTRTESVSDASTGTDTSAAGSDSRDADARAGDARADEASTIAAGPSVDVADSRQTTEGTVYTVTGGDWDEVLADAAGDERIVMNLGPQHPSTHGVLRLVLELEGESVTQARSVIGYLHTGIEKNLEYRNWTQGVTFVTRMDYLAPLHNEAAYCMSVEKLLGVEVPQRAQVIRVLLMELNRISSHLVALATGGMELGALTGMTAGFREREEVLHLLEHLTGLRMNHAFIRPGGVAQDLPADAVEKIRSFLKIMDKRLPDYDKLLTGQPIWRNRLAGVGYLPVDACLALGITGPILRSAGLPWDLRKVEPYSGYETYDFDVPTSNAADSFARYLMRVEEIHQSLRLVRQAVDRLEPGPVMVEDAKIAWPAQLTIGSDGMGNSLEHVRKIMGQSMESLIHHFKLVTEGFDVPAGQVYVPIESPRGELGYHVVSDGGTRPFRVHVREPSFVNLQSMPAMCEGGMVADVIASVASIDPVMGGCDR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 3 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 4 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 5 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 6 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 7 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 8 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 9 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 10 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 11 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 12 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 13 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 14 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 15 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 16 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 17 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 18 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 19 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 20 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 21 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 22 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 23 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 24 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 25 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 26 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 27 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 28 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 29 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 30 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 31 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 32 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 33 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 34 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 35 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 36 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 37 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 38 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 39 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 40 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 41 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 42 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 43 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 44 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 45 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 46 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 47 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 48 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 49 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 50 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 51 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 52 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 53 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 54 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 55 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 56 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 57 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 58 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 59 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 60 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 61 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 62 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 63 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 64 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 65 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 66 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 67 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 68 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 69 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 70 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 71 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 72 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 73 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 74 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 75 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 76 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 77 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 78 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 79 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 80 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 81 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 82 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 83 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 84 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 85 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 86 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 87 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 88 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 89 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 90 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 91 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 92 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 93 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 94 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 95 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 96 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 97 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 98 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 99 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 100 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 101 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 102 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 103 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 104 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 105 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 106 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 107 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 108 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 109 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 110 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 111 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 112 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 113 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 114 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 115 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 116 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 117 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 118 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 119 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 120 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 121 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 122 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 123 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 124 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 125 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 126 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 127 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 128 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 129 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 130 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 131 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 132 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 133 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 134 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 135 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 136 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 137 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 138 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 139 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 140 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 141 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 142 | 2932398195 | Dietzia sp. 2505 | Isolate | Rhizosphere |
| 143 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 144 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 145 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 146 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 147 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 148 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 149 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 150 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 151 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 152 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 153 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 154 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 155 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 156 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 157 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 158 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 159 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 160 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 161 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 162 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 163 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 164 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 165 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 166 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 167 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 168 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 169 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 172 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 173 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 175 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 177 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 178 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 179 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 181 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 182 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 183 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 185 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 186 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 189 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 192 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 195 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 196 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 198 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 199 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 200 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 203 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 204 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 206 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 209 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 210 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 211 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 212 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 213 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 214 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 215 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 216 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 217 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 218 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 220 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 224 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 225 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 227 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 228 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 229 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 230 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 231 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 232 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 233 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 234 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 235 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 236 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 237 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 238 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 239 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 240 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 241 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 242 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 243 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 244 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 245 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 246 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 247 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 248 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 249 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 250 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 251 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 252 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 253 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 255 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 256 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 257 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 258 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 259 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 260 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 261 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 262 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 263 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 264 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 266 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 267 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 268 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 270 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 271 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 273 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 274 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 275 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 276 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 277 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 278 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 279 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 280 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 281 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 282 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 283 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 284 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 285 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 286 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 287 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 288 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 289 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 290 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 291 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 292 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 293 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 294 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 295 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 296 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 297 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 298 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 299 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 300 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 301 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 302 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 303 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 304 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 305 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 306 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 308 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 309 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 310 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 311 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 312 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 313 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 314 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 315 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 381 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 385 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 386 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 387 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 388 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 389 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 390 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 391 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 392 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 393 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 394 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 395 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 396 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 397 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 398 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 399 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 400 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 401 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 402 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 403 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 404 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 405 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 406 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 407 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 408 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 409 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 410 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 411 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 412 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 413 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 414 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 415 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 416 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 418 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 419 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 420 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 421 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 422 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 423 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 424 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 425 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 426 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 427 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 428 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 429 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 430 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 431 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 432 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 433 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 434 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 435 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 436 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 437 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 438 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 439 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 440 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 441 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 442 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 443 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 444 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 445 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 446 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 448 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 449 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 450 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 451 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 452 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 453 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 454 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 455 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 456 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 457 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 458 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 459 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 460 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 461 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 462 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 463 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 464 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 465 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 466 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 467 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 468 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 469 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 470 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 471 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 472 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 473 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 474 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 475 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 476 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 477 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 478 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 479 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 480 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 481 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 482 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 483 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 484 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 485 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 486 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 487 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 488 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 489 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 490 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 491 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 492 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 493 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 494 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 565 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 566 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 567 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 568 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 569 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 570 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 571 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 572 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 573 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 574 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 575 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 576 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 577 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 578 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 579 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 580 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 581 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 582 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 583 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 584 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 585 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 586 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 587 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 588 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 589 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 590 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 591 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 593 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 594 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 595 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 596 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 597 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 598 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 599 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 600 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 601 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 602 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 603 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 604 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 605 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 606 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 607 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 608 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 609 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 610 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 611 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 612 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 613 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 614 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 615 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 616 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 617 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 618 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 619 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 620 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 621 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 622 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 623 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 624 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 625 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 626 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 627 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 628 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 629 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 630 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 631 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 632 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 633 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 634 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 637 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 639 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 640 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 641 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 642 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 643 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 644 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 645 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 646 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 647 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 648 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 649 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 650 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 651 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 652 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 653 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 654 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 655 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 656 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 657 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 658 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 659 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 660 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 661 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 662 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 663 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 664 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 665 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 666 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 667 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 668 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 669 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 670 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 671 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 672 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 673 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 674 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 675 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
| 676 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
| 677 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
| 678 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 679 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 680 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
| 681 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.53 |
| Metatranscriptomes | 1.48 |
| Isolates | 10.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.55 |
| Nodule | 1.95 |
| Rhizoplane | 6.68 |
| Rhizosphere | 75.3 |
| Stem | 0 |
| Stem Tuber | 0.12 |
| Unclassified | 12.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1007077 | 3300000549 | Bacteria | 1384 |
| 2 | JGI24752J21851_1003471 | 3300001976 | Bacteria | 2073 |
| 3 | JGI24737J22298_10019288 | 3300001990 | Bacteria | 2182 |
| 4 | JGI24743J22301_10007272 | 3300001991 | Bacteria | 1915 |
| 5 | JGI24735J21928_10011371 | 3300002067 | Bacteria | 2825 |
| 6 | JGI24745J21846_1003962 | 3300002073 | Bacteria | 1568 |
| 7 | JGI24738J21930_10014650 | 3300002075 | Bacteria | 1680 |
| 8 | JGI24744J21845_10000088 | 3300002077 | Bacteria | 11973 |
| 9 | JGI24744J21845_10001304 | 3300002077 | Bacteria | 4925 |
| 10 | JGI24742J22300_10000442 | 3300002244 | Bacteria | 6102 |
| 11 | JGI24751J29686_10005336 | 3300002459 | Bacteria | 2616 |
| 12 | JGI24751J29686_10016334 | 3300002459 | Bacteria | 1531 |
| 13 | JGI25406J46586_10001934 | 3300003203 | Bacteria | 9774 |
| 14 | JGI25406J46586_10015066 | 3300003203 | Bacteria | 3270 |
| 15 | JGI25406J46586_10021225 | 3300003203 | Bacteria | 2610 |
| 16 | JGI25160J50197_1021813 | 3300003354 | Bacteria | 1892 |
| 17 | JGI25404J52841_10000389 | 3300003659 | Bacteria | 6058 |
| 18 | Ga0055540_1000003 | 3300003792 | Bacteria | 428375 |
| 19 | Ga0055540_1011637 | 3300003792 | Bacteria | 2819 |
| 20 | Ga0070658_10000319 | 3300005327 | Bacteria | 41203 |
| 21 | Ga0070658_10000776 | 3300005327 | Bacteria | 27421 |
| 22 | Ga0070658_10010607 | 3300005327 | Bacteria | 7382 |
| 23 | Ga0070658_10027200 | 3300005327 | Bacteria | 4592 |
| 24 | Ga0070658_10045247 | 3300005327 | Bacteria | 3559 |
| 25 | Ga0070676_10011568 | 3300005328 | Bacteria | 4800 |
| 26 | Ga0070683_100017452 | 3300005329 | Bacteria | 6344 |
| 27 | Ga0070683_100025549 | 3300005329 | Bacteria | 5306 |
| 28 | Ga0070683_100074305 | 3300005329 | Bacteria | 3175 |
| 29 | Ga0070683_100110779 | 3300005329 | Bacteria | 2589 |
| 30 | Ga0070683_100151142 | 3300005329 | Bacteria | 2201 |
| 31 | Ga0070690_100021350 | 3300005330 | Bacteria | 3952 |
| 32 | Ga0070670_100046760 | 3300005331 | Bacteria | 3722 |
| 33 | Ga0070670_100065296 | 3300005331 | Bacteria | 3123 |
| 34 | Ga0068869_100001172 | 3300005334 | Bacteria | 15378 |
| 35 | Ga0068869_100003836 | 3300005334 | Bacteria | 9270 |
| 36 | Ga0068869_100015543 | 3300005334 | Bacteria | 5109 |
| 37 | Ga0068869_100041488 | 3300005334 | Bacteria | 3296 |
| 38 | Ga0068869_100086618 | 3300005334 | Bacteria | 2348 |
| 39 | Ga0068869_100097501 | 3300005334 | Bacteria | 2220 |
| 40 | Ga0070666_10017287 | 3300005335 | Bacteria | 4622 |
| 41 | Ga0070666_10038699 | 3300005335 | Bacteria | 3174 |
| 42 | Ga0070666_10076122 | 3300005335 | Bacteria | 2289 |
| 43 | Ga0070680_100000061 | 3300005336 | Bacteria | 56357 |
| 44 | Ga0070680_100000142 | 3300005336 | Bacteria | 43698 |
| 45 | Ga0070682_100013085 | 3300005337 | Bacteria | 4767 |
| 46 | Ga0070682_100015617 | 3300005337 | Bacteria | 4403 |
| 47 | Ga0070682_100024558 | 3300005337 | Bacteria | 3588 |
| 48 | Ga0070682_100034343 | 3300005337 | Bacteria | 3088 |
| 49 | Ga0068868_100001480 | 3300005338 | Bacteria | 16204 |
| 50 | Ga0068868_100016132 | 3300005338 | Bacteria | 5541 |
| 51 | Ga0068868_100044260 | 3300005338 | Bacteria | 3480 |
| 52 | Ga0068868_100052582 | 3300005338 | Bacteria | 3207 |
| 53 | Ga0068868_100093418 | 3300005338 | Bacteria | 2426 |
| 54 | Ga0068868_100095458 | 3300005338 | Bacteria | 2400 |
| 55 | Ga0068868_100125388 | 3300005338 | Bacteria | 2097 |
| 56 | Ga0070660_100009555 | 3300005339 | Bacteria | 6828 |
| 57 | Ga0070660_100056785 | 3300005339 | Bacteria | 3030 |
| 58 | Ga0070660_100093165 | 3300005339 | Bacteria | 2378 |
| 59 | Ga0070689_100025866 | 3300005340 | Bacteria | 4412 |
| 60 | Ga0070689_100026796 | 3300005340 | Bacteria | 4342 |
| 61 | Ga0070691_10004160 | 3300005341 | Bacteria | 6570 |
| 62 | Ga0070691_10056891 | 3300005341 | Bacteria | 1876 |
| 63 | Ga0070687_100010502 | 3300005343 | Bacteria | 4007 |
| 64 | Ga0070687_100066214 | 3300005343 | Bacteria | 1924 |
| 65 | Ga0070661_100038413 | 3300005344 | Bacteria | 3485 |
| 66 | Ga0070692_10010462 | 3300005345 | Bacteria | 4222 |
| 67 | Ga0070692_10027337 | 3300005345 | Bacteria | 2827 |
| 68 | Ga0070692_10038183 | 3300005345 | Bacteria | 2446 |
| 69 | Ga0070668_100001192 | 3300005347 | Bacteria | 18433 |
| 70 | Ga0070668_100001297 | 3300005347 | Bacteria | 17872 |
| 71 | Ga0070668_100024803 | 3300005347 | Bacteria | 4545 |
| 72 | Ga0070668_100030442 | 3300005347 | Bacteria | 4103 |
| 73 | Ga0070668_100046862 | 3300005347 | Bacteria | 3322 |
| 74 | Ga0070669_100004569 | 3300005353 | Bacteria | 9993 |
| 75 | Ga0070669_100022235 | 3300005353 | Bacteria | 4535 |
| 76 | Ga0070675_100000392 | 3300005354 | Bacteria | 29617 |
| 77 | Ga0070675_100010873 | 3300005354 | Bacteria | 7118 |
| 78 | Ga0070671_100001259 | 3300005355 | Bacteria | 18984 |
| 79 | Ga0070671_100001780 | 3300005355 | Bacteria | 16356 |
| 80 | Ga0070674_100000187 | 3300005356 | Bacteria | 29321 |
| 81 | Ga0070674_100123412 | 3300005356 | Bacteria | 1920 |
| 82 | Ga0070673_100022227 | 3300005364 | Bacteria | 4614 |
| 83 | Ga0070673_100245360 | 3300005364 | Bacteria | 1559 |
| 84 | Ga0070688_100057304 | 3300005365 | Bacteria | 2449 |
| 85 | Ga0070659_100023288 | 3300005366 | Bacteria | 4738 |
| 86 | Ga0070659_100032701 | 3300005366 | Bacteria | 4036 |
| 87 | Ga0070659_100054109 | 3300005366 | Bacteria | 3161 |
| 88 | Ga0070659_100107419 | 3300005366 | Bacteria | 2250 |
| 89 | Ga0070667_100000056 | 3300005367 | Bacteria | 150952 |
| 90 | Ga0070667_100000854 | 3300005367 | Bacteria | 28370 |
| 91 | Ga0070667_100003985 | 3300005367 | Bacteria | 12518 |
| 92 | Ga0070667_100012230 | 3300005367 | Bacteria | 7100 |
| 93 | Ga0070667_100051103 | 3300005367 | Bacteria | 3484 |
| 94 | Ga0070667_100134697 | 3300005367 | Bacteria | 2159 |
| 95 | Ga0070703_10009742 | 3300005406 | Bacteria | 2710 |
| 96 | Ga0070709_10045596 | 3300005434 | Bacteria | 2721 |
| 97 | Ga0070714_100000011 | 3300005435 | Bacteria | 231268 |
| 98 | Ga0070714_100006750 | 3300005435 | Bacteria | 8894 |
| 99 | Ga0070714_100086997 | 3300005435 | Bacteria | 2732 |
| 100 | Ga0070714_100110626 | 3300005435 | Bacteria | 2432 |
| 101 | Ga0070714_100163353 | 3300005435 | Bacteria | 2016 |
| 102 | Ga0070713_100003953 | 3300005436 | Bacteria | 9851 |
| 103 | Ga0070713_100106097 | 3300005436 | Bacteria | 2442 |
| 104 | Ga0070713_100152745 | 3300005436 | Bacteria | 2055 |
| 105 | Ga0070710_10000264 | 3300005437 | Bacteria | 24986 |
| 106 | Ga0070710_10000277 | 3300005437 | Bacteria | 24255 |
| 107 | Ga0070701_10000584 | 3300005438 | Bacteria | 12705 |
| 108 | Ga0070701_10003695 | 3300005438 | Bacteria | 6104 |
| 109 | Ga0070711_100000493 | 3300005439 | Bacteria | 20558 |
| 110 | Ga0070711_100154332 | 3300005439 | Bacteria | 1734 |
| 111 | Ga0070705_100004099 | 3300005440 | Bacteria | 7115 |
| 112 | Ga0070700_100000046 | 3300005441 | Bacteria | 91380 |
| 113 | Ga0070700_100003730 | 3300005441 | Bacteria | 7875 |
| 114 | Ga0070700_100005557 | 3300005441 | Bacteria | 6683 |
| 115 | Ga0070700_100026657 | 3300005441 | Bacteria | 3417 |
| 116 | Ga0070700_100090058 | 3300005441 | Bacteria | 2000 |
| 117 | Ga0070694_100024042 | 3300005444 | Bacteria | 3929 |
| 118 | Ga0070708_100000671 | 3300005445 | Bacteria | 26000 |
| 119 | Ga0070708_100008205 | 3300005445 | Bacteria | 8381 |
| 120 | Ga0070663_100015215 | 3300005455 | Bacteria | 4959 |
| 121 | Ga0070663_100046120 | 3300005455 | Bacteria | 3082 |
| 122 | Ga0070663_100065685 | 3300005455 | Bacteria | 2627 |
| 123 | Ga0070678_100000280 | 3300005456 | Bacteria | 23679 |
| 124 | Ga0070678_100059459 | 3300005456 | Bacteria | 2809 |
| 125 | Ga0070662_100001491 | 3300005457 | Bacteria | 14399 |
| 126 | Ga0070681_10000077 | 3300005458 | Bacteria | 72675 |
| 127 | Ga0070681_10001025 | 3300005458 | Bacteria | 23693 |
| 128 | Ga0070681_10071491 | 3300005458 | Bacteria | 3434 |
| 129 | Ga0068867_100002048 | 3300005459 | Bacteria | 14123 |
| 130 | Ga0068867_100003687 | 3300005459 | Bacteria | 10780 |
| 131 | Ga0070685_10018850 | 3300005466 | Bacteria | 3717 |
| 132 | Ga0070706_100009403 | 3300005467 | Bacteria | 9102 |
| 133 | Ga0070706_100021841 | 3300005467 | Bacteria | 5894 |
| 134 | Ga0070706_100028028 | 3300005467 | Bacteria | 5182 |
| 135 | Ga0070706_100066875 | 3300005467 | Bacteria | 3324 |
| 136 | Ga0070706_100085150 | 3300005467 | Bacteria | 2929 |
| 137 | Ga0070706_100167265 | 3300005467 | Bacteria | 2053 |
| 138 | Ga0070707_100001912 | 3300005468 | Bacteria | 19958 |
| 139 | Ga0070707_100180704 | 3300005468 | Bacteria | 2056 |
| 140 | Ga0070698_100008833 | 3300005471 | Bacteria | 10839 |
| 141 | Ga0070698_100045276 | 3300005471 | Bacteria | 4504 |
| 142 | Ga0070698_100053032 | 3300005471 | Bacteria | 4122 |
| 143 | Ga0070679_100000135 | 3300005530 | Bacteria | 59584 |
| 144 | Ga0070679_100001551 | 3300005530 | Bacteria | 20538 |
| 145 | Ga0070679_100040221 | 3300005530 | Bacteria | 4651 |
| 146 | Ga0070679_100067837 | 3300005530 | Bacteria | 3558 |
| 147 | Ga0070679_100167285 | 3300005530 | Bacteria | 2172 |
| 148 | Ga0070684_100003821 | 3300005535 | Bacteria | 11391 |
| 149 | Ga0070684_100088166 | 3300005535 | Bacteria | 2756 |
| 150 | Ga0070697_100002048 | 3300005536 | Bacteria | 15439 |
| 151 | Ga0068853_100001367 | 3300005539 | Bacteria | 17604 |
| 152 | Ga0068853_100017068 | 3300005539 | Bacteria | 5987 |
| 153 | Ga0068853_100044645 | 3300005539 | Bacteria | 3794 |
| 154 | Ga0070672_100003670 | 3300005543 | Bacteria | 9972 |
| 155 | Ga0070695_100021815 | 3300005545 | Bacteria | 3924 |
| 156 | Ga0070695_100036124 | 3300005545 | Bacteria | 3108 |
| 157 | Ga0070696_100002977 | 3300005546 | Bacteria | 11251 |
| 158 | Ga0070696_100030003 | 3300005546 | Bacteria | 3720 |
| 159 | Ga0070693_100009341 | 3300005547 | Bacteria | 4874 |
| 160 | Ga0070665_100001617 | 3300005548 | Bacteria | 25940 |
| 161 | Ga0070665_100006813 | 3300005548 | Bacteria | 11618 |
| 162 | Ga0070665_100056517 | 3300005548 | Bacteria | 3934 |
| 163 | Ga0070665_100075774 | 3300005548 | Bacteria | 3371 |
| 164 | Ga0070665_100113871 | 3300005548 | Bacteria | 2708 |
| 165 | Ga0070665_100160653 | 3300005548 | Bacteria | 2249 |
| 166 | Ga0070704_100001052 | 3300005549 | Bacteria | 14260 |
| 167 | Ga0070704_100129626 | 3300005549 | Bacteria | 1952 |
| 168 | Ga0068855_100010555 | 3300005563 | Bacteria | 11138 |
| 169 | Ga0068855_100038437 | 3300005563 | Bacteria | 5687 |
| 170 | Ga0068855_100050888 | 3300005563 | Bacteria | 4880 |
| 171 | Ga0070664_100020153 | 3300005564 | Bacteria | 5491 |
| 172 | Ga0070664_100031931 | 3300005564 | Bacteria | 4404 |
| 173 | Ga0068857_100033853 | 3300005577 | Bacteria | 4519 |
| 174 | Ga0068857_100057168 | 3300005577 | Bacteria | 3462 |
| 175 | Ga0068854_100000458 | 3300005578 | Bacteria | 25182 |
| 176 | Ga0068854_100069551 | 3300005578 | Bacteria | 2570 |
| 177 | Ga0068856_100023376 | 3300005614 | Bacteria | 6009 |
| 178 | Ga0068856_100068491 | 3300005614 | Bacteria | 3508 |
| 179 | Ga0068856_100077717 | 3300005614 | Bacteria | 3289 |
| 180 | Ga0068856_100081444 | 3300005614 | Bacteria | 3211 |
| 181 | Ga0068856_100093039 | 3300005614 | Bacteria | 3000 |
| 182 | Ga0068856_100139694 | 3300005614 | Bacteria | 2429 |
| 183 | Ga0070702_100000308 | 3300005615 | Bacteria | 16864 |
| 184 | Ga0070702_100016071 | 3300005615 | Bacteria | 3833 |
| 185 | Ga0068852_100020000 | 3300005616 | Bacteria | 5315 |
| 186 | Ga0068852_100046729 | 3300005616 | Bacteria | 3690 |
| 187 | Ga0068859_100000596 | 3300005617 | Bacteria | 36034 |
| 188 | Ga0068859_100000751 | 3300005617 | Bacteria | 32654 |
| 189 | Ga0068859_100061973 | 3300005617 | Bacteria | 3769 |
| 190 | Ga0068859_100064675 | 3300005617 | Bacteria | 3690 |
| 191 | Ga0068859_100245302 | 3300005617 | Bacteria | 1881 |
| 192 | Ga0068864_100010645 | 3300005618 | Bacteria | 7603 |
| 193 | Ga0068864_100049976 | 3300005618 | Bacteria | 3598 |
| 194 | Ga0068864_100143695 | 3300005618 | Bacteria | 2154 |
| 195 | Ga0068866_10000187 | 3300005718 | Bacteria | 29090 |
| 196 | Ga0068866_10039686 | 3300005718 | Bacteria | 2326 |
| 197 | Ga0068866_10066629 | 3300005718 | Bacteria | 1888 |
| 198 | Ga0068861_100000195 | 3300005719 | Bacteria | 32550 |
| 199 | Ga0068861_100009645 | 3300005719 | Bacteria | 6669 |
| 200 | Ga0068851_10044148 | 3300005834 | Bacteria | 2249 |
| 201 | Ga0068863_100000345 | 3300005841 | Bacteria | 47228 |
| 202 | Ga0068863_100001182 | 3300005841 | Bacteria | 26109 |
| 203 | Ga0068863_100002092 | 3300005841 | Bacteria | 19783 |
| 204 | Ga0068863_100009630 | 3300005841 | Bacteria | 9424 |
| 205 | Ga0068863_100009994 | 3300005841 | Bacteria | 9236 |
| 206 | Ga0068863_100014417 | 3300005841 | Bacteria | 7614 |
| 207 | Ga0068863_100066840 | 3300005841 | Bacteria | 3400 |
| 208 | Ga0068863_100076174 | 3300005841 | Bacteria | 3174 |
| 209 | Ga0068863_100115358 | 3300005841 | Bacteria | 2559 |
| 210 | Ga0068863_100249428 | 3300005841 | Bacteria | 1714 |
| 211 | Ga0068858_100000010 | 3300005842 | Bacteria | 234748 |
| 212 | Ga0068858_100000013 | 3300005842 | Bacteria | 216466 |
| 213 | Ga0068858_100013843 | 3300005842 | Bacteria | 7610 |
| 214 | Ga0068858_100047379 | 3300005842 | Bacteria | 3985 |
| 215 | Ga0068858_100068586 | 3300005842 | Bacteria | 3286 |
| 216 | Ga0068858_100070309 | 3300005842 | Bacteria | 3244 |
| 217 | Ga0068858_100102867 | 3300005842 | Bacteria | 2664 |
| 218 | Ga0068860_100000054 | 3300005843 | Bacteria | 206114 |
| 219 | Ga0068860_100000092 | 3300005843 | Bacteria | 150190 |
| 220 | Ga0068860_100001932 | 3300005843 | Bacteria | 21940 |
| 221 | Ga0068860_100122269 | 3300005843 | Bacteria | 2493 |
| 222 | Ga0068860_100184455 | 3300005843 | Bacteria | 2017 |
| 223 | Ga0068860_100187925 | 3300005843 | Bacteria | 1998 |
| 224 | Ga0068862_100000035 | 3300005844 | Bacteria | 174953 |
| 225 | Ga0068862_100000358 | 3300005844 | Bacteria | 49480 |
| 226 | Ga0068862_100033018 | 3300005844 | Bacteria | 4372 |
| 227 | Ga0068862_100036238 | 3300005844 | Bacteria | 4181 |
| 228 | Ga0081455_10000071 | 3300005937 | Bacteria | 110373 |
| 229 | Ga0081455_10000262 | 3300005937 | Bacteria | 69313 |
| 230 | Ga0081455_10001346 | 3300005937 | Bacteria | 30424 |
| 231 | Ga0081455_10015182 | 3300005937 | Bacteria | 7494 |
| 232 | Ga0081455_10015517 | 3300005937 | Bacteria | 7396 |
| 233 | Ga0081455_10015911 | 3300005937 | Bacteria | 7282 |
| 234 | Ga0081538_10000050 | 3300005981 | Bacteria | 110501 |
| 235 | Ga0081538_10022725 | 3300005981 | Bacteria | 4534 |
| 236 | Ga0081538_10070670 | 3300005981 | Bacteria | 1926 |
| 237 | Ga0081540_1000522 | 3300005983 | Bacteria | 37453 |
| 238 | Ga0081540_1000903 | 3300005983 | Bacteria | 26812 |
| 239 | Ga0081540_1000912 | 3300005983 | Bacteria | 26643 |
| 240 | Ga0081540_1002205 | 3300005983 | Bacteria | 16090 |
| 241 | Ga0081540_1015235 | 3300005983 | Bacteria | 4874 |
| 242 | Ga0081540_1028790 | 3300005983 | Bacteria | 3109 |
| 243 | Ga0081539_10000086 | 3300005985 | Bacteria | 217801 |
| 244 | Ga0081539_10000763 | 3300005985 | Bacteria | 63498 |
| 245 | Ga0081539_10003492 | 3300005985 | Bacteria | 19204 |
| 246 | Ga0081539_10004406 | 3300005985 | Bacteria | 15592 |
| 247 | Ga0081539_10005222 | 3300005985 | Bacteria | 13439 |
| 248 | Ga0081539_10010250 | 3300005985 | Bacteria | 7655 |
| 249 | Ga0081539_10036577 | 3300005985 | Bacteria | 2937 |
| 250 | Ga0081539_10044321 | 3300005985 | Bacteria | 2569 |
| 251 | Ga0081539_10072764 | 3300005985 | Bacteria | 1836 |
| 252 | Ga0070717_10040433 | 3300006028 | Bacteria | 3798 |
| 253 | Ga0070717_10049357 | 3300006028 | Bacteria | 3455 |
| 254 | Ga0070717_10161596 | 3300006028 | Bacteria | 1943 |
| 255 | Ga0075365_10031640 | 3300006038 | Bacteria | 3395 |
| 256 | Ga0075365_10040457 | 3300006038 | Bacteria | 3040 |
| 257 | Ga0075365_10072687 | 3300006038 | Bacteria | 2317 |
| 258 | Ga0075363_100019672 | 3300006048 | Bacteria | 3378 |
| 259 | Ga0075363_100040686 | 3300006048 | Bacteria | 2450 |
| 260 | Ga0075363_100058072 | 3300006048 | Bacteria | 2078 |
| 261 | Ga0075364_10001965 | 3300006051 | Bacteria | 11452 |
| 262 | Ga0075364_10003691 | 3300006051 | Bacteria | 8739 |
| 263 | Ga0075364_10017939 | 3300006051 | Bacteria | 4426 |
| 264 | Ga0075364_10051014 | 3300006051 | Bacteria | 2701 |
| 265 | Ga0070715_10005907 | 3300006163 | Bacteria | 4123 |
| 266 | Ga0070716_100007171 | 3300006173 | Bacteria | 5480 |
| 267 | Ga0070716_100025356 | 3300006173 | Bacteria | 3163 |
| 268 | Ga0070716_100116427 | 3300006173 | Bacteria | 1665 |
| 269 | Ga0070712_100001061 | 3300006175 | Bacteria | 16610 |
| 270 | Ga0070712_100009444 | 3300006175 | Bacteria | 6146 |
| 271 | Ga0070712_100110988 | 3300006175 | Bacteria | 2046 |
| 272 | Ga0075362_10021385 | 3300006177 | Bacteria | 2714 |
| 273 | Ga0075369_10002244 | 3300006186 | Bacteria | 6854 |
| 274 | Ga0075369_10006357 | 3300006186 | Bacteria | 4463 |
| 275 | Ga0075369_10044254 | 3300006186 | Bacteria | 1912 |
| 276 | Ga0075369_10046171 | 3300006186 | Bacteria | 1875 |
| 277 | Ga0097621_100036611 | 3300006237 | Bacteria | 3927 |
| 278 | Ga0075370_10001448 | 3300006353 | Bacteria | 10304 |
| 279 | Ga0075370_10034607 | 3300006353 | Bacteria | 2832 |
| 280 | Ga0075370_10063851 | 3300006353 | Bacteria | 2099 |
| 281 | Ga0068871_100011221 | 3300006358 | Bacteria | 6566 |
| 282 | Ga0068871_100093095 | 3300006358 | Bacteria | 2514 |
| 283 | Ga0075428_100000610 | 3300006844 | Bacteria | 36472 |
| 284 | Ga0075428_100007051 | 3300006844 | Bacteria | 12454 |
| 285 | Ga0075428_100007414 | 3300006844 | Bacteria | 12158 |
| 286 | Ga0075428_100030689 | 3300006844 | Bacteria | 5943 |
| 287 | Ga0075428_100174888 | 3300006844 | Bacteria | 2326 |
| 288 | Ga0075428_100311879 | 3300006844 | Bacteria | 1691 |
| 289 | Ga0075428_100400186 | 3300006844 | Bacteria | 1472 |
| 290 | Ga0075430_100007092 | 3300006846 | Bacteria | 9450 |
| 291 | Ga0075430_100015607 | 3300006846 | Bacteria | 6467 |
| 292 | Ga0075430_100034036 | 3300006846 | Bacteria | 4324 |
| 293 | Ga0075430_100041690 | 3300006846 | Bacteria | 3883 |
| 294 | Ga0075430_100067840 | 3300006846 | Bacteria | 2994 |
| 295 | Ga0075431_100012865 | 3300006847 | Bacteria | 8445 |
| 296 | Ga0075431_100056189 | 3300006847 | Bacteria | 4060 |
| 297 | Ga0075431_100060345 | 3300006847 | Bacteria | 3913 |
| 298 | Ga0075431_100068233 | 3300006847 | Bacteria | 3669 |
| 299 | Ga0075431_100171475 | 3300006847 | Bacteria | 2229 |
| 300 | Ga0075433_10007460 | 3300006852 | Bacteria | 8684 |
| 301 | Ga0075434_100032312 | 3300006871 | Bacteria | 5161 |
| 302 | Ga0075434_100291348 | 3300006871 | Bacteria | 1652 |
| 303 | Ga0075429_100009820 | 3300006880 | Bacteria | 8298 |
| 304 | Ga0075429_100016282 | 3300006880 | Bacteria | 6444 |
| 305 | Ga0075429_100022283 | 3300006880 | Bacteria | 5495 |
| 306 | Ga0075429_100051551 | 3300006880 | Bacteria | 3581 |
| 307 | Ga0075429_100144942 | 3300006880 | Bacteria | 2079 |
| 308 | Ga0068865_100003084 | 3300006881 | Bacteria | 9971 |
| 309 | Ga0068865_100006359 | 3300006881 | Bacteria | 7199 |
| 310 | Ga0068865_100053951 | 3300006881 | Bacteria | 2791 |
| 311 | Ga0075436_100050482 | 3300006914 | Bacteria | 2871 |
| 312 | Ga0097620_100000596 | 3300006931 | Bacteria | 36034 |
| 313 | Ga0097620_100000751 | 3300006931 | Bacteria | 32654 |
| 314 | Ga0097620_100061974 | 3300006931 | Bacteria | 3769 |
| 315 | Ga0097620_100064675 | 3300006931 | Bacteria | 3690 |
| 316 | Ga0097620_100245303 | 3300006931 | Bacteria | 1881 |
| 317 | Ga0105251_10030178 | 3300009011 | Bacteria | 2725 |
| 318 | Ga0105251_10053826 | 3300009011 | Bacteria | 1912 |
| 319 | Ga0105250_10018756 | 3300009092 | Bacteria | 2800 |
| 320 | Ga0105240_10003639 | 3300009093 | Bacteria | 23876 |
| 321 | Ga0105240_10037111 | 3300009093 | Bacteria | 6264 |
| 322 | Ga0105240_10194704 | 3300009093 | Bacteria | 2381 |
| 323 | Ga0105240_10354671 | 3300009093 | Bacteria | 1663 |
| 324 | Ga0111539_10001504 | 3300009094 | Bacteria | 31141 |
| 325 | Ga0111539_10002724 | 3300009094 | Bacteria | 23442 |
| 326 | Ga0111539_10009764 | 3300009094 | Bacteria | 12113 |
| 327 | Ga0111539_10100066 | 3300009094 | Bacteria | 3404 |
| 328 | Ga0105245_10000870 | 3300009098 | Bacteria | 27352 |
| 329 | Ga0105245_10005605 | 3300009098 | Bacteria | 11030 |
| 330 | Ga0105245_10005886 | 3300009098 | Bacteria | 10772 |
| 331 | Ga0105245_10018820 | 3300009098 | Bacteria | 6043 |
| 332 | Ga0105245_10097087 | 3300009098 | Bacteria | 2720 |
| 333 | Ga0105245_10176509 | 3300009098 | Bacteria | 2038 |
| 334 | Ga0105245_10263285 | 3300009098 | Bacteria | 1679 |
| 335 | Ga0105247_10000038 | 3300009101 | Bacteria | 164083 |
| 336 | Ga0105247_10000062 | 3300009101 | Bacteria | 126437 |
| 337 | Ga0105247_10000637 | 3300009101 | Bacteria | 28051 |
| 338 | Ga0105247_10009210 | 3300009101 | Bacteria | 6005 |
| 339 | Ga0105247_10018328 | 3300009101 | Bacteria | 4200 |
| 340 | Ga0105247_10022164 | 3300009101 | Bacteria | 3824 |
| 341 | Ga0114129_10000852 | 3300009147 | Bacteria | 39505 |
| 342 | Ga0114129_10001274 | 3300009147 | Bacteria | 33664 |
| 343 | Ga0114129_10001724 | 3300009147 | Bacteria | 29818 |
| 344 | Ga0114129_10091266 | 3300009147 | Bacteria | 4221 |
| 345 | Ga0114129_10118258 | 3300009147 | Bacteria | 3651 |
| 346 | Ga0114129_10185214 | 3300009147 | Bacteria | 2830 |
| 347 | Ga0105243_10001020 | 3300009148 | Bacteria | 25871 |
| 348 | Ga0105243_10021920 | 3300009148 | Bacteria | 4852 |
| 349 | Ga0105243_10194003 | 3300009148 | Bacteria | 1776 |
| 350 | Ga0105241_10025845 | 3300009174 | Bacteria | 4365 |
| 351 | Ga0105241_10133231 | 3300009174 | Bacteria | 2014 |
| 352 | Ga0105242_10000650 | 3300009176 | Bacteria | 27213 |
| 353 | Ga0105242_10027971 | 3300009176 | Bacteria | 4483 |
| 354 | Ga0105242_10041014 | 3300009176 | Bacteria | 3731 |
| 355 | Ga0105242_10092703 | 3300009176 | Bacteria | 2545 |
| 356 | Ga0105242_10103959 | 3300009176 | Bacteria | 2410 |
| 357 | Ga0105242_10135768 | 3300009176 | Bacteria | 2129 |
| 358 | Ga0105248_10000035 | 3300009177 | Bacteria | 187578 |
| 359 | Ga0105248_10000036 | 3300009177 | Bacteria | 187421 |
| 360 | Ga0105248_10003863 | 3300009177 | Bacteria | 16573 |
| 361 | Ga0105248_10011321 | 3300009177 | Bacteria | 9832 |
| 362 | Ga0105248_10033866 | 3300009177 | Bacteria | 5707 |
| 363 | Ga0105248_10039835 | 3300009177 | Bacteria | 5266 |
| 364 | Ga0105248_10045424 | 3300009177 | Bacteria | 4926 |
| 365 | Ga0105248_10049682 | 3300009177 | Bacteria | 4704 |
| 366 | Ga0105248_10075304 | 3300009177 | Bacteria | 3793 |
| 367 | Ga0105248_10134247 | 3300009177 | Bacteria | 2792 |
| 368 | Ga0105248_10201205 | 3300009177 | Bacteria | 2244 |
| 369 | Ga0105248_10238833 | 3300009177 | Bacteria | 2045 |
| 370 | Ga0105248_10241017 | 3300009177 | Bacteria | 2036 |
| 371 | Ga0105237_10000467 | 3300009545 | Bacteria | 57237 |
| 372 | Ga0105237_10014748 | 3300009545 | Bacteria | 8156 |
| 373 | Ga0105237_10014930 | 3300009545 | Bacteria | 8099 |
| 374 | Ga0105237_10044770 | 3300009545 | Bacteria | 4456 |
| 375 | Ga0105238_10032638 | 3300009551 | Bacteria | 5298 |
| 376 | Ga0105238_10085210 | 3300009551 | Bacteria | 3148 |
| 377 | Ga0105238_10307532 | 3300009551 | Bacteria | 1570 |
| 378 | Ga0105249_10000046 | 3300009553 | Bacteria | 176363 |
| 379 | Ga0105249_10001186 | 3300009553 | Bacteria | 23057 |
| 380 | Ga0105249_10005191 | 3300009553 | Bacteria | 11241 |
| 381 | Ga0105249_10118937 | 3300009553 | Bacteria | 2508 |
| 382 | Ga0099796_10029146 | 3300010159 | Bacteria | 1778 |
| 383 | Ga0105239_10003093 | 3300010375 | Bacteria | 20661 |
| 384 | Ga0105239_10008819 | 3300010375 | Bacteria | 11412 |
| 385 | Ga0105239_10016946 | 3300010375 | Bacteria | 8054 |
| 386 | Ga0105239_10147161 | 3300010375 | Bacteria | 2628 |
| 387 | Ga0105239_10323128 | 3300010375 | Bacteria | 1740 |
| 388 | Ga0105246_10014319 | 3300011119 | Bacteria | 4987 |
| 389 | Ga0105246_10040638 | 3300011119 | Bacteria | 3140 |
| 390 | Ga0105246_10062558 | 3300011119 | Bacteria | 2593 |
| 391 | Ga0105246_10083890 | 3300011119 | Bacteria | 2278 |
| 392 | Ga0105246_10094152 | 3300011119 | Bacteria | 2166 |
| 393 | Ga0157373_10026116 | 3300013100 | Bacteria | 4221 |
| 394 | Ga0157373_10034275 | 3300013100 | Bacteria | 3646 |
| 395 | Ga0157371_10056311 | 3300013102 | Bacteria | 2789 |
| 396 | Ga0157370_10014109 | 3300013104 | Bacteria | 8196 |
| 397 | Ga0157370_10016416 | 3300013104 | Bacteria | 7496 |
| 398 | Ga0157370_10040559 | 3300013104 | Bacteria | 4495 |
| 399 | Ga0157370_10132940 | 3300013104 | Bacteria | 2320 |
| 400 | Ga0157369_10000890 | 3300013105 | Bacteria | 38122 |
| 401 | Ga0157369_10010203 | 3300013105 | Bacteria | 10717 |
| 402 | Ga0157369_10048565 | 3300013105 | Bacteria | 4605 |
| 403 | Ga0157369_10065749 | 3300013105 | Bacteria | 3902 |
| 404 | Ga0157369_10098846 | 3300013105 | Bacteria | 3111 |
| 405 | Ga0157369_10100808 | 3300013105 | Bacteria | 3078 |
| 406 | Ga0157369_10235375 | 3300013105 | Bacteria | 1914 |
| 407 | Ga0157369_10269053 | 3300013105 | Bacteria | 1776 |
| 408 | Ga0157374_10203151 | 3300013296 | Bacteria | 1941 |
| 409 | Ga0157378_10029056 | 3300013297 | Bacteria | 4879 |
| 410 | Ga0163162_10001609 | 3300013306 | Bacteria | 21131 |
| 411 | Ga0163162_10054540 | 3300013306 | Bacteria | 4021 |
| 412 | Ga0163162_10094916 | 3300013306 | Bacteria | 3069 |
| 413 | Ga0157372_10000069 | 3300013307 | Bacteria | 110621 |
| 414 | Ga0157372_10004145 | 3300013307 | Bacteria | 15520 |
| 415 | Ga0157372_10081467 | 3300013307 | Bacteria | 3663 |
| 416 | Ga0157372_10252452 | 3300013307 | Bacteria | 2047 |
| 417 | Ga0157372_10256371 | 3300013307 | Bacteria | 2031 |
| 418 | Ga0157372_10466967 | 3300013307 | Bacteria | 1471 |
| 419 | Ga0157375_10000419 | 3300013308 | Bacteria | 38685 |
| 420 | Ga0157375_10097169 | 3300013308 | Bacteria | 3019 |
| 421 | Ga0163163_10008079 | 3300014325 | Bacteria | 9322 |
| 422 | Ga0163163_10013354 | 3300014325 | Bacteria | 7517 |
| 423 | Ga0163163_10041882 | 3300014325 | Bacteria | 4481 |
| 424 | Ga0163163_10095860 | 3300014325 | Bacteria | 2987 |
| 425 | Ga0163163_10109215 | 3300014325 | Bacteria | 2793 |
| 426 | Ga0163163_10141080 | 3300014325 | Bacteria | 2452 |
| 427 | Ga0157380_10015814 | 3300014326 | Bacteria | 5551 |
| 428 | Ga0157380_10056783 | 3300014326 | Bacteria | 3115 |
| 429 | Ga0157380_10162506 | 3300014326 | Bacteria | 1943 |
| 430 | Ga0157377_10003983 | 3300014745 | Bacteria | 6737 |
| 431 | Ga0157377_10037198 | 3300014745 | Bacteria | 2681 |
| 432 | Ga0157379_10000012 | 3300014968 | Bacteria | 110577 |
| 433 | Ga0157379_10008843 | 3300014968 | Bacteria | 8783 |
| 434 | Ga0157379_10020489 | 3300014968 | Bacteria | 5847 |
| 435 | Ga0157379_10045149 | 3300014968 | Bacteria | 3934 |
| 436 | Ga0157379_10185118 | 3300014968 | Bacteria | 1882 |
| 437 | Ga0157376_10003944 | 3300014969 | Bacteria | 10264 |
| 438 | Ga0182007_10006330 | 3300015262 | Bacteria | 5091 |
| 439 | Ga0183367_1002 | 3300015688 | Bacteria | 1101531 |
| 440 | Ga0163161_10004818 | 3300017792 | Bacteria | 9403 |
| 441 | Ga0163161_10021838 | 3300017792 | Bacteria | 4501 |
| 442 | Ga0163161_10025906 | 3300017792 | Bacteria | 4152 |
| 443 | Ga0197907_10125209 | 3300020069 | Bacteria | 3972 |
| 444 | Ga0197907_10824310 | 3300020069 | Bacteria | 2432 |
| 445 | Ga0197907_11041682 | 3300020069 | Bacteria | 2109 |
| 446 | Ga0206356_11084540 | 3300020070 | Bacteria | 3024 |
| 447 | Ga0206356_11251781 | 3300020070 | Bacteria | 3419 |
| 448 | Ga0206356_11557117 | 3300020070 | Bacteria | 2360 |
| 449 | Ga0206355_1061250 | 3300020076 | Bacteria | 1620 |
| 450 | Ga0206351_10970124 | 3300020077 | Bacteria | 2115 |
| 451 | Ga0206352_11163761 | 3300020078 | Bacteria | 1641 |
| 452 | Ga0206350_11654720 | 3300020080 | Bacteria | 2983 |
| 453 | Ga0206353_10041609 | 3300020082 | Bacteria | 2329 |
| 454 | Ga0206353_10184723 | 3300020082 | Bacteria | 3671 |
| 455 | Ga0206353_10976662 | 3300020082 | Bacteria | 5738 |
| 456 | Ga0154015_1539966 | 3300020610 | Bacteria | 2439 |
| 457 | Ga0154015_1634210 | 3300020610 | Bacteria | 1709 |
| 458 | Ga0154015_1690007 | 3300020610 | Bacteria | 2383 |
| 459 | Ga0213873_10000037 | 3300021358 | Bacteria | 34798 |
| 460 | Ga0213876_10000793 | 3300021384 | Bacteria | 21431 |
| 461 | Ga0213876_10019769 | 3300021384 | Bacteria | 3557 |
| 462 | Ga0213876_10075381 | 3300021384 | Bacteria | 1781 |
| 463 | Ga0213875_10002364 | 3300021388 | Bacteria | 11366 |
| 464 | Ga0213875_10010278 | 3300021388 | Bacteria | 4690 |
| 465 | Ga0213875_10011142 | 3300021388 | Bacteria | 4482 |
| 466 | Ga0213875_10016187 | 3300021388 | Bacteria | 3618 |
| 467 | Ga0213875_10017198 | 3300021388 | Bacteria | 3498 |
| 468 | Ga0213875_10023525 | 3300021388 | Bacteria | 2942 |
| 469 | Ga0213875_10035752 | 3300021388 | Bacteria | 2343 |
| 470 | Ga0224712_10000640 | 3300022467 | Bacteria | 7152 |
| 471 | Ga0224712_10000868 | 3300022467 | Bacteria | 6453 |
| 472 | Ga0224712_10001321 | 3300022467 | Bacteria | 5648 |
| 473 | Ga0224712_10002852 | 3300022467 | Bacteria | 4361 |
| 474 | Ga0224712_10003615 | 3300022467 | Bacteria | 4050 |
| 475 | Ga0224712_10008703 | 3300022467 | Bacteria | 3023 |
| 476 | Ga0224712_10021348 | 3300022467 | Bacteria | 2215 |
| 477 | Ga0228598_1007224 | 3300024227 | Bacteria | 2270 |
| 478 | Ga0209758_1005072 | 3300025297 | Bacteria | 10434 |
| 479 | Ga0207426_1002674 | 3300025302 | Bacteria | 10931 |
| 480 | Ga0207426_1004723 | 3300025302 | Bacteria | 6516 |
| 481 | Ga0209051_1000011 | 3300025303 | Bacteria | 610828 |
| 482 | Ga0209051_1000620 | 3300025303 | Bacteria | 40785 |
| 483 | Ga0209051_1000933 | 3300025303 | Bacteria | 28862 |
| 484 | Ga0209051_1001428 | 3300025303 | Bacteria | 20451 |
| 485 | Ga0209051_1042780 | 3300025303 | Bacteria | 1597 |
| 486 | Ga0207713_1047252 | 3300025735 | Bacteria | 1743 |
| 487 | Ga0207653_10019979 | 3300025885 | Bacteria | 2117 |
| 488 | Ga0207692_10000049 | 3300025898 | Bacteria | 35853 |
| 489 | Ga0207692_10006547 | 3300025898 | Bacteria | 4728 |
| 490 | Ga0207692_10041273 | 3300025898 | Bacteria | 2283 |
| 491 | Ga0207642_10000726 | 3300025899 | Bacteria | 10182 |
| 492 | Ga0207642_10008157 | 3300025899 | Bacteria | 3579 |
| 493 | Ga0207710_10000017 | 3300025900 | Bacteria | 370962 |
| 494 | Ga0207710_10000048 | 3300025900 | Bacteria | 189597 |
| 495 | Ga0207710_10000060 | 3300025900 | Bacteria | 168230 |
| 496 | Ga0207710_10000890 | 3300025900 | Bacteria | 15991 |
| 497 | Ga0207710_10017562 | 3300025900 | Bacteria | 3034 |
| 498 | Ga0207710_10018265 | 3300025900 | Bacteria | 2981 |
| 499 | Ga0207688_10000177 | 3300025901 | Bacteria | 28125 |
| 500 | Ga0207688_10000985 | 3300025901 | Bacteria | 14533 |
| 501 | Ga0207688_10001785 | 3300025901 | Bacteria | 11428 |
| 502 | Ga0207688_10003133 | 3300025901 | Bacteria | 9023 |
| 503 | Ga0207688_10069288 | 3300025901 | Bacteria | 1999 |
| 504 | Ga0207688_10089663 | 3300025901 | Bacteria | 1765 |
| 505 | Ga0207680_10004709 | 3300025903 | Bacteria | 6485 |
| 506 | Ga0207680_10019714 | 3300025903 | Bacteria | 3612 |
| 507 | Ga0207680_10055310 | 3300025903 | Bacteria | 2391 |
| 508 | Ga0207680_10074674 | 3300025903 | Bacteria | 2112 |
| 509 | Ga0207647_10041404 | 3300025904 | Bacteria | 2896 |
| 510 | Ga0207647_10052506 | 3300025904 | Bacteria | 2516 |
| 511 | Ga0207685_10001985 | 3300025905 | Bacteria | 4542 |
| 512 | Ga0207685_10028071 | 3300025905 | Bacteria | 1977 |
| 513 | Ga0207699_10044380 | 3300025906 | Bacteria | 2587 |
| 514 | Ga0207699_10066505 | 3300025906 | Bacteria | 2188 |
| 515 | Ga0207699_10071370 | 3300025906 | Bacteria | 2123 |
| 516 | Ga0207645_10022095 | 3300025907 | Bacteria | 4144 |
| 517 | Ga0207643_10000335 | 3300025908 | Bacteria | 32120 |
| 518 | Ga0207643_10012832 | 3300025908 | Bacteria | 4529 |
| 519 | Ga0207705_10000676 | 3300025909 | Bacteria | 28263 |
| 520 | Ga0207705_10002002 | 3300025909 | Bacteria | 15842 |
| 521 | Ga0207705_10014666 | 3300025909 | Bacteria | 5638 |
| 522 | Ga0207705_10020763 | 3300025909 | Bacteria | 4687 |
| 523 | Ga0207705_10020946 | 3300025909 | Bacteria | 4665 |
| 524 | Ga0207705_10061174 | 3300025909 | Bacteria | 2720 |
| 525 | Ga0207705_10138892 | 3300025909 | Bacteria | 1813 |
| 526 | Ga0207684_10002893 | 3300025910 | Bacteria | 17012 |
| 527 | Ga0207684_10143592 | 3300025910 | Bacteria | 2053 |
| 528 | Ga0207707_10000089 | 3300025912 | Bacteria | 90919 |
| 529 | Ga0207707_10009801 | 3300025912 | Bacteria | 8308 |
| 530 | Ga0207707_10010633 | 3300025912 | Bacteria | 7993 |
| 531 | Ga0207695_10017340 | 3300025913 | Bacteria | 8383 |
| 532 | Ga0207695_10027984 | 3300025913 | Bacteria | 6264 |
| 533 | Ga0207671_10038644 | 3300025914 | Bacteria | 3537 |
| 534 | Ga0207671_10056241 | 3300025914 | Bacteria | 2915 |
| 535 | Ga0207693_10000339 | 3300025915 | Bacteria | 43073 |
| 536 | Ga0207693_10001185 | 3300025915 | Bacteria | 23283 |
| 537 | Ga0207693_10029887 | 3300025915 | Bacteria | 4300 |
| 538 | Ga0207693_10067864 | 3300025915 | Bacteria | 2792 |
| 539 | Ga0207693_10075462 | 3300025915 | Bacteria | 2640 |
| 540 | Ga0207693_10083640 | 3300025915 | Bacteria | 2500 |
| 541 | Ga0207693_10118340 | 3300025915 | Bacteria | 2080 |
| 542 | Ga0207693_10157566 | 3300025915 | Bacteria | 1786 |
| 543 | Ga0207693_10170474 | 3300025915 | Bacteria | 1714 |
| 544 | Ga0207663_10035253 | 3300025916 | Bacteria | 3000 |
| 545 | Ga0207663_10062232 | 3300025916 | Bacteria | 2371 |
| 546 | Ga0207660_10000115 | 3300025917 | Bacteria | 46447 |
| 547 | Ga0207660_10000815 | 3300025917 | Bacteria | 20585 |
| 548 | Ga0207660_10163950 | 3300025917 | Bacteria | 1717 |
| 549 | Ga0207660_10194254 | 3300025917 | Bacteria | 1582 |
| 550 | Ga0207662_10013813 | 3300025918 | Bacteria | 4520 |
| 551 | Ga0207662_10020422 | 3300025918 | Bacteria | 3780 |
| 552 | Ga0207662_10084502 | 3300025918 | Bacteria | 1942 |
| 553 | Ga0207657_10002680 | 3300025919 | Bacteria | 19204 |
| 554 | Ga0207657_10014660 | 3300025919 | Bacteria | 7638 |
| 555 | Ga0207657_10020276 | 3300025919 | Bacteria | 6287 |
| 556 | Ga0207657_10062164 | 3300025919 | Bacteria | 3198 |
| 557 | Ga0207657_10084696 | 3300025919 | Bacteria | 2656 |
| 558 | Ga0207657_10129847 | 3300025919 | Bacteria | 2066 |
| 559 | Ga0207649_10004339 | 3300025920 | Bacteria | 7701 |
| 560 | Ga0207649_10150627 | 3300025920 | Bacteria | 1602 |
| 561 | Ga0207652_10000015 | 3300025921 | Bacteria | 193042 |
| 562 | Ga0207652_10010364 | 3300025921 | Bacteria | 7504 |
| 563 | Ga0207652_10016837 | 3300025921 | Bacteria | 5974 |
| 564 | Ga0207652_10037921 | 3300025921 | Bacteria | 4081 |
| 565 | Ga0207652_10047432 | 3300025921 | Bacteria | 3669 |
| 566 | Ga0207646_10022954 | 3300025922 | Bacteria | 5736 |
| 567 | Ga0207681_10000788 | 3300025923 | Bacteria | 20865 |
| 568 | Ga0207694_10023506 | 3300025924 | Bacteria | 4679 |
| 569 | Ga0207650_10007490 | 3300025925 | Bacteria | 7443 |
| 570 | Ga0207650_10077853 | 3300025925 | Bacteria | 2507 |
| 571 | Ga0207650_10208497 | 3300025925 | Bacteria | 1569 |
| 572 | Ga0207659_10012720 | 3300025926 | Bacteria | 5369 |
| 573 | Ga0207659_10014966 | 3300025926 | Bacteria | 5015 |
| 574 | Ga0207687_10003312 | 3300025927 | Bacteria | 10883 |
| 575 | Ga0207687_10024289 | 3300025927 | Bacteria | 4048 |
| 576 | Ga0207687_10034677 | 3300025927 | Bacteria | 3427 |
| 577 | Ga0207687_10077886 | 3300025927 | Bacteria | 2385 |
| 578 | Ga0207687_10153233 | 3300025927 | Bacteria | 1761 |
| 579 | Ga0207700_10063014 | 3300025928 | Bacteria | 2818 |
| 580 | Ga0207700_10065136 | 3300025928 | Bacteria | 2779 |
| 581 | Ga0207700_10122586 | 3300025928 | Bacteria | 2110 |
| 582 | Ga0207700_10124281 | 3300025928 | Bacteria | 2096 |
| 583 | Ga0207664_10000001 | 3300025929 | Bacteria | 724213 |
| 584 | Ga0207664_10003864 | 3300025929 | Bacteria | 10068 |
| 585 | Ga0207664_10016390 | 3300025929 | Bacteria | 5406 |
| 586 | Ga0207664_10028564 | 3300025929 | Bacteria | 4240 |
| 587 | Ga0207664_10044386 | 3300025929 | Bacteria | 3480 |
| 588 | Ga0207664_10065900 | 3300025929 | Bacteria | 2901 |
| 589 | Ga0207664_10130771 | 3300025929 | Bacteria | 2113 |
| 590 | Ga0207664_10142941 | 3300025929 | Bacteria | 2026 |
| 591 | Ga0207644_10000976 | 3300025931 | Bacteria | 18277 |
| 592 | Ga0207644_10003155 | 3300025931 | Bacteria | 10607 |
| 593 | Ga0207644_10107041 | 3300025931 | Bacteria | 2109 |
| 594 | Ga0207690_10000171 | 3300025932 | Bacteria | 50511 |
| 595 | Ga0207690_10022295 | 3300025932 | Bacteria | 3937 |
| 596 | Ga0207706_10002589 | 3300025933 | Bacteria | 17618 |
| 597 | Ga0207706_10007779 | 3300025933 | Bacteria | 9895 |
| 598 | Ga0207706_10053435 | 3300025933 | Bacteria | 3566 |
| 599 | Ga0207686_10001637 | 3300025934 | Bacteria | 12508 |
| 600 | Ga0207686_10017197 | 3300025934 | Bacteria | 4072 |
| 601 | Ga0207686_10070814 | 3300025934 | Bacteria | 2242 |
| 602 | Ga0207686_10104898 | 3300025934 | Bacteria | 1894 |
| 603 | Ga0207709_10001393 | 3300025935 | Bacteria | 16930 |
| 604 | Ga0207709_10005302 | 3300025935 | Bacteria | 7335 |
| 605 | Ga0207709_10008671 | 3300025935 | Bacteria | 5610 |
| 606 | Ga0207670_10044191 | 3300025936 | Bacteria | 2947 |
| 607 | Ga0207670_10142032 | 3300025936 | Bacteria | 1771 |
| 608 | Ga0207669_10000205 | 3300025937 | Bacteria | 26813 |
| 609 | Ga0207669_10003947 | 3300025937 | Bacteria | 6471 |
| 610 | Ga0207704_10000618 | 3300025938 | Bacteria | 15725 |
| 611 | Ga0207704_10005569 | 3300025938 | Bacteria | 5806 |
| 612 | Ga0207704_10107026 | 3300025938 | Bacteria | 1880 |
| 613 | Ga0207665_10006357 | 3300025939 | Bacteria | 7837 |
| 614 | Ga0207665_10009000 | 3300025939 | Bacteria | 6552 |
| 615 | Ga0207665_10019025 | 3300025939 | Bacteria | 4511 |
| 616 | Ga0207665_10041528 | 3300025939 | Bacteria | 3072 |
| 617 | Ga0207665_10043041 | 3300025939 | Bacteria | 3019 |
| 618 | Ga0207665_10095785 | 3300025939 | Bacteria | 2063 |
| 619 | Ga0207691_10000365 | 3300025940 | Bacteria | 45542 |
| 620 | Ga0207691_10014980 | 3300025940 | Bacteria | 7383 |
| 621 | Ga0207691_10123103 | 3300025940 | Bacteria | 2296 |
| 622 | Ga0207711_10000073 | 3300025941 | Bacteria | 107878 |
| 623 | Ga0207711_10000747 | 3300025941 | Bacteria | 31851 |
| 624 | Ga0207711_10001409 | 3300025941 | Bacteria | 22525 |
| 625 | Ga0207711_10006606 | 3300025941 | Bacteria | 9769 |
| 626 | Ga0207711_10009126 | 3300025941 | Bacteria | 8280 |
| 627 | Ga0207711_10010854 | 3300025941 | Bacteria | 7570 |
| 628 | Ga0207711_10016330 | 3300025941 | Bacteria | 6168 |
| 629 | Ga0207711_10099817 | 3300025941 | Bacteria | 2567 |
| 630 | Ga0207711_10125273 | 3300025941 | Bacteria | 2297 |
| 631 | Ga0207711_10160682 | 3300025941 | Bacteria | 2033 |
| 632 | Ga0207689_10002913 | 3300025942 | Bacteria | 15796 |
| 633 | Ga0207689_10006800 | 3300025942 | Bacteria | 10062 |
| 634 | Ga0207689_10047196 | 3300025942 | Bacteria | 3558 |
| 635 | Ga0207689_10071434 | 3300025942 | Bacteria | 2851 |
| 636 | Ga0207661_10001912 | 3300025944 | Bacteria | 14292 |
| 637 | Ga0207661_10025154 | 3300025944 | Bacteria | 4523 |
| 638 | Ga0207661_10026607 | 3300025944 | Bacteria | 4410 |
| 639 | Ga0207661_10064146 | 3300025944 | Bacteria | 2977 |
| 640 | Ga0207661_10076749 | 3300025944 | Bacteria | 2745 |
| 641 | Ga0207661_10123955 | 3300025944 | Bacteria | 2204 |
| 642 | Ga0207661_10187600 | 3300025944 | Bacteria | 1811 |
| 643 | Ga0207661_10234549 | 3300025944 | Bacteria | 1626 |
| 644 | Ga0207679_10006663 | 3300025945 | Bacteria | 7313 |
| 645 | Ga0207679_10024111 | 3300025945 | Bacteria | 4168 |
| 646 | Ga0207679_10037555 | 3300025945 | Bacteria | 3444 |
| 647 | Ga0207679_10260636 | 3300025945 | Bacteria | 1478 |
| 648 | Ga0207667_10009549 | 3300025949 | Bacteria | 11416 |
| 649 | Ga0207667_10027730 | 3300025949 | Bacteria | 6160 |
| 650 | Ga0207667_10102345 | 3300025949 | Bacteria | 2955 |
| 651 | Ga0207667_10146731 | 3300025949 | Bacteria | 2429 |
| 652 | Ga0207667_10230340 | 3300025949 | Bacteria | 1897 |
| 653 | Ga0207651_10040572 | 3300025960 | Bacteria | 3081 |
| 654 | Ga0207651_10209457 | 3300025960 | Bacteria | 1568 |
| 655 | Ga0207712_10000042 | 3300025961 | Bacteria | 176338 |
| 656 | Ga0207712_10015171 | 3300025961 | Bacteria | 4966 |
| 657 | Ga0207712_10076219 | 3300025961 | Bacteria | 2427 |
| 658 | Ga0207712_10210514 | 3300025961 | Bacteria | 1548 |
| 659 | Ga0207668_10000918 | 3300025972 | Bacteria | 17752 |
| 660 | Ga0207668_10002531 | 3300025972 | Bacteria | 10674 |
| 661 | Ga0207668_10003383 | 3300025972 | Bacteria | 9352 |
| 662 | Ga0207668_10006483 | 3300025972 | Bacteria | 6920 |
| 663 | Ga0207668_10011491 | 3300025972 | Bacteria | 5383 |
| 664 | Ga0207668_10030292 | 3300025972 | Bacteria | 3555 |
| 665 | Ga0207640_10003652 | 3300025981 | Bacteria | 8297 |
| 666 | Ga0207640_10010659 | 3300025981 | Bacteria | 5184 |
| 667 | Ga0207640_10068543 | 3300025981 | Bacteria | 2378 |
| 668 | Ga0207658_10000449 | 3300025986 | Bacteria | 38511 |
| 669 | Ga0207658_10005595 | 3300025986 | Bacteria | 8596 |
| 670 | Ga0207658_10053121 | 3300025986 | Bacteria | 2992 |
| 671 | Ga0207658_10076757 | 3300025986 | Bacteria | 2547 |
| 672 | Ga0207658_10188247 | 3300025986 | Bacteria | 1713 |
| 673 | Ga0207677_10003695 | 3300026023 | Bacteria | 8117 |
| 674 | Ga0207677_10011197 | 3300026023 | Bacteria | 5104 |
| 675 | Ga0207677_10027876 | 3300026023 | Bacteria | 3565 |
| 676 | Ga0207677_10035072 | 3300026023 | Bacteria | 3254 |
| 677 | Ga0207677_10036316 | 3300026023 | Bacteria | 3210 |
| 678 | Ga0207677_10038832 | 3300026023 | Bacteria | 3124 |
| 679 | Ga0207677_10043595 | 3300026023 | Bacteria | 2984 |
| 680 | Ga0207703_10000002 | 3300026035 | Bacteria | 600711 |
| 681 | Ga0207703_10000009 | 3300026035 | Bacteria | 343983 |
| 682 | Ga0207703_10002964 | 3300026035 | Bacteria | 14391 |
| 683 | Ga0207703_10061458 | 3300026035 | Bacteria | 3075 |
| 684 | Ga0207639_10005809 | 3300026041 | Bacteria | 8358 |
| 685 | Ga0207639_10045082 | 3300026041 | Bacteria | 3320 |
| 686 | Ga0207639_10047931 | 3300026041 | Bacteria | 3232 |
| 687 | Ga0207639_10050377 | 3300026041 | Bacteria | 3162 |
| 688 | Ga0207639_10061070 | 3300026041 | Bacteria | 2909 |
| 689 | Ga0207678_10000657 | 3300026067 | Bacteria | 31782 |
| 690 | Ga0207678_10002619 | 3300026067 | Bacteria | 16406 |
| 691 | Ga0207678_10008350 | 3300026067 | Bacteria | 9130 |
| 692 | Ga0207678_10008815 | 3300026067 | Bacteria | 8876 |
| 693 | Ga0207678_10037057 | 3300026067 | Bacteria | 4244 |
| 694 | Ga0207678_10051777 | 3300026067 | Bacteria | 3544 |
| 695 | Ga0207678_10121879 | 3300026067 | Bacteria | 2225 |
| 696 | Ga0207708_10000002 | 3300026075 | Bacteria | 411071 |
| 697 | Ga0207708_10000208 | 3300026075 | Bacteria | 46487 |
| 698 | Ga0207708_10005701 | 3300026075 | Bacteria | 9204 |
| 699 | Ga0207708_10013101 | 3300026075 | Bacteria | 6188 |
| 700 | Ga0207702_10004196 | 3300026078 | Bacteria | 12876 |
| 701 | Ga0207702_10009828 | 3300026078 | Bacteria | 8022 |
| 702 | Ga0207702_10017665 | 3300026078 | Bacteria | 5902 |
| 703 | Ga0207702_10096501 | 3300026078 | Bacteria | 2600 |
| 704 | Ga0207702_10143824 | 3300026078 | Bacteria | 2161 |
| 705 | Ga0207702_10239809 | 3300026078 | Bacteria | 1698 |
| 706 | Ga0207641_10001094 | 3300026088 | Bacteria | 27248 |
| 707 | Ga0207641_10001703 | 3300026088 | Bacteria | 21401 |
| 708 | Ga0207641_10002959 | 3300026088 | Bacteria | 15363 |
| 709 | Ga0207641_10013167 | 3300026088 | Bacteria | 6781 |
| 710 | Ga0207641_10014228 | 3300026088 | Bacteria | 6519 |
| 711 | Ga0207641_10057479 | 3300026088 | Bacteria | 3308 |
| 712 | Ga0207641_10237589 | 3300026088 | Bacteria | 1696 |
| 713 | Ga0207648_10000623 | 3300026089 | Bacteria | 39688 |
| 714 | Ga0207648_10002531 | 3300026089 | Bacteria | 19612 |
| 715 | Ga0207676_10003163 | 3300026095 | Bacteria | 11746 |
| 716 | Ga0207674_10013076 | 3300026116 | Bacteria | 9241 |
| 717 | Ga0207674_10015850 | 3300026116 | Bacteria | 8264 |
| 718 | Ga0207674_10201721 | 3300026116 | Bacteria | 1938 |
| 719 | Ga0207674_10300114 | 3300026116 | Bacteria | 1555 |
| 720 | Ga0207675_100001672 | 3300026118 | Bacteria | 22194 |
| 721 | Ga0207675_100022173 | 3300026118 | Bacteria | 5913 |
| 722 | Ga0207675_100033946 | 3300026118 | Bacteria | 4755 |
| 723 | Ga0207675_100115421 | 3300026118 | Bacteria | 2537 |
| 724 | Ga0207683_10000539 | 3300026121 | Bacteria | 35044 |
| 725 | Ga0207683_10000857 | 3300026121 | Bacteria | 27885 |
| 726 | Ga0207683_10001164 | 3300026121 | Bacteria | 23801 |
| 727 | Ga0207683_10001504 | 3300026121 | Bacteria | 21012 |
| 728 | Ga0207683_10055797 | 3300026121 | Bacteria | 3465 |
| 729 | Ga0207683_10068459 | 3300026121 | Bacteria | 3134 |
| 730 | Ga0207698_10014728 | 3300026142 | Bacteria | 5209 |
| 731 | Ga0207698_10040729 | 3300026142 | Bacteria | 3455 |
| 732 | Ga0207698_10309789 | 3300026142 | Bacteria | 1474 |
| 733 | Ga0207428_10005680 | 3300027907 | Bacteria | 11590 |
| 734 | Ga0207428_10022479 | 3300027907 | Bacteria | 5321 |
| 735 | Ga0207428_10030910 | 3300027907 | Bacteria | 4424 |
| 736 | Ga0268266_10003190 | 3300028379 | Bacteria | 16606 |
| 737 | Ga0268266_10005174 | 3300028379 | Bacteria | 12290 |
| 738 | Ga0268266_10014863 | 3300028379 | Bacteria | 6684 |
| 739 | Ga0268266_10084004 | 3300028379 | Bacteria | 2780 |
| 740 | Ga0268266_10106405 | 3300028379 | Bacteria | 2479 |
| 741 | Ga0268266_10146164 | 3300028379 | Bacteria | 2126 |
| 742 | Ga0268265_10000051 | 3300028380 | Bacteria | 174968 |
| 743 | Ga0268265_10000156 | 3300028380 | Bacteria | 83798 |
| 744 | Ga0268265_10015530 | 3300028380 | Bacteria | 5213 |
| 745 | Ga0268265_10036439 | 3300028380 | Bacteria | 3603 |
| 746 | Ga0268264_10000097 | 3300028381 | Bacteria | 229722 |
| 747 | Ga0268264_10000108 | 3300028381 | Bacteria | 208791 |
| 748 | Ga0268264_10004939 | 3300028381 | Bacteria | 11297 |
| 749 | Ga0268264_10075422 | 3300028381 | Bacteria | 2868 |
| 750 | Ga0268264_10091589 | 3300028381 | Bacteria | 2623 |
| 751 | Ga0307515_10000038 | 3300028794 | Bacteria | 331376 |
| 752 | Ga0307515_10019047 | 3300028794 | Bacteria | 12384 |
| 753 | Ga0307515_10033888 | 3300028794 | Bacteria | 8389 |
| 754 | Ga0307515_10037382 | 3300028794 | Bacteria | 7810 |
| 755 | Ga0307515_10070295 | 3300028794 | Bacteria | 4767 |
| 756 | Ga0265338_10017927 | 3300028800 | Bacteria | 7604 |
| 757 | Ga0265338_10038060 | 3300028800 | Bacteria | 4565 |
| 758 | Ga0307511_10000590 | 3300030521 | Bacteria | 38846 |
| 759 | Ga0307511_10002042 | 3300030521 | Bacteria | 21169 |
| 760 | Ga0307512_10006290 | 3300030522 | Bacteria | 12063 |
| 761 | Ga0307512_10024887 | 3300030522 | Bacteria | 5316 |
| 762 | Ga0307512_10045352 | 3300030522 | Bacteria | 3602 |
| 763 | Ga0316180_1157808 | 3300030736 | Bacteria | 2010 |
| 764 | Ga0316183_1115972 | 3300030742 | Bacteria | 2236 |
| 765 | Ga0265325_10003221 | 3300031241 | Bacteria | 10740 |
| 766 | Ga0265325_10005156 | 3300031241 | Bacteria | 8125 |
| 767 | Ga0265340_10019334 | 3300031247 | Bacteria | 3507 |
| 768 | Ga0265339_10008767 | 3300031249 | Bacteria | 6409 |
| 769 | Ga0265339_10049576 | 3300031249 | Bacteria | 2299 |
| 770 | Ga0265327_10000021 | 3300031251 | Bacteria | 417788 |
| 771 | Ga0265327_10000071 | 3300031251 | Bacteria | 215502 |
| 772 | Ga0307513_10000002 | 3300031456 | Bacteria | 842612 |
| 773 | Ga0307513_10007971 | 3300031456 | Bacteria | 13620 |
| 774 | Ga0307513_10009861 | 3300031456 | Bacteria | 12056 |
| 775 | Ga0307513_10015380 | 3300031456 | Bacteria | 9277 |
| 776 | Ga0307513_10094607 | 3300031456 | Bacteria | 3032 |
| 777 | Ga0307509_10015278 | 3300031507 | Bacteria | 8971 |
| 778 | Ga0307509_10048348 | 3300031507 | Bacteria | 4569 |
| 779 | Ga0307509_10149351 | 3300031507 | Bacteria | 2256 |
| 780 | Ga0307408_100189282 | 3300031548 | Bacteria | 1657 |
| 781 | Ga0307508_10000506 | 3300031616 | Bacteria | 46624 |
| 782 | Ga0307508_10001775 | 3300031616 | Bacteria | 23968 |
| 783 | Ga0307508_10070716 | 3300031616 | Bacteria | 3063 |
| 784 | Ga0307514_10006847 | 3300031649 | Bacteria | 9870 |
| 785 | Ga0307514_10075008 | 3300031649 | Bacteria | 2523 |
| 786 | Ga0265314_10006663 | 3300031711 | Bacteria | 10148 |
| 787 | Ga0265342_10042943 | 3300031712 | Bacteria | 2729 |
| 788 | Ga0316576_10001518 | 3300031727 | Bacteria | 12548 |
| 789 | Ga0316576_10004023 | 3300031727 | Bacteria | 8750 |
| 790 | Ga0316576_10017633 | 3300031727 | Bacteria | 4856 |
| 791 | Ga0316576_10114347 | 3300031727 | Bacteria | 2024 |
| 792 | Ga0316578_10010142 | 3300031728 | Bacteria | 4876 |
| 793 | Ga0316578_10069683 | 3300031728 | Bacteria | 2081 |
| 794 | Ga0307516_10002871 | 3300031730 | Bacteria | 22675 |
| 795 | Ga0307516_10093745 | 3300031730 | Bacteria | 2827 |
| 796 | Ga0307516_10094321 | 3300031730 | Bacteria | 2817 |
| 797 | Ga0307405_10000804 | 3300031731 | Bacteria | 12338 |
| 798 | Ga0307405_10024124 | 3300031731 | Bacteria | 3469 |
| 799 | Ga0307405_10127210 | 3300031731 | Bacteria | 1754 |
| 800 | Ga0307413_10000862 | 3300031824 | Bacteria | 10698 |
| 801 | Ga0307413_10018416 | 3300031824 | Bacteria | 3664 |
| 802 | Ga0307413_10034067 | 3300031824 | Bacteria | 2907 |
| 803 | Ga0307413_10160841 | 3300031824 | Bacteria | 1577 |
| 804 | Ga0307518_10004772 | 3300031838 | Bacteria | 9704 |
| 805 | Ga0307410_10015291 | 3300031852 | Bacteria | 4547 |
| 806 | Ga0307410_10024255 | 3300031852 | Bacteria | 3787 |
| 807 | Ga0307410_10045221 | 3300031852 | Bacteria | 2930 |
| 808 | Ga0307410_10054371 | 3300031852 | Bacteria | 2714 |
| 809 | Ga0307410_10096536 | 3300031852 | Bacteria | 2110 |
| 810 | Ga0307410_10111554 | 3300031852 | Bacteria | 1979 |
| 811 | Ga0307406_10004254 | 3300031901 | Bacteria | 7791 |
| 812 | Ga0307406_10075140 | 3300031901 | Bacteria | 2228 |
| 813 | Ga0307406_10082326 | 3300031901 | Bacteria | 2143 |
| 814 | Ga0307406_10131537 | 3300031901 | Bacteria | 1757 |
| 815 | Ga0307406_10181694 | 3300031901 | Bacteria | 1532 |
| 816 | Ga0307407_10002514 | 3300031903 | Bacteria | 7194 |
| 817 | Ga0307407_10003337 | 3300031903 | Bacteria | 6563 |
| 818 | Ga0307409_100000406 | 3300031995 | Bacteria | 18400 |
| 819 | Ga0307409_100000409 | 3300031995 | Bacteria | 18204 |
| 820 | Ga0307409_100012688 | 3300031995 | Bacteria | 5382 |
| 821 | Ga0307409_100089208 | 3300031995 | Bacteria | 2520 |
| 822 | Ga0307409_100156524 | 3300031995 | Bacteria | 1986 |
| 823 | Ga0307409_100256598 | 3300031995 | Bacteria | 1602 |
| 824 | Ga0307416_100005536 | 3300032002 | Bacteria | 7769 |
| 825 | Ga0307416_100006145 | 3300032002 | Bacteria | 7484 |
| 826 | Ga0307416_100007073 | 3300032002 | Bacteria | 7088 |
| 827 | Ga0307414_10089640 | 3300032004 | Bacteria | 2280 |
| 828 | Ga0307414_10106356 | 3300032004 | Bacteria | 2124 |
| 829 | Ga0307415_100000021 | 3300032126 | Bacteria | 67460 |
| 830 | Ga0307415_100000422 | 3300032126 | Bacteria | 18141 |
| 831 | Ga0307415_100003770 | 3300032126 | Bacteria | 7768 |
| 832 | Ga0307415_100004822 | 3300032126 | Bacteria | 7070 |
| 833 | Ga0307415_100039753 | 3300032126 | Bacteria | 3112 |
| 834 | Ga0307415_100052948 | 3300032126 | Bacteria | 2763 |
| 835 | Ga0316585_10004353 | 3300032137 | Bacteria | 3938 |
| 836 | Ga0316580_10019075 | 3300032139 | Bacteria | 2111 |
| 837 | Ga0316593_10000889 | 3300032168 | Bacteria | 6090 |
| 838 | Ga0307507_10000732 | 3300033179 | Bacteria | 72083 |
| 839 | Ga0307507_10016917 | 3300033179 | Bacteria | 8430 |
| 840 | Ga0307507_10020822 | 3300033179 | Bacteria | 7326 |
| 841 | Ga0307510_10055624 | 3300033180 | Bacteria | 4131 |
| 842 | Ga0307510_10089223 | 3300033180 | Bacteria | 2937 |
| 843 | Ga0307510_10116839 | 3300033180 | Bacteria | 2387 |
| 844 | Ga0316214_1001544 | 3300033545 | Bacteria | 2712 |
| 845 | Ga0373959_0014790 | 3300034820 | Bacteria | 1425 |
| 846 | Ga0373926_0009791 | 3300035083 | Bacteria | 3202 |
| 847 | Ga0373934_0003190 | 3300035086 | Bacteria | 5994 |
| 848 | Ga0373944_0007599 | 3300035089 | Bacteria | 2909 |
| 849 | Ga0373949_0005321 | 3300035090 | Bacteria | 2875 |
| 850 | Ga0373951_0000115 | 3300035091 | Bacteria | 30473 |
| 851 | Ga0373923_0001801 | 3300035111 | Bacteria | 6330 |
| 852 | Ga0373936_0000466 | 3300035113 | Bacteria | 13640 |
| 853 | Ga0373936_0051674 | 3300035113 | Bacteria | 1663 |
| 854 | Ga0373945_0001125 | 3300035116 | Bacteria | 8082 |
| 855 | Ga0373945_0005546 | 3300035116 | Bacteria | 4043 |
| 856 | Ga0373953_0001306 | 3300035117 | Bacteria | 7137 |
| 857 | Ga0373953_0002560 | 3300035117 | Bacteria | 5499 |
| 858 | Ga0373953_0025343 | 3300035117 | Bacteria | 2265 |
| 859 | Ga0373954_0025370 | 3300035118 | Bacteria | 2708 |
| 860 | Ga0373956_0003065 | 3300035119 | Bacteria | 6767 |
| 861 | Ga0373956_0033163 | 3300035119 | Bacteria | 2269 |
| 862 | Ga0373960_0004283 | 3300035121 | Bacteria | 3259 |
| 863 | Ga0373943_0001264 | 3300035170 | Bacteria | 11318 |
| 864 | Ga0373946_0001321 | 3300035171 | Bacteria | 8568 |
| 865 | Ga0373955_0003782 | 3300035172 | Bacteria | 6663 |
| 866 | Ga0373955_0040542 | 3300035172 | Bacteria | 2491 |
| 867 | Ga0373942_0000196 | 3300035207 | Bacteria | 15484 |
| 868 | Ga0373942_0012372 | 3300035207 | Bacteria | 2037 |
| 869 | Ga0373962_0011117 | 3300035242 | Bacteria | 2252 |
| 870 | Ga0316574_0024953 | 3300035398 | Bacteria | 3584 |
| 871 | Ga0316574_0058180 | 3300035398 | Bacteria | 2421 |
| 872 | Ga0316574_0061945 | 3300035398 | Bacteria | 2350 |
| 873 | Ga0373924_0005485 | 3300035410 | Bacteria | 4495 |
| 874 | Ga0373924_0013950 | 3300035410 | Bacteria | 3027 |
| 875 | Ga0373931_0008885 | 3300035691 | Bacteria | 4785 |
| 876 | Ga0373931_0048658 | 3300035691 | Bacteria | 2248 |
| 877 | Ga0373935_0004907 | 3300035692 | Bacteria | 7858 |
| 878 | Ga0373935_0014322 | 3300035692 | Bacteria | 4786 |
| 879 | Ga0373935_0015818 | 3300035692 | Bacteria | 4565 |
| 880 | Ga0373935_0029064 | 3300035692 | Bacteria | 3420 |
| 881 | Ga0373935_0151391 | 3300035692 | Bacteria | 1574 |
| 882 | Ga0373927_0002894 | 3300035695 | Bacteria | 12485 |
| 883 | Ga0373927_0093639 | 3300035695 | Bacteria | 1952 |
| 884 | Ga0373933_0013288 | 3300035724 | Bacteria | 4561 |
| 885 | Ga0373947_0000039 | 3300035725 | Bacteria | 63474 |
| 886 | Ga0373947_0003402 | 3300035725 | Bacteria | 9414 |
| 887 | Ga0373947_0009537 | 3300035725 | Bacteria | 5571 |
| 888 | Ga0373937_0053491 | 3300036401 | Bacteria | 3703 |
| 889 | Ga0373937_0070973 | 3300036401 | Bacteria | 3212 |
| 890 | Ga0373937_0086281 | 3300036401 | Bacteria | 2905 |
| 891 | Ga0265778_000400 | 3300036457 | Bacteria | 3373 |
| 892 | Ga0316582_0097304 | 3300036647 | Bacteria | 1945 |
| 893 | Ga0316584_0000281 | 3300036712 | Bacteria | 26040 |
| 894 | Ga0316584_0005744 | 3300036712 | Bacteria | 8359 |
| 895 | Ga0316584_0071624 | 3300036712 | Bacteria | 2597 |
| 896 | Ga0316584_0102955 | 3300036712 | Bacteria | 2138 |
| 897 | Ga0373925_0000006 | 3300037068 | Bacteria | 278942 |
| 898 | Ga0373925_0050996 | 3300037068 | Bacteria | 3087 |
| 899 | Ga0395899_0053281 | 3300037312 | Bacteria | 2996 |
| 900 | Ga0395900_0003901 | 3300037418 | Bacteria | 15934 |
| 901 | Ga0395900_0008791 | 3300037418 | Bacteria | 10378 |
| 902 | Ga0395900_0042604 | 3300037418 | Bacteria | 4678 |
| 903 | Ga0395900_0182565 | 3300037418 | Bacteria | 2131 |
| 904 | Ga0395898_0011400 | 3300037466 | Bacteria | 9232 |
| 905 | Ga0395898_0035335 | 3300037466 | Bacteria | 4971 |
| 906 | Ga0395898_0119080 | 3300037466 | Bacteria | 2529 |
| 907 | Ga0395898_0136410 | 3300037466 | Bacteria | 2349 |
| 908 | Ga0395905_0023889 | 3300037471 | Bacteria | 5771 |
| 909 | Ga0395905_0087531 | 3300037471 | Bacteria | 2920 |
| 910 | Ga0395905_0254809 | 3300037471 | Bacteria | 1639 |
| 911 | Ga0436364_0238775 | 3300037853 | Bacteria | 6929 |
| 912 | Ga0436364_0516238 | 3300037853 | Bacteria | 122645 |
| 913 | Ga0436364_0696641 | 3300037853 | Bacteria | 19004 |
| 914 | Ga0436364_0735260 | 3300037853 | Bacteria | 16919 |
| 915 | Ga0436364_0823558 | 3300037853 | Bacteria | 25963 |
| 916 | Ga0436364_1039945 | 3300037853 | Bacteria | 3520 |
| 917 | Ga0436364_1051432 | 3300037853 | Bacteria | 7404 |
| 918 | Ga0436364_1086504 | 3300037853 | Bacteria | 29464 |
| 919 | Ga0436364_1291536 | 3300037853 | Bacteria | 16625 |
| 920 | Ga0395901_0033677 | 3300038443 | Bacteria | 5289 |
| 921 | Ga0436365_0447055 | 3300039437 | Bacteria | 3724 |
| 922 | Ga0436365_0567091 | 3300039437 | Bacteria | 46375 |
| 923 | Ga0436365_0574117 | 3300039437 | Bacteria | 5877 |
| 924 | Ga0436365_0939033 | 3300039437 | Bacteria | 60216 |
| 925 | Ga0436365_1050647 | 3300039437 | Bacteria | 21064 |
| 926 | Ga0436365_1284454 | 3300039437 | Bacteria | 8745 |
| 927 | Ga0436365_1908396 | 3300039437 | Bacteria | 15438 |
| 928 | Ga0436363_0129189 | 3300039450 | Bacteria | 2074 |
| 929 | Ga0436363_0464660 | 3300039450 | Bacteria | 2418 |
| 930 | Ga0436363_1431793 | 3300039450 | Bacteria | 2059 |
| 931 | Ga0436362_0884990 | 3300039453 | Bacteria | 27774 |
| 932 | Ga0439436_0000647 | 3300041404 | Bacteria | 9264 |
| 933 | Ga0439436_0002022 | 3300041404 | Bacteria | 6033 |
| 934 | Ga0439439_0010546 | 3300041406 | Bacteria | 2211 |
| 935 | Ga0439461_0001991 | 3300041410 | Bacteria | 3230 |
| 936 | Ga0439466_0004599 | 3300041411 | Bacteria | 5300 |
| 937 | Ga0439465_0008298 | 3300041413 | Bacteria | 3278 |
| 938 | Ga0439465_0009044 | 3300041413 | Bacteria | 3139 |
| 939 | Ga0451789_0957144 | 3300041443 | Bacteria | 1201 |
| 940 | Ga0451793_0254203 | 3300041452 | Bacteria | 6453 |
| 941 | Ga0451795_0111892 | 3300041456 | Bacteria | 2768 |
| 942 | Ga0451853_2614358 | 3300041512 | Bacteria | 3913 |
| 943 | Ga0439431_0005807 | 3300041997 | Bacteria | 2725 |
| 944 | Ga0439433_0001382 | 3300041999 | Bacteria | 4990 |
| 945 | Ga0439433_0009801 | 3300041999 | Bacteria | 2091 |
| 946 | Ga0439442_002424 | 3300042002 | Bacteria | 3662 |
| 947 | Ga0439445_0003352 | 3300042004 | Bacteria | 3597 |
| 948 | Ga0439432_020825 | 3300042006 | Bacteria | 2177 |
| 949 | Ga0439457_000479 | 3300042014 | Bacteria | 11535 |
| 950 | Ga0439457_004100 | 3300042014 | Bacteria | 3854 |
| 951 | Ga0450894_000878 | 3300042131 | Bacteria | 4808 |
| 952 | Ga0450899_000129 | 3300042135 | Bacteria | 7101 |
| 953 | Ga0439459_0000473 | 3300042438 | Bacteria | 5243 |
| 954 | Ga0451577_0066941 | 3300042876 | Bacteria | 3203 |
| 955 | Ga0466969_0000632 | 3300044656 | Bacteria | 19011 |
| 956 | Ga0466969_0002576 | 3300044656 | Bacteria | 9685 |
| 957 | Ga0466969_0004118 | 3300044656 | Bacteria | 7717 |
| 958 | Ga0466969_0049407 | 3300044656 | Bacteria | 2076 |
| 959 | Ga0466972_0002173 | 3300044658 | Bacteria | 9628 |
| 960 | Ga0466972_0011396 | 3300044658 | Bacteria | 4462 |
| 961 | Ga0466972_0014915 | 3300044658 | Bacteria | 3888 |
| 962 | Ga0466972_0028907 | 3300044658 | Bacteria | 2731 |
| 963 | Ga0466972_0039438 | 3300044658 | Bacteria | 2304 |
| 964 | Ga0466972_0057374 | 3300044658 | Bacteria | 1870 |
| 965 | Ga0466965_0000194 | 3300044683 | Bacteria | 18907 |
| 966 | Ga0466965_0007146 | 3300044683 | Bacteria | 5114 |
| 967 | Ga0466965_0024585 | 3300044683 | Bacteria | 2915 |
| 968 | Ga0466965_0024726 | 3300044683 | Bacteria | 2906 |
| 969 | Ga0466965_0026949 | 3300044683 | Bacteria | 2787 |
| 970 | Ga0466966_0001302 | 3300044684 | Bacteria | 15981 |
| 971 | Ga0466966_0006474 | 3300044684 | Bacteria | 7751 |
| 972 | Ga0466966_0061797 | 3300044684 | Bacteria | 2362 |
| 973 | Ga0466966_0080943 | 3300044684 | Bacteria | 2022 |
| 974 | Ga0466961_0001660 | 3300044693 | Bacteria | 13839 |
| 975 | Ga0466961_0002350 | 3300044693 | Bacteria | 11760 |
| 976 | Ga0466961_0002892 | 3300044693 | Bacteria | 10653 |
| 977 | Ga0466961_0005797 | 3300044693 | Bacteria | 7823 |
| 978 | Ga0466961_0021171 | 3300044693 | Bacteria | 4186 |
| 979 | Ga0466961_0024210 | 3300044693 | Bacteria | 3905 |
| 980 | Ga0466961_0029146 | 3300044693 | Bacteria | 3548 |
| 981 | Ga0466961_0049882 | 3300044693 | Bacteria | 2674 |
| 982 | Ga0466961_0062349 | 3300044693 | Bacteria | 2369 |
| 983 | Ga0466961_0073870 | 3300044693 | Bacteria | 2162 |
| 984 | Ga0466963_0001094 | 3300044694 | Bacteria | 14129 |
| 985 | Ga0466963_0003573 | 3300044694 | Bacteria | 8931 |
| 986 | Ga0466963_0010639 | 3300044694 | Bacteria | 5579 |
| 987 | Ga0466963_0016897 | 3300044694 | Bacteria | 4545 |
| 988 | Ga0466963_0019383 | 3300044694 | Bacteria | 4265 |
| 989 | Ga0466963_0032161 | 3300044694 | Bacteria | 3396 |
| 990 | Ga0466963_0034188 | 3300044694 | Bacteria | 3307 |
| 991 | Ga0466963_0040311 | 3300044694 | Bacteria | 3061 |
| 992 | Ga0466963_0074602 | 3300044694 | Bacteria | 2288 |
| 993 | Ga0466963_0083359 | 3300044694 | Bacteria | 2168 |
| 994 | Ga0466964_0019639 | 3300044706 | Bacteria | 2599 |
| 995 | Ga0466964_0024386 | 3300044706 | Bacteria | 2358 |
| 996 | Ga0466964_0025198 | 3300044706 | Bacteria | 2321 |
| 997 | Ga0466964_0071300 | 3300044706 | Bacteria | 1470 |
| 998 | Ga0466971_0000892 | 3300044719 | Bacteria | 12211 |
| 999 | Ga0466971_0003748 | 3300044719 | Bacteria | 6508 |
| 1000 | Ga0466971_0008516 | 3300044719 | Bacteria | 4474 |
| 1001 | Ga0466971_0028339 | 3300044719 | Bacteria | 2506 |
| 1002 | Ga0466971_0045012 | 3300044719 | Bacteria | 1982 |
| 1003 | Ga0466968_0003734 | 3300044735 | Bacteria | 5645 |
| 1004 | Ga0466968_0003834 | 3300044735 | Bacteria | 5579 |
| 1005 | Ga0466968_0016662 | 3300044735 | Bacteria | 2929 |
| 1006 | Ga0466968_0061106 | 3300044735 | Bacteria | 1625 |
| 1007 | Ga0466970_0014696 | 3300044765 | Bacteria | 4021 |
| 1008 | Ga0466970_0022106 | 3300044765 | Bacteria | 3320 |
| 1009 | Ga0466970_0032443 | 3300044765 | Bacteria | 2759 |
| 1010 | Ga0466970_0051351 | 3300044765 | Bacteria | 2200 |
| 1011 | Ga0466970_0054821 | 3300044765 | Bacteria | 2129 |
| 1012 | Ga0466970_0067744 | 3300044765 | Bacteria | 1917 |
| 1013 | Ga0466957_0012041 | 3300044842 | Bacteria | 5000 |
| 1014 | Ga0466957_0013266 | 3300044842 | Bacteria | 4779 |
| 1015 | Ga0466960_0000703 | 3300044901 | Bacteria | 11662 |
| 1016 | Ga0466960_0001139 | 3300044901 | Bacteria | 9536 |
| 1017 | Ga0466960_0001775 | 3300044901 | Bacteria | 7915 |
| 1018 | Ga0466960_0004561 | 3300044901 | Bacteria | 5432 |
| 1019 | Ga0466960_0007316 | 3300044901 | Bacteria | 4477 |
| 1020 | Ga0466960_0036259 | 3300044901 | Bacteria | 2309 |
| 1021 | Ga0466959_0000877 | 3300045049 | Bacteria | 17736 |
| 1022 | Ga0466959_0006347 | 3300045049 | Bacteria | 8181 |
| 1023 | Ga0466959_0018130 | 3300045049 | Bacteria | 5165 |
| 1024 | Ga0466959_0038655 | 3300045049 | Bacteria | 3526 |
| 1025 | Ga0466959_0059597 | 3300045049 | Bacteria | 2780 |
| 1026 | Ga0466959_0084429 | 3300045049 | Bacteria | 2286 |
| 1027 | Ga0466959_0089585 | 3300045049 | Bacteria | 2210 |
| 1028 | Ga0466959_0093383 | 3300045049 | Bacteria | 2159 |
| 1029 | Ga0466959_0099313 | 3300045049 | Bacteria | 2084 |
| 1030 | Ga0451576_0128588 | 3300045051 | Bacteria | 2640 |
| 1031 | Ga0466958_0003068 | 3300045836 | Bacteria | 8566 |
| 1032 | Ga0466958_0009782 | 3300045836 | Bacteria | 5350 |
| 1033 | Ga0466958_0011259 | 3300045836 | Bacteria | 5035 |
| 1034 | Ga0466958_0011623 | 3300045836 | Bacteria | 4962 |
| 1035 | Ga0466958_0019285 | 3300045836 | Bacteria | 3969 |
| 1036 | Ga0466958_0028208 | 3300045836 | Bacteria | 3327 |
| 1037 | Ga0466958_0034449 | 3300045836 | Bacteria | 3020 |
| 1038 | Ga0466958_0041184 | 3300045836 | Bacteria | 2778 |
| 1039 | Ga0466958_0042780 | 3300045836 | Bacteria | 2728 |
| 1040 | Ga0466958_0070299 | 3300045836 | Bacteria | 2142 |
| 1041 | Ga0466958_0087654 | 3300045836 | Bacteria | 1922 |
| 1042 | Ga0466967_0000595 | 3300045976 | Bacteria | 17954 |
| 1043 | Ga0466967_0001175 | 3300045976 | Bacteria | 14690 |
| 1044 | Ga0466967_0001407 | 3300045976 | Bacteria | 13915 |
| 1045 | Ga0466967_0002012 | 3300045976 | Bacteria | 12383 |
| 1046 | Ga0466967_0002261 | 3300045976 | Bacteria | 11871 |
| 1047 | Ga0466967_0005637 | 3300045976 | Bacteria | 8713 |
| 1048 | Ga0466967_0009226 | 3300045976 | Bacteria | 7304 |
| 1049 | Ga0466967_0009250 | 3300045976 | Bacteria | 7297 |
| 1050 | Ga0466967_0009629 | 3300045976 | Bacteria | 7182 |
| 1051 | Ga0466967_0009645 | 3300045976 | Bacteria | 7179 |
| 1052 | Ga0466967_0010064 | 3300045976 | Bacteria | 7067 |
| 1053 | Ga0466967_0017233 | 3300045976 | Bacteria | 5728 |
| 1054 | Ga0466967_0055472 | 3300045976 | Bacteria | 3490 |
| 1055 | Ga0466967_0059846 | 3300045976 | Bacteria | 3373 |
| 1056 | Ga0466967_0102881 | 3300045976 | Bacteria | 2613 |
| 1057 | Ga0466967_0147542 | 3300045976 | Bacteria | 2195 |
| 1058 | Ga0466967_0181544 | 3300045976 | Bacteria | 1985 |
| 1059 | Ga0466967_0266619 | 3300045976 | Bacteria | 1640 |
| 1060 | Ga0495627_008543 | 3300046453 | Bacteria | 3829 |
| 1061 | Ga0495592_0094071 | 3300046454 | Bacteria | 2145 |
| 1062 | Ga0495603_0009235 | 3300046455 | Bacteria | 5959 |
| 1063 | Ga0495603_0014289 | 3300046455 | Bacteria | 4803 |
| 1064 | Ga0495603_0027419 | 3300046455 | Bacteria | 3438 |
| 1065 | Ga0495629_0002245 | 3300046459 | Bacteria | 14890 |
| 1066 | Ga0495629_0032233 | 3300046459 | Bacteria | 3710 |
| 1067 | Ga0495629_0075214 | 3300046459 | Bacteria | 2359 |
| 1068 | Ga0495629_0122824 | 3300046459 | Bacteria | 1809 |
| 1069 | Ga0495641_0007399 | 3300046461 | Bacteria | 6864 |
| 1070 | Ga0495641_0009246 | 3300046461 | Bacteria | 5873 |
| 1071 | Ga0495651_0017471 | 3300046462 | Bacteria | 5555 |
| 1072 | Ga0495653_0004573 | 3300046463 | Bacteria | 11182 |
| 1073 | Ga0495653_0022314 | 3300046463 | Bacteria | 5123 |
| 1074 | Ga0495653_0066800 | 3300046463 | Bacteria | 2703 |
| 1075 | Ga0495653_0125370 | 3300046463 | Bacteria | 1824 |
| 1076 | Ga0495653_0158387 | 3300046463 | Bacteria | 1574 |
| 1077 | Ga0495650_0016688 | 3300046471 | Bacteria | 3707 |
| 1078 | Ga0495639_0003954 | 3300046475 | Bacteria | 6365 |
| 1079 | Ga0495639_0028677 | 3300046475 | Bacteria | 2467 |
| 1080 | Ga0495639_0062309 | 3300046475 | Bacteria | 1711 |
| 1081 | Ga0495662_0002349 | 3300046476 | Bacteria | 9532 |
| 1082 | Ga0495664_0008545 | 3300046477 | Bacteria | 5708 |
| 1083 | Ga0495664_0065266 | 3300046477 | Bacteria | 2169 |
| 1084 | Ga0495585_0017360 | 3300046492 | Bacteria | 4157 |
| 1085 | Ga0495594_0001342 | 3300046499 | Bacteria | 12775 |
| 1086 | Ga0495594_0045170 | 3300046499 | Bacteria | 2418 |
| 1087 | Ga0495607_0027985 | 3300046501 | Bacteria | 3480 |
| 1088 | Ga0495607_0070996 | 3300046501 | Bacteria | 1943 |
| 1089 | Ga0495583_0014310 | 3300046506 | Bacteria | 4383 |
| 1090 | Ga0495583_0069052 | 3300046506 | Bacteria | 1557 |
| 1091 | Ga0495606_0001359 | 3300046507 | Bacteria | 33075 |
| 1092 | Ga0495606_0021271 | 3300046507 | Bacteria | 4754 |
| 1093 | Ga0495606_0026257 | 3300046507 | Bacteria | 4153 |
| 1094 | Ga0495608_0012884 | 3300046511 | Bacteria | 5802 |
| 1095 | Ga0495608_0058655 | 3300046511 | Bacteria | 2537 |
| 1096 | Ga0495616_0004473 | 3300046513 | Bacteria | 8801 |
| 1097 | Ga0495620_0070009 | 3300046515 | Bacteria | 1437 |
| 1098 | Ga0495628_0055179 | 3300046516 | Bacteria | 3130 |
| 1099 | Ga0495628_0095450 | 3300046516 | Bacteria | 2297 |
| 1100 | Ga0495628_0225663 | 3300046516 | Bacteria | 1405 |
| 1101 | Ga0495630_0008465 | 3300046517 | Bacteria | 7383 |
| 1102 | Ga0495630_0018073 | 3300046517 | Bacteria | 5174 |
| 1103 | Ga0495631_0003096 | 3300046518 | Bacteria | 9166 |
| 1104 | Ga0495637_0015812 | 3300046520 | Bacteria | 3534 |
| 1105 | Ga0495648_0021577 | 3300046524 | Bacteria | 4455 |
| 1106 | Ga0495666_0003647 | 3300046526 | Bacteria | 7781 |
| 1107 | Ga0495652_0018073 | 3300046529 | Bacteria | 6290 |
| 1108 | Ga0495652_0086307 | 3300046529 | Bacteria | 2577 |
| 1109 | Ga0495654_0032188 | 3300046530 | Bacteria | 2659 |
| 1110 | Ga0495665_0010808 | 3300046531 | Bacteria | 4941 |
| 1111 | Ga0495665_0015610 | 3300046531 | Bacteria | 4087 |
| 1112 | Ga0495640_0045514 | 3300046533 | Bacteria | 3044 |
| 1113 | Ga0495640_0046303 | 3300046533 | Bacteria | 3014 |
| 1114 | Ga0495586_0008930 | 3300046535 | Bacteria | 5334 |
| 1115 | Ga0495587_0000907 | 3300046536 | Bacteria | 19603 |
| 1116 | Ga0495609_0007988 | 3300046538 | Bacteria | 5225 |
| 1117 | Ga0495597_0028324 | 3300046542 | Bacteria | 2564 |
| 1118 | Ga0495622_0006694 | 3300046557 | Bacteria | 5342 |
| 1119 | Ga0495667_0018746 | 3300046559 | Bacteria | 4670 |
| 1120 | Ga0495667_0038390 | 3300046559 | Bacteria | 3188 |
| 1121 | Ga0495668_0000519 | 3300046616 | Bacteria | 47924 |
| 1122 | Ga0495668_0064041 | 3300046616 | Bacteria | 2024 |
| 1123 | Ga0495634_0008927 | 3300046642 | Bacteria | 7422 |
| 1124 | Ga0495634_0057874 | 3300046642 | Bacteria | 2586 |
| 1125 | Ga0495634_0091681 | 3300046642 | Bacteria | 1972 |
| 1126 | Ga0495611_0030633 | 3300046648 | Bacteria | 2366 |
| 1127 | Ga0495625_0001636 | 3300046660 | Bacteria | 26330 |
| 1128 | Ga0495625_0044373 | 3300046660 | Bacteria | 3218 |
| 1129 | Ga0495635_0036284 | 3300046663 | Bacteria | 3417 |
| 1130 | Ga0495635_0055499 | 3300046663 | Bacteria | 2729 |
| 1131 | Ga0495635_0087728 | 3300046663 | Bacteria | 2129 |
| 1132 | Ga0495661_0007473 | 3300046665 | Bacteria | 7619 |
| 1133 | Ga0495588_0020166 | 3300046674 | Bacteria | 3273 |
| 1134 | Ga0495657_0053190 | 3300046675 | Bacteria | 2710 |
| 1135 | Ga0495657_0066629 | 3300046675 | Bacteria | 2365 |
| 1136 | Ga0495657_0080018 | 3300046675 | Bacteria | 2115 |
| 1137 | Ga0495599_0027522 | 3300046678 | Bacteria | 3563 |
| 1138 | Ga0495623_0012970 | 3300046679 | Bacteria | 5394 |
| 1139 | Ga0495623_0026038 | 3300046679 | Bacteria | 3767 |
| 1140 | Ga0495646_0002906 | 3300046680 | Bacteria | 10616 |
| 1141 | Ga0495646_0082841 | 3300046680 | Bacteria | 1866 |
| 1142 | Ga0495646_0177897 | 3300046680 | Bacteria | 1169 |
| 1143 | Ga0495658_0029170 | 3300046683 | Bacteria | 2983 |
| 1144 | Ga0495658_0074911 | 3300046683 | Bacteria | 1974 |
| 1145 | Ga0495669_0019460 | 3300046684 | Bacteria | 2930 |
| 1146 | Ga0495613_0003081 | 3300046689 | Bacteria | 12453 |
| 1147 | Ga0495613_0007268 | 3300046689 | Bacteria | 8244 |
| 1148 | Ga0495624_0000535 | 3300046690 | Bacteria | 29778 |
| 1149 | Ga0495624_0011184 | 3300046690 | Bacteria | 6175 |
| 1150 | Ga0495649_0036673 | 3300046694 | Bacteria | 2693 |
| 1151 | Ga0495589_0068244 | 3300046794 | Bacteria | 1739 |
| 1152 | Ga0495589_0068308 | 3300046794 | Bacteria | 1739 |
| 1153 | Ga0495600_0005439 | 3300046809 | Bacteria | 7677 |
| 1154 | Ga0495600_0021071 | 3300046809 | Bacteria | 4171 |
| 1155 | Ga0495600_0119154 | 3300046809 | Bacteria | 1717 |
| 1156 | Ga0495660_0055775 | 3300046810 | Bacteria | 2137 |
| 1157 | Ga0495581_0003107 | 3300047315 | Bacteria | 9509 |
| 1158 | Ga0495581_0068143 | 3300047315 | Bacteria | 2058 |
| 1159 | Ga0495604_0115329 | 3300047317 | Bacteria | 1952 |
| 1160 | Ga0495636_0021632 | 3300047318 | Bacteria | 2597 |
| 1161 | Ga0495674_0001362 | 3300047319 | Bacteria | 23834 |
| 1162 | Ga0495674_0055153 | 3300047319 | Bacteria | 3487 |
| 1163 | Ga0495674_0157529 | 3300047319 | Bacteria | 1901 |
| 1164 | Ga0495672_0024614 | 3300047320 | Bacteria | 3874 |
| 1165 | Ga0495676_0028819 | 3300047321 | Bacteria | 4736 |
| 1166 | Ga0495676_0058754 | 3300047321 | Bacteria | 3024 |
| 1167 | Ga0495680_0022892 | 3300047322 | Bacteria | 5202 |
| 1168 | Ga0495680_0034707 | 3300047322 | Bacteria | 4069 |
| 1169 | Ga0495680_0037991 | 3300047322 | Bacteria | 3852 |
| 1170 | Ga0495680_0042878 | 3300047322 | Bacteria | 3586 |
| 1171 | Ga0495687_001147 | 3300047443 | Bacteria | 25643 |
| 1172 | Ga0495687_003306 | 3300047443 | Bacteria | 11824 |
| 1173 | Ga0495687_024126 | 3300047443 | Bacteria | 2895 |
| 1174 | Ga0495675_0034556 | 3300047444 | Bacteria | 3227 |
| 1175 | Ga0495685_008578 | 3300047447 | Bacteria | 3396 |
| 1176 | Ga0495684_0000973 | 3300047471 | Bacteria | 23335 |
| 1177 | Ga0495684_0023120 | 3300047471 | Bacteria | 4780 |
| 1178 | Ga0495684_0042296 | 3300047471 | Bacteria | 3490 |
| 1179 | Ga0495684_0047712 | 3300047471 | Bacteria | 3275 |
| 1180 | Ga0495684_0106123 | 3300047471 | Bacteria | 2122 |
| 1181 | Ga0495686_0000637 | 3300047472 | Bacteria | 48296 |
| 1182 | Ga0495686_0042822 | 3300047472 | Bacteria | 2875 |
| 1183 | Ga0495593_0013292 | 3300047673 | Bacteria | 4698 |
| 1184 | Ga0495614_0017285 | 3300048089 | Bacteria | 3134 |
| 1185 | Ga0495614_0082573 | 3300048089 | Bacteria | 1393 |
| 1186 | Ga0495615_0005916 | 3300048090 | Bacteria | 2233 |
| 1187 | Ga0495626_0001401 | 3300048091 | Bacteria | 19307 |
| 1188 | Ga0495626_0007219 | 3300048091 | Bacteria | 6208 |
| 1189 | Ga0496100_0000067 | 3300048903 | Bacteria | 58703 |
| 1190 | Ga0496100_0000461 | 3300048903 | Bacteria | 19507 |
| 1191 | Ga0496100_0002943 | 3300048903 | Bacteria | 8762 |
| 1192 | Ga0496100_0015097 | 3300048903 | Bacteria | 4504 |
| 1193 | Ga0496100_0065715 | 3300048903 | Bacteria | 2404 |
| 1194 | Ga0496100_0147500 | 3300048903 | Bacteria | 1674 |
| 1195 | Ga0496100_0173793 | 3300048903 | Bacteria | 1553 |
| 1196 | Ga0496101_0000099 | 3300048904 | Bacteria | 90235 |
| 1197 | Ga0496101_0001394 | 3300048904 | Bacteria | 14462 |
| 1198 | Ga0496101_0045811 | 3300048904 | Bacteria | 3134 |
| 1199 | Ga0496101_0117477 | 3300048904 | Bacteria | 2008 |
| 1200 | Ga0496102_0000013 | 3300048905 | Bacteria | 311668 |
| 1201 | Ga0496102_0000048 | 3300048905 | Bacteria | 179713 |
| 1202 | Ga0496102_0000175 | 3300048905 | Bacteria | 87026 |
| 1203 | Ga0496102_0000390 | 3300048905 | Bacteria | 51759 |
| 1204 | Ga0496102_0003032 | 3300048905 | Bacteria | 14221 |
| 1205 | Ga0496102_0011278 | 3300048905 | Bacteria | 7701 |
| 1206 | Ga0496102_0027616 | 3300048905 | Bacteria | 5068 |
| 1207 | Ga0496102_0046711 | 3300048905 | Bacteria | 3932 |
| 1208 | Ga0496102_0064426 | 3300048905 | Bacteria | 3357 |
| 1209 | Ga0496102_0073478 | 3300048905 | Bacteria | 3142 |
| 1210 | Ga0496102_0081793 | 3300048905 | Bacteria | 2978 |
| 1211 | Ga0496102_0089145 | 3300048905 | Bacteria | 2853 |
| 1212 | Ga0496102_0127161 | 3300048905 | Bacteria | 2383 |
| 1213 | Ga0496103_0000018 | 3300048906 | Bacteria | 239585 |
| 1214 | Ga0496103_0000039 | 3300048906 | Bacteria | 174284 |
| 1215 | Ga0496103_0000116 | 3300048906 | Bacteria | 86969 |
| 1216 | Ga0496103_0011446 | 3300048906 | Bacteria | 5258 |
| 1217 | Ga0496104_0007024 | 3300048907 | Bacteria | 9927 |
| 1218 | Ga0496104_0040322 | 3300048907 | Bacteria | 4376 |
| 1219 | Ga0496104_0051650 | 3300048907 | Bacteria | 3880 |
| 1220 | Ga0496104_0133115 | 3300048907 | Bacteria | 2388 |
| 1221 | Ga0496105_0012606 | 3300048908 | Bacteria | 6695 |
| 1222 | Ga0496105_0020163 | 3300048908 | Bacteria | 5384 |
| 1223 | Ga0496105_0020716 | 3300048908 | Bacteria | 5315 |
| 1224 | Ga0496105_0024253 | 3300048908 | Bacteria | 4929 |
| 1225 | Ga0496105_0092674 | 3300048908 | Bacteria | 2494 |
| 1226 | Ga0496105_0112736 | 3300048908 | Bacteria | 2244 |
| 1227 | Ga0496105_0134693 | 3300048908 | Bacteria | 2035 |
| 1228 | Ga0496106_0000424 | 3300048909 | Bacteria | 30065 |
| 1229 | Ga0496106_0001155 | 3300048909 | Bacteria | 19580 |
| 1230 | Ga0496106_0002018 | 3300048909 | Bacteria | 15276 |
| 1231 | Ga0496106_0008649 | 3300048909 | Bacteria | 7534 |
| 1232 | Ga0496106_0019812 | 3300048909 | Bacteria | 4987 |
| 1233 | Ga0496106_0020907 | 3300048909 | Bacteria | 4857 |
| 1234 | Ga0496106_0101504 | 3300048909 | Bacteria | 2232 |
| 1235 | Ga0496107_0000079 | 3300048910 | Bacteria | 46405 |
| 1236 | Ga0496107_0000254 | 3300048910 | Bacteria | 28236 |
| 1237 | Ga0496107_0026359 | 3300048910 | Bacteria | 4119 |
| 1238 | Ga0496107_0027103 | 3300048910 | Bacteria | 4068 |
| 1239 | Ga0496108_0000035 | 3300048911 | Bacteria | 154937 |
| 1240 | Ga0496108_0000959 | 3300048911 | Bacteria | 22428 |
| 1241 | Ga0496108_0003817 | 3300048911 | Bacteria | 12072 |
| 1242 | Ga0496108_0005688 | 3300048911 | Bacteria | 10091 |
| 1243 | Ga0496108_0057509 | 3300048911 | Bacteria | 3268 |
| 1244 | Ga0496108_0065466 | 3300048911 | Bacteria | 3064 |
| 1245 | Ga0496108_0067004 | 3300048911 | Bacteria | 3028 |
| 1246 | Ga0496108_0177067 | 3300048911 | Bacteria | 1846 |
| 1247 | Ga0496109_0000159 | 3300048912 | Bacteria | 66124 |
| 1248 | Ga0496109_0004668 | 3300048912 | Bacteria | 11441 |
| 1249 | Ga0496109_0008285 | 3300048912 | Bacteria | 8824 |
| 1250 | Ga0496109_0012040 | 3300048912 | Bacteria | 7452 |
| 1251 | Ga0496109_0015418 | 3300048912 | Bacteria | 6660 |
| 1252 | Ga0496109_0054048 | 3300048912 | Bacteria | 3664 |
| 1253 | Ga0496109_0069929 | 3300048912 | Bacteria | 3220 |
| 1254 | Ga0496109_0075199 | 3300048912 | Bacteria | 3105 |
| 1255 | Ga0496109_0076274 | 3300048912 | Bacteria | 3083 |
| 1256 | Ga0496109_0118222 | 3300048912 | Bacteria | 2467 |
| 1257 | Ga0496110_0000220 | 3300048913 | Bacteria | 37013 |
| 1258 | Ga0496110_0004660 | 3300048913 | Bacteria | 10661 |
| 1259 | Ga0496110_0008200 | 3300048913 | Bacteria | 8395 |
| 1260 | Ga0496110_0011646 | 3300048913 | Bacteria | 7211 |
| 1261 | Ga0496110_0014056 | 3300048913 | Bacteria | 6636 |
| 1262 | Ga0496110_0026145 | 3300048913 | Bacteria | 4992 |
| 1263 | Ga0496110_0027265 | 3300048913 | Bacteria | 4895 |
| 1264 | Ga0496110_0074940 | 3300048913 | Bacteria | 3006 |
| 1265 | Ga0496110_0080252 | 3300048913 | Bacteria | 2906 |
| 1266 | Ga0496111_0000527 | 3300048914 | Bacteria | 19793 |
| 1267 | Ga0496111_0000575 | 3300048914 | Bacteria | 19168 |
| 1268 | Ga0496111_0000817 | 3300048914 | Bacteria | 16718 |
| 1269 | Ga0496111_0003344 | 3300048914 | Bacteria | 9916 |
| 1270 | Ga0496111_0028049 | 3300048914 | Bacteria | 3988 |
| 1271 | Ga0496111_0037721 | 3300048914 | Bacteria | 3460 |
| 1272 | Ga0496112_0004865 | 3300048915 | Bacteria | 11480 |
| 1273 | Ga0496112_0009854 | 3300048915 | Bacteria | 8632 |
| 1274 | Ga0496112_0061906 | 3300048915 | Bacteria | 3690 |
| 1275 | Ga0496112_0068854 | 3300048915 | Bacteria | 3495 |
| 1276 | Ga0496112_0130578 | 3300048915 | Bacteria | 2483 |
| 1277 | Ga0496112_0131147 | 3300048915 | Bacteria | 2477 |
| 1278 | Ga0496112_0194690 | 3300048915 | Bacteria | 1988 |
| 1279 | Ga0496112_0249612 | 3300048915 | Bacteria | 1726 |
| 1280 | Ga0496113_0004876 | 3300048916 | Bacteria | 8308 |
| 1281 | Ga0496113_0049946 | 3300048916 | Bacteria | 3116 |
| 1282 | Ga0496113_0092889 | 3300048916 | Bacteria | 2328 |
| 1283 | Ga0496113_0115480 | 3300048916 | Bacteria | 2094 |
| 1284 | Ga0496114_0000116 | 3300048917 | Bacteria | 57632 |
| 1285 | Ga0496114_0000286 | 3300048917 | Bacteria | 36864 |
| 1286 | Ga0496114_0011013 | 3300048917 | Bacteria | 7211 |
| 1287 | Ga0496114_0027001 | 3300048917 | Bacteria | 4703 |
| 1288 | Ga0496114_0036877 | 3300048917 | Bacteria | 4041 |
| 1289 | Ga0496114_0040866 | 3300048917 | Bacteria | 3841 |
| 1290 | Ga0496114_0050348 | 3300048917 | Bacteria | 3467 |
| 1291 | Ga0496114_0072131 | 3300048917 | Bacteria | 2903 |
| 1292 | Ga0496114_0140787 | 3300048917 | Bacteria | 2088 |
| 1293 | Ga0496115_0002425 | 3300048918 | Bacteria | 13379 |
| 1294 | Ga0496115_0002960 | 3300048918 | Bacteria | 12217 |
| 1295 | Ga0496115_0049446 | 3300048918 | Bacteria | 3366 |
| 1296 | Ga0496115_0060345 | 3300048918 | Bacteria | 3055 |
| 1297 | Ga0496115_0104371 | 3300048918 | Bacteria | 2326 |
| 1298 | Ga0496116_0000173 | 3300048919 | Bacteria | 129928 |
| 1299 | Ga0496116_0000182 | 3300048919 | Bacteria | 125343 |
| 1300 | Ga0496116_0001408 | 3300048919 | Bacteria | 27021 |
| 1301 | Ga0496116_0002098 | 3300048919 | Bacteria | 21291 |
| 1302 | Ga0496117_0000144 | 3300048920 | Bacteria | 153831 |
| 1303 | Ga0496117_0000278 | 3300048920 | Bacteria | 95496 |
| 1304 | Ga0496117_0001155 | 3300048920 | Bacteria | 39752 |
| 1305 | Ga0496117_0005163 | 3300048920 | Bacteria | 13934 |
| 1306 | Ga0496117_0041649 | 3300048920 | Bacteria | 3361 |
| 1307 | Ga0496117_0072589 | 3300048920 | Bacteria | 2299 |
| 1308 | Ga0496118_0000165 | 3300048921 | Bacteria | 119376 |
| 1309 | Ga0496118_0000466 | 3300048921 | Bacteria | 67173 |
| 1310 | Ga0496118_0019168 | 3300048921 | Bacteria | 6125 |
| 1311 | Ga0496118_0022954 | 3300048921 | Bacteria | 5436 |
| 1312 | Ga0496118_0094561 | 3300048921 | Bacteria | 2043 |
| 1313 | Ga0496119_0000449 | 3300048922 | Bacteria | 56334 |
| 1314 | Ga0496119_0001560 | 3300048922 | Bacteria | 27295 |
| 1315 | Ga0496119_0002247 | 3300048922 | Bacteria | 21487 |
| 1316 | Ga0496119_0003552 | 3300048922 | Bacteria | 16090 |
| 1317 | Ga0496119_0004224 | 3300048922 | Bacteria | 14409 |
| 1318 | Ga0496119_0009347 | 3300048922 | Bacteria | 8431 |
| 1319 | Ga0496119_0015383 | 3300048922 | Bacteria | 5896 |
| 1320 | Ga0496119_0051687 | 3300048922 | Bacteria | 2523 |
| 1321 | Ga0496120_0000663 | 3300048923 | Bacteria | 50609 |
| 1322 | Ga0496120_0002291 | 3300048923 | Bacteria | 19857 |
| 1323 | Ga0496120_0012354 | 3300048923 | Bacteria | 5818 |
| 1324 | Ga0496120_0029616 | 3300048923 | Bacteria | 3341 |
| 1325 | Ga0496121_0000016 | 3300048924 | Bacteria | 562911 |
| 1326 | Ga0496121_0009172 | 3300048924 | Bacteria | 11436 |
| 1327 | Ga0496121_0015653 | 3300048924 | Bacteria | 7913 |
| 1328 | Ga0496121_0016297 | 3300048924 | Bacteria | 7684 |
| 1329 | Ga0496121_0112226 | 3300048924 | Bacteria | 2077 |
| 1330 | Ga0496122_0000284 | 3300048925 | Bacteria | 113244 |
| 1331 | Ga0496122_0017733 | 3300048925 | Bacteria | 6628 |
| 1332 | Ga0496122_0018799 | 3300048925 | Bacteria | 6355 |
| 1333 | Ga0496123_0008217 | 3300048926 | Bacteria | 9623 |
| 1334 | Ga0496123_0028056 | 3300048926 | Bacteria | 4176 |
| 1335 | Ga0496124_0000015 | 3300048927 | Bacteria | 460700 |
| 1336 | Ga0496124_0005946 | 3300048927 | Bacteria | 13489 |
| 1337 | Ga0496125_0000021 | 3300048928 | Bacteria | 460688 |
| 1338 | Ga0496125_0007725 | 3300048928 | Bacteria | 11390 |
| 1339 | Ga0496125_0032094 | 3300048928 | Bacteria | 4669 |
| 1340 | Ga0496126_0000015 | 3300048929 | Bacteria | 663212 |
| 1341 | Ga0496126_0000039 | 3300048929 | Bacteria | 347353 |
| 1342 | Ga0496126_0000075 | 3300048929 | Bacteria | 235121 |
| 1343 | Ga0496126_0000677 | 3300048929 | Bacteria | 62685 |
| 1344 | Ga0496126_0000807 | 3300048929 | Bacteria | 56090 |
| 1345 | Ga0496126_0003990 | 3300048929 | Bacteria | 18027 |
| 1346 | Ga0496126_0008063 | 3300048929 | Bacteria | 11413 |
| 1347 | Ga0496126_0041523 | 3300048929 | Bacteria | 4256 |
| 1348 | Ga0496126_0045712 | 3300048929 | Bacteria | 4022 |
| 1349 | Ga0496126_0067728 | 3300048929 | Bacteria | 3189 |
| 1350 | Ga0496126_0071524 | 3300048929 | Bacteria | 3087 |
| 1351 | Ga0495682_0015944 | 3300049460 | Bacteria | 2845 |
| 1352 | Ga0501031_0000144 | 3300049568 | Bacteria | 40113 |
| 1353 | Ga0501031_0008167 | 3300049568 | Bacteria | 6813 |
| 1354 | Ga0501032_0002470 | 3300049569 | Bacteria | 14437 |
| 1355 | Ga0501032_0007497 | 3300049569 | Bacteria | 7969 |
| 1356 | Ga0501032_0011513 | 3300049569 | Bacteria | 6354 |
| 1357 | Ga0501032_0039210 | 3300049569 | Bacteria | 3222 |
| 1358 | Ga0501033_0002503 | 3300049570 | Bacteria | 15572 |
| 1359 | Ga0501034_0001101 | 3300049571 | Bacteria | 38016 |
| 1360 | Ga0501034_0007303 | 3300049571 | Bacteria | 11778 |
| 1361 | Ga0501034_0059693 | 3300049571 | Bacteria | 3831 |
| 1362 | Ga0501034_0091706 | 3300049571 | Bacteria | 3035 |
| 1363 | Ga0501034_0290035 | 3300049571 | Bacteria | 1575 |
| 1364 | Ga0501036_0003893 | 3300049572 | Bacteria | 11980 |
| 1365 | Ga0501036_0007139 | 3300049572 | Bacteria | 9097 |
| 1366 | Ga0501037_0000796 | 3300049573 | Bacteria | 23665 |
| 1367 | Ga0501037_0003517 | 3300049573 | Bacteria | 11374 |
| 1368 | Ga0501037_0003564 | 3300049573 | Bacteria | 11291 |
| 1369 | Ga0501037_0087309 | 3300049573 | Bacteria | 2257 |
| 1370 | Ga0501038_0001310 | 3300049574 | Bacteria | 22652 |
| 1371 | Ga0501038_0002811 | 3300049574 | Bacteria | 16213 |
| 1372 | Ga0501038_0003820 | 3300049574 | Bacteria | 14007 |
| 1373 | Ga0501038_0008860 | 3300049574 | Bacteria | 9233 |
| 1374 | Ga0501039_0001985 | 3300049575 | Bacteria | 15168 |
| 1375 | Ga0501039_0004366 | 3300049575 | Bacteria | 10657 |
| 1376 | Ga0501039_0081386 | 3300049575 | Bacteria | 2521 |
| 1377 | Ga0501040_0008828 | 3300049576 | Bacteria | 6551 |
| 1378 | Ga0501041_0018104 | 3300049577 | Bacteria | 4195 |
| 1379 | Ga0501042_0118887 | 3300049578 | Bacteria | 1902 |
| 1380 | Ga0501043_0000990 | 3300049579 | Bacteria | 25039 |
| 1381 | Ga0501043_0006893 | 3300049579 | Bacteria | 9066 |
| 1382 | Ga0501043_0038202 | 3300049579 | Bacteria | 3775 |
| 1383 | Ga0501043_0113935 | 3300049579 | Bacteria | 2123 |
| 1384 | Ga0501046_0000427 | 3300049580 | Bacteria | 42168 |
| 1385 | Ga0501046_0002722 | 3300049580 | Bacteria | 16457 |
| 1386 | Ga0501046_0077417 | 3300049580 | Bacteria | 2575 |
| 1387 | Ga0501047_0002484 | 3300049581 | Bacteria | 17594 |
| 1388 | Ga0501047_0034364 | 3300049581 | Bacteria | 4894 |
| 1389 | Ga0501047_0060268 | 3300049581 | Bacteria | 3663 |
| 1390 | Ga0501047_0071012 | 3300049581 | Bacteria | 3352 |
| 1391 | Ga0501047_0076929 | 3300049581 | Bacteria | 3211 |
| 1392 | Ga0501048_0000026 | 3300049582 | Bacteria | 66602 |
| 1393 | Ga0501048_0002590 | 3300049582 | Bacteria | 13851 |
| 1394 | Ga0501048_0004211 | 3300049582 | Bacteria | 10963 |
| 1395 | Ga0501067_0010708 | 3300049583 | Bacteria | 5073 |
| 1396 | Ga0501067_0056142 | 3300049583 | Bacteria | 2182 |
| 1397 | Ga0501067_0067902 | 3300049583 | Bacteria | 1974 |
| 1398 | Ga0501068_0008200 | 3300049584 | Bacteria | 5808 |
| 1399 | Ga0501069_0000223 | 3300049585 | Bacteria | 25278 |
| 1400 | Ga0501069_0000515 | 3300049585 | Bacteria | 17655 |
| 1401 | Ga0501070_0000766 | 3300049586 | Bacteria | 29273 |
| 1402 | Ga0501070_0001165 | 3300049586 | Bacteria | 23519 |
| 1403 | Ga0501070_0001589 | 3300049586 | Bacteria | 20181 |
| 1404 | Ga0501070_0001682 | 3300049586 | Bacteria | 19594 |
| 1405 | Ga0501070_0002601 | 3300049586 | Bacteria | 15774 |
| 1406 | Ga0501070_0003370 | 3300049586 | Bacteria | 13863 |
| 1407 | Ga0501070_0003504 | 3300049586 | Bacteria | 13581 |
| 1408 | Ga0501070_0038098 | 3300049586 | Bacteria | 4012 |
| 1409 | Ga0501071_0013695 | 3300049587 | Bacteria | 5532 |
| 1410 | Ga0501072_0003695 | 3300049588 | Bacteria | 11541 |
| 1411 | Ga0501074_0008363 | 3300049590 | Bacteria | 7501 |
| 1412 | Ga0501074_0014120 | 3300049590 | Bacteria | 5806 |
| 1413 | Ga0501076_0073923 | 3300049592 | Bacteria | 2730 |
| 1414 | Ga0501079_0000093 | 3300049741 | Bacteria | 43802 |
| 1415 | Ga0501080_0000266 | 3300049742 | Bacteria | 39496 |
| 1416 | Ga0501080_0003067 | 3300049742 | Bacteria | 14750 |
| 1417 | Ga0501080_0009512 | 3300049742 | Bacteria | 8868 |
| 1418 | Ga0501080_0010586 | 3300049742 | Bacteria | 8441 |
| 1419 | Ga0501080_0016463 | 3300049742 | Bacteria | 6828 |
| 1420 | Ga0501080_0170999 | 3300049742 | Bacteria | 2004 |
| 1421 | Ga0501083_0030883 | 3300049744 | Bacteria | 3677 |
| 1422 | Ga0501035_0001097 | 3300049822 | Bacteria | 28352 |
| 1423 | Ga0501035_0001386 | 3300049822 | Bacteria | 24909 |
| 1424 | Ga0501035_0016730 | 3300049822 | Bacteria | 6762 |
| 1425 | Ga0501035_0021620 | 3300049822 | Bacteria | 5915 |
| 1426 | Ga0501035_0044132 | 3300049822 | Bacteria | 4015 |
| 1427 | Ga0501035_0177973 | 3300049822 | Bacteria | 1834 |
| 1428 | Ga0501044_0001367 | 3300049823 | Bacteria | 28613 |
| 1429 | Ga0501044_0004810 | 3300049823 | Bacteria | 15100 |
| 1430 | Ga0501044_0008934 | 3300049823 | Bacteria | 10952 |
| 1431 | Ga0501044_0010160 | 3300049823 | Bacteria | 10228 |
| 1432 | Ga0501044_0100053 | 3300049823 | Bacteria | 2918 |
| 1433 | Ga0501045_0035134 | 3300049824 | Bacteria | 3639 |
| 1434 | Ga0501045_0077109 | 3300049824 | Bacteria | 2456 |
| 1435 | Ga0501045_0128149 | 3300049824 | Bacteria | 1886 |
| 1436 | nmdc:mga03683_3089_c1 | 3300050489 | Bacteria | 5293 |
| 1437 | nmdc:mga03n38_78836_c1 | 3300050490 | Bacteria | 1543 |
| 1438 | nmdc:mga00v17_152149_c1 | 3300050491 | Bacteria | 1487 |
| 1439 | nmdc:mga00v17_2947_c1 | 3300050491 | Bacteria | 8733 |
| 1440 | nmdc:mga00v17_48988_c1 | 3300050491 | Bacteria | 2561 |
| 1441 | nmdc:mga00v17_5845_c1 | 3300050491 | Bacteria | 6496 |
| 1442 | nmdc:mga0yw44_147755_c1 | 3300050492 | Bacteria | 1531 |
| 1443 | nmdc:mga0yw44_172183_c1 | 3300050492 | Bacteria | 1422 |
| 1444 | nmdc:mga0yw44_25015_c1 | 3300050492 | Bacteria | 3388 |
| 1445 | nmdc:mga0yw44_66507_c1 | 3300050492 | Bacteria | 2224 |
| 1446 | nmdc:mga0yw44_70038_c1 | 3300050492 | Bacteria | 2174 |
| 1447 | nmdc:mga07m45_101866_c1 | 3300050496 | Bacteria | 1211 |
| 1448 | nmdc:mga07m45_34034_c1 | 3300050496 | Bacteria | 2831 |
| 1449 | nmdc:mga07m45_36181_c1 | 3300050496 | Bacteria | 2749 |
| 1450 | nmdc:mga07m45_62048_c1 | 3300050496 | Bacteria | 2118 |
| 1451 | nmdc:mga05p37_110473_c1 | 3300050507 | Bacteria | 3382 |
| 1452 | nmdc:mga05p37_12466_c1 | 3300050507 | Bacteria | 10154 |
| 1453 | nmdc:mga05p37_160331_c1 | 3300050507 | Bacteria | 2748 |
| 1454 | nmdc:mga05p37_188068_c1 | 3300050507 | Bacteria | 2509 |
| 1455 | nmdc:mga05p37_2735_c1 | 3300050507 | Bacteria | 20505 |
| 1456 | nmdc:mga05p37_43393_c1 | 3300050507 | Bacteria | 5532 |
| 1457 | nmdc:mga05p37_610624_c1 | 3300050507 | Bacteria | 1229 |
| 1458 | nmdc:mga09592_115355_c1 | 3300050508 | Bacteria | 2305 |
| 1459 | nmdc:mga09592_120387_c1 | 3300050508 | Bacteria | 2254 |
| 1460 | nmdc:mga09592_138562_c1 | 3300050508 | Bacteria | 2096 |
| 1461 | nmdc:mga09592_16095_c1 | 3300050508 | Bacteria | 6113 |
| 1462 | nmdc:mga09592_46742_c1 | 3300050508 | Bacteria | 3646 |
| 1463 | nmdc:mga09592_80423_c1 | 3300050508 | Bacteria | 2775 |
| 1464 | nmdc:mga09592_87_c3 | 3300050508 | Bacteria | 23142 |
| 1465 | nmdc:mga0qj67_509_c1 | 3300050509 | Bacteria | 23236 |
| 1466 | nmdc:mga06r32_162003_c1 | 3300050510 | Bacteria | 2219 |
| 1467 | nmdc:mga06r32_172091_c1 | 3300050510 | Bacteria | 2149 |
| 1468 | nmdc:mga06r32_1913_c1 | 3300050510 | Bacteria | 18545 |
| 1469 | nmdc:mga06r32_692_c3 | 3300050510 | Bacteria | 10179 |
| 1470 | nmdc:mga08y16_28599_c1 | 3300050511 | Bacteria | 5876 |
| 1471 | nmdc:mga08y16_39956_c1 | 3300050511 | Bacteria | 4921 |
| 1472 | nmdc:mga08y16_41095_c1 | 3300050511 | Bacteria | 4845 |
| 1473 | nmdc:mga08x19_52346_c1 | 3300050514 | Bacteria | 2625 |
| 1474 | nmdc:mga08x19_5990_c1 | 3300050514 | Bacteria | 7190 |
| 1475 | nmdc:mga0a205_12444_c1 | 3300050515 | Bacteria | 7870 |
| 1476 | nmdc:mga0sz30_21727_c1 | 3300050516 | Bacteria | 2599 |
| 1477 | nmdc:mga0sz30_5944_c1 | 3300050516 | Bacteria | 4501 |
| 1478 | Ga0495601_0000602 | 3300053077 | Bacteria | 19111 |
| 1479 | Ga0495601_0010705 | 3300053077 | Bacteria | 5470 |
| 1480 | Ga0495612_0000929 | 3300053078 | Bacteria | 11998 |
| 1481 | Ga0500635_0021790 | 3300053080 | Bacteria | 1979 |
| 1482 | Ga0495619_0005371 | 3300053085 | Bacteria | 8113 |
| 1483 | Ga0495619_0054104 | 3300053085 | Bacteria | 2656 |
| 1484 | Ga0500643_003109 | 3300053087 | Bacteria | 8148 |
| 1485 | Ga0500646_0000357 | 3300053090 | Bacteria | 13753 |
| 1486 | Ga0500646_0029241 | 3300053090 | Bacteria | 1508 |
| 1487 | Ga0500583_0003525 | 3300053092 | Bacteria | 4939 |
| 1488 | Ga0500583_0071248 | 3300053092 | Bacteria | 1662 |
| 1489 | Ga0500559_0004201 | 3300053136 | Bacteria | 6901 |
| 1490 | Ga0500568_0000706 | 3300053139 | Bacteria | 23977 |
| 1491 | Ga0500573_0088921 | 3300053140 | Bacteria | 1747 |
| 1492 | Ga0500577_0074856 | 3300053142 | Bacteria | 1337 |
| 1493 | Ga0500588_0004867 | 3300053146 | Bacteria | 2939 |
| 1494 | Ga0500616_0009263 | 3300053153 | Bacteria | 6001 |
| 1495 | Ga0500627_0006875 | 3300053158 | Bacteria | 3913 |
| 1496 | Ga0500645_000032 | 3300053730 | Bacteria | 119506 |
| 1497 | Ga0501084_0000239 | 3300054114 | Bacteria | 41470 |
| 1498 | Ga0501084_0035629 | 3300054114 | Bacteria | 4160 |
| 1499 | Ga0466962_0000056 | 3300061719 | Bacteria | 46579 |
| 1500 | Ga0466962_0006087 | 3300061719 | Bacteria | 5802 |
| 1501 | Ga0466962_0009800 | 3300061719 | Bacteria | 4596 |
| 1502 | Ga0466962_0018078 | 3300061719 | Bacteria | 3391 |
| 1503 | Ga0466962_0018089 | 3300061719 | Bacteria | 3389 |
| 1504 | Ga0466962_0019198 | 3300061719 | Bacteria | 3282 |
| 1505 | Ga0530510_0051283 | 3300061734 | Bacteria | 2981 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050507 | nmdc:mga05p37_610624_c1 | nmdc:mga05p37_610624_c1_105_1214 | 367 |
| 2 | 3300046680 | Ga0495646_0177897 | Ga0495646_0177897_21_1151 | 369 |
| 3 | 3300025901 | Ga0207688_10089663 | Ga0207688_100896633 | 376 |
| 4 | 3300041443 | Ga0451789_0957144 | Ga0451789_0957144_20_1171 | 381 |
| 5 | 3300048089 | Ga0495614_0082573 | Ga0495614_0082573_198_1373 | 383 |
| 6 | 3300046533 | Ga0495640_0046303 | Ga0495640_0046303_1825_2997 | 386 |
| 7 | 3300050492 | nmdc:mga0yw44_70038_c1 | nmdc:mga0yw44_70038_c1_973_2148 | 386 |
| 8 | 3300050496 | nmdc:mga07m45_101866_c1 | nmdc:mga07m45_101866_c1_17_1183 | 386 |
| 9 | 3300005334 | Ga0068869_100097501 | Ga0068869_1000975012 | 389 |
| 10 | 3300032168 | Ga0316593_10000889 | Ga0316593_100008899 | 389 |
| 11 | 3300048920 | Ga0496117_0000278 | Ga0496117_0000278_31936_33189 | 389 |
| 12 | 3300006844 | Ga0075428_100000610 | Ga0075428_10000061032 | 390 |
| 13 | 3300009094 | Ga0111539_10001504 | Ga0111539_1000150415 | 390 |
| 14 | 3300027907 | Ga0207428_10022479 | Ga0207428_100224792 | 390 |
| 15 | 3300045051 | Ga0451576_0128588 | Ga0451576_0128588_469_1644 | 390 |
| 16 | 3300050511 | nmdc:mga08y16_28599_c1 | nmdc:mga08y16_28599_c1_3572_4747 | 390 |
| 17 | 3300025907 | Ga0207645_10022095 | Ga0207645_100220952 | 396 |
| 18 | 3300049571 | Ga0501034_0290035 | Ga0501034_0290035_11_1213 | 400 |
| 19 | 3300005340 | Ga0070689_100025866 | Ga0070689_1000258662 | 401 |
| 20 | 3300025936 | Ga0207670_10044191 | Ga0207670_100441912 | 401 |
| 21 | 3300044658 | Ga0466972_0011396 | Ga0466972_0011396_1784_3094 | 404 |
| 22 | 3300044683 | Ga0466965_0024726 | Ga0466965_0024726_715_2025 | 404 |
| 23 | 3300044693 | Ga0466961_0005797 | Ga0466961_0005797_5984_7294 | 404 |
| 24 | 3300044706 | Ga0466964_0025198 | Ga0466964_0025198_509_1819 | 404 |
| 25 | 3300044719 | Ga0466971_0008516 | Ga0466971_0008516_2459_3769 | 404 |
| 26 | 3300044765 | Ga0466970_0014696 | Ga0466970_0014696_1714_3024 | 404 |
| 27 | 3300045836 | Ga0466958_0028208 | Ga0466958_0028208_975_2285 | 404 |
| 28 | 3300061719 | Ga0466962_0019198 | Ga0466962_0019198_538_1848 | 404 |
| 29 | 3300005467 | Ga0070706_100167265 | Ga0070706_1001672652 | 406 |
| 30 | 3300006844 | Ga0075428_100174888 | Ga0075428_1001748883 | 406 |
| 31 | 3300025910 | Ga0207684_10143592 | Ga0207684_101435922 | 406 |
| 32 | 3300009093 | Ga0105240_10354671 | Ga0105240_103546711 | 407 |
| 33 | 3300045976 | Ga0466967_0181544 | Ga0466967_0181544_352_1707 | 407 |
| 34 | 3300050491 | nmdc:mga00v17_48988_c1 | nmdc:mga00v17_48988_c1_81_1343 | 407 |
| 35 | 3300048916 | Ga0496113_0092889 | Ga0496113_0092889_704_1957 | 408 |
| 36 | 3300021384 | Ga0213876_10075381 | Ga0213876_100753812 | 409 |
| 37 | 3300039437 | Ga0436365_1050647 | Ga0436365_1050647_2124_3422 | 409 |
| 38 | 3300046516 | Ga0495628_0225663 | Ga0495628_0225663_120_1394 | 411 |
| 39 | iso_pu_bacteria | 2643221715 | 2644636244 | 411 |
| 40 | 3300048904 | Ga0496101_0117477 | Ga0496101_0117477_464_1774 | 413 |
| 41 | 3300048909 | Ga0496106_0020907 | Ga0496106_0020907_2641_3951 | 413 |
| 42 | 3300053140 | Ga0500573_0088921 | Ga0500573_0088921_269_1528 | 413 |
| 43 | 3300050492 | nmdc:mga0yw44_147755_c1 | nmdc:mga0yw44_147755_c1_22_1296 | 414 |
| 44 | 3300021384 | Ga0213876_10019769 | Ga0213876_100197695 | 415 |
| 45 | 3300037853 | Ga0436364_1291536 | Ga0436364_1291536_1032_2372 | 415 |
| 46 | 3300039437 | Ga0436365_0447055 | Ga0436365_0447055_408_1748 | 415 |
| 47 | 3300044693 | Ga0466961_0021171 | Ga0466961_0021171_1681_2982 | 416 |
| 48 | 3300005985 | Ga0081539_10044321 | Ga0081539_100443213 | 417 |
| 49 | 3300009098 | Ga0105245_10263285 | Ga0105245_102632852 | 417 |
| 50 | 3300037418 | Ga0395900_0042604 | Ga0395900_0042604_2902_4179 | 417 |
| 51 | 3300037471 | Ga0395905_0087531 | Ga0395905_0087531_678_1955 | 417 |
| 52 | iso_pu_bacteria | 2551306166 | 2552108222 | 418 |
| 53 | 3300048911 | Ga0496108_0065466 | Ga0496108_0065466_1612_2910 | 419 |
| 54 | 3300050492 | nmdc:mga0yw44_172183_c1 | nmdc:mga0yw44_172183_c1_23_1312 | 419 |
| 55 | 3300035695 | Ga0373927_0093639 | Ga0373927_0093639_556_1824 | 420 |
| 56 | 3300045976 | Ga0466967_0000595 | Ga0466967_0000595_7565_8830 | 420 |
| 57 | 3300046694 | Ga0495649_0036673 | Ga0495649_0036673_294_1634 | 420 |
| 58 | 3300048925 | Ga0496122_0018799 | Ga0496122_0018799_1462_2787 | 420 |
| 59 | 3300048926 | Ga0496123_0028056 | Ga0496123_0028056_2008_3333 | 420 |
| 60 | 3300021388 | Ga0213875_10011142 | Ga0213875_100111425 | 421 |
| 61 | 3300037853 | Ga0436364_0238775 | Ga0436364_0238775_4776_6155 | 421 |
| 62 | iso_pu_bacteria | 2902792274 | 2902799087 | 421 |
| 63 | iso_pu_bacteria | 2902799365 | 2902804385 | 421 |
| 64 | iso_pu_bacteria | 2974315732 | 2974319899 | 421 |
| 65 | 3300005353 | Ga0070669_100004569 | Ga0070669_1000045698 | 422 |
| 66 | 3300005367 | Ga0070667_100000056 | Ga0070667_100000056103 | 422 |
| 67 | 3300005445 | Ga0070708_100008205 | Ga0070708_1000082053 | 422 |
| 68 | 3300005467 | Ga0070706_100009403 | Ga0070706_1000094037 | 422 |
| 69 | 3300005468 | Ga0070707_100001912 | Ga0070707_10000191215 | 422 |
| 70 | 3300005548 | Ga0070665_100006813 | Ga0070665_1000068133 | 422 |
| 71 | 3300005617 | Ga0068859_100000751 | Ga0068859_1000007513 | 422 |
| 72 | 3300005841 | Ga0068863_100002092 | Ga0068863_1000020927 | 422 |
| 73 | 3300005843 | Ga0068860_100000092 | Ga0068860_10000009253 | 422 |
| 74 | 3300005844 | Ga0068862_100000035 | Ga0068862_10000003555 | 422 |
| 75 | 3300006931 | Ga0097620_100000751 | Ga0097620_1000007513 | 422 |
| 76 | 3300009101 | Ga0105247_10000062 | Ga0105247_10000062105 | 422 |
| 77 | 3300009177 | Ga0105248_10000036 | Ga0105248_10000036102 | 422 |
| 78 | 3300009553 | Ga0105249_10000046 | Ga0105249_10000046124 | 422 |
| 79 | 3300013306 | Ga0163162_10054540 | Ga0163162_100545403 | 422 |
| 80 | 3300014325 | Ga0163163_10041882 | Ga0163163_100418822 | 422 |
| 81 | 3300014325 | Ga0163163_10141080 | Ga0163163_101410801 | 422 |
| 82 | 3300025900 | Ga0207710_10000060 | Ga0207710_10000060104 | 422 |
| 83 | 3300025910 | Ga0207684_10002893 | Ga0207684_100028937 | 422 |
| 84 | 3300025922 | Ga0207646_10022954 | Ga0207646_100229544 | 422 |
| 85 | 3300025923 | Ga0207681_10000788 | Ga0207681_1000078818 | 422 |
| 86 | 3300025941 | Ga0207711_10000073 | Ga0207711_1000007385 | 422 |
| 87 | 3300025961 | Ga0207712_10000042 | Ga0207712_1000004257 | 422 |
| 88 | 3300026088 | Ga0207641_10001094 | Ga0207641_1000109416 | 422 |
| 89 | 3300028379 | Ga0268266_10005174 | Ga0268266_1000517414 | 422 |
| 90 | 3300028380 | Ga0268265_10000051 | Ga0268265_10000051125 | 422 |
| 91 | 3300028381 | Ga0268264_10000108 | Ga0268264_1000010882 | 422 |
| 92 | 3300048903 | Ga0496100_0002943 | Ga0496100_0002943_7238_8536 | 422 |
| 93 | 3300048905 | Ga0496102_0000390 | Ga0496102_0000390_10718_12016 | 422 |
| 94 | 3300048915 | Ga0496112_0061906 | Ga0496112_0061906_204_1487 | 422 |
| 95 | 3300048919 | Ga0496116_0002098 | Ga0496116_0002098_18439_19737 | 422 |
| 96 | 3300048920 | Ga0496117_0001155 | Ga0496117_0001155_11283_12581 | 422 |
| 97 | 3300048921 | Ga0496118_0000165 | Ga0496118_0000165_27044_28342 | 422 |
| 98 | 3300048922 | Ga0496119_0003552 | Ga0496119_0003552_9564_10862 | 422 |
| 99 | 3300048924 | Ga0496121_0009172 | Ga0496121_0009172_8178_9476 | 422 |
| 100 | 3300048928 | Ga0496125_0007725 | Ga0496125_0007725_387_1685 | 422 |
| 101 | 3300048929 | Ga0496126_0000807 | Ga0496126_0000807_23239_24537 | 422 |
| 102 | 3300050491 | nmdc:mga00v17_152149_c1 | nmdc:mga00v17_152149_c1_51_1382 | 422 |
| 103 | iso_pu_bacteria | 2751185725 | 2753037140 | 422 |
| 104 | iso_pu_bacteria | 2751185792 | 2753325009 | 422 |
| 105 | iso_pu_bacteria | 2902810491 | 2902812382 | 422 |
| 106 | 3300005329 | Ga0070683_100017452 | Ga0070683_1000174523 | 423 |
| 107 | 3300005435 | Ga0070714_100086997 | Ga0070714_1000869972 | 423 |
| 108 | 3300005436 | Ga0070713_100106097 | Ga0070713_1001060971 | 423 |
| 109 | 3300005535 | Ga0070684_100003821 | Ga0070684_1000038215 | 423 |
| 110 | 3300006038 | Ga0075365_10031640 | Ga0075365_100316403 | 423 |
| 111 | 3300006353 | Ga0075370_10001448 | Ga0075370_100014483 | 423 |
| 112 | 3300025928 | Ga0207700_10122586 | Ga0207700_101225862 | 423 |
| 113 | 3300025929 | Ga0207664_10065900 | Ga0207664_100659002 | 423 |
| 114 | 3300025929 | Ga0207664_10130771 | Ga0207664_101307712 | 423 |
| 115 | 3300025944 | Ga0207661_10001912 | Ga0207661_100019129 | 423 |
| 116 | 3300031251 | Ga0265327_10000071 | Ga0265327_10000071149 | 423 |
| 117 | 3300033180 | Ga0307510_10089223 | Ga0307510_100892232 | 423 |
| 118 | 3300046531 | Ga0495665_0010808 | Ga0495665_0010808_3108_4424 | 423 |
| 119 | 3300050491 | nmdc:mga00v17_5845_c1 | nmdc:mga00v17_5845_c1_831_2174 | 423 |
| 120 | 3300050496 | nmdc:mga07m45_36181_c1 | nmdc:mga07m45_36181_c1_66_1409 | 423 |
| 121 | iso_pu_bacteria | 2643221687 | 2644489440 | 423 |
| 122 | iso_pu_bacteria | 2738543011 | 2739239476 | 423 |
| 123 | iso_pu_bacteria | 2856741275 | 2856746188 | 423 |
| 124 | iso_pu_bacteria | 2889300758 | 2889301895 | 423 |
| 125 | iso_pu_bacteria | 2891395885 | 2891402637 | 423 |
| 126 | iso_pu_bacteria | 2891562705 | 2891562734 | 423 |
| 127 | iso_pu_bacteria | 2902837492 | 2902842205 | 423 |
| 128 | iso_pu_bacteria | 2932398195 | 2932400111 | 423 |
| 129 | iso_pu_bacteria | 2939582691 | 2939586276 | 423 |
| 130 | iso_pu_bacteria | 2939743619 | 2939747105 | 423 |
| 131 | 3300044706 | Ga0466964_0024386 | Ga0466964_0024386_282_1583 | 424 |
| 132 | 3300045049 | Ga0466959_0038655 | Ga0466959_0038655_519_1820 | 424 |
| 133 | 3300045836 | Ga0466958_0087654 | Ga0466958_0087654_501_1802 | 424 |
| 134 | iso_pu_bacteria | 2738541308 | 2738891357 | 424 |
| 135 | iso_pu_bacteria | 2891554331 | 2891554964 | 424 |
| 136 | 3300005563 | Ga0068855_100038437 | Ga0068855_1000384374 | 425 |
| 137 | 3300006038 | Ga0075365_10040457 | Ga0075365_100404573 | 425 |
| 138 | 3300006051 | Ga0075364_10003691 | Ga0075364_100036912 | 425 |
| 139 | 3300006186 | Ga0075369_10006357 | Ga0075369_100063573 | 425 |
| 140 | 3300009098 | Ga0105245_10097087 | Ga0105245_100970871 | 425 |
| 141 | 3300009545 | Ga0105237_10000467 | Ga0105237_1000046711 | 425 |
| 142 | 3300010375 | Ga0105239_10003093 | Ga0105239_1000309313 | 425 |
| 143 | 3300021388 | Ga0213875_10016187 | Ga0213875_100161873 | 425 |
| 144 | 3300025303 | Ga0209051_1042780 | Ga0209051_10427801 | 425 |
| 145 | 3300025914 | Ga0207671_10056241 | Ga0207671_100562412 | 425 |
| 146 | 3300025935 | Ga0207709_10005302 | Ga0207709_100053023 | 425 |
| 147 | 3300025949 | Ga0207667_10102345 | Ga0207667_101023453 | 425 |
| 148 | 3300031251 | Ga0265327_10000021 | Ga0265327_10000021124 | 425 |
| 149 | 3300037853 | Ga0436364_1051432 | Ga0436364_1051432_1267_2565 | 425 |
| 150 | 3300039437 | Ga0436365_0939033 | Ga0436365_0939033_45585_46883 | 425 |
| 151 | 3300046506 | Ga0495583_0069052 | Ga0495583_0069052_236_1546 | 425 |
| 152 | 3300046507 | Ga0495606_0026257 | Ga0495606_0026257_2616_3926 | 425 |
| 153 | 3300046663 | Ga0495635_0087728 | Ga0495635_0087728_583_1902 | 425 |
| 154 | 3300047320 | Ga0495672_0024614 | Ga0495672_0024614_121_1419 | 425 |
| 155 | 3300048921 | Ga0496118_0019168 | Ga0496118_0019168_1361_2659 | 425 |
| 156 | 3300048929 | Ga0496126_0071524 | Ga0496126_0071524_1336_2634 | 425 |
| 157 | 3300049569 | Ga0501032_0007497 | Ga0501032_0007497_1892_3190 | 425 |
| 158 | 3300049571 | Ga0501034_0007303 | Ga0501034_0007303_2178_3476 | 425 |
| 159 | 3300049572 | Ga0501036_0003893 | Ga0501036_0003893_5392_6690 | 425 |
| 160 | 3300049573 | Ga0501037_0000796 | Ga0501037_0000796_7766_9064 | 425 |
| 161 | 3300049574 | Ga0501038_0002811 | Ga0501038_0002811_7637_8935 | 425 |
| 162 | 3300049575 | Ga0501039_0004366 | Ga0501039_0004366_8173_9471 | 425 |
| 163 | 3300049579 | Ga0501043_0000990 | Ga0501043_0000990_17082_18380 | 425 |
| 164 | 3300049583 | Ga0501067_0067902 | Ga0501067_0067902_532_1830 | 425 |
| 165 | 3300049586 | Ga0501070_0000766 | Ga0501070_0000766_20145_21443 | 425 |
| 166 | 3300049823 | Ga0501044_0100053 | Ga0501044_0100053_1324_2643 | 425 |
| 167 | 3300050490 | nmdc:mga03n38_78836_c1 | nmdc:mga03n38_78836_c1_193_1491 | 425 |
| 168 | 3300050492 | nmdc:mga0yw44_25015_c1 | nmdc:mga0yw44_25015_c1_1525_2823 | 425 |
| 169 | 3300050516 | nmdc:mga0sz30_21727_c1 | nmdc:mga0sz30_21727_c1_852_2150 | 425 |
| 170 | 3300053080 | Ga0500635_0021790 | Ga0500635_0021790_261_1559 | 425 |
| 171 | 3300053087 | Ga0500643_003109 | Ga0500643_003109_4078_5388 | 425 |
| 172 | 3300053153 | Ga0500616_0009263 | Ga0500616_0009263_3660_4973 | 425 |
| 173 | 3300053158 | Ga0500627_0006875 | Ga0500627_0006875_139_1437 | 425 |
| 174 | 3300053730 | Ga0500645_000032 | Ga0500645_000032_108608_109906 | 425 |
| 175 | iso_pu_bacteria | 2738543034 | 2739362096 | 425 |
| 176 | iso_pu_bacteria | 2884693830 | 2884694345 | 425 |
| 177 | iso_pu_bacteria | 2895427314 | 2895435587 | 425 |
| 178 | iso_pu_bacteria | 2895442618 | 2895444240 | 425 |
| 179 | 3300009176 | Ga0105242_10092703 | Ga0105242_100927033 | 426 |
| 180 | 3300025931 | Ga0207644_10107041 | Ga0207644_101070412 | 426 |
| 181 | 3300025972 | Ga0207668_10000918 | Ga0207668_1000091819 | 426 |
| 182 | 3300048903 | Ga0496100_0000461 | Ga0496100_0000461_10529_11842 | 426 |
| 183 | 3300048909 | Ga0496106_0002018 | Ga0496106_0002018_1799_3112 | 426 |
| 184 | 3300048910 | Ga0496107_0026359 | Ga0496107_0026359_404_1717 | 426 |
| 185 | 3300053142 | Ga0500577_0074856 | Ga0500577_0074856_11_1324 | 426 |
| 186 | iso_pu_bacteria | 2643221692 | 2644516049 | 426 |
| 187 | iso_pu_bacteria | 2899370129 | 2899370663 | 426 |
| 188 | iso_pu_bacteria | 3001119090 | 3001120186 | 426 |
| 189 | 3300003792 | Ga0055540_1011637 | Ga0055540_10116372 | 427 |
| 190 | 3300025303 | Ga0209051_1000620 | Ga0209051_100062020 | 427 |
| 191 | 3300025303 | Ga0209051_1000933 | Ga0209051_100093317 | 427 |
| 192 | 3300025303 | Ga0209051_1001428 | Ga0209051_10014289 | 427 |
| 193 | 3300026041 | Ga0207639_10005809 | Ga0207639_100058095 | 427 |
| 194 | 3300041456 | Ga0451795_0111892 | Ga0451795_0111892_851_2167 | 427 |
| 195 | 3300042438 | Ga0439459_0000473 | Ga0439459_0000473_2295_3593 | 427 |
| 196 | 3300047472 | Ga0495686_0000637 | Ga0495686_0000637_28740_30056 | 427 |
| 197 | 3300050516 | nmdc:mga0sz30_5944_c1 | nmdc:mga0sz30_5944_c1_424_1740 | 427 |
| 198 | iso_pu_bacteria | 2738543005 | 2739205419 | 427 |
| 199 | 3300002459 | JGI24751J29686_10016334 | JGI24751J29686_100163341 | 428 |
| 200 | 3300003792 | Ga0055540_1000003 | Ga0055540_100000312 | 428 |
| 201 | 3300005335 | Ga0070666_10017287 | Ga0070666_100172872 | 428 |
| 202 | 3300005347 | Ga0070668_100024803 | Ga0070668_1000248033 | 428 |
| 203 | 3300005367 | Ga0070667_100000854 | Ga0070667_10000085420 | 428 |
| 204 | 3300005842 | Ga0068858_100068586 | Ga0068858_1000685863 | 428 |
| 205 | 3300005981 | Ga0081538_10070670 | Ga0081538_100706702 | 428 |
| 206 | 3300006038 | Ga0075365_10072687 | Ga0075365_100726873 | 428 |
| 207 | 3300006186 | Ga0075369_10044254 | Ga0075369_100442542 | 428 |
| 208 | 3300006353 | Ga0075370_10063851 | Ga0075370_100638512 | 428 |
| 209 | 3300009177 | Ga0105248_10075304 | Ga0105248_100753044 | 428 |
| 210 | 3300009551 | Ga0105238_10085210 | Ga0105238_100852103 | 428 |
| 211 | 3300011119 | Ga0105246_10040638 | Ga0105246_100406382 | 428 |
| 212 | 3300013104 | Ga0157370_10040559 | Ga0157370_100405593 | 428 |
| 213 | 3300013306 | Ga0163162_10094916 | Ga0163162_100949162 | 428 |
| 214 | 3300014325 | Ga0163163_10013354 | Ga0163163_100133545 | 428 |
| 215 | 3300014969 | Ga0157376_10003944 | Ga0157376_100039445 | 428 |
| 216 | 3300025303 | Ga0209051_1000011 | Ga0209051_1000011584 | 428 |
| 217 | 3300025903 | Ga0207680_10004709 | Ga0207680_100047095 | 428 |
| 218 | 3300025916 | Ga0207663_10062232 | Ga0207663_100622322 | 428 |
| 219 | 3300025939 | Ga0207665_10019025 | Ga0207665_100190255 | 428 |
| 220 | 3300025941 | Ga0207711_10099817 | Ga0207711_100998172 | 428 |
| 221 | 3300025961 | Ga0207712_10076219 | Ga0207712_100762192 | 428 |
| 222 | 3300025972 | Ga0207668_10030292 | Ga0207668_100302923 | 428 |
| 223 | 3300025986 | Ga0207658_10000449 | Ga0207658_1000044924 | 428 |
| 224 | 3300025986 | Ga0207658_10005595 | Ga0207658_1000559512 | 428 |
| 225 | 3300026023 | Ga0207677_10035072 | Ga0207677_100350722 | 428 |
| 226 | 3300026078 | Ga0207702_10239809 | Ga0207702_102398092 | 428 |
| 227 | 3300026116 | Ga0207674_10201721 | Ga0207674_102017212 | 428 |
| 228 | 3300028379 | Ga0268266_10003190 | Ga0268266_1000319019 | 428 |
| 229 | 3300028379 | Ga0268266_10084004 | Ga0268266_100840043 | 428 |
| 230 | 3300028381 | Ga0268264_10075422 | Ga0268264_100754223 | 428 |
| 231 | 3300035083 | Ga0373926_0009791 | Ga0373926_0009791_1394_2704 | 428 |
| 232 | 3300035410 | Ga0373924_0013950 | Ga0373924_0013950_1000_2328 | 428 |
| 233 | 3300035692 | Ga0373935_0004907 | Ga0373935_0004907_5207_6517 | 428 |
| 234 | 3300035725 | Ga0373947_0000039 | Ga0373947_0000039_26154_27464 | 428 |
| 235 | 3300044658 | Ga0466972_0028907 | Ga0466972_0028907_95_1414 | 428 |
| 236 | 3300044735 | Ga0466968_0016662 | Ga0466968_0016662_445_1764 | 428 |
| 237 | 3300044765 | Ga0466970_0054821 | Ga0466970_0054821_636_1955 | 428 |
| 238 | 3300045836 | Ga0466958_0042780 | Ga0466958_0042780_798_2117 | 428 |
| 239 | 3300046454 | Ga0495592_0094071 | Ga0495592_0094071_153_1481 | 428 |
| 240 | 3300046463 | Ga0495653_0022314 | Ga0495653_0022314_2791_4119 | 428 |
| 241 | 3300046529 | Ga0495652_0018073 | Ga0495652_0018073_3057_4385 | 428 |
| 242 | 3300046533 | Ga0495640_0045514 | Ga0495640_0045514_336_1664 | 428 |
| 243 | 3300046536 | Ga0495587_0000907 | Ga0495587_0000907_5297_6625 | 428 |
| 244 | 3300046675 | Ga0495657_0066629 | Ga0495657_0066629_168_1496 | 428 |
| 245 | 3300046679 | Ga0495623_0026038 | Ga0495623_0026038_2115_3443 | 428 |
| 246 | 3300046809 | Ga0495600_0005439 | Ga0495600_0005439_2129_3457 | 428 |
| 247 | 3300047444 | Ga0495675_0034556 | Ga0495675_0034556_348_1676 | 428 |
| 248 | 3300047471 | Ga0495684_0042296 | Ga0495684_0042296_847_2196 | 428 |
| 249 | 3300048903 | Ga0496100_0000067 | Ga0496100_0000067_31510_32838 | 428 |
| 250 | 3300048904 | Ga0496101_0000099 | Ga0496101_0000099_36949_38277 | 428 |
| 251 | 3300048905 | Ga0496102_0046711 | Ga0496102_0046711_849_2177 | 428 |
| 252 | 3300048906 | Ga0496103_0000116 | Ga0496103_0000116_9038_10366 | 428 |
| 253 | 3300048907 | Ga0496104_0133115 | Ga0496104_0133115_938_2266 | 428 |
| 254 | 3300048908 | Ga0496105_0020163 | Ga0496105_0020163_511_1839 | 428 |
| 255 | 3300048909 | Ga0496106_0101504 | Ga0496106_0101504_515_1843 | 428 |
| 256 | 3300048910 | Ga0496107_0000254 | Ga0496107_0000254_15743_17071 | 428 |
| 257 | 3300048911 | Ga0496108_0000959 | Ga0496108_0000959_4370_5698 | 428 |
| 258 | 3300048911 | Ga0496108_0005688 | Ga0496108_0005688_7957_9285 | 428 |
| 259 | 3300048911 | Ga0496108_0067004 | Ga0496108_0067004_16_1335 | 428 |
| 260 | 3300048912 | Ga0496109_0000159 | Ga0496109_0000159_26264_27592 | 428 |
| 261 | 3300048913 | Ga0496110_0008200 | Ga0496110_0008200_2481_3809 | 428 |
| 262 | 3300048914 | Ga0496111_0003344 | Ga0496111_0003344_6204_7532 | 428 |
| 263 | 3300048915 | Ga0496112_0130578 | Ga0496112_0130578_255_1583 | 428 |
| 264 | 3300048915 | Ga0496112_0131147 | Ga0496112_0131147_72_1391 | 428 |
| 265 | 3300048917 | Ga0496114_0000116 | Ga0496114_0000116_36938_38266 | 428 |
| 266 | 3300048919 | Ga0496116_0001408 | Ga0496116_0001408_13924_15252 | 428 |
| 267 | 3300048920 | Ga0496117_0072589 | Ga0496117_0072589_548_1876 | 428 |
| 268 | 3300048921 | Ga0496118_0094561 | Ga0496118_0094561_296_1624 | 428 |
| 269 | 3300048922 | Ga0496119_0004224 | Ga0496119_0004224_2487_3815 | 428 |
| 270 | 3300048924 | Ga0496121_0000016 | Ga0496121_0000016_340103_341431 | 428 |
| 271 | 3300048925 | Ga0496122_0000284 | Ga0496122_0000284_54022_55350 | 428 |
| 272 | 3300048926 | Ga0496123_0008217 | Ga0496123_0008217_888_2216 | 428 |
| 273 | 3300048927 | Ga0496124_0000015 | Ga0496124_0000015_36959_38287 | 428 |
| 274 | 3300048928 | Ga0496125_0000021 | Ga0496125_0000021_422414_423742 | 428 |
| 275 | 3300048929 | Ga0496126_0000015 | Ga0496126_0000015_422414_423742 | 428 |
| 276 | 3300049571 | Ga0501034_0059693 | Ga0501034_0059693_1723_3042 | 428 |
| 277 | 3300049574 | Ga0501038_0008860 | Ga0501038_0008860_7228_8580 | 428 |
| 278 | 3300049580 | Ga0501046_0077417 | Ga0501046_0077417_182_1534 | 428 |
| 279 | 3300049581 | Ga0501047_0076929 | Ga0501047_0076929_1469_2821 | 428 |
| 280 | 3300049822 | Ga0501035_0044132 | Ga0501035_0044132_2147_3499 | 428 |
| 281 | 3300049824 | Ga0501045_0035134 | Ga0501045_0035134_795_2147 | 428 |
| 282 | 3300050492 | nmdc:mga0yw44_66507_c1 | nmdc:mga0yw44_66507_c1_621_1949 | 428 |
| 283 | 3300050496 | nmdc:mga07m45_62048_c1 | nmdc:mga07m45_62048_c1_234_1553 | 428 |
| 284 | 3300050514 | nmdc:mga08x19_52346_c1 | nmdc:mga08x19_52346_c1_944_2272 | 428 |
| 285 | 3300053077 | Ga0495601_0000602 | Ga0495601_0000602_5548_6897 | 428 |
| 286 | iso_pu_bacteria | 2928142448 | 2928144866 | 428 |
| 287 | 3300006880 | Ga0075429_100144942 | Ga0075429_1001449422 | 429 |
| 288 | 3300044683 | Ga0466965_0024585 | Ga0466965_0024585_682_2004 | 429 |
| 289 | 3300048916 | Ga0496113_0049946 | Ga0496113_0049946_1620_2927 | 429 |
| 290 | 3300048925 | Ga0496122_0017733 | Ga0496122_0017733_1287_2594 | 429 |
| 291 | 3300048929 | Ga0496126_0003990 | Ga0496126_0003990_5979_7286 | 429 |
| 292 | iso_pu_bacteria | 2558860280 | 2559428650 | 429 |
| 293 | iso_pu_bacteria | 2862281513 | 2862286751 | 429 |
| 294 | iso_pu_bacteria | 2919713450 | 2919713859 | 429 |
| 295 | iso_pu_bacteria | 3002998708 | 3003000808 | 429 |
| 296 | 3300005327 | Ga0070658_10000319 | Ga0070658_1000031916 | 430 |
| 297 | 3300005336 | Ga0070680_100000061 | Ga0070680_1000000618 | 430 |
| 298 | 3300005458 | Ga0070681_10001025 | Ga0070681_100010258 | 430 |
| 299 | 3300005530 | Ga0070679_100001551 | Ga0070679_10000155113 | 430 |
| 300 | 3300005937 | Ga0081455_10015911 | Ga0081455_100159116 | 430 |
| 301 | 3300006844 | Ga0075428_100400186 | Ga0075428_1004001861 | 430 |
| 302 | 3300020070 | Ga0206356_11084540 | Ga0206356_110845403 | 430 |
| 303 | 3300020077 | Ga0206351_10970124 | Ga0206351_109701241 | 430 |
| 304 | 3300025909 | Ga0207705_10002002 | Ga0207705_100020023 | 430 |
| 305 | 3300025917 | Ga0207660_10000115 | Ga0207660_1000011518 | 430 |
| 306 | 3300046471 | Ga0495650_0016688 | Ga0495650_0016688_2378_3694 | 430 |
| 307 | 3300050510 | nmdc:mga06r32_172091_c1 | nmdc:mga06r32_172091_c1_813_2120 | 430 |
| 308 | iso_pu_bacteria | 2547132424 | 2548696252 | 430 |
| 309 | iso_pu_bacteria | 2842134933 | 2842138788 | 430 |
| 310 | iso_pu_bacteria | 2866612099 | 2866617239 | 430 |
| 311 | iso_pu_bacteria | 2899370129 | 2899373771 | 430 |
| 312 | iso_pu_bacteria | 2917736166 | 2917741264 | 430 |
| 313 | iso_pu_bacteria | 2956939328 | 2956941385 | 430 |
| 314 | 3300039450 | Ga0436363_1431793 | Ga0436363_1431793_326_1666 | 431 |
| 315 | 3300048918 | Ga0496115_0060345 | Ga0496115_0060345_519_1856 | 431 |
| 316 | iso_pu_bacteria | 2582581312 | 2585299412 | 431 |
| 317 | iso_pu_bacteria | 2643221578 | 2643902794 | 431 |
| 318 | iso_pu_bacteria | 2643221601 | 2644017233 | 431 |
| 319 | iso_pu_bacteria | 2643221631 | 2644173806 | 431 |
| 320 | iso_pu_bacteria | 2643221673 | 2644404697 | 431 |
| 321 | iso_pu_bacteria | 2643221678 | 2644439217 | 431 |
| 322 | iso_pu_bacteria | 2795385470 | 2795781345 | 431 |
| 323 | iso_pu_bacteria | 2808606359 | 2808843222 | 431 |
| 324 | iso_pu_bacteria | 2808606375 | 2808912807 | 431 |
| 325 | iso_pu_bacteria | 2808606375 | 2808921570 | 431 |
| 326 | iso_pu_bacteria | 2808606982 | 2811845203 | 431 |
| 327 | iso_pu_bacteria | 2811994879 | 2812356826 | 431 |
| 328 | iso_pu_bacteria | 2816332139 | 2816505690 | 431 |
| 329 | iso_pu_bacteria | 2862290372 | 2862292202 | 431 |
| 330 | iso_pu_bacteria | 2875391855 | 2875395928 | 431 |
| 331 | iso_pu_bacteria | 2912715099 | 2912718568 | 431 |
| 332 | iso_pu_bacteria | 2929212328 | 2929214389 | 431 |
| 333 | iso_pu_bacteria | 2946045630 | 2946048707 | 431 |
| 334 | iso_pu_bacteria | 2946064051 | 2946069045 | 431 |
| 335 | iso_pu_bacteria | 8025478263 | 8025480867 | 431 |
| 336 | iso_pu_bacteria | 8033684223 | 8033686785 | 431 |
| 337 | iso_pu_bacteria | 8053945823 | 8053948518 | 431 |
| 338 | 3300005471 | Ga0070698_100008833 | Ga0070698_1000088335 | 432 |
| 339 | 3300005539 | Ga0068853_100017068 | Ga0068853_1000170686 | 432 |
| 340 | 3300005937 | Ga0081455_10015182 | Ga0081455_100151827 | 432 |
| 341 | 3300005937 | Ga0081455_10015517 | Ga0081455_100155174 | 432 |
| 342 | 3300005981 | Ga0081538_10022725 | Ga0081538_100227253 | 432 |
| 343 | 3300009147 | Ga0114129_10091266 | Ga0114129_100912663 | 432 |
| 344 | 3300009551 | Ga0105238_10032638 | Ga0105238_100326384 | 432 |
| 345 | 3300013307 | Ga0157372_10466967 | Ga0157372_104669671 | 432 |
| 346 | 3300020069 | Ga0197907_11041682 | Ga0197907_110416822 | 432 |
| 347 | 3300025915 | Ga0207693_10118340 | Ga0207693_101183402 | 432 |
| 348 | 3300025924 | Ga0207694_10023506 | Ga0207694_100235063 | 432 |
| 349 | 3300026041 | Ga0207639_10050377 | Ga0207639_100503772 | 432 |
| 350 | 3300030521 | Ga0307511_10000590 | Ga0307511_1000059025 | 432 |
| 351 | 3300035119 | Ga0373956_0033163 | Ga0373956_0033163_415_1788 | 432 |
| 352 | 3300044656 | Ga0466969_0004118 | Ga0466969_0004118_1512_2834 | 432 |
| 353 | 3300044684 | Ga0466966_0080943 | Ga0466966_0080943_376_1698 | 432 |
| 354 | 3300044693 | Ga0466961_0029146 | Ga0466961_0029146_1767_3089 | 432 |
| 355 | 3300044735 | Ga0466968_0003834 | Ga0466968_0003834_2693_4021 | 432 |
| 356 | 3300045049 | Ga0466959_0099313 | Ga0466959_0099313_209_1531 | 432 |
| 357 | 3300046501 | Ga0495607_0070996 | Ga0495607_0070996_223_1602 | 432 |
| 358 | 3300049581 | Ga0501047_0060268 | Ga0501047_0060268_691_2010 | 432 |
| 359 | 3300049581 | Ga0501047_0071012 | Ga0501047_0071012_877_2223 | 432 |
| 360 | 3300049822 | Ga0501035_0001386 | Ga0501035_0001386_19545_20864 | 432 |
| 361 | 3300049823 | Ga0501044_0001367 | Ga0501044_0001367_22641_23960 | 432 |
| 362 | 3300050507 | nmdc:mga05p37_188068_c1 | nmdc:mga05p37_188068_c1_119_1432 | 432 |
| 363 | iso_pu_bacteria | 2867475112 | 2867479151 | 432 |
| 364 | iso_pu_bacteria | 2883821847 | 2883826516 | 432 |
| 365 | iso_pu_bacteria | 2912723979 | 2912730885 | 432 |
| 366 | iso_pu_bacteria | 3006425503 | 3006427226 | 432 |
| 367 | 3300001990 | JGI24737J22298_10019288 | JGI24737J22298_100192882 | 433 |
| 368 | 3300001991 | JGI24743J22301_10007272 | JGI24743J22301_100072722 | 433 |
| 369 | 3300002073 | JGI24745J21846_1003962 | JGI24745J21846_10039622 | 433 |
| 370 | 3300002075 | JGI24738J21930_10014650 | JGI24738J21930_100146502 | 433 |
| 371 | 3300002077 | JGI24744J21845_10000088 | JGI24744J21845_100000886 | 433 |
| 372 | 3300002244 | JGI24742J22300_10000442 | JGI24742J22300_100004423 | 433 |
| 373 | 3300005329 | Ga0070683_100074305 | Ga0070683_1000743052 | 433 |
| 374 | 3300005330 | Ga0070690_100021350 | Ga0070690_1000213505 | 433 |
| 375 | 3300005334 | Ga0068869_100003836 | Ga0068869_1000038363 | 433 |
| 376 | 3300005335 | Ga0070666_10076122 | Ga0070666_100761222 | 433 |
| 377 | 3300005337 | Ga0070682_100015617 | Ga0070682_1000156172 | 433 |
| 378 | 3300005338 | Ga0068868_100001480 | Ga0068868_10000148010 | 433 |
| 379 | 3300005338 | Ga0068868_100052582 | Ga0068868_1000525823 | 433 |
| 380 | 3300005338 | Ga0068868_100095458 | Ga0068868_1000954582 | 433 |
| 381 | 3300005339 | Ga0070660_100056785 | Ga0070660_1000567853 | 433 |
| 382 | 3300005340 | Ga0070689_100026796 | Ga0070689_1000267962 | 433 |
| 383 | 3300005341 | Ga0070691_10004160 | Ga0070691_100041603 | 433 |
| 384 | 3300005343 | Ga0070687_100010502 | Ga0070687_1000105023 | 433 |
| 385 | 3300005347 | Ga0070668_100001192 | Ga0070668_1000011929 | 433 |
| 386 | 3300005353 | Ga0070669_100022235 | Ga0070669_1000222353 | 433 |
| 387 | 3300005356 | Ga0070674_100000187 | Ga0070674_10000018722 | 433 |
| 388 | 3300005356 | Ga0070674_100123412 | Ga0070674_1001234122 | 433 |
| 389 | 3300005364 | Ga0070673_100245360 | Ga0070673_1002453602 | 433 |
| 390 | 3300005367 | Ga0070667_100003985 | Ga0070667_10000398510 | 433 |
| 391 | 3300005437 | Ga0070710_10000277 | Ga0070710_1000027713 | 433 |
| 392 | 3300005438 | Ga0070701_10000584 | Ga0070701_1000058413 | 433 |
| 393 | 3300005439 | Ga0070711_100000493 | Ga0070711_1000004939 | 433 |
| 394 | 3300005440 | Ga0070705_100004099 | Ga0070705_1000040997 | 433 |
| 395 | 3300005441 | Ga0070700_100003730 | Ga0070700_1000037306 | 433 |
| 396 | 3300005444 | Ga0070694_100024042 | Ga0070694_1000240426 | 433 |
| 397 | 3300005455 | Ga0070663_100065685 | Ga0070663_1000656852 | 433 |
| 398 | 3300005456 | Ga0070678_100000280 | Ga0070678_10000028021 | 433 |
| 399 | 3300005457 | Ga0070662_100001491 | Ga0070662_1000014916 | 433 |
| 400 | 3300005459 | Ga0068867_100002048 | Ga0068867_1000020487 | 433 |
| 401 | 3300005467 | Ga0070706_100021841 | Ga0070706_1000218415 | 433 |
| 402 | 3300005467 | Ga0070706_100028028 | Ga0070706_1000280285 | 433 |
| 403 | 3300005535 | Ga0070684_100088166 | Ga0070684_1000881662 | 433 |
| 404 | 3300005539 | Ga0068853_100001367 | Ga0068853_10000136715 | 433 |
| 405 | 3300005545 | Ga0070695_100021815 | Ga0070695_1000218153 | 433 |
| 406 | 3300005546 | Ga0070696_100002977 | Ga0070696_1000029771 | 433 |
| 407 | 3300005549 | Ga0070704_100001052 | Ga0070704_10000105210 | 433 |
| 408 | 3300005578 | Ga0068854_100000458 | Ga0068854_10000045818 | 433 |
| 409 | 3300005615 | Ga0070702_100000308 | Ga0070702_1000003082 | 433 |
| 410 | 3300005617 | Ga0068859_100064675 | Ga0068859_1000646754 | 433 |
| 411 | 3300005718 | Ga0068866_10000187 | Ga0068866_1000018721 | 433 |
| 412 | 3300005718 | Ga0068866_10066629 | Ga0068866_100666292 | 433 |
| 413 | 3300005719 | Ga0068861_100000195 | Ga0068861_10000019521 | 433 |
| 414 | 3300005842 | Ga0068858_100070309 | Ga0068858_1000703092 | 433 |
| 415 | 3300005843 | Ga0068860_100001932 | Ga0068860_1000019328 | 433 |
| 416 | 3300005844 | Ga0068862_100033018 | Ga0068862_1000330184 | 433 |
| 417 | 3300005985 | Ga0081539_10072764 | Ga0081539_100727642 | 433 |
| 418 | 3300006028 | Ga0070717_10049357 | Ga0070717_100493573 | 433 |
| 419 | 3300006048 | Ga0075363_100040686 | Ga0075363_1000406863 | 433 |
| 420 | 3300006048 | Ga0075363_100058072 | Ga0075363_1000580722 | 433 |
| 421 | 3300006051 | Ga0075364_10001965 | Ga0075364_100019658 | 433 |
| 422 | 3300006051 | Ga0075364_10017939 | Ga0075364_100179395 | 433 |
| 423 | 3300006051 | Ga0075364_10051014 | Ga0075364_100510142 | 433 |
| 424 | 3300006163 | Ga0070715_10005907 | Ga0070715_100059073 | 433 |
| 425 | 3300006173 | Ga0070716_100007171 | Ga0070716_1000071714 | 433 |
| 426 | 3300006175 | Ga0070712_100001061 | Ga0070712_10000106114 | 433 |
| 427 | 3300006177 | Ga0075362_10021385 | Ga0075362_100213853 | 433 |
| 428 | 3300006186 | Ga0075369_10002244 | Ga0075369_100022443 | 433 |
| 429 | 3300006186 | Ga0075369_10046171 | Ga0075369_100461712 | 433 |
| 430 | 3300006353 | Ga0075370_10034607 | Ga0075370_100346073 | 433 |
| 431 | 3300006358 | Ga0068871_100093095 | Ga0068871_1000930952 | 433 |
| 432 | 3300006844 | Ga0075428_100030689 | Ga0075428_1000306896 | 433 |
| 433 | 3300006846 | Ga0075430_100034036 | Ga0075430_1000340362 | 433 |
| 434 | 3300006847 | Ga0075431_100171475 | Ga0075431_1001714752 | 433 |
| 435 | 3300006881 | Ga0068865_100003084 | Ga0068865_1000030842 | 433 |
| 436 | 3300006931 | Ga0097620_100064675 | Ga0097620_1000646754 | 433 |
| 437 | 3300009094 | Ga0111539_10100066 | Ga0111539_101000663 | 433 |
| 438 | 3300009098 | Ga0105245_10000870 | Ga0105245_1000087014 | 433 |
| 439 | 3300009101 | Ga0105247_10000637 | Ga0105247_1000063716 | 433 |
| 440 | 3300009147 | Ga0114129_10185214 | Ga0114129_101852143 | 433 |
| 441 | 3300009148 | Ga0105243_10001020 | Ga0105243_100010209 | 433 |
| 442 | 3300009176 | Ga0105242_10000650 | Ga0105242_1000065013 | 433 |
| 443 | 3300009177 | Ga0105248_10201205 | Ga0105248_102012052 | 433 |
| 444 | 3300009177 | Ga0105248_10238833 | Ga0105248_102388331 | 433 |
| 445 | 3300009553 | Ga0105249_10001186 | Ga0105249_1000118621 | 433 |
| 446 | 3300010375 | Ga0105239_10008819 | Ga0105239_100088199 | 433 |
| 447 | 3300010375 | Ga0105239_10147161 | Ga0105239_101471612 | 433 |
| 448 | 3300011119 | Ga0105246_10083890 | Ga0105246_100838902 | 433 |
| 449 | 3300013296 | Ga0157374_10203151 | Ga0157374_102031512 | 433 |
| 450 | 3300013297 | Ga0157378_10029056 | Ga0157378_100290562 | 433 |
| 451 | 3300013306 | Ga0163162_10001609 | Ga0163162_100016097 | 433 |
| 452 | 3300013307 | Ga0157372_10004145 | Ga0157372_100041459 | 433 |
| 453 | 3300013308 | Ga0157375_10000419 | Ga0157375_1000041923 | 433 |
| 454 | 3300014326 | Ga0157380_10056783 | Ga0157380_100567832 | 433 |
| 455 | 3300015262 | Ga0182007_10006330 | Ga0182007_100063304 | 433 |
| 456 | 3300017792 | Ga0163161_10004818 | Ga0163161_100048184 | 433 |
| 457 | 3300017792 | Ga0163161_10021838 | Ga0163161_100218382 | 433 |
| 458 | 3300017792 | Ga0163161_10025906 | Ga0163161_100259062 | 433 |
| 459 | 3300025898 | Ga0207692_10006547 | Ga0207692_100065476 | 433 |
| 460 | 3300025899 | Ga0207642_10000726 | Ga0207642_1000072615 | 433 |
| 461 | 3300025900 | Ga0207710_10000890 | Ga0207710_1000089010 | 433 |
| 462 | 3300025901 | Ga0207688_10000177 | Ga0207688_100001778 | 433 |
| 463 | 3300025901 | Ga0207688_10001785 | Ga0207688_100017854 | 433 |
| 464 | 3300025903 | Ga0207680_10074674 | Ga0207680_100746742 | 433 |
| 465 | 3300025905 | Ga0207685_10001985 | Ga0207685_100019853 | 433 |
| 466 | 3300025914 | Ga0207671_10038644 | Ga0207671_100386443 | 433 |
| 467 | 3300025915 | Ga0207693_10000339 | Ga0207693_1000033940 | 433 |
| 468 | 3300025918 | Ga0207662_10013813 | Ga0207662_100138135 | 433 |
| 469 | 3300025918 | Ga0207662_10020422 | Ga0207662_100204223 | 433 |
| 470 | 3300025919 | Ga0207657_10129847 | Ga0207657_101298472 | 433 |
| 471 | 3300025920 | Ga0207649_10150627 | Ga0207649_101506272 | 433 |
| 472 | 3300025927 | Ga0207687_10003312 | Ga0207687_100033123 | 433 |
| 473 | 3300025932 | Ga0207690_10022295 | Ga0207690_100222954 | 433 |
| 474 | 3300025933 | Ga0207706_10002589 | Ga0207706_1000258913 | 433 |
| 475 | 3300025934 | Ga0207686_10001637 | Ga0207686_100016379 | 433 |
| 476 | 3300025935 | Ga0207709_10001393 | Ga0207709_100013936 | 433 |
| 477 | 3300025936 | Ga0207670_10142032 | Ga0207670_101420322 | 433 |
| 478 | 3300025937 | Ga0207669_10000205 | Ga0207669_1000020517 | 433 |
| 479 | 3300025938 | Ga0207704_10000618 | Ga0207704_1000061811 | 433 |
| 480 | 3300025939 | Ga0207665_10006357 | Ga0207665_100063578 | 433 |
| 481 | 3300025941 | Ga0207711_10009126 | Ga0207711_100091265 | 433 |
| 482 | 3300025941 | Ga0207711_10125273 | Ga0207711_101252732 | 433 |
| 483 | 3300025944 | Ga0207661_10064146 | Ga0207661_100641463 | 433 |
| 484 | 3300025944 | Ga0207661_10187600 | Ga0207661_101876002 | 433 |
| 485 | 3300025960 | Ga0207651_10209457 | Ga0207651_102094571 | 433 |
| 486 | 3300025961 | Ga0207712_10015171 | Ga0207712_100151713 | 433 |
| 487 | 3300025972 | Ga0207668_10006483 | Ga0207668_100064833 | 433 |
| 488 | 3300025972 | Ga0207668_10011491 | Ga0207668_100114916 | 433 |
| 489 | 3300025981 | Ga0207640_10003652 | Ga0207640_100036524 | 433 |
| 490 | 3300025986 | Ga0207658_10053121 | Ga0207658_100531213 | 433 |
| 491 | 3300026023 | Ga0207677_10011197 | Ga0207677_100111977 | 433 |
| 492 | 3300026023 | Ga0207677_10036316 | Ga0207677_100363162 | 433 |
| 493 | 3300026035 | Ga0207703_10002964 | Ga0207703_1000296412 | 433 |
| 494 | 3300026041 | Ga0207639_10047931 | Ga0207639_100479312 | 433 |
| 495 | 3300026067 | Ga0207678_10037057 | Ga0207678_100370576 | 433 |
| 496 | 3300026067 | Ga0207678_10051777 | Ga0207678_100517772 | 433 |
| 497 | 3300026089 | Ga0207648_10000623 | Ga0207648_1000062336 | 433 |
| 498 | 3300026118 | Ga0207675_100001672 | Ga0207675_10000167210 | 433 |
| 499 | 3300026118 | Ga0207675_100033946 | Ga0207675_1000339463 | 433 |
| 500 | 3300026121 | Ga0207683_10000539 | Ga0207683_1000053910 | 433 |
| 501 | 3300026142 | Ga0207698_10309789 | Ga0207698_103097891 | 433 |
| 502 | 3300028379 | Ga0268266_10106405 | Ga0268266_101064053 | 433 |
| 503 | 3300028380 | Ga0268265_10015530 | Ga0268265_100155307 | 433 |
| 504 | 3300028381 | Ga0268264_10004939 | Ga0268264_1000493916 | 433 |
| 505 | 3300028794 | Ga0307515_10033888 | Ga0307515_100338887 | 433 |
| 506 | 3300030521 | Ga0307511_10002042 | Ga0307511_1000204216 | 433 |
| 507 | 3300030522 | Ga0307512_10006290 | Ga0307512_1000629012 | 433 |
| 508 | 3300031456 | Ga0307513_10007971 | Ga0307513_100079715 | 433 |
| 509 | 3300031507 | Ga0307509_10149351 | Ga0307509_101493512 | 433 |
| 510 | 3300031731 | Ga0307405_10127210 | Ga0307405_101272102 | 433 |
| 511 | 3300031824 | Ga0307413_10018416 | Ga0307413_100184162 | 433 |
| 512 | 3300031852 | Ga0307410_10024255 | Ga0307410_100242551 | 433 |
| 513 | 3300031852 | Ga0307410_10054371 | Ga0307410_100543713 | 433 |
| 514 | 3300035398 | Ga0316574_0061945 | Ga0316574_0061945_974_2311 | 433 |
| 515 | 3300041410 | Ga0439461_0001991 | Ga0439461_0001991_1122_2456 | 433 |
| 516 | 3300041411 | Ga0439466_0004599 | Ga0439466_0004599_2483_3817 | 433 |
| 517 | 3300041413 | Ga0439465_0008298 | Ga0439465_0008298_1915_3255 | 433 |
| 518 | 3300041413 | Ga0439465_0009044 | Ga0439465_0009044_1417_2751 | 433 |
| 519 | 3300041997 | Ga0439431_0005807 | Ga0439431_0005807_123_1457 | 433 |
| 520 | 3300042004 | Ga0439445_0003352 | Ga0439445_0003352_194_1528 | 433 |
| 521 | 3300044694 | Ga0466963_0010639 | Ga0466963_0010639_1336_2643 | 433 |
| 522 | 3300044694 | Ga0466963_0016897 | Ga0466963_0016897_786_2111 | 433 |
| 523 | 3300044694 | Ga0466963_0040311 | Ga0466963_0040311_459_1784 | 433 |
| 524 | 3300044842 | Ga0466957_0012041 | Ga0466957_0012041_3300_4607 | 433 |
| 525 | 3300044901 | Ga0466960_0001775 | Ga0466960_0001775_3990_5315 | 433 |
| 526 | 3300045836 | Ga0466958_0011259 | Ga0466958_0011259_188_1495 | 433 |
| 527 | 3300045836 | Ga0466958_0019285 | Ga0466958_0019285_807_2132 | 433 |
| 528 | 3300045976 | Ga0466967_0001175 | Ga0466967_0001175_8021_9346 | 433 |
| 529 | 3300045976 | Ga0466967_0009226 | Ga0466967_0009226_1201_2526 | 433 |
| 530 | 3300046455 | Ga0495603_0027419 | Ga0495603_0027419_1422_2753 | 433 |
| 531 | 3300047319 | Ga0495674_0055153 | Ga0495674_0055153_448_1779 | 433 |
| 532 | 3300047443 | Ga0495687_003306 | Ga0495687_003306_9066_10403 | 433 |
| 533 | 3300048903 | Ga0496100_0173793 | Ga0496100_0173793_131_1465 | 433 |
| 534 | 3300048904 | Ga0496101_0001394 | Ga0496101_0001394_1726_3060 | 433 |
| 535 | 3300048905 | Ga0496102_0003032 | Ga0496102_0003032_9751_11085 | 433 |
| 536 | 3300048905 | Ga0496102_0089145 | Ga0496102_0089145_1182_2516 | 433 |
| 537 | 3300048905 | Ga0496102_0127161 | Ga0496102_0127161_56_1390 | 433 |
| 538 | 3300048909 | Ga0496106_0000424 | Ga0496106_0000424_13447_14781 | 433 |
| 539 | 3300048910 | Ga0496107_0000079 | Ga0496107_0000079_28549_29883 | 433 |
| 540 | 3300048912 | Ga0496109_0069929 | Ga0496109_0069929_1210_2544 | 433 |
| 541 | 3300048912 | Ga0496109_0075199 | Ga0496109_0075199_1558_2889 | 433 |
| 542 | 3300048913 | Ga0496110_0014056 | Ga0496110_0014056_4547_5881 | 433 |
| 543 | 3300048913 | Ga0496110_0074940 | Ga0496110_0074940_1446_2750 | 433 |
| 544 | 3300048915 | Ga0496112_0004865 | Ga0496112_0004865_3716_5047 | 433 |
| 545 | 3300048915 | Ga0496112_0009854 | Ga0496112_0009854_4788_6122 | 433 |
| 546 | 3300048915 | Ga0496112_0249612 | Ga0496112_0249612_205_1536 | 433 |
| 547 | 3300048917 | Ga0496114_0011013 | Ga0496114_0011013_5074_6408 | 433 |
| 548 | 3300048917 | Ga0496114_0140787 | Ga0496114_0140787_30_1364 | 433 |
| 549 | 3300048918 | Ga0496115_0002425 | Ga0496115_0002425_10780_12114 | 433 |
| 550 | 3300048929 | Ga0496126_0008063 | Ga0496126_0008063_6006_7331 | 433 |
| 551 | 3300049569 | Ga0501032_0011513 | Ga0501032_0011513_496_1821 | 433 |
| 552 | 3300049571 | Ga0501034_0001101 | Ga0501034_0001101_10228_11553 | 433 |
| 553 | 3300049573 | Ga0501037_0003517 | Ga0501037_0003517_9983_11308 | 433 |
| 554 | 3300049576 | Ga0501040_0008828 | Ga0501040_0008828_1128_2462 | 433 |
| 555 | 3300049577 | Ga0501041_0018104 | Ga0501041_0018104_2350_3684 | 433 |
| 556 | 3300049578 | Ga0501042_0118887 | Ga0501042_0118887_550_1884 | 433 |
| 557 | 3300049579 | Ga0501043_0113935 | Ga0501043_0113935_719_2044 | 433 |
| 558 | 3300049580 | Ga0501046_0002722 | Ga0501046_0002722_7567_8892 | 433 |
| 559 | 3300049581 | Ga0501047_0002484 | Ga0501047_0002484_5003_6328 | 433 |
| 560 | 3300049582 | Ga0501048_0002590 | Ga0501048_0002590_2082_3407 | 433 |
| 561 | 3300049586 | Ga0501070_0001682 | Ga0501070_0001682_11437_12762 | 433 |
| 562 | 3300049588 | Ga0501072_0003695 | Ga0501072_0003695_4688_6022 | 433 |
| 563 | 3300049592 | Ga0501076_0073923 | Ga0501076_0073923_410_1744 | 433 |
| 564 | 3300049742 | Ga0501080_0009512 | Ga0501080_0009512_4840_6165 | 433 |
| 565 | 3300049822 | Ga0501035_0001097 | Ga0501035_0001097_2045_3370 | 433 |
| 566 | 3300049822 | Ga0501035_0177973 | Ga0501035_0177973_96_1424 | 433 |
| 567 | 3300049823 | Ga0501044_0004810 | Ga0501044_0004810_1638_2963 | 433 |
| 568 | 3300050489 | nmdc:mga03683_3089_c1 | nmdc:mga03683_3089_c1_2479_3819 | 433 |
| 569 | 3300050491 | nmdc:mga00v17_2947_c1 | nmdc:mga00v17_2947_c1_92_1432 | 433 |
| 570 | 3300050496 | nmdc:mga07m45_34034_c1 | nmdc:mga07m45_34034_c1_658_2001 | 433 |
| 571 | 3300050508 | nmdc:mga09592_115355_c1 | nmdc:mga09592_115355_c1_256_1563 | 433 |
| 572 | 3300050510 | nmdc:mga06r32_162003_c1 | nmdc:mga06r32_162003_c1_378_1712 | 433 |
| 573 | 3300054114 | Ga0501084_0035629 | Ga0501084_0035629_2692_4026 | 433 |
| 574 | 3300061734 | Ga0530510_0051283 | Ga0530510_0051283_522_1856 | 433 |
| 575 | iso_pu_bacteria | 2501939600 | 2501945555 | 433 |
| 576 | iso_pu_bacteria | 2515154088 | 2515497893 | 433 |
| 577 | iso_pu_bacteria | 2515154129 | 2515720789 | 433 |
| 578 | iso_pu_bacteria | 2515154137 | 2515759014 | 433 |
| 579 | iso_pu_bacteria | 2515154155 | 2515852236 | 433 |
| 580 | iso_pu_bacteria | 2515154202 | 2516085727 | 433 |
| 581 | iso_pu_bacteria | 2515154203 | 2516090690 | 433 |
| 582 | iso_pu_bacteria | 2585427649 | 2586064689 | 433 |
| 583 | iso_pu_bacteria | 2622736626 | 2623586153 | 433 |
| 584 | iso_pu_bacteria | 2772190715 | 2772641348 | 433 |
| 585 | iso_pu_bacteria | 2818991472 | 2819741114 | 433 |
| 586 | iso_pu_bacteria | 2831935698 | 2831938277 | 433 |
| 587 | iso_pu_bacteria | 2832004796 | 2832009697 | 433 |
| 588 | iso_pu_bacteria | 2855670206 | 2855676681 | 433 |
| 589 | iso_pu_bacteria | 2855676851 | 2855683271 | 433 |
| 590 | iso_pu_bacteria | 2855683550 | 2855685019 | 433 |
| 591 | iso_pu_bacteria | 2856858025 | 2856860054 | 433 |
| 592 | iso_pu_bacteria | 2857288857 | 2857295018 | 433 |
| 593 | iso_pu_bacteria | 2858848962 | 2858852275 | 433 |
| 594 | iso_pu_bacteria | 2858868258 | 2858868911 | 433 |
| 595 | iso_pu_bacteria | 2858882152 | 2858888208 | 433 |
| 596 | iso_pu_bacteria | 2858888857 | 2858890386 | 433 |
| 597 | iso_pu_bacteria | 2858895516 | 2858898961 | 433 |
| 598 | iso_pu_bacteria | 2858902515 | 2858905233 | 433 |
| 599 | iso_pu_bacteria | 2866065130 | 2866068993 | 433 |
| 600 | iso_pu_bacteria | 2867302475 | 2867304310 | 433 |
| 601 | iso_pu_bacteria | 2867312974 | 2867313640 | 433 |
| 602 | iso_pu_bacteria | 2867319477 | 2867322535 | 433 |
| 603 | iso_pu_bacteria | 2867369537 | 2867373116 | 433 |
| 604 | iso_pu_bacteria | 2867507094 | 2867509696 | 433 |
| 605 | iso_pu_bacteria | 2869048445 | 2869052138 | 433 |
| 606 | iso_pu_bacteria | 2869061728 | 2869061989 | 433 |
| 607 | iso_pu_bacteria | 2869068681 | 2869073967 | 433 |
| 608 | iso_pu_bacteria | 2880495981 | 2880498227 | 433 |
| 609 | iso_pu_bacteria | 2887478801 | 2887483547 | 433 |
| 610 | iso_pu_bacteria | 2902582711 | 2902587479 | 433 |
| 611 | iso_pu_bacteria | 2915768154 | 2915773507 | 433 |
| 612 | iso_pu_bacteria | 2929219909 | 2929220268 | 433 |
| 613 | iso_pu_bacteria | 2929226422 | 2929226803 | 433 |
| 614 | iso_pu_bacteria | 2990088156 | 2990091294 | 433 |
| 615 | iso_pu_bacteria | 2996221748 | 2996226236 | 433 |
| 616 | iso_pu_bacteria | 649633069 | 649810539 | 433 |
| 617 | iso_pu_bacteria | 8003830390 | 8003834810 | 433 |
| 618 | iso_pu_bacteria | 8003856774 | 8003860826 | 433 |
| 619 | iso_pu_bacteria | 8003870546 | 8003875000 | 433 |
| 620 | iso_pu_bacteria | 8054704163 | 8054707202 | 433 |
| 621 | iso_pu_bacteria | 8054727385 | 8054728157 | 433 |
| 622 | iso_pu_bacteria | 8054734606 | 8054736481 | 433 |
| 623 | iso_pu_bacteria | 8055412473 | 8055415592 | 433 |
| 624 | 3300005435 | Ga0070714_100006750 | Ga0070714_1000067503 | 434 |
| 625 | 3300005530 | Ga0070679_100067837 | Ga0070679_1000678373 | 434 |
| 626 | 3300005616 | Ga0068852_100046729 | Ga0068852_1000467292 | 434 |
| 627 | 3300005985 | Ga0081539_10036577 | Ga0081539_100365773 | 434 |
| 628 | 3300006844 | Ga0075428_100311879 | Ga0075428_1003118792 | 434 |
| 629 | 3300006846 | Ga0075430_100067840 | Ga0075430_1000678402 | 434 |
| 630 | 3300021388 | Ga0213875_10002364 | Ga0213875_100023647 | 434 |
| 631 | 3300025918 | Ga0207662_10084502 | Ga0207662_100845022 | 434 |
| 632 | 3300025925 | Ga0207650_10208497 | Ga0207650_102084972 | 434 |
| 633 | 3300025929 | Ga0207664_10003864 | Ga0207664_1000386412 | 434 |
| 634 | 3300025940 | Ga0207691_10123103 | Ga0207691_101231032 | 434 |
| 635 | 3300025942 | Ga0207689_10047196 | Ga0207689_100471963 | 434 |
| 636 | 3300025949 | Ga0207667_10146731 | Ga0207667_101467312 | 434 |
| 637 | 3300026142 | Ga0207698_10014728 | Ga0207698_100147284 | 434 |
| 638 | 3300028794 | Ga0307515_10037382 | Ga0307515_100373827 | 434 |
| 639 | 3300030522 | Ga0307512_10024887 | Ga0307512_100248874 | 434 |
| 640 | 3300031838 | Ga0307518_10004772 | Ga0307518_100047723 | 434 |
| 641 | 3300031901 | Ga0307406_10181694 | Ga0307406_101816942 | 434 |
| 642 | 3300033179 | Ga0307507_10016917 | Ga0307507_100169175 | 434 |
| 643 | 3300033180 | Ga0307510_10116839 | Ga0307510_101168393 | 434 |
| 644 | 3300035207 | Ga0373942_0000196 | Ga0373942_0000196_4237_5553 | 434 |
| 645 | 3300037853 | Ga0436364_0823558 | Ga0436364_0823558_3621_4955 | 434 |
| 646 | 3300039437 | Ga0436365_1908396 | Ga0436365_1908396_6174_7511 | 434 |
| 647 | 3300041512 | Ga0451853_2614358 | Ga0451853_2614358_212_1525 | 434 |
| 648 | 3300044656 | Ga0466969_0049407 | Ga0466969_0049407_216_1532 | 434 |
| 649 | 3300044683 | Ga0466965_0007146 | Ga0466965_0007146_1854_3176 | 434 |
| 650 | 3300044693 | Ga0466961_0002892 | Ga0466961_0002892_399_1715 | 434 |
| 651 | 3300044694 | Ga0466963_0019383 | Ga0466963_0019383_2307_3629 | 434 |
| 652 | 3300044719 | Ga0466971_0003748 | Ga0466971_0003748_769_2091 | 434 |
| 653 | 3300044765 | Ga0466970_0051351 | Ga0466970_0051351_716_2035 | 434 |
| 654 | 3300044842 | Ga0466957_0013266 | Ga0466957_0013266_2541_3863 | 434 |
| 655 | 3300045976 | Ga0466967_0002012 | Ga0466967_0002012_7403_8725 | 434 |
| 656 | 3300045976 | Ga0466967_0055472 | Ga0466967_0055472_975_2321 | 434 |
| 657 | 3300045976 | Ga0466967_0266619 | Ga0466967_0266619_34_1359 | 434 |
| 658 | 3300048917 | Ga0496114_0000286 | Ga0496114_0000286_32925_34319 | 434 |
| 659 | 3300049586 | Ga0501070_0002601 | Ga0501070_0002601_1108_2433 | 434 |
| 660 | 3300050508 | nmdc:mga09592_120387_c1 | nmdc:mga09592_120387_c1_289_1605 | 434 |
| 661 | 3300053136 | Ga0500559_0004201 | Ga0500559_0004201_1405_2748 | 434 |
| 662 | 3300061719 | Ga0466962_0018089 | Ga0466962_0018089_1062_2384 | 434 |
| 663 | iso_pu_bacteria | 2558860112 | 2558912601 | 434 |
| 664 | iso_pu_bacteria | 2675903059 | 2676484056 | 434 |
| 665 | iso_pu_bacteria | 2775506925 | 2776371566 | 434 |
| 666 | iso_pu_bacteria | 2795385472 | 2795791688 | 434 |
| 667 | iso_pu_bacteria | 2808606522 | 2809586083 | 434 |
| 668 | iso_pu_bacteria | 2862705112 | 2862710215 | 434 |
| 669 | iso_pu_bacteria | 2863067949 | 2863070217 | 434 |
| 670 | iso_pu_bacteria | 2866552031 | 2866555677 | 434 |
| 671 | iso_pu_bacteria | 2880489317 | 2880494103 | 434 |
| 672 | iso_pu_bacteria | 8008485437 | 8008490388 | 434 |
| 673 | iso_pu_bacteria | 8025524527 | 8025529690 | 434 |
| 674 | iso_pu_bacteria | 8055157932 | 8055160552 | 434 |
| 675 | 3300002067 | JGI24735J21928_10011371 | JGI24735J21928_100113712 | 435 |
| 676 | 3300005327 | Ga0070658_10010607 | Ga0070658_100106075 | 435 |
| 677 | 3300005618 | Ga0068864_100010645 | Ga0068864_1000106456 | 435 |
| 678 | 3300005841 | Ga0068863_100066840 | Ga0068863_1000668403 | 435 |
| 679 | 3300005842 | Ga0068858_100047379 | Ga0068858_1000473793 | 435 |
| 680 | 3300005843 | Ga0068860_100187925 | Ga0068860_1001879252 | 435 |
| 681 | 3300006844 | Ga0075428_100007051 | Ga0075428_10000705112 | 435 |
| 682 | 3300006844 | Ga0075428_100007414 | Ga0075428_10000741412 | 435 |
| 683 | 3300006846 | Ga0075430_100015607 | Ga0075430_1000156074 | 435 |
| 684 | 3300006846 | Ga0075430_100041690 | Ga0075430_1000416902 | 435 |
| 685 | 3300006847 | Ga0075431_100012865 | Ga0075431_1000128657 | 435 |
| 686 | 3300006847 | Ga0075431_100060345 | Ga0075431_1000603454 | 435 |
| 687 | 3300006880 | Ga0075429_100009820 | Ga0075429_1000098205 | 435 |
| 688 | 3300006880 | Ga0075429_100016282 | Ga0075429_1000162825 | 435 |
| 689 | 3300009011 | Ga0105251_10030178 | Ga0105251_100301782 | 435 |
| 690 | 3300009092 | Ga0105250_10018756 | Ga0105250_100187562 | 435 |
| 691 | 3300009147 | Ga0114129_10000852 | Ga0114129_100008524 | 435 |
| 692 | 3300009177 | Ga0105248_10039835 | Ga0105248_100398354 | 435 |
| 693 | 3300014325 | Ga0163163_10008079 | Ga0163163_100080794 | 435 |
| 694 | 3300015688 | Ga0183367_1002 | Ga0183367_1002881 | 435 |
| 695 | 3300025735 | Ga0207713_1047252 | Ga0207713_10472522 | 435 |
| 696 | 3300025909 | Ga0207705_10014666 | Ga0207705_100146666 | 435 |
| 697 | 3300025915 | Ga0207693_10067864 | Ga0207693_100678642 | 435 |
| 698 | 3300025927 | Ga0207687_10077886 | Ga0207687_100778862 | 435 |
| 699 | 3300026035 | Ga0207703_10061458 | Ga0207703_100614582 | 435 |
| 700 | 3300026088 | Ga0207641_10013167 | Ga0207641_100131673 | 435 |
| 701 | 3300026121 | Ga0207683_10055797 | Ga0207683_100557973 | 435 |
| 702 | 3300031456 | Ga0307513_10009861 | Ga0307513_100098618 | 435 |
| 703 | 3300031548 | Ga0307408_100189282 | Ga0307408_1001892822 | 435 |
| 704 | 3300031649 | Ga0307514_10006847 | Ga0307514_100068476 | 435 |
| 705 | 3300031824 | Ga0307413_10000862 | Ga0307413_100008624 | 435 |
| 706 | 3300031852 | Ga0307410_10096536 | Ga0307410_100965362 | 435 |
| 707 | 3300031901 | Ga0307406_10082326 | Ga0307406_100823262 | 435 |
| 708 | 3300032002 | Ga0307416_100006145 | Ga0307416_1000061454 | 435 |
| 709 | 3300032004 | Ga0307414_10106356 | Ga0307414_101063562 | 435 |
| 710 | 3300033180 | Ga0307510_10055624 | Ga0307510_100556243 | 435 |
| 711 | 3300035117 | Ga0373953_0002560 | Ga0373953_0002560_895_2214 | 435 |
| 712 | 3300035398 | Ga0316574_0058180 | Ga0316574_0058180_457_1833 | 435 |
| 713 | 3300036401 | Ga0373937_0086281 | Ga0373937_0086281_1129_2448 | 435 |
| 714 | 3300036712 | Ga0316584_0000281 | Ga0316584_0000281_821_2197 | 435 |
| 715 | 3300037312 | Ga0395899_0053281 | Ga0395899_0053281_1295_2614 | 435 |
| 716 | 3300037418 | Ga0395900_0008791 | Ga0395900_0008791_5080_6399 | 435 |
| 717 | 3300037466 | Ga0395898_0011400 | Ga0395898_0011400_4905_6224 | 435 |
| 718 | 3300037466 | Ga0395898_0136410 | Ga0395898_0136410_907_2229 | 435 |
| 719 | 3300037471 | Ga0395905_0023889 | Ga0395905_0023889_201_1520 | 435 |
| 720 | 3300038443 | Ga0395901_0033677 | Ga0395901_0033677_1745_3064 | 435 |
| 721 | 3300041404 | Ga0439436_0000647 | Ga0439436_0000647_6463_7785 | 435 |
| 722 | 3300041406 | Ga0439439_0010546 | Ga0439439_0010546_153_1475 | 435 |
| 723 | 3300041999 | Ga0439433_0001382 | Ga0439433_0001382_2952_4274 | 435 |
| 724 | 3300042014 | Ga0439457_000479 | Ga0439457_000479_129_1451 | 435 |
| 725 | 3300044694 | Ga0466963_0032161 | Ga0466963_0032161_402_1712 | 435 |
| 726 | 3300046459 | Ga0495629_0032233 | Ga0495629_0032233_125_1447 | 435 |
| 727 | 3300046459 | Ga0495629_0122824 | Ga0495629_0122824_337_1653 | 435 |
| 728 | 3300046499 | Ga0495594_0045170 | Ga0495594_0045170_16_1332 | 435 |
| 729 | 3300046684 | Ga0495669_0019460 | Ga0495669_0019460_266_1573 | 435 |
| 730 | 3300046689 | Ga0495613_0003081 | Ga0495613_0003081_4460_5782 | 435 |
| 731 | 3300047318 | Ga0495636_0021632 | Ga0495636_0021632_1220_2542 | 435 |
| 732 | 3300048909 | Ga0496106_0008649 | Ga0496106_0008649_1180_2556 | 435 |
| 733 | 3300048913 | Ga0496110_0011646 | Ga0496110_0011646_68_1384 | 435 |
| 734 | 3300048914 | Ga0496111_0000575 | Ga0496111_0000575_53_1369 | 435 |
| 735 | 3300050507 | nmdc:mga05p37_160331_c1 | nmdc:mga05p37_160331_c1_265_1584 | 435 |
| 736 | 3300050507 | nmdc:mga05p37_2735_c1 | nmdc:mga05p37_2735_c1_17386_18699 | 435 |
| 737 | 3300050508 | nmdc:mga09592_16095_c1 | nmdc:mga09592_16095_c1_555_1874 | 435 |
| 738 | 3300050508 | nmdc:mga09592_87_c3 | nmdc:mga09592_87_c3_1969_3282 | 435 |
| 739 | 3300050509 | nmdc:mga0qj67_509_c1 | nmdc:mga0qj67_509_c1_1849_3162 | 435 |
| 740 | 3300050510 | nmdc:mga06r32_1913_c1 | nmdc:mga06r32_1913_c1_15384_16697 | 435 |
| 741 | 3300053085 | Ga0495619_0054104 | Ga0495619_0054104_154_1473 | 435 |
| 742 | 3300053090 | Ga0500646_0000357 | Ga0500646_0000357_8804_10120 | 435 |
| 743 | 3300053090 | Ga0500646_0029241 | Ga0500646_0029241_145_1461 | 435 |
| 744 | 3300053092 | Ga0500583_0003525 | Ga0500583_0003525_2575_3891 | 435 |
| 745 | 3300053146 | Ga0500588_0004867 | Ga0500588_0004867_842_2158 | 435 |
| 746 | iso_pu_bacteria | 2767802112 | 2768643398 | 435 |
| 747 | iso_pu_bacteria | 2867346516 | 2867351643 | 435 |
| 748 | iso_pu_bacteria | 2870782633 | 2870788453 | 435 |
| 749 | iso_pu_bacteria | 8001781756 | 8001789401 | 435 |
| 750 | iso_pu_bacteria | 8054472261 | 8054473473 | 435 |
| 751 | iso_pu_bacteria | 8056054917 | 8056060064 | 435 |
| 752 | iso_pu_bacteria | 8056207758 | 8056212431 | 435 |
| 753 | 3300003203 | JGI25406J46586_10001934 | JGI25406J46586_100019349 | 436 |
| 754 | 3300003354 | JGI25160J50197_1021813 | JGI25160J50197_10218132 | 436 |
| 755 | 3300005329 | Ga0070683_100025549 | Ga0070683_1000255495 | 436 |
| 756 | 3300005329 | Ga0070683_100151142 | Ga0070683_1001511422 | 436 |
| 757 | 3300005331 | Ga0070670_100065296 | Ga0070670_1000652963 | 436 |
| 758 | 3300005334 | Ga0068869_100015543 | Ga0068869_1000155434 | 436 |
| 759 | 3300005334 | Ga0068869_100041488 | Ga0068869_1000414883 | 436 |
| 760 | 3300005337 | Ga0070682_100024558 | Ga0070682_1000245581 | 436 |
| 761 | 3300005338 | Ga0068868_100016132 | Ga0068868_1000161322 | 436 |
| 762 | 3300005347 | Ga0070668_100046862 | Ga0070668_1000468623 | 436 |
| 763 | 3300005354 | Ga0070675_100000392 | Ga0070675_10000039223 | 436 |
| 764 | 3300005355 | Ga0070671_100001259 | Ga0070671_10000125911 | 436 |
| 765 | 3300005366 | Ga0070659_100107419 | Ga0070659_1001074192 | 436 |
| 766 | 3300005367 | Ga0070667_100012230 | Ga0070667_1000122304 | 436 |
| 767 | 3300005435 | Ga0070714_100000011 | Ga0070714_10000001166 | 436 |
| 768 | 3300005435 | Ga0070714_100110626 | Ga0070714_1001106262 | 436 |
| 769 | 3300005436 | Ga0070713_100152745 | Ga0070713_1001527452 | 436 |
| 770 | 3300005441 | Ga0070700_100000046 | Ga0070700_10000004639 | 436 |
| 771 | 3300005441 | Ga0070700_100026657 | Ga0070700_1000266572 | 436 |
| 772 | 3300005456 | Ga0070678_100059459 | Ga0070678_1000594592 | 436 |
| 773 | 3300005545 | Ga0070695_100036124 | Ga0070695_1000361243 | 436 |
| 774 | 3300005546 | Ga0070696_100030003 | Ga0070696_1000300033 | 436 |
| 775 | 3300005548 | Ga0070665_100001617 | Ga0070665_10000161726 | 436 |
| 776 | 3300005548 | Ga0070665_100056517 | Ga0070665_1000565171 | 436 |
| 777 | 3300005548 | Ga0070665_100075774 | Ga0070665_1000757744 | 436 |
| 778 | 3300005549 | Ga0070704_100129626 | Ga0070704_1001296262 | 436 |
| 779 | 3300005563 | Ga0068855_100010555 | Ga0068855_1000105556 | 436 |
| 780 | 3300005563 | Ga0068855_100050888 | Ga0068855_1000508883 | 436 |
| 781 | 3300005564 | Ga0070664_100020153 | Ga0070664_1000201536 | 436 |
| 782 | 3300005614 | Ga0068856_100068491 | Ga0068856_1000684913 | 436 |
| 783 | 3300005614 | Ga0068856_100093039 | Ga0068856_1000930392 | 436 |
| 784 | 3300005616 | Ga0068852_100020000 | Ga0068852_1000200004 | 436 |
| 785 | 3300005841 | Ga0068863_100000345 | Ga0068863_1000003453 | 436 |
| 786 | 3300005841 | Ga0068863_100014417 | Ga0068863_1000144175 | 436 |
| 787 | 3300005841 | Ga0068863_100076174 | Ga0068863_1000761742 | 436 |
| 788 | 3300005843 | Ga0068860_100000054 | Ga0068860_100000054182 | 436 |
| 789 | 3300005843 | Ga0068860_100122269 | Ga0068860_1001222692 | 436 |
| 790 | 3300005843 | Ga0068860_100184455 | Ga0068860_1001844552 | 436 |
| 791 | 3300005844 | Ga0068862_100036238 | Ga0068862_1000362383 | 436 |
| 792 | 3300005937 | Ga0081455_10000262 | Ga0081455_1000026256 | 436 |
| 793 | 3300005937 | Ga0081455_10001346 | Ga0081455_1000134615 | 436 |
| 794 | 3300005937 | Ga0081455_10015517 | Ga0081455_100155173 | 436 |
| 795 | 3300005983 | Ga0081540_1002205 | Ga0081540_10022058 | 436 |
| 796 | 3300005983 | Ga0081540_1015235 | Ga0081540_10152354 | 436 |
| 797 | 3300005985 | Ga0081539_10000086 | Ga0081539_10000086166 | 436 |
| 798 | 3300006048 | Ga0075363_100019672 | Ga0075363_1000196723 | 436 |
| 799 | 3300006175 | Ga0070712_100009444 | Ga0070712_1000094444 | 436 |
| 800 | 3300006846 | Ga0075430_100007092 | Ga0075430_1000070925 | 436 |
| 801 | 3300006847 | Ga0075431_100056189 | Ga0075431_1000561894 | 436 |
| 802 | 3300006871 | Ga0075434_100291348 | Ga0075434_1002913481 | 436 |
| 803 | 3300006881 | Ga0068865_100053951 | Ga0068865_1000539513 | 436 |
| 804 | 3300009093 | Ga0105240_10003639 | Ga0105240_1000363915 | 436 |
| 805 | 3300009093 | Ga0105240_10194704 | Ga0105240_101947042 | 436 |
| 806 | 3300009094 | Ga0111539_10002724 | Ga0111539_100027244 | 436 |
| 807 | 3300009098 | Ga0105245_10005605 | Ga0105245_100056053 | 436 |
| 808 | 3300009101 | Ga0105247_10000038 | Ga0105247_10000038120 | 436 |
| 809 | 3300009101 | Ga0105247_10009210 | Ga0105247_100092104 | 436 |
| 810 | 3300009174 | Ga0105241_10025845 | Ga0105241_100258454 | 436 |
| 811 | 3300009176 | Ga0105242_10103959 | Ga0105242_101039593 | 436 |
| 812 | 3300009177 | Ga0105248_10045424 | Ga0105248_100454243 | 436 |
| 813 | 3300009177 | Ga0105248_10134247 | Ga0105248_101342472 | 436 |
| 814 | 3300009545 | Ga0105237_10014748 | Ga0105237_100147486 | 436 |
| 815 | 3300010375 | Ga0105239_10323128 | Ga0105239_103231282 | 436 |
| 816 | 3300011119 | Ga0105246_10062558 | Ga0105246_100625583 | 436 |
| 817 | 3300013104 | Ga0157370_10014109 | Ga0157370_100141096 | 436 |
| 818 | 3300013104 | Ga0157370_10016416 | Ga0157370_100164162 | 436 |
| 819 | 3300013105 | Ga0157369_10048565 | Ga0157369_100485654 | 436 |
| 820 | 3300013105 | Ga0157369_10065749 | Ga0157369_100657493 | 436 |
| 821 | 3300013307 | Ga0157372_10000069 | Ga0157372_100000699 | 436 |
| 822 | 3300013308 | Ga0157375_10097169 | Ga0157375_100971693 | 436 |
| 823 | 3300014325 | Ga0163163_10095860 | Ga0163163_100958603 | 436 |
| 824 | 3300014326 | Ga0157380_10162506 | Ga0157380_101625061 | 436 |
| 825 | 3300014745 | Ga0157377_10003983 | Ga0157377_100039837 | 436 |
| 826 | 3300014968 | Ga0157379_10008843 | Ga0157379_100088432 | 436 |
| 827 | 3300014968 | Ga0157379_10045149 | Ga0157379_100451492 | 436 |
| 828 | 3300020069 | Ga0197907_10824310 | Ga0197907_108243102 | 436 |
| 829 | 3300020610 | Ga0154015_1539966 | Ga0154015_15399662 | 436 |
| 830 | 3300021388 | Ga0213875_10017198 | Ga0213875_100171983 | 436 |
| 831 | 3300022467 | Ga0224712_10008703 | Ga0224712_100087032 | 436 |
| 832 | 3300025297 | Ga0209758_1005072 | Ga0209758_100507211 | 436 |
| 833 | 3300025302 | Ga0207426_1002674 | Ga0207426_10026748 | 436 |
| 834 | 3300025302 | Ga0207426_1004723 | Ga0207426_10047237 | 436 |
| 835 | 3300025900 | Ga0207710_10000017 | Ga0207710_1000001759 | 436 |
| 836 | 3300025900 | Ga0207710_10017562 | Ga0207710_100175624 | 436 |
| 837 | 3300025901 | Ga0207688_10000985 | Ga0207688_100009855 | 436 |
| 838 | 3300025903 | Ga0207680_10019714 | Ga0207680_100197143 | 436 |
| 839 | 3300025904 | Ga0207647_10041404 | Ga0207647_100414043 | 436 |
| 840 | 3300025906 | Ga0207699_10071370 | Ga0207699_100713702 | 436 |
| 841 | 3300025913 | Ga0207695_10017340 | Ga0207695_100173403 | 436 |
| 842 | 3300025915 | Ga0207693_10001185 | Ga0207693_1000118511 | 436 |
| 843 | 3300025916 | Ga0207663_10035253 | Ga0207663_100352533 | 436 |
| 844 | 3300025919 | Ga0207657_10062164 | Ga0207657_100621642 | 436 |
| 845 | 3300025925 | Ga0207650_10077853 | Ga0207650_100778532 | 436 |
| 846 | 3300025926 | Ga0207659_10014966 | Ga0207659_100149665 | 436 |
| 847 | 3300025927 | Ga0207687_10034677 | Ga0207687_100346772 | 436 |
| 848 | 3300025928 | Ga0207700_10124281 | Ga0207700_101242812 | 436 |
| 849 | 3300025929 | Ga0207664_10000001 | Ga0207664_10000001444 | 436 |
| 850 | 3300025929 | Ga0207664_10044386 | Ga0207664_100443863 | 436 |
| 851 | 3300025931 | Ga0207644_10000976 | Ga0207644_1000097611 | 436 |
| 852 | 3300025933 | Ga0207706_10007779 | Ga0207706_100077794 | 436 |
| 853 | 3300025938 | Ga0207704_10107026 | Ga0207704_101070262 | 436 |
| 854 | 3300025939 | Ga0207665_10009000 | Ga0207665_100090002 | 436 |
| 855 | 3300025941 | Ga0207711_10006606 | Ga0207711_100066063 | 436 |
| 856 | 3300025941 | Ga0207711_10016330 | Ga0207711_100163304 | 436 |
| 857 | 3300025942 | Ga0207689_10071434 | Ga0207689_100714343 | 436 |
| 858 | 3300025944 | Ga0207661_10026607 | Ga0207661_100266073 | 436 |
| 859 | 3300025944 | Ga0207661_10076749 | Ga0207661_100767492 | 436 |
| 860 | 3300025945 | Ga0207679_10006663 | Ga0207679_100066634 | 436 |
| 861 | 3300025945 | Ga0207679_10260636 | Ga0207679_102606362 | 436 |
| 862 | 3300025949 | Ga0207667_10009549 | Ga0207667_100095496 | 436 |
| 863 | 3300025949 | Ga0207667_10027730 | Ga0207667_100277304 | 436 |
| 864 | 3300025961 | Ga0207712_10210514 | Ga0207712_102105141 | 436 |
| 865 | 3300025981 | Ga0207640_10068543 | Ga0207640_100685433 | 436 |
| 866 | 3300025986 | Ga0207658_10076757 | Ga0207658_100767572 | 436 |
| 867 | 3300026023 | Ga0207677_10038832 | Ga0207677_100388323 | 436 |
| 868 | 3300026023 | Ga0207677_10043595 | Ga0207677_100435953 | 436 |
| 869 | 3300026067 | Ga0207678_10008815 | Ga0207678_100088153 | 436 |
| 870 | 3300026075 | Ga0207708_10000002 | Ga0207708_1000000256 | 436 |
| 871 | 3300026078 | Ga0207702_10009828 | Ga0207702_100098287 | 436 |
| 872 | 3300026088 | Ga0207641_10001703 | Ga0207641_1000170310 | 436 |
| 873 | 3300026088 | Ga0207641_10057479 | Ga0207641_100574793 | 436 |
| 874 | 3300026088 | Ga0207641_10237589 | Ga0207641_102375892 | 436 |
| 875 | 3300026116 | Ga0207674_10015850 | Ga0207674_100158506 | 436 |
| 876 | 3300026118 | Ga0207675_100115421 | Ga0207675_1001154212 | 436 |
| 877 | 3300026121 | Ga0207683_10001164 | Ga0207683_1000116410 | 436 |
| 878 | 3300027907 | Ga0207428_10030910 | Ga0207428_100309101 | 436 |
| 879 | 3300028379 | Ga0268266_10014863 | Ga0268266_100148636 | 436 |
| 880 | 3300028379 | Ga0268266_10146164 | Ga0268266_101461642 | 436 |
| 881 | 3300028380 | Ga0268265_10036439 | Ga0268265_100364392 | 436 |
| 882 | 3300028381 | Ga0268264_10000097 | Ga0268264_1000009745 | 436 |
| 883 | 3300028381 | Ga0268264_10091589 | Ga0268264_100915893 | 436 |
| 884 | 3300031727 | Ga0316576_10004023 | Ga0316576_100040238 | 436 |
| 885 | 3300031727 | Ga0316576_10017633 | Ga0316576_100176333 | 436 |
| 886 | 3300031727 | Ga0316576_10114347 | Ga0316576_101143472 | 436 |
| 887 | 3300031728 | Ga0316578_10069683 | Ga0316578_100696831 | 436 |
| 888 | 3300031731 | Ga0307405_10000804 | Ga0307405_100008049 | 436 |
| 889 | 3300031731 | Ga0307405_10024124 | Ga0307405_100241243 | 436 |
| 890 | 3300031824 | Ga0307413_10034067 | Ga0307413_100340672 | 436 |
| 891 | 3300031824 | Ga0307413_10160841 | Ga0307413_101608411 | 436 |
| 892 | 3300031901 | Ga0307406_10075140 | Ga0307406_100751401 | 436 |
| 893 | 3300031901 | Ga0307406_10131537 | Ga0307406_101315372 | 436 |
| 894 | 3300031903 | Ga0307407_10002514 | Ga0307407_100025144 | 436 |
| 895 | 3300031995 | Ga0307409_100000409 | Ga0307409_10000040922 | 436 |
| 896 | 3300031995 | Ga0307409_100012688 | Ga0307409_1000126882 | 436 |
| 897 | 3300032002 | Ga0307416_100007073 | Ga0307416_1000070732 | 436 |
| 898 | 3300032126 | Ga0307415_100000021 | Ga0307415_1000000215 | 436 |
| 899 | 3300032126 | Ga0307415_100003770 | Ga0307415_1000037703 | 436 |
| 900 | 3300032126 | Ga0307415_100004822 | Ga0307415_1000048225 | 436 |
| 901 | 3300032126 | Ga0307415_100052948 | Ga0307415_1000529482 | 436 |
| 902 | 3300032139 | Ga0316580_10019075 | Ga0316580_100190752 | 436 |
| 903 | 3300034820 | Ga0373959_0014790 | Ga0373959_0014790_90_1406 | 436 |
| 904 | 3300035207 | Ga0373942_0012372 | Ga0373942_0012372_224_1540 | 436 |
| 905 | 3300035691 | Ga0373931_0048658 | Ga0373931_0048658_96_1412 | 436 |
| 906 | 3300036647 | Ga0316582_0097304 | Ga0316582_0097304_248_1636 | 436 |
| 907 | 3300036712 | Ga0316584_0102955 | Ga0316584_0102955_445_1833 | 436 |
| 908 | 3300037418 | Ga0395900_0182565 | Ga0395900_0182565_780_2111 | 436 |
| 909 | 3300037466 | Ga0395898_0119080 | Ga0395898_0119080_65_1396 | 436 |
| 910 | 3300037853 | Ga0436364_0696641 | Ga0436364_0696641_1539_2885 | 436 |
| 911 | 3300042131 | Ga0450894_000878 | Ga0450894_000878_138_1478 | 436 |
| 912 | 3300042135 | Ga0450899_000129 | Ga0450899_000129_4631_5971 | 436 |
| 913 | 3300042876 | Ga0451577_0066941 | Ga0451577_0066941_815_2158 | 436 |
| 914 | 3300044658 | Ga0466972_0039438 | Ga0466972_0039438_697_2049 | 436 |
| 915 | 3300044658 | Ga0466972_0057374 | Ga0466972_0057374_357_1676 | 436 |
| 916 | 3300044683 | Ga0466965_0026949 | Ga0466965_0026949_747_2099 | 436 |
| 917 | 3300044684 | Ga0466966_0006474 | Ga0466966_0006474_4876_6204 | 436 |
| 918 | 3300044693 | Ga0466961_0024210 | Ga0466961_0024210_1330_2655 | 436 |
| 919 | 3300044694 | Ga0466963_0003573 | Ga0466963_0003573_4002_5330 | 436 |
| 920 | 3300044694 | Ga0466963_0074602 | Ga0466963_0074602_636_1964 | 436 |
| 921 | 3300044735 | Ga0466968_0061106 | Ga0466968_0061106_100_1425 | 436 |
| 922 | 3300044765 | Ga0466970_0022106 | Ga0466970_0022106_1678_3003 | 436 |
| 923 | 3300044765 | Ga0466970_0032443 | Ga0466970_0032443_1229_2581 | 436 |
| 924 | 3300044901 | Ga0466960_0001139 | Ga0466960_0001139_7948_9288 | 436 |
| 925 | 3300044901 | Ga0466960_0007316 | Ga0466960_0007316_830_2170 | 436 |
| 926 | 3300045049 | Ga0466959_0018130 | Ga0466959_0018130_337_1662 | 436 |
| 927 | 3300045836 | Ga0466958_0009782 | Ga0466958_0009782_2960_4285 | 436 |
| 928 | 3300045836 | Ga0466958_0034449 | Ga0466958_0034449_55_1374 | 436 |
| 929 | 3300045976 | Ga0466967_0001407 | Ga0466967_0001407_6671_7999 | 436 |
| 930 | 3300045976 | Ga0466967_0002261 | Ga0466967_0002261_8518_9837 | 436 |
| 931 | 3300045976 | Ga0466967_0005637 | Ga0466967_0005637_7077_8405 | 436 |
| 932 | 3300045976 | Ga0466967_0017233 | Ga0466967_0017233_3603_4931 | 436 |
| 933 | 3300045976 | Ga0466967_0102881 | Ga0466967_0102881_1108_2433 | 436 |
| 934 | 3300046453 | Ga0495627_008543 | Ga0495627_008543_1604_2947 | 436 |
| 935 | 3300046455 | Ga0495603_0014289 | Ga0495603_0014289_1492_2835 | 436 |
| 936 | 3300046459 | Ga0495629_0075214 | Ga0495629_0075214_141_1475 | 436 |
| 937 | 3300046492 | Ga0495585_0017360 | Ga0495585_0017360_2099_3442 | 436 |
| 938 | 3300046499 | Ga0495594_0001342 | Ga0495594_0001342_5021_6364 | 436 |
| 939 | 3300046501 | Ga0495607_0027985 | Ga0495607_0027985_1422_2765 | 436 |
| 940 | 3300046506 | Ga0495583_0014310 | Ga0495583_0014310_688_2031 | 436 |
| 941 | 3300046507 | Ga0495606_0021271 | Ga0495606_0021271_2444_3787 | 436 |
| 942 | 3300046513 | Ga0495616_0004473 | Ga0495616_0004473_5239_6582 | 436 |
| 943 | 3300046515 | Ga0495620_0070009 | Ga0495620_0070009_68_1411 | 436 |
| 944 | 3300046518 | Ga0495631_0003096 | Ga0495631_0003096_3459_4802 | 436 |
| 945 | 3300046520 | Ga0495637_0015812 | Ga0495637_0015812_1196_2539 | 436 |
| 946 | 3300046530 | Ga0495654_0032188 | Ga0495654_0032188_1095_2438 | 436 |
| 947 | 3300046538 | Ga0495609_0007988 | Ga0495609_0007988_1567_2910 | 436 |
| 948 | 3300046542 | Ga0495597_0028324 | Ga0495597_0028324_1195_2538 | 436 |
| 949 | 3300046557 | Ga0495622_0006694 | Ga0495622_0006694_3455_4798 | 436 |
| 950 | 3300046616 | Ga0495668_0064041 | Ga0495668_0064041_312_1655 | 436 |
| 951 | 3300046648 | Ga0495611_0030633 | Ga0495611_0030633_99_1442 | 436 |
| 952 | 3300046660 | Ga0495625_0044373 | Ga0495625_0044373_1197_2540 | 436 |
| 953 | 3300046665 | Ga0495661_0007473 | Ga0495661_0007473_531_1874 | 436 |
| 954 | 3300046794 | Ga0495589_0068244 | Ga0495589_0068244_370_1713 | 436 |
| 955 | 3300046810 | Ga0495660_0055775 | Ga0495660_0055775_727_2070 | 436 |
| 956 | 3300047321 | Ga0495676_0028819 | Ga0495676_0028819_1470_2813 | 436 |
| 957 | 3300047443 | Ga0495687_001147 | Ga0495687_001147_9323_10666 | 436 |
| 958 | 3300047443 | Ga0495687_024126 | Ga0495687_024126_679_2022 | 436 |
| 959 | 3300047447 | Ga0495685_008578 | Ga0495685_008578_1084_2427 | 436 |
| 960 | 3300047472 | Ga0495686_0042822 | Ga0495686_0042822_1357_2700 | 436 |
| 961 | 3300048091 | Ga0495626_0007219 | Ga0495626_0007219_260_1603 | 436 |
| 962 | 3300048903 | Ga0496100_0015097 | Ga0496100_0015097_312_1640 | 436 |
| 963 | 3300048903 | Ga0496100_0065715 | Ga0496100_0065715_723_2039 | 436 |
| 964 | 3300048904 | Ga0496101_0045811 | Ga0496101_0045811_1165_2493 | 436 |
| 965 | 3300048905 | Ga0496102_0000013 | Ga0496102_0000013_10259_11581 | 436 |
| 966 | 3300048905 | Ga0496102_0000048 | Ga0496102_0000048_44442_45770 | 436 |
| 967 | 3300048905 | Ga0496102_0000175 | Ga0496102_0000175_15422_16735 | 436 |
| 968 | 3300048905 | Ga0496102_0073478 | Ga0496102_0073478_1147_2463 | 436 |
| 969 | 3300048906 | Ga0496103_0000018 | Ga0496103_0000018_70313_71641 | 436 |
| 970 | 3300048906 | Ga0496103_0000039 | Ga0496103_0000039_83786_85108 | 436 |
| 971 | 3300048907 | Ga0496104_0007024 | Ga0496104_0007024_1644_2960 | 436 |
| 972 | 3300048908 | Ga0496105_0012606 | Ga0496105_0012606_3585_4913 | 436 |
| 973 | 3300048908 | Ga0496105_0024253 | Ga0496105_0024253_1634_2950 | 436 |
| 974 | 3300048908 | Ga0496105_0092674 | Ga0496105_0092674_750_2066 | 436 |
| 975 | 3300048911 | Ga0496108_0003817 | Ga0496108_0003817_7966_9282 | 436 |
| 976 | 3300048912 | Ga0496109_0004668 | Ga0496109_0004668_8692_10020 | 436 |
| 977 | 3300048912 | Ga0496109_0008285 | Ga0496109_0008285_4019_5335 | 436 |
| 978 | 3300048912 | Ga0496109_0012040 | Ga0496109_0012040_3817_5133 | 436 |
| 979 | 3300048912 | Ga0496109_0015418 | Ga0496109_0015418_3624_4943 | 436 |
| 980 | 3300048913 | Ga0496110_0004660 | Ga0496110_0004660_2012_3340 | 436 |
| 981 | 3300048913 | Ga0496110_0026145 | Ga0496110_0026145_851_2179 | 436 |
| 982 | 3300048914 | Ga0496111_0028049 | Ga0496111_0028049_1605_2921 | 436 |
| 983 | 3300048914 | Ga0496111_0037721 | Ga0496111_0037721_947_2275 | 436 |
| 984 | 3300048916 | Ga0496113_0115480 | Ga0496113_0115480_130_1458 | 436 |
| 985 | 3300048917 | Ga0496114_0027001 | Ga0496114_0027001_3159_4565 | 436 |
| 986 | 3300048917 | Ga0496114_0072131 | Ga0496114_0072131_1278_2594 | 436 |
| 987 | 3300048918 | Ga0496115_0002960 | Ga0496115_0002960_1010_2326 | 436 |
| 988 | 3300048919 | Ga0496116_0000173 | Ga0496116_0000173_114898_116226 | 436 |
| 989 | 3300048920 | Ga0496117_0000144 | Ga0496117_0000144_47355_48683 | 436 |
| 990 | 3300048921 | Ga0496118_0000466 | Ga0496118_0000466_13929_15257 | 436 |
| 991 | 3300048922 | Ga0496119_0000449 | Ga0496119_0000449_21151_22470 | 436 |
| 992 | 3300048922 | Ga0496119_0001560 | Ga0496119_0001560_3297_4625 | 436 |
| 993 | 3300048922 | Ga0496119_0002247 | Ga0496119_0002247_1077_2429 | 436 |
| 994 | 3300048923 | Ga0496120_0000663 | Ga0496120_0000663_43169_44521 | 436 |
| 995 | 3300048923 | Ga0496120_0002291 | Ga0496120_0002291_15119_16447 | 436 |
| 996 | 3300048923 | Ga0496120_0012354 | Ga0496120_0012354_3739_5058 | 436 |
| 997 | 3300048924 | Ga0496121_0015653 | Ga0496121_0015653_1306_2634 | 436 |
| 998 | 3300048924 | Ga0496121_0112226 | Ga0496121_0112226_214_1566 | 436 |
| 999 | 3300048927 | Ga0496124_0005946 | Ga0496124_0005946_11730_13058 | 436 |
| 1000 | 3300048928 | Ga0496125_0032094 | Ga0496125_0032094_1370_2698 | 436 |
| 1001 | 3300048929 | Ga0496126_0000677 | Ga0496126_0000677_13988_15316 | 436 |
| 1002 | 3300049460 | Ga0495682_0015944 | Ga0495682_0015944_672_2015 | 436 |
| 1003 | 3300049568 | Ga0501031_0000144 | Ga0501031_0000144_5670_7022 | 436 |
| 1004 | 3300049568 | Ga0501031_0008167 | Ga0501031_0008167_5101_6414 | 436 |
| 1005 | 3300049569 | Ga0501032_0002470 | Ga0501032_0002470_324_1637 | 436 |
| 1006 | 3300049569 | Ga0501032_0039210 | Ga0501032_0039210_1161_2513 | 436 |
| 1007 | 3300049570 | Ga0501033_0002503 | Ga0501033_0002503_11067_12419 | 436 |
| 1008 | 3300049571 | Ga0501034_0091706 | Ga0501034_0091706_1450_2802 | 436 |
| 1009 | 3300049572 | Ga0501036_0007139 | Ga0501036_0007139_448_1800 | 436 |
| 1010 | 3300049573 | Ga0501037_0003564 | Ga0501037_0003564_7543_8895 | 436 |
| 1011 | 3300049573 | Ga0501037_0087309 | Ga0501037_0087309_606_1919 | 436 |
| 1012 | 3300049574 | Ga0501038_0001310 | Ga0501038_0001310_8607_9920 | 436 |
| 1013 | 3300049574 | Ga0501038_0003820 | Ga0501038_0003820_9524_10876 | 436 |
| 1014 | 3300049575 | Ga0501039_0001985 | Ga0501039_0001985_3455_4807 | 436 |
| 1015 | 3300049575 | Ga0501039_0081386 | Ga0501039_0081386_578_1918 | 436 |
| 1016 | 3300049579 | Ga0501043_0006893 | Ga0501043_0006893_1929_3281 | 436 |
| 1017 | 3300049579 | Ga0501043_0038202 | Ga0501043_0038202_1650_2963 | 436 |
| 1018 | 3300049580 | Ga0501046_0000427 | Ga0501046_0000427_1564_2916 | 436 |
| 1019 | 3300049581 | Ga0501047_0034364 | Ga0501047_0034364_2833_4185 | 436 |
| 1020 | 3300049582 | Ga0501048_0000026 | Ga0501048_0000026_12784_14097 | 436 |
| 1021 | 3300049582 | Ga0501048_0004211 | Ga0501048_0004211_1450_2802 | 436 |
| 1022 | 3300049583 | Ga0501067_0056142 | Ga0501067_0056142_640_1992 | 436 |
| 1023 | 3300049584 | Ga0501068_0008200 | Ga0501068_0008200_3297_4649 | 436 |
| 1024 | 3300049585 | Ga0501069_0000515 | Ga0501069_0000515_14642_15994 | 436 |
| 1025 | 3300049586 | Ga0501070_0003504 | Ga0501070_0003504_11069_12421 | 436 |
| 1026 | 3300049587 | Ga0501071_0013695 | Ga0501071_0013695_2183_3535 | 436 |
| 1027 | 3300049590 | Ga0501074_0008363 | Ga0501074_0008363_1000_2352 | 436 |
| 1028 | 3300049742 | Ga0501080_0010586 | Ga0501080_0010586_3829_5181 | 436 |
| 1029 | 3300049742 | Ga0501080_0170999 | Ga0501080_0170999_75_1406 | 436 |
| 1030 | 3300049744 | Ga0501083_0030883 | Ga0501083_0030883_444_1796 | 436 |
| 1031 | 3300049822 | Ga0501035_0016730 | Ga0501035_0016730_3315_4628 | 436 |
| 1032 | 3300049822 | Ga0501035_0021620 | Ga0501035_0021620_710_2062 | 436 |
| 1033 | 3300049823 | Ga0501044_0008934 | Ga0501044_0008934_1161_2513 | 436 |
| 1034 | 3300050508 | nmdc:mga09592_138562_c1 | nmdc:mga09592_138562_c1_521_1840 | 436 |
| 1035 | 3300050510 | nmdc:mga06r32_692_c3 | nmdc:mga06r32_692_c3_2741_4057 | 436 |
| 1036 | 3300050511 | nmdc:mga08y16_39956_c1 | nmdc:mga08y16_39956_c1_2984_4303 | 436 |
| 1037 | 3300054114 | Ga0501084_0000239 | Ga0501084_0000239_3259_4611 | 436 |
| 1038 | iso_pu_bacteria | 2582581314 | 2585319173 | 436 |
| 1039 | iso_pu_bacteria | 2643221714 | 2644633404 | 436 |
| 1040 | iso_pu_bacteria | 2861520306 | 2861525285 | 436 |
| 1041 | iso_pu_bacteria | 2863404153 | 2863411672 | 436 |
| 1042 | iso_pu_bacteria | 2873151551 | 2873154783 | 436 |
| 1043 | iso_pu_bacteria | 2915358134 | 2915362918 | 436 |
| 1044 | iso_pu_bacteria | 3006493962 | 3006499684 | 436 |
| 1045 | iso_pu_bacteria | 8002784119 | 8002789843 | 436 |
| 1046 | iso_pu_bacteria | 8008574985 | 8008577896 | 436 |
| 1047 | iso_pu_bacteria | 8056667051 | 8056669307 | 436 |
| 1048 | iso_pu_bacteria | 8056829672 | 8056833865 | 436 |
| 1049 | iso_pu_bacteria | 8057568493 | 8057574016 | 436 |
| 1050 | 3300001976 | JGI24752J21851_1003471 | JGI24752J21851_10034712 | 437 |
| 1051 | 3300002459 | JGI24751J29686_10005336 | JGI24751J29686_100053361 | 437 |
| 1052 | 3300003203 | JGI25406J46586_10015066 | JGI25406J46586_100150663 | 437 |
| 1053 | 3300003203 | JGI25406J46586_10021225 | JGI25406J46586_100212252 | 437 |
| 1054 | 3300005328 | Ga0070676_10011568 | Ga0070676_100115683 | 437 |
| 1055 | 3300005331 | Ga0070670_100046760 | Ga0070670_1000467603 | 437 |
| 1056 | 3300005334 | Ga0068869_100001172 | Ga0068869_10000117217 | 437 |
| 1057 | 3300005337 | Ga0070682_100034343 | Ga0070682_1000343433 | 437 |
| 1058 | 3300005338 | Ga0068868_100125388 | Ga0068868_1001253882 | 437 |
| 1059 | 3300005339 | Ga0070660_100009555 | Ga0070660_1000095553 | 437 |
| 1060 | 3300005341 | Ga0070691_10056891 | Ga0070691_100568911 | 437 |
| 1061 | 3300005343 | Ga0070687_100066214 | Ga0070687_1000662142 | 437 |
| 1062 | 3300005344 | Ga0070661_100038413 | Ga0070661_1000384133 | 437 |
| 1063 | 3300005345 | Ga0070692_10010462 | Ga0070692_100104622 | 437 |
| 1064 | 3300005347 | Ga0070668_100001297 | Ga0070668_1000012973 | 437 |
| 1065 | 3300005354 | Ga0070675_100010873 | Ga0070675_1000108733 | 437 |
| 1066 | 3300005355 | Ga0070671_100001780 | Ga0070671_10000178011 | 437 |
| 1067 | 3300005364 | Ga0070673_100022227 | Ga0070673_1000222273 | 437 |
| 1068 | 3300005366 | Ga0070659_100023288 | Ga0070659_1000232884 | 437 |
| 1069 | 3300005367 | Ga0070667_100051103 | Ga0070667_1000511032 | 437 |
| 1070 | 3300005367 | Ga0070667_100134697 | Ga0070667_1001346972 | 437 |
| 1071 | 3300005435 | Ga0070714_100163353 | Ga0070714_1001633532 | 437 |
| 1072 | 3300005436 | Ga0070713_100003953 | Ga0070713_1000039537 | 437 |
| 1073 | 3300005441 | Ga0070700_100090058 | Ga0070700_1000900582 | 437 |
| 1074 | 3300005455 | Ga0070663_100015215 | Ga0070663_1000152154 | 437 |
| 1075 | 3300005458 | Ga0070681_10071491 | Ga0070681_100714913 | 437 |
| 1076 | 3300005530 | Ga0070679_100040221 | Ga0070679_1000402214 | 437 |
| 1077 | 3300005547 | Ga0070693_100009341 | Ga0070693_1000093413 | 437 |
| 1078 | 3300005548 | Ga0070665_100113871 | Ga0070665_1001138713 | 437 |
| 1079 | 3300005548 | Ga0070665_100160653 | Ga0070665_1001606532 | 437 |
| 1080 | 3300005577 | Ga0068857_100057168 | Ga0068857_1000571683 | 437 |
| 1081 | 3300005614 | Ga0068856_100077717 | Ga0068856_1000777172 | 437 |
| 1082 | 3300005614 | Ga0068856_100081444 | Ga0068856_1000814443 | 437 |
| 1083 | 3300005615 | Ga0070702_100016071 | Ga0070702_1000160714 | 437 |
| 1084 | 3300005617 | Ga0068859_100000596 | Ga0068859_10000059613 | 437 |
| 1085 | 3300005617 | Ga0068859_100245302 | Ga0068859_1002453022 | 437 |
| 1086 | 3300005618 | Ga0068864_100143695 | Ga0068864_1001436952 | 437 |
| 1087 | 3300005834 | Ga0068851_10044148 | Ga0068851_100441482 | 437 |
| 1088 | 3300005841 | Ga0068863_100001182 | Ga0068863_10000118214 | 437 |
| 1089 | 3300005841 | Ga0068863_100009630 | Ga0068863_1000096305 | 437 |
| 1090 | 3300005841 | Ga0068863_100009994 | Ga0068863_1000099948 | 437 |
| 1091 | 3300005842 | Ga0068858_100000010 | Ga0068858_10000001070 | 437 |
| 1092 | 3300005842 | Ga0068858_100000013 | Ga0068858_1000000139 | 437 |
| 1093 | 3300005842 | Ga0068858_100013843 | Ga0068858_1000138433 | 437 |
| 1094 | 3300005842 | Ga0068858_100102867 | Ga0068858_1001028672 | 437 |
| 1095 | 3300005844 | Ga0068862_100000358 | Ga0068862_10000035832 | 437 |
| 1096 | 3300005981 | Ga0081538_10000050 | Ga0081538_1000005078 | 437 |
| 1097 | 3300005983 | Ga0081540_1000903 | Ga0081540_100090328 | 437 |
| 1098 | 3300005983 | Ga0081540_1000912 | Ga0081540_100091214 | 437 |
| 1099 | 3300005983 | Ga0081540_1028790 | Ga0081540_10287903 | 437 |
| 1100 | 3300005985 | Ga0081539_10000763 | Ga0081539_1000076317 | 437 |
| 1101 | 3300005985 | Ga0081539_10003492 | Ga0081539_1000349212 | 437 |
| 1102 | 3300005985 | Ga0081539_10004406 | Ga0081539_100044068 | 437 |
| 1103 | 3300005985 | Ga0081539_10005222 | Ga0081539_100052223 | 437 |
| 1104 | 3300005985 | Ga0081539_10010250 | Ga0081539_100102505 | 437 |
| 1105 | 3300006237 | Ga0097621_100036611 | Ga0097621_1000366113 | 437 |
| 1106 | 3300006358 | Ga0068871_100011221 | Ga0068871_1000112216 | 437 |
| 1107 | 3300006847 | Ga0075431_100068233 | Ga0075431_1000682332 | 437 |
| 1108 | 3300006852 | Ga0075433_10007460 | Ga0075433_100074608 | 437 |
| 1109 | 3300006871 | Ga0075434_100032312 | Ga0075434_1000323123 | 437 |
| 1110 | 3300006880 | Ga0075429_100022283 | Ga0075429_1000222835 | 437 |
| 1111 | 3300006880 | Ga0075429_100051551 | Ga0075429_1000515512 | 437 |
| 1112 | 3300006914 | Ga0075436_100050482 | Ga0075436_1000504822 | 437 |
| 1113 | 3300006931 | Ga0097620_100000596 | Ga0097620_10000059613 | 437 |
| 1114 | 3300006931 | Ga0097620_100245303 | Ga0097620_1002453032 | 437 |
| 1115 | 3300009011 | Ga0105251_10053826 | Ga0105251_100538261 | 437 |
| 1116 | 3300009094 | Ga0111539_10009764 | Ga0111539_100097642 | 437 |
| 1117 | 3300009098 | Ga0105245_10005886 | Ga0105245_100058862 | 437 |
| 1118 | 3300009098 | Ga0105245_10176509 | Ga0105245_101765092 | 437 |
| 1119 | 3300009101 | Ga0105247_10018328 | Ga0105247_100183283 | 437 |
| 1120 | 3300009101 | Ga0105247_10022164 | Ga0105247_100221642 | 437 |
| 1121 | 3300009147 | Ga0114129_10001274 | Ga0114129_1000127421 | 437 |
| 1122 | 3300009147 | Ga0114129_10001724 | Ga0114129_100017249 | 437 |
| 1123 | 3300009147 | Ga0114129_10118258 | Ga0114129_101182587 | 437 |
| 1124 | 3300009148 | Ga0105243_10194003 | Ga0105243_101940032 | 437 |
| 1125 | 3300009174 | Ga0105241_10133231 | Ga0105241_101332312 | 437 |
| 1126 | 3300009176 | Ga0105242_10135768 | Ga0105242_101357682 | 437 |
| 1127 | 3300009177 | Ga0105248_10000035 | Ga0105248_1000003555 | 437 |
| 1128 | 3300009177 | Ga0105248_10003863 | Ga0105248_1000386311 | 437 |
| 1129 | 3300009177 | Ga0105248_10033866 | Ga0105248_100338666 | 437 |
| 1130 | 3300009177 | Ga0105248_10049682 | Ga0105248_100496822 | 437 |
| 1131 | 3300009177 | Ga0105248_10241017 | Ga0105248_102410172 | 437 |
| 1132 | 3300009551 | Ga0105238_10307532 | Ga0105238_103075322 | 437 |
| 1133 | 3300009553 | Ga0105249_10005191 | Ga0105249_100051913 | 437 |
| 1134 | 3300011119 | Ga0105246_10014319 | Ga0105246_100143193 | 437 |
| 1135 | 3300013100 | Ga0157373_10026116 | Ga0157373_100261163 | 437 |
| 1136 | 3300013104 | Ga0157370_10132940 | Ga0157370_101329402 | 437 |
| 1137 | 3300013105 | Ga0157369_10010203 | Ga0157369_100102039 | 437 |
| 1138 | 3300013105 | Ga0157369_10235375 | Ga0157369_102353752 | 437 |
| 1139 | 3300013307 | Ga0157372_10081467 | Ga0157372_100814673 | 437 |
| 1140 | 3300013307 | Ga0157372_10256371 | Ga0157372_102563711 | 437 |
| 1141 | 3300014968 | Ga0157379_10000012 | Ga0157379_10000012112 | 437 |
| 1142 | 3300014968 | Ga0157379_10020489 | Ga0157379_100204894 | 437 |
| 1143 | 3300014968 | Ga0157379_10185118 | Ga0157379_101851182 | 437 |
| 1144 | 3300020070 | Ga0206356_11251781 | Ga0206356_112517812 | 437 |
| 1145 | 3300020070 | Ga0206356_11557117 | Ga0206356_115571171 | 437 |
| 1146 | 3300020076 | Ga0206355_1061250 | Ga0206355_10612502 | 437 |
| 1147 | 3300020078 | Ga0206352_11163761 | Ga0206352_111637612 | 437 |
| 1148 | 3300020080 | Ga0206350_11654720 | Ga0206350_116547202 | 437 |
| 1149 | 3300020082 | Ga0206353_10041609 | Ga0206353_100416093 | 437 |
| 1150 | 3300020082 | Ga0206353_10184723 | Ga0206353_101847233 | 437 |
| 1151 | 3300020082 | Ga0206353_10976662 | Ga0206353_109766622 | 437 |
| 1152 | 3300020610 | Ga0154015_1634210 | Ga0154015_16342101 | 437 |
| 1153 | 3300021384 | Ga0213876_10000793 | Ga0213876_1000079312 | 437 |
| 1154 | 3300022467 | Ga0224712_10002852 | Ga0224712_100028523 | 437 |
| 1155 | 3300022467 | Ga0224712_10003615 | Ga0224712_100036154 | 437 |
| 1156 | 3300022467 | Ga0224712_10021348 | Ga0224712_100213481 | 437 |
| 1157 | 3300025900 | Ga0207710_10000048 | Ga0207710_1000004891 | 437 |
| 1158 | 3300025900 | Ga0207710_10018265 | Ga0207710_100182652 | 437 |
| 1159 | 3300025901 | Ga0207688_10069288 | Ga0207688_100692881 | 437 |
| 1160 | 3300025904 | Ga0207647_10052506 | Ga0207647_100525062 | 437 |
| 1161 | 3300025906 | Ga0207699_10044380 | Ga0207699_100443802 | 437 |
| 1162 | 3300025908 | Ga0207643_10000335 | Ga0207643_100003356 | 437 |
| 1163 | 3300025909 | Ga0207705_10020763 | Ga0207705_100207633 | 437 |
| 1164 | 3300025909 | Ga0207705_10061174 | Ga0207705_100611741 | 437 |
| 1165 | 3300025912 | Ga0207707_10009801 | Ga0207707_100098014 | 437 |
| 1166 | 3300025915 | Ga0207693_10157566 | Ga0207693_101575662 | 437 |
| 1167 | 3300025915 | Ga0207693_10170474 | Ga0207693_101704742 | 437 |
| 1168 | 3300025917 | Ga0207660_10194254 | Ga0207660_101942541 | 437 |
| 1169 | 3300025919 | Ga0207657_10014660 | Ga0207657_100146607 | 437 |
| 1170 | 3300025919 | Ga0207657_10020276 | Ga0207657_100202767 | 437 |
| 1171 | 3300025920 | Ga0207649_10004339 | Ga0207649_100043392 | 437 |
| 1172 | 3300025921 | Ga0207652_10010364 | Ga0207652_100103646 | 437 |
| 1173 | 3300025921 | Ga0207652_10037921 | Ga0207652_100379212 | 437 |
| 1174 | 3300025921 | Ga0207652_10047432 | Ga0207652_100474323 | 437 |
| 1175 | 3300025925 | Ga0207650_10007490 | Ga0207650_100074906 | 437 |
| 1176 | 3300025926 | Ga0207659_10012720 | Ga0207659_100127202 | 437 |
| 1177 | 3300025927 | Ga0207687_10024289 | Ga0207687_100242892 | 437 |
| 1178 | 3300025928 | Ga0207700_10063014 | Ga0207700_100630142 | 437 |
| 1179 | 3300025929 | Ga0207664_10028564 | Ga0207664_100285643 | 437 |
| 1180 | 3300025931 | Ga0207644_10003155 | Ga0207644_100031552 | 437 |
| 1181 | 3300025934 | Ga0207686_10104898 | Ga0207686_101048982 | 437 |
| 1182 | 3300025939 | Ga0207665_10095785 | Ga0207665_100957851 | 437 |
| 1183 | 3300025940 | Ga0207691_10014980 | Ga0207691_100149802 | 437 |
| 1184 | 3300025941 | Ga0207711_10000747 | Ga0207711_1000074712 | 437 |
| 1185 | 3300025941 | Ga0207711_10001409 | Ga0207711_1000140911 | 437 |
| 1186 | 3300025941 | Ga0207711_10160682 | Ga0207711_101606822 | 437 |
| 1187 | 3300025942 | Ga0207689_10002913 | Ga0207689_100029132 | 437 |
| 1188 | 3300025944 | Ga0207661_10123955 | Ga0207661_101239553 | 437 |
| 1189 | 3300025945 | Ga0207679_10024111 | Ga0207679_100241113 | 437 |
| 1190 | 3300025945 | Ga0207679_10037555 | Ga0207679_100375553 | 437 |
| 1191 | 3300025949 | Ga0207667_10230340 | Ga0207667_102303402 | 437 |
| 1192 | 3300025972 | Ga0207668_10003383 | Ga0207668_100033838 | 437 |
| 1193 | 3300025986 | Ga0207658_10188247 | Ga0207658_101882471 | 437 |
| 1194 | 3300026035 | Ga0207703_10000002 | Ga0207703_10000002197 | 437 |
| 1195 | 3300026035 | Ga0207703_10000009 | Ga0207703_100000099 | 437 |
| 1196 | 3300026041 | Ga0207639_10061070 | Ga0207639_100610704 | 437 |
| 1197 | 3300026067 | Ga0207678_10008350 | Ga0207678_100083502 | 437 |
| 1198 | 3300026067 | Ga0207678_10121879 | Ga0207678_101218792 | 437 |
| 1199 | 3300026075 | Ga0207708_10005701 | Ga0207708_100057013 | 437 |
| 1200 | 3300026078 | Ga0207702_10017665 | Ga0207702_100176654 | 437 |
| 1201 | 3300026088 | Ga0207641_10002959 | Ga0207641_100029595 | 437 |
| 1202 | 3300026088 | Ga0207641_10014228 | Ga0207641_100142289 | 437 |
| 1203 | 3300026095 | Ga0207676_10003163 | Ga0207676_100031632 | 437 |
| 1204 | 3300026116 | Ga0207674_10300114 | Ga0207674_103001142 | 437 |
| 1205 | 3300026121 | Ga0207683_10000857 | Ga0207683_1000085721 | 437 |
| 1206 | 3300026121 | Ga0207683_10068459 | Ga0207683_100684592 | 437 |
| 1207 | 3300027907 | Ga0207428_10005680 | Ga0207428_1000568010 | 437 |
| 1208 | 3300028380 | Ga0268265_10000156 | Ga0268265_1000015669 | 437 |
| 1209 | 3300028794 | Ga0307515_10000038 | Ga0307515_10000038131 | 437 |
| 1210 | 3300028794 | Ga0307515_10019047 | Ga0307515_100190478 | 437 |
| 1211 | 3300028794 | Ga0307515_10070295 | Ga0307515_100702954 | 437 |
| 1212 | 3300028800 | Ga0265338_10017927 | Ga0265338_100179272 | 437 |
| 1213 | 3300028800 | Ga0265338_10038060 | Ga0265338_100380604 | 437 |
| 1214 | 3300030522 | Ga0307512_10045352 | Ga0307512_100453522 | 437 |
| 1215 | 3300030736 | Ga0316180_1157808 | Ga0316180_11578081 | 437 |
| 1216 | 3300031241 | Ga0265325_10005156 | Ga0265325_100051564 | 437 |
| 1217 | 3300031247 | Ga0265340_10019334 | Ga0265340_100193342 | 437 |
| 1218 | 3300031249 | Ga0265339_10049576 | Ga0265339_100495763 | 437 |
| 1219 | 3300031456 | Ga0307513_10015380 | Ga0307513_100153805 | 437 |
| 1220 | 3300031507 | Ga0307509_10015278 | Ga0307509_100152785 | 437 |
| 1221 | 3300031507 | Ga0307509_10048348 | Ga0307509_100483482 | 437 |
| 1222 | 3300031616 | Ga0307508_10000506 | Ga0307508_1000050639 | 437 |
| 1223 | 3300031616 | Ga0307508_10001775 | Ga0307508_1000177512 | 437 |
| 1224 | 3300031616 | Ga0307508_10070716 | Ga0307508_100707163 | 437 |
| 1225 | 3300031649 | Ga0307514_10075008 | Ga0307514_100750082 | 437 |
| 1226 | 3300031730 | Ga0307516_10002871 | Ga0307516_1000287110 | 437 |
| 1227 | 3300031730 | Ga0307516_10093745 | Ga0307516_100937453 | 437 |
| 1228 | 3300031730 | Ga0307516_10094321 | Ga0307516_100943213 | 437 |
| 1229 | 3300031995 | Ga0307409_100089208 | Ga0307409_1000892081 | 437 |
| 1230 | 3300031995 | Ga0307409_100256598 | Ga0307409_1002565982 | 437 |
| 1231 | 3300032137 | Ga0316585_10004353 | Ga0316585_100043533 | 437 |
| 1232 | 3300033179 | Ga0307507_10000732 | Ga0307507_1000073249 | 437 |
| 1233 | 3300033179 | Ga0307507_10020822 | Ga0307507_100208222 | 437 |
| 1234 | 3300033545 | Ga0316214_1001544 | Ga0316214_10015442 | 437 |
| 1235 | 3300035091 | Ga0373951_0000115 | Ga0373951_0000115_14374_15714 | 437 |
| 1236 | 3300035117 | Ga0373953_0025343 | Ga0373953_0025343_543_1916 | 437 |
| 1237 | 3300035172 | Ga0373955_0040542 | Ga0373955_0040542_977_2350 | 437 |
| 1238 | 3300035692 | Ga0373935_0015818 | Ga0373935_0015818_2205_3548 | 437 |
| 1239 | 3300035692 | Ga0373935_0151391 | Ga0373935_0151391_45_1418 | 437 |
| 1240 | 3300035724 | Ga0373933_0013288 | Ga0373933_0013288_3063_4436 | 437 |
| 1241 | 3300036401 | Ga0373937_0070973 | Ga0373937_0070973_1426_2799 | 437 |
| 1242 | 3300036712 | Ga0316584_0071624 | Ga0316584_0071624_1170_2552 | 437 |
| 1243 | 3300037068 | Ga0373925_0000006 | Ga0373925_0000006_197538_198902 | 437 |
| 1244 | 3300037466 | Ga0395898_0035335 | Ga0395898_0035335_1806_3146 | 437 |
| 1245 | 3300037471 | Ga0395905_0254809 | Ga0395905_0254809_251_1591 | 437 |
| 1246 | 3300039437 | Ga0436365_0567091 | Ga0436365_0567091_13177_14529 | 437 |
| 1247 | 3300041452 | Ga0451793_0254203 | Ga0451793_0254203_2412_3842 | 437 |
| 1248 | 3300042006 | Ga0439432_020825 | Ga0439432_020825_760_2088 | 437 |
| 1249 | 3300044656 | Ga0466969_0002576 | Ga0466969_0002576_2490_3866 | 437 |
| 1250 | 3300044693 | Ga0466961_0062349 | Ga0466961_0062349_929_2302 | 437 |
| 1251 | 3300044719 | Ga0466971_0045012 | Ga0466971_0045012_23_1399 | 437 |
| 1252 | 3300046462 | Ga0495651_0017471 | Ga0495651_0017471_745_2118 | 437 |
| 1253 | 3300046463 | Ga0495653_0125370 | Ga0495653_0125370_422_1795 | 437 |
| 1254 | 3300046475 | Ga0495639_0062309 | Ga0495639_0062309_361_1689 | 437 |
| 1255 | 3300046507 | Ga0495606_0001359 | Ga0495606_0001359_28412_29737 | 437 |
| 1256 | 3300046524 | Ga0495648_0021577 | Ga0495648_0021577_275_1636 | 437 |
| 1257 | 3300046616 | Ga0495668_0000519 | Ga0495668_0000519_13809_15134 | 437 |
| 1258 | 3300046642 | Ga0495634_0057874 | Ga0495634_0057874_390_1763 | 437 |
| 1259 | 3300046660 | Ga0495625_0001636 | Ga0495625_0001636_13939_15264 | 437 |
| 1260 | 3300046663 | Ga0495635_0055499 | Ga0495635_0055499_496_1965 | 437 |
| 1261 | 3300046674 | Ga0495588_0020166 | Ga0495588_0020166_228_1559 | 437 |
| 1262 | 3300046675 | Ga0495657_0080018 | Ga0495657_0080018_299_1672 | 437 |
| 1263 | 3300046680 | Ga0495646_0082841 | Ga0495646_0082841_197_1666 | 437 |
| 1264 | 3300046683 | Ga0495658_0074911 | Ga0495658_0074911_488_1957 | 437 |
| 1265 | 3300046809 | Ga0495600_0119154 | Ga0495600_0119154_158_1630 | 437 |
| 1266 | 3300047315 | Ga0495581_0068143 | Ga0495581_0068143_282_1751 | 437 |
| 1267 | 3300047317 | Ga0495604_0115329 | Ga0495604_0115329_137_1510 | 437 |
| 1268 | 3300047319 | Ga0495674_0157529 | Ga0495674_0157529_295_1668 | 437 |
| 1269 | 3300047322 | Ga0495680_0042878 | Ga0495680_0042878_687_2060 | 437 |
| 1270 | 3300047471 | Ga0495684_0047712 | Ga0495684_0047712_1069_2442 | 437 |
| 1271 | 3300048091 | Ga0495626_0001401 | Ga0495626_0001401_4266_5591 | 437 |
| 1272 | 3300048903 | Ga0496100_0147500 | Ga0496100_0147500_313_1659 | 437 |
| 1273 | 3300048905 | Ga0496102_0027616 | Ga0496102_0027616_129_1598 | 437 |
| 1274 | 3300048905 | Ga0496102_0064426 | Ga0496102_0064426_1364_2710 | 437 |
| 1275 | 3300048905 | Ga0496102_0081793 | Ga0496102_0081793_1122_2480 | 437 |
| 1276 | 3300048907 | Ga0496104_0040322 | Ga0496104_0040322_2896_4242 | 437 |
| 1277 | 3300048907 | Ga0496104_0051650 | Ga0496104_0051650_1224_2693 | 437 |
| 1278 | 3300048908 | Ga0496105_0020716 | Ga0496105_0020716_1456_2925 | 437 |
| 1279 | 3300048908 | Ga0496105_0134693 | Ga0496105_0134693_207_1553 | 437 |
| 1280 | 3300048909 | Ga0496106_0001155 | Ga0496106_0001155_14187_15533 | 437 |
| 1281 | 3300048910 | Ga0496107_0027103 | Ga0496107_0027103_110_1456 | 437 |
| 1282 | 3300048911 | Ga0496108_0000035 | Ga0496108_0000035_87355_88680 | 437 |
| 1283 | 3300048911 | Ga0496108_0177067 | Ga0496108_0177067_77_1423 | 437 |
| 1284 | 3300048912 | Ga0496109_0054048 | Ga0496109_0054048_880_2349 | 437 |
| 1285 | 3300048912 | Ga0496109_0118222 | Ga0496109_0118222_887_2233 | 437 |
| 1286 | 3300048913 | Ga0496110_0000220 | Ga0496110_0000220_16718_18187 | 437 |
| 1287 | 3300048913 | Ga0496110_0027265 | Ga0496110_0027265_2971_4317 | 437 |
| 1288 | 3300048914 | Ga0496111_0000527 | Ga0496111_0000527_3699_5168 | 437 |
| 1289 | 3300048914 | Ga0496111_0000817 | Ga0496111_0000817_13913_15259 | 437 |
| 1290 | 3300048915 | Ga0496112_0068854 | Ga0496112_0068854_455_1801 | 437 |
| 1291 | 3300048916 | Ga0496113_0004876 | Ga0496113_0004876_1036_2382 | 437 |
| 1292 | 3300048917 | Ga0496114_0040866 | Ga0496114_0040866_2156_3622 | 437 |
| 1293 | 3300048917 | Ga0496114_0050348 | Ga0496114_0050348_867_2336 | 437 |
| 1294 | 3300048918 | Ga0496115_0049446 | Ga0496115_0049446_1604_2950 | 437 |
| 1295 | 3300048918 | Ga0496115_0104371 | Ga0496115_0104371_496_1860 | 437 |
| 1296 | 3300048919 | Ga0496116_0000182 | Ga0496116_0000182_86185_87543 | 437 |
| 1297 | 3300048920 | Ga0496117_0005163 | Ga0496117_0005163_4696_6054 | 437 |
| 1298 | 3300048920 | Ga0496117_0041649 | Ga0496117_0041649_1128_2486 | 437 |
| 1299 | 3300048921 | Ga0496118_0022954 | Ga0496118_0022954_364_1722 | 437 |
| 1300 | 3300048922 | Ga0496119_0009347 | Ga0496119_0009347_3779_5137 | 437 |
| 1301 | 3300048922 | Ga0496119_0015383 | Ga0496119_0015383_4036_5406 | 437 |
| 1302 | 3300048922 | Ga0496119_0051687 | Ga0496119_0051687_424_1788 | 437 |
| 1303 | 3300048923 | Ga0496120_0029616 | Ga0496120_0029616_1279_2637 | 437 |
| 1304 | 3300048924 | Ga0496121_0016297 | Ga0496121_0016297_2126_3496 | 437 |
| 1305 | 3300048929 | Ga0496126_0041523 | Ga0496126_0041523_957_2282 | 437 |
| 1306 | 3300048929 | Ga0496126_0045712 | Ga0496126_0045712_1499_2821 | 437 |
| 1307 | 3300048929 | Ga0496126_0067728 | Ga0496126_0067728_941_2305 | 437 |
| 1308 | 3300049586 | Ga0501070_0038098 | Ga0501070_0038098_1134_2480 | 437 |
| 1309 | 3300049824 | Ga0501045_0077109 | Ga0501045_0077109_368_1717 | 437 |
| 1310 | 3300049824 | Ga0501045_0128149 | Ga0501045_0128149_510_1865 | 437 |
| 1311 | 3300050507 | nmdc:mga05p37_110473_c1 | nmdc:mga05p37_110473_c1_1675_3000 | 437 |
| 1312 | 3300050507 | nmdc:mga05p37_12466_c1 | nmdc:mga05p37_12466_c1_4900_6261 | 437 |
| 1313 | 3300050507 | nmdc:mga05p37_43393_c1 | nmdc:mga05p37_43393_c1_183_1529 | 437 |
| 1314 | 3300050508 | nmdc:mga09592_46742_c1 | nmdc:mga09592_46742_c1_2114_3439 | 437 |
| 1315 | 3300050508 | nmdc:mga09592_80423_c1 | nmdc:mga09592_80423_c1_866_2212 | 437 |
| 1316 | 3300050511 | nmdc:mga08y16_41095_c1 | nmdc:mga08y16_41095_c1_433_1779 | 437 |
| 1317 | 3300050514 | nmdc:mga08x19_5990_c1 | nmdc:mga08x19_5990_c1_1998_3344 | 437 |
| 1318 | 3300050515 | nmdc:mga0a205_12444_c1 | nmdc:mga0a205_12444_c1_3079_4425 | 437 |
| 1319 | 3300053092 | Ga0500583_0071248 | Ga0500583_0071248_212_1570 | 437 |
| 1320 | iso_pu_bacteria | 2508501039 | 2508670694 | 437 |
| 1321 | iso_pu_bacteria | 2517572101 | 2517762484 | 437 |
| 1322 | iso_pu_bacteria | 2579778521 | 2579854552 | 437 |
| 1323 | iso_pu_bacteria | 2619618881 | 2619853809 | 437 |
| 1324 | iso_pu_bacteria | 2619619003 | 2620349509 | 437 |
| 1325 | iso_pu_bacteria | 2626541554 | 2626634845 | 437 |
| 1326 | iso_pu_bacteria | 2671180195 | 2671835795 | 437 |
| 1327 | iso_pu_bacteria | 2675902999 | 2676201272 | 437 |
| 1328 | iso_pu_bacteria | 2675903058 | 2676474608 | 437 |
| 1329 | iso_pu_bacteria | 2684623035 | 2686539648 | 437 |
| 1330 | iso_pu_bacteria | 2687453737 | 2689960499 | 437 |
| 1331 | iso_pu_bacteria | 2687453743 | 2689992300 | 437 |
| 1332 | iso_pu_bacteria | 2751185782 | 2753271021 | 437 |
| 1333 | iso_pu_bacteria | 2773857921 | 2774845848 | 437 |
| 1334 | iso_pu_bacteria | 2773857922 | 2774853951 | 437 |
| 1335 | iso_pu_bacteria | 2827628540 | 2827632918 | 437 |
| 1336 | iso_pu_bacteria | 2862382967 | 2862387248 | 437 |
| 1337 | iso_pu_bacteria | 2895880812 | 2895884875 | 437 |
| 1338 | iso_pu_bacteria | 8002775197 | 8002781598 | 437 |
| 1339 | iso_pu_bacteria | 8008558824 | 8008566431 | 437 |
| 1340 | 3300002077 | JGI24744J21845_10001304 | JGI24744J21845_100013042 | 438 |
| 1341 | 3300003659 | JGI25404J52841_10000389 | JGI25404J52841_100003896 | 438 |
| 1342 | 3300005327 | Ga0070658_10027200 | Ga0070658_100272005 | 438 |
| 1343 | 3300005327 | Ga0070658_10045247 | Ga0070658_100452472 | 438 |
| 1344 | 3300005337 | Ga0070682_100013085 | Ga0070682_1000130856 | 438 |
| 1345 | 3300005338 | Ga0068868_100044260 | Ga0068868_1000442602 | 438 |
| 1346 | 3300005347 | Ga0070668_100030442 | Ga0070668_1000304422 | 438 |
| 1347 | 3300005366 | Ga0070659_100054109 | Ga0070659_1000541092 | 438 |
| 1348 | 3300005437 | Ga0070710_10000264 | Ga0070710_100002644 | 438 |
| 1349 | 3300005438 | Ga0070701_10003695 | Ga0070701_100036956 | 438 |
| 1350 | 3300005439 | Ga0070711_100154332 | Ga0070711_1001543321 | 438 |
| 1351 | 3300005441 | Ga0070700_100005557 | Ga0070700_1000055576 | 438 |
| 1352 | 3300005445 | Ga0070708_100000671 | Ga0070708_10000067117 | 438 |
| 1353 | 3300005455 | Ga0070663_100046120 | Ga0070663_1000461201 | 438 |
| 1354 | 3300005459 | Ga0068867_100003687 | Ga0068867_1000036879 | 438 |
| 1355 | 3300005466 | Ga0070685_10018850 | Ga0070685_100188503 | 438 |
| 1356 | 3300005467 | Ga0070706_100066875 | Ga0070706_1000668753 | 438 |
| 1357 | 3300005467 | Ga0070706_100085150 | Ga0070706_1000851504 | 438 |
| 1358 | 3300005468 | Ga0070707_100180704 | Ga0070707_1001807041 | 438 |
| 1359 | 3300005471 | Ga0070698_100053032 | Ga0070698_1000530323 | 438 |
| 1360 | 3300005543 | Ga0070672_100003670 | Ga0070672_1000036708 | 438 |
| 1361 | 3300005578 | Ga0068854_100069551 | Ga0068854_1000695512 | 438 |
| 1362 | 3300005614 | Ga0068856_100023376 | Ga0068856_1000233764 | 438 |
| 1363 | 3300005614 | Ga0068856_100139694 | Ga0068856_1001396942 | 438 |
| 1364 | 3300005718 | Ga0068866_10039686 | Ga0068866_100396862 | 438 |
| 1365 | 3300005719 | Ga0068861_100009645 | Ga0068861_1000096453 | 438 |
| 1366 | 3300005841 | Ga0068863_100249428 | Ga0068863_1002494282 | 438 |
| 1367 | 3300005937 | Ga0081455_10000071 | Ga0081455_1000007166 | 438 |
| 1368 | 3300005983 | Ga0081540_1000522 | Ga0081540_100052224 | 438 |
| 1369 | 3300006028 | Ga0070717_10040433 | Ga0070717_100404331 | 438 |
| 1370 | 3300006028 | Ga0070717_10161596 | Ga0070717_101615962 | 438 |
| 1371 | 3300006173 | Ga0070716_100116427 | Ga0070716_1001164272 | 438 |
| 1372 | 3300006175 | Ga0070712_100110988 | Ga0070712_1001109882 | 438 |
| 1373 | 3300006881 | Ga0068865_100006359 | Ga0068865_1000063594 | 438 |
| 1374 | 3300009093 | Ga0105240_10037111 | Ga0105240_100371115 | 438 |
| 1375 | 3300009098 | Ga0105245_10018820 | Ga0105245_100188203 | 438 |
| 1376 | 3300009148 | Ga0105243_10021920 | Ga0105243_100219202 | 438 |
| 1377 | 3300009176 | Ga0105242_10027971 | Ga0105242_100279712 | 438 |
| 1378 | 3300009177 | Ga0105248_10011321 | Ga0105248_100113218 | 438 |
| 1379 | 3300009545 | Ga0105237_10014930 | Ga0105237_100149305 | 438 |
| 1380 | 3300009553 | Ga0105249_10118937 | Ga0105249_101189371 | 438 |
| 1381 | 3300010375 | Ga0105239_10016946 | Ga0105239_100169462 | 438 |
| 1382 | 3300011119 | Ga0105246_10094152 | Ga0105246_100941522 | 438 |
| 1383 | 3300013100 | Ga0157373_10034275 | Ga0157373_100342753 | 438 |
| 1384 | 3300014326 | Ga0157380_10015814 | Ga0157380_100158143 | 438 |
| 1385 | 3300014745 | Ga0157377_10037198 | Ga0157377_100371982 | 438 |
| 1386 | 3300021358 | Ga0213873_10000037 | Ga0213873_100000376 | 438 |
| 1387 | 3300021388 | Ga0213875_10010278 | Ga0213875_100102784 | 438 |
| 1388 | 3300021388 | Ga0213875_10023525 | Ga0213875_100235252 | 438 |
| 1389 | 3300021388 | Ga0213875_10035752 | Ga0213875_100357522 | 438 |
| 1390 | 3300022467 | Ga0224712_10000640 | Ga0224712_100006405 | 438 |
| 1391 | 3300024227 | Ga0228598_1007224 | Ga0228598_10072243 | 438 |
| 1392 | 3300025898 | Ga0207692_10000049 | Ga0207692_1000004918 | 438 |
| 1393 | 3300025899 | Ga0207642_10008157 | Ga0207642_100081574 | 438 |
| 1394 | 3300025908 | Ga0207643_10012832 | Ga0207643_100128323 | 438 |
| 1395 | 3300025909 | Ga0207705_10020946 | Ga0207705_100209465 | 438 |
| 1396 | 3300025913 | Ga0207695_10027984 | Ga0207695_100279845 | 438 |
| 1397 | 3300025915 | Ga0207693_10075462 | Ga0207693_100754622 | 438 |
| 1398 | 3300025915 | Ga0207693_10083640 | Ga0207693_100836403 | 438 |
| 1399 | 3300025929 | Ga0207664_10142941 | Ga0207664_101429412 | 438 |
| 1400 | 3300025934 | Ga0207686_10017197 | Ga0207686_100171972 | 438 |
| 1401 | 3300025935 | Ga0207709_10008671 | Ga0207709_100086716 | 438 |
| 1402 | 3300025937 | Ga0207669_10003947 | Ga0207669_100039476 | 438 |
| 1403 | 3300025938 | Ga0207704_10005569 | Ga0207704_100055694 | 438 |
| 1404 | 3300025940 | Ga0207691_10000365 | Ga0207691_100003658 | 438 |
| 1405 | 3300025941 | Ga0207711_10010854 | Ga0207711_100108547 | 438 |
| 1406 | 3300025944 | Ga0207661_10025154 | Ga0207661_100251542 | 438 |
| 1407 | 3300025944 | Ga0207661_10234549 | Ga0207661_102345492 | 438 |
| 1408 | 3300025960 | Ga0207651_10040572 | Ga0207651_100405722 | 438 |
| 1409 | 3300025972 | Ga0207668_10002531 | Ga0207668_100025315 | 438 |
| 1410 | 3300025981 | Ga0207640_10010659 | Ga0207640_100106592 | 438 |
| 1411 | 3300026023 | Ga0207677_10027876 | Ga0207677_100278763 | 438 |
| 1412 | 3300026041 | Ga0207639_10045082 | Ga0207639_100450822 | 438 |
| 1413 | 3300026067 | Ga0207678_10000657 | Ga0207678_1000065718 | 438 |
| 1414 | 3300026075 | Ga0207708_10000208 | Ga0207708_1000020840 | 438 |
| 1415 | 3300026078 | Ga0207702_10004196 | Ga0207702_100041965 | 438 |
| 1416 | 3300026078 | Ga0207702_10096501 | Ga0207702_100965012 | 438 |
| 1417 | 3300026089 | Ga0207648_10002531 | Ga0207648_1000253112 | 438 |
| 1418 | 3300026142 | Ga0207698_10040729 | Ga0207698_100407293 | 438 |
| 1419 | 3300031456 | Ga0307513_10094607 | Ga0307513_100946073 | 438 |
| 1420 | 3300031852 | Ga0307410_10015291 | Ga0307410_100152913 | 438 |
| 1421 | 3300031852 | Ga0307410_10111554 | Ga0307410_101115541 | 438 |
| 1422 | 3300031901 | Ga0307406_10004254 | Ga0307406_100042544 | 438 |
| 1423 | 3300031903 | Ga0307407_10003337 | Ga0307407_100033376 | 438 |
| 1424 | 3300031995 | Ga0307409_100000406 | Ga0307409_1000004067 | 438 |
| 1425 | 3300031995 | Ga0307409_100156524 | Ga0307409_1001565242 | 438 |
| 1426 | 3300032002 | Ga0307416_100005536 | Ga0307416_1000055367 | 438 |
| 1427 | 3300032004 | Ga0307414_10089640 | Ga0307414_100896402 | 438 |
| 1428 | 3300032126 | Ga0307415_100000422 | Ga0307415_10000042210 | 438 |
| 1429 | 3300032126 | Ga0307415_100039753 | Ga0307415_1000397532 | 438 |
| 1430 | 3300036457 | Ga0265778_000400 | Ga0265778_000400_1778_3130 | 438 |
| 1431 | 3300037853 | Ga0436364_0516238 | Ga0436364_0516238_68341_69771 | 438 |
| 1432 | 3300037853 | Ga0436364_0735260 | Ga0436364_0735260_14985_16352 | 438 |
| 1433 | 3300037853 | Ga0436364_1039945 | Ga0436364_1039945_182_1549 | 438 |
| 1434 | 3300037853 | Ga0436364_1086504 | Ga0436364_1086504_132_1553 | 438 |
| 1435 | 3300039437 | Ga0436365_0574117 | Ga0436365_0574117_1092_2522 | 438 |
| 1436 | 3300039437 | Ga0436365_1284454 | Ga0436365_1284454_4782_6176 | 438 |
| 1437 | 3300039450 | Ga0436363_0464660 | Ga0436363_0464660_145_1518 | 438 |
| 1438 | 3300039453 | Ga0436362_0884990 | Ga0436362_0884990_18707_20101 | 438 |
| 1439 | 3300044656 | Ga0466969_0000632 | Ga0466969_0000632_11488_12888 | 438 |
| 1440 | 3300044658 | Ga0466972_0002173 | Ga0466972_0002173_4133_5518 | 438 |
| 1441 | 3300044658 | Ga0466972_0014915 | Ga0466972_0014915_997_2334 | 438 |
| 1442 | 3300044683 | Ga0466965_0000194 | Ga0466965_0000194_14123_15460 | 438 |
| 1443 | 3300044684 | Ga0466966_0001302 | Ga0466966_0001302_10647_12041 | 438 |
| 1444 | 3300044684 | Ga0466966_0061797 | Ga0466966_0061797_127_1527 | 438 |
| 1445 | 3300044693 | Ga0466961_0002350 | Ga0466961_0002350_2258_3658 | 438 |
| 1446 | 3300044693 | Ga0466961_0073870 | Ga0466961_0073870_195_1538 | 438 |
| 1447 | 3300044694 | Ga0466963_0001094 | Ga0466963_0001094_355_1749 | 438 |
| 1448 | 3300044694 | Ga0466963_0034188 | Ga0466963_0034188_715_2061 | 438 |
| 1449 | 3300044694 | Ga0466963_0083359 | Ga0466963_0083359_659_2002 | 438 |
| 1450 | 3300044706 | Ga0466964_0071300 | Ga0466964_0071300_63_1400 | 438 |
| 1451 | 3300044719 | Ga0466971_0000892 | Ga0466971_0000892_10691_12091 | 438 |
| 1452 | 3300044719 | Ga0466971_0028339 | Ga0466971_0028339_459_1802 | 438 |
| 1453 | 3300044735 | Ga0466968_0003734 | Ga0466968_0003734_2019_3365 | 438 |
| 1454 | 3300044901 | Ga0466960_0000703 | Ga0466960_0000703_9403_10740 | 438 |
| 1455 | 3300044901 | Ga0466960_0004561 | Ga0466960_0004561_328_1713 | 438 |
| 1456 | 3300044901 | Ga0466960_0036259 | Ga0466960_0036259_624_1979 | 438 |
| 1457 | 3300045049 | Ga0466959_0000877 | Ga0466959_0000877_12074_13474 | 438 |
| 1458 | 3300045049 | Ga0466959_0006347 | Ga0466959_0006347_802_2196 | 438 |
| 1459 | 3300045836 | Ga0466958_0003068 | Ga0466958_0003068_3461_4855 | 438 |
| 1460 | 3300045836 | Ga0466958_0011623 | Ga0466958_0011623_16_1359 | 438 |
| 1461 | 3300045836 | Ga0466958_0041184 | Ga0466958_0041184_1309_2709 | 438 |
| 1462 | 3300045976 | Ga0466967_0009250 | Ga0466967_0009250_2601_3956 | 438 |
| 1463 | 3300045976 | Ga0466967_0009629 | Ga0466967_0009629_1935_3299 | 438 |
| 1464 | 3300045976 | Ga0466967_0147542 | Ga0466967_0147542_574_1929 | 438 |
| 1465 | 3300046794 | Ga0495589_0068308 | Ga0495589_0068308_387_1715 | 438 |
| 1466 | 3300048090 | Ga0495615_0005916 | Ga0495615_0005916_871_2202 | 438 |
| 1467 | 3300048905 | Ga0496102_0011278 | Ga0496102_0011278_385_1758 | 438 |
| 1468 | 3300048906 | Ga0496103_0011446 | Ga0496103_0011446_1933_3306 | 438 |
| 1469 | 3300048911 | Ga0496108_0057509 | Ga0496108_0057509_1190_2566 | 438 |
| 1470 | 3300048912 | Ga0496109_0076274 | Ga0496109_0076274_1385_2761 | 438 |
| 1471 | 3300048915 | Ga0496112_0194690 | Ga0496112_0194690_130_1506 | 438 |
| 1472 | 3300048929 | Ga0496126_0000039 | Ga0496126_0000039_294529_295872 | 438 |
| 1473 | 3300048929 | Ga0496126_0000075 | Ga0496126_0000075_132953_134353 | 438 |
| 1474 | 3300049583 | Ga0501067_0010708 | Ga0501067_0010708_2882_4228 | 438 |
| 1475 | 3300061719 | Ga0466962_0000056 | Ga0466962_0000056_16772_18172 | 438 |
| 1476 | 3300061719 | Ga0466962_0006087 | Ga0466962_0006087_61_1404 | 438 |
| 1477 | 3300061719 | Ga0466962_0009800 | Ga0466962_0009800_1835_3229 | 438 |
| 1478 | 3300061719 | Ga0466962_0018078 | Ga0466962_0018078_340_1695 | 438 |
| 1479 | iso_pu_bacteria | 2506783011 | 2506868573 | 438 |
| 1480 | iso_pu_bacteria | 2527291627 | 2528206638 | 438 |
| 1481 | iso_pu_bacteria | 2527291629 | 2528212030 | 438 |
| 1482 | iso_pu_bacteria | 2546825537 | 2546946947 | 438 |
| 1483 | iso_pu_bacteria | 2576861822 | 2579747544 | 438 |
| 1484 | iso_pu_bacteria | 2582580736 | 2583148894 | 438 |
| 1485 | iso_pu_bacteria | 2622736605 | 2623497715 | 438 |
| 1486 | iso_pu_bacteria | 2684623036 | 2686543539 | 438 |
| 1487 | iso_pu_bacteria | 2710264753 | 2710602608 | 438 |
| 1488 | iso_pu_bacteria | 2751185734 | 2753069843 | 438 |
| 1489 | iso_pu_bacteria | 2773857924 | 2774867069 | 438 |
| 1490 | iso_pu_bacteria | 2773857933 | 2774902955 | 438 |
| 1491 | iso_pu_bacteria | 2791354901 | 2791914400 | 438 |
| 1492 | iso_pu_bacteria | 2870721527 | 2870727646 | 438 |
| 1493 | iso_pu_bacteria | 2891326441 | 2891331593 | 438 |
| 1494 | iso_pu_bacteria | 2899359706 | 2899364797 | 438 |
| 1495 | iso_pu_bacteria | 637000116 | 637877870 | 438 |
| 1496 | iso_pu_bacteria | 8003314358 | 8003316403 | 438 |
| 1497 | iso_pu_bacteria | 8047710418 | 8047719884 | 438 |
| 1498 | iso_pu_bacteria | 8054913762 | 8054920573 | 438 |
| 1499 | iso_pu_bacteria | 8054920844 | 8054922604 | 438 |
| 1500 | 3300005327 | Ga0070658_10000776 | Ga0070658_100007762 | 439 |
| 1501 | 3300005329 | Ga0070683_100110779 | Ga0070683_1001107792 | 439 |
| 1502 | 3300005334 | Ga0068869_100086618 | Ga0068869_1000866182 | 439 |
| 1503 | 3300005335 | Ga0070666_10038699 | Ga0070666_100386992 | 439 |
| 1504 | 3300005336 | Ga0070680_100000142 | Ga0070680_1000001429 | 439 |
| 1505 | 3300005338 | Ga0068868_100093418 | Ga0068868_1000934183 | 439 |
| 1506 | 3300005339 | Ga0070660_100093165 | Ga0070660_1000931652 | 439 |
| 1507 | 3300005345 | Ga0070692_10027337 | Ga0070692_100273373 | 439 |
| 1508 | 3300005345 | Ga0070692_10038183 | Ga0070692_100381833 | 439 |
| 1509 | 3300005365 | Ga0070688_100057304 | Ga0070688_1000573043 | 439 |
| 1510 | 3300005366 | Ga0070659_100032701 | Ga0070659_1000327013 | 439 |
| 1511 | 3300005406 | Ga0070703_10009742 | Ga0070703_100097422 | 439 |
| 1512 | 3300005458 | Ga0070681_10000077 | Ga0070681_1000007723 | 439 |
| 1513 | 3300005471 | Ga0070698_100045276 | Ga0070698_1000452763 | 439 |
| 1514 | 3300005530 | Ga0070679_100000135 | Ga0070679_1000001354 | 439 |
| 1515 | 3300005530 | Ga0070679_100167285 | Ga0070679_1001672852 | 439 |
| 1516 | 3300005536 | Ga0070697_100002048 | Ga0070697_1000020489 | 439 |
| 1517 | 3300005539 | Ga0068853_100044645 | Ga0068853_1000446453 | 439 |
| 1518 | 3300005564 | Ga0070664_100031931 | Ga0070664_1000319313 | 439 |
| 1519 | 3300005577 | Ga0068857_100033853 | Ga0068857_1000338532 | 439 |
| 1520 | 3300005617 | Ga0068859_100061973 | Ga0068859_1000619732 | 439 |
| 1521 | 3300005618 | Ga0068864_100049976 | Ga0068864_1000499762 | 439 |
| 1522 | 3300005841 | Ga0068863_100115358 | Ga0068863_1001153583 | 439 |
| 1523 | 3300006931 | Ga0097620_100061974 | Ga0097620_1000619743 | 439 |
| 1524 | 3300009176 | Ga0105242_10041014 | Ga0105242_100410145 | 439 |
| 1525 | 3300009545 | Ga0105237_10044770 | Ga0105237_100447705 | 439 |
| 1526 | 3300010159 | Ga0099796_10029146 | Ga0099796_100291461 | 439 |
| 1527 | 3300013102 | Ga0157371_10056311 | Ga0157371_100563113 | 439 |
| 1528 | 3300013105 | Ga0157369_10000890 | Ga0157369_100008904 | 439 |
| 1529 | 3300013105 | Ga0157369_10098846 | Ga0157369_100988463 | 439 |
| 1530 | 3300013105 | Ga0157369_10100808 | Ga0157369_101008082 | 439 |
| 1531 | 3300013105 | Ga0157369_10269053 | Ga0157369_102690532 | 439 |
| 1532 | 3300013307 | Ga0157372_10252452 | Ga0157372_102524522 | 439 |
| 1533 | 3300014325 | Ga0163163_10109215 | Ga0163163_101092152 | 439 |
| 1534 | 3300020069 | Ga0197907_10125209 | Ga0197907_101252093 | 439 |
| 1535 | 3300020610 | Ga0154015_1690007 | Ga0154015_16900072 | 439 |
| 1536 | 3300022467 | Ga0224712_10000868 | Ga0224712_100008684 | 439 |
| 1537 | 3300022467 | Ga0224712_10001321 | Ga0224712_100013212 | 439 |
| 1538 | 3300025885 | Ga0207653_10019979 | Ga0207653_100199792 | 439 |
| 1539 | 3300025901 | Ga0207688_10003133 | Ga0207688_100031334 | 439 |
| 1540 | 3300025903 | Ga0207680_10055310 | Ga0207680_100553102 | 439 |
| 1541 | 3300025909 | Ga0207705_10000676 | Ga0207705_100006763 | 439 |
| 1542 | 3300025909 | Ga0207705_10138892 | Ga0207705_101388922 | 439 |
| 1543 | 3300025912 | Ga0207707_10000089 | Ga0207707_1000008923 | 439 |
| 1544 | 3300025912 | Ga0207707_10010633 | Ga0207707_100106334 | 439 |
| 1545 | 3300025917 | Ga0207660_10000815 | Ga0207660_1000081513 | 439 |
| 1546 | 3300025917 | Ga0207660_10163950 | Ga0207660_101639502 | 439 |
| 1547 | 3300025919 | Ga0207657_10002680 | Ga0207657_1000268014 | 439 |
| 1548 | 3300025919 | Ga0207657_10084696 | Ga0207657_100846963 | 439 |
| 1549 | 3300025921 | Ga0207652_10000015 | Ga0207652_1000001581 | 439 |
| 1550 | 3300025921 | Ga0207652_10016837 | Ga0207652_100168375 | 439 |
| 1551 | 3300025927 | Ga0207687_10153233 | Ga0207687_101532332 | 439 |
| 1552 | 3300025932 | Ga0207690_10000171 | Ga0207690_1000017123 | 439 |
| 1553 | 3300025933 | Ga0207706_10053435 | Ga0207706_100534353 | 439 |
| 1554 | 3300025934 | Ga0207686_10070814 | Ga0207686_100708142 | 439 |
| 1555 | 3300025939 | Ga0207665_10041528 | Ga0207665_100415283 | 439 |
| 1556 | 3300025942 | Ga0207689_10006800 | Ga0207689_100068004 | 439 |
| 1557 | 3300026023 | Ga0207677_10003695 | Ga0207677_100036959 | 439 |
| 1558 | 3300026067 | Ga0207678_10002619 | Ga0207678_100026192 | 439 |
| 1559 | 3300026075 | Ga0207708_10013101 | Ga0207708_100131014 | 439 |
| 1560 | 3300026078 | Ga0207702_10143824 | Ga0207702_101438242 | 439 |
| 1561 | 3300026116 | Ga0207674_10013076 | Ga0207674_100130768 | 439 |
| 1562 | 3300026118 | Ga0207675_100022173 | Ga0207675_1000221732 | 439 |
| 1563 | 3300026121 | Ga0207683_10001504 | Ga0207683_1000150410 | 439 |
| 1564 | 3300030742 | Ga0316183_1115972 | Ga0316183_11159722 | 439 |
| 1565 | 3300031241 | Ga0265325_10003221 | Ga0265325_100032213 | 439 |
| 1566 | 3300031249 | Ga0265339_10008767 | Ga0265339_100087674 | 439 |
| 1567 | 3300031456 | Ga0307513_10000002 | Ga0307513_10000002505 | 439 |
| 1568 | 3300031711 | Ga0265314_10006663 | Ga0265314_100066638 | 439 |
| 1569 | 3300031712 | Ga0265342_10042943 | Ga0265342_100429432 | 439 |
| 1570 | 3300031727 | Ga0316576_10001518 | Ga0316576_100015182 | 439 |
| 1571 | 3300031728 | Ga0316578_10010142 | Ga0316578_100101422 | 439 |
| 1572 | 3300031852 | Ga0307410_10045221 | Ga0307410_100452212 | 439 |
| 1573 | 3300035090 | Ga0373949_0005321 | Ga0373949_0005321_145_1524 | 439 |
| 1574 | 3300035111 | Ga0373923_0001801 | Ga0373923_0001801_4072_5451 | 439 |
| 1575 | 3300035113 | Ga0373936_0000466 | Ga0373936_0000466_4151_5530 | 439 |
| 1576 | 3300035116 | Ga0373945_0001125 | Ga0373945_0001125_2467_3846 | 439 |
| 1577 | 3300035117 | Ga0373953_0001306 | Ga0373953_0001306_4087_5466 | 439 |
| 1578 | 3300035118 | Ga0373954_0025370 | Ga0373954_0025370_1064_2443 | 439 |
| 1579 | 3300035119 | Ga0373956_0003065 | Ga0373956_0003065_3258_4637 | 439 |
| 1580 | 3300035121 | Ga0373960_0004283 | Ga0373960_0004283_187_1566 | 439 |
| 1581 | 3300035171 | Ga0373946_0001321 | Ga0373946_0001321_1532_2911 | 439 |
| 1582 | 3300035172 | Ga0373955_0003782 | Ga0373955_0003782_131_1510 | 439 |
| 1583 | 3300035242 | Ga0373962_0011117 | Ga0373962_0011117_725_2104 | 439 |
| 1584 | 3300035398 | Ga0316574_0024953 | Ga0316574_0024953_827_2152 | 439 |
| 1585 | 3300035410 | Ga0373924_0005485 | Ga0373924_0005485_1959_3338 | 439 |
| 1586 | 3300035691 | Ga0373931_0008885 | Ga0373931_0008885_2338_3717 | 439 |
| 1587 | 3300035692 | Ga0373935_0014322 | Ga0373935_0014322_987_2366 | 439 |
| 1588 | 3300035725 | Ga0373947_0009537 | Ga0373947_0009537_2429_3808 | 439 |
| 1589 | 3300036712 | Ga0316584_0005744 | Ga0316584_0005744_610_1935 | 439 |
| 1590 | 3300037418 | Ga0395900_0003901 | Ga0395900_0003901_2775_4109 | 439 |
| 1591 | 3300039450 | Ga0436363_0129189 | Ga0436363_0129189_369_1724 | 439 |
| 1592 | 3300041404 | Ga0439436_0002022 | Ga0439436_0002022_1001_2338 | 439 |
| 1593 | 3300041999 | Ga0439433_0009801 | Ga0439433_0009801_255_1595 | 439 |
| 1594 | 3300042002 | Ga0439442_002424 | Ga0439442_002424_1315_2655 | 439 |
| 1595 | 3300042014 | Ga0439457_004100 | Ga0439457_004100_205_1545 | 439 |
| 1596 | 3300044693 | Ga0466961_0001660 | Ga0466961_0001660_538_1896 | 439 |
| 1597 | 3300044693 | Ga0466961_0049882 | Ga0466961_0049882_1202_2557 | 439 |
| 1598 | 3300044706 | Ga0466964_0019639 | Ga0466964_0019639_715_2043 | 439 |
| 1599 | 3300044765 | Ga0466970_0067744 | Ga0466970_0067744_167_1489 | 439 |
| 1600 | 3300045049 | Ga0466959_0059597 | Ga0466959_0059597_475_1839 | 439 |
| 1601 | 3300045049 | Ga0466959_0084429 | Ga0466959_0084429_95_1450 | 439 |
| 1602 | 3300045049 | Ga0466959_0089585 | Ga0466959_0089585_375_1709 | 439 |
| 1603 | 3300045049 | Ga0466959_0093383 | Ga0466959_0093383_691_2043 | 439 |
| 1604 | 3300045836 | Ga0466958_0070299 | Ga0466958_0070299_179_1507 | 439 |
| 1605 | 3300045976 | Ga0466967_0009645 | Ga0466967_0009645_3036_4364 | 439 |
| 1606 | 3300045976 | Ga0466967_0010064 | Ga0466967_0010064_3541_4878 | 439 |
| 1607 | 3300045976 | Ga0466967_0059846 | Ga0466967_0059846_1201_2532 | 439 |
| 1608 | 3300046455 | Ga0495603_0009235 | Ga0495603_0009235_498_1877 | 439 |
| 1609 | 3300046459 | Ga0495629_0002245 | Ga0495629_0002245_9755_11134 | 439 |
| 1610 | 3300046461 | Ga0495641_0009246 | Ga0495641_0009246_3962_5341 | 439 |
| 1611 | 3300046463 | Ga0495653_0004573 | Ga0495653_0004573_2449_3828 | 439 |
| 1612 | 3300046475 | Ga0495639_0003954 | Ga0495639_0003954_4896_6275 | 439 |
| 1613 | 3300046476 | Ga0495662_0002349 | Ga0495662_0002349_4146_5525 | 439 |
| 1614 | 3300046477 | Ga0495664_0065266 | Ga0495664_0065266_258_1637 | 439 |
| 1615 | 3300046511 | Ga0495608_0012884 | Ga0495608_0012884_2003_3382 | 439 |
| 1616 | 3300046516 | Ga0495628_0095450 | Ga0495628_0095450_386_1765 | 439 |
| 1617 | 3300046517 | Ga0495630_0008465 | Ga0495630_0008465_908_2287 | 439 |
| 1618 | 3300046526 | Ga0495666_0003647 | Ga0495666_0003647_4209_5588 | 439 |
| 1619 | 3300046531 | Ga0495665_0015610 | Ga0495665_0015610_2449_3828 | 439 |
| 1620 | 3300046535 | Ga0495586_0008930 | Ga0495586_0008930_3049_4428 | 439 |
| 1621 | 3300046559 | Ga0495667_0038390 | Ga0495667_0038390_780_2159 | 439 |
| 1622 | 3300046642 | Ga0495634_0008927 | Ga0495634_0008927_5658_7037 | 439 |
| 1623 | 3300046678 | Ga0495599_0027522 | Ga0495599_0027522_1405_2784 | 439 |
| 1624 | 3300046679 | Ga0495623_0012970 | Ga0495623_0012970_2389_3768 | 439 |
| 1625 | 3300046680 | Ga0495646_0002906 | Ga0495646_0002906_5225_6604 | 439 |
| 1626 | 3300046683 | Ga0495658_0029170 | Ga0495658_0029170_298_1677 | 439 |
| 1627 | 3300046689 | Ga0495613_0007268 | Ga0495613_0007268_406_1785 | 439 |
| 1628 | 3300046690 | Ga0495624_0000535 | Ga0495624_0000535_6178_7557 | 439 |
| 1629 | 3300046809 | Ga0495600_0021071 | Ga0495600_0021071_1763_3142 | 439 |
| 1630 | 3300047315 | Ga0495581_0003107 | Ga0495581_0003107_4141_5520 | 439 |
| 1631 | 3300047322 | Ga0495680_0022892 | Ga0495680_0022892_258_1637 | 439 |
| 1632 | 3300047471 | Ga0495684_0023120 | Ga0495684_0023120_2449_3828 | 439 |
| 1633 | 3300047673 | Ga0495593_0013292 | Ga0495593_0013292_2540_3919 | 439 |
| 1634 | 3300048089 | Ga0495614_0017285 | Ga0495614_0017285_566_1945 | 439 |
| 1635 | 3300048908 | Ga0496105_0112736 | Ga0496105_0112736_523_1902 | 439 |
| 1636 | 3300048909 | Ga0496106_0019812 | Ga0496106_0019812_2635_4014 | 439 |
| 1637 | 3300048913 | Ga0496110_0080252 | Ga0496110_0080252_1172_2551 | 439 |
| 1638 | 3300048917 | Ga0496114_0036877 | Ga0496114_0036877_1067_2446 | 439 |
| 1639 | 3300049585 | Ga0501069_0000223 | Ga0501069_0000223_12467_13828 | 439 |
| 1640 | 3300049586 | Ga0501070_0001165 | Ga0501070_0001165_10962_12323 | 439 |
| 1641 | 3300049586 | Ga0501070_0001589 | Ga0501070_0001589_1461_2831 | 439 |
| 1642 | 3300049586 | Ga0501070_0003370 | Ga0501070_0003370_12289_13650 | 439 |
| 1643 | 3300049590 | Ga0501074_0014120 | Ga0501074_0014120_1058_2428 | 439 |
| 1644 | 3300049741 | Ga0501079_0000093 | Ga0501079_0000093_21168_22538 | 439 |
| 1645 | 3300049742 | Ga0501080_0000266 | Ga0501080_0000266_10814_12175 | 439 |
| 1646 | 3300049742 | Ga0501080_0003067 | Ga0501080_0003067_8694_10064 | 439 |
| 1647 | 3300049742 | Ga0501080_0016463 | Ga0501080_0016463_1017_2378 | 439 |
| 1648 | 3300049823 | Ga0501044_0010160 | Ga0501044_0010160_7581_8942 | 439 |
| 1649 | 3300053077 | Ga0495601_0010705 | Ga0495601_0010705_908_2287 | 439 |
| 1650 | 3300053078 | Ga0495612_0000929 | Ga0495612_0000929_9087_10466 | 439 |
| 1651 | 3300053085 | Ga0495619_0005371 | Ga0495619_0005371_2726_4105 | 439 |
| 1652 | 3300053139 | Ga0500568_0000706 | Ga0500568_0000706_135_1493 | 439 |
| 1653 | 3300000549 | LJQas_1007077 | LJQas_10070771 | 440 |
| 1654 | 3300005434 | Ga0070709_10045596 | Ga0070709_100455962 | 440 |
| 1655 | 3300006173 | Ga0070716_100025356 | Ga0070716_1000253562 | 440 |
| 1656 | 3300025898 | Ga0207692_10041273 | Ga0207692_100412732 | 440 |
| 1657 | 3300025905 | Ga0207685_10028071 | Ga0207685_100280712 | 440 |
| 1658 | 3300025906 | Ga0207699_10066505 | Ga0207699_100665052 | 440 |
| 1659 | 3300025915 | Ga0207693_10029887 | Ga0207693_100298874 | 440 |
| 1660 | 3300025928 | Ga0207700_10065136 | Ga0207700_100651363 | 440 |
| 1661 | 3300025929 | Ga0207664_10016390 | Ga0207664_100163902 | 440 |
| 1662 | 3300025939 | Ga0207665_10043041 | Ga0207665_100430413 | 440 |
| 1663 | 3300035086 | Ga0373934_0003190 | Ga0373934_0003190_3819_5198 | 440 |
| 1664 | 3300035089 | Ga0373944_0007599 | Ga0373944_0007599_41_1420 | 440 |
| 1665 | 3300035113 | Ga0373936_0051674 | Ga0373936_0051674_198_1577 | 440 |
| 1666 | 3300035116 | Ga0373945_0005546 | Ga0373945_0005546_152_1531 | 440 |
| 1667 | 3300035170 | Ga0373943_0001264 | Ga0373943_0001264_2971_4350 | 440 |
| 1668 | 3300035692 | Ga0373935_0029064 | Ga0373935_0029064_1917_3296 | 440 |
| 1669 | 3300035695 | Ga0373927_0002894 | Ga0373927_0002894_4293_5672 | 440 |
| 1670 | 3300035725 | Ga0373947_0003402 | Ga0373947_0003402_5999_7378 | 440 |
| 1671 | 3300036401 | Ga0373937_0053491 | Ga0373937_0053491_1077_2456 | 440 |
| 1672 | 3300037068 | Ga0373925_0050996 | Ga0373925_0050996_439_1818 | 440 |
| 1673 | 3300046461 | Ga0495641_0007399 | Ga0495641_0007399_935_2314 | 440 |
| 1674 | 3300046463 | Ga0495653_0066800 | Ga0495653_0066800_149_1528 | 440 |
| 1675 | 3300046463 | Ga0495653_0158387 | Ga0495653_0158387_139_1518 | 440 |
| 1676 | 3300046475 | Ga0495639_0028677 | Ga0495639_0028677_400_1779 | 440 |
| 1677 | 3300046477 | Ga0495664_0008545 | Ga0495664_0008545_3671_5050 | 440 |
| 1678 | 3300046511 | Ga0495608_0058655 | Ga0495608_0058655_721_2100 | 440 |
| 1679 | 3300046516 | Ga0495628_0055179 | Ga0495628_0055179_752_2131 | 440 |
| 1680 | 3300046517 | Ga0495630_0018073 | Ga0495630_0018073_1751_3130 | 440 |
| 1681 | 3300046529 | Ga0495652_0086307 | Ga0495652_0086307_766_2145 | 440 |
| 1682 | 3300046559 | Ga0495667_0018746 | Ga0495667_0018746_1807_3186 | 440 |
| 1683 | 3300046642 | Ga0495634_0091681 | Ga0495634_0091681_232_1611 | 440 |
| 1684 | 3300046663 | Ga0495635_0036284 | Ga0495635_0036284_1860_3239 | 440 |
| 1685 | 3300046675 | Ga0495657_0053190 | Ga0495657_0053190_318_1697 | 440 |
| 1686 | 3300046690 | Ga0495624_0011184 | Ga0495624_0011184_4270_5649 | 440 |
| 1687 | 3300047319 | Ga0495674_0001362 | Ga0495674_0001362_20976_22355 | 440 |
| 1688 | 3300047321 | Ga0495676_0058754 | Ga0495676_0058754_1112_2491 | 440 |
| 1689 | 3300047322 | Ga0495680_0034707 | Ga0495680_0034707_1669_3048 | 440 |
| 1690 | 3300047322 | Ga0495680_0037991 | Ga0495680_0037991_1504_2883 | 440 |
| 1691 | 3300047471 | Ga0495684_0000973 | Ga0495684_0000973_20472_21851 | 440 |
| 1692 | 3300047471 | Ga0495684_0106123 | Ga0495684_0106123_329_1708 | 440 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8e9h-assembly1.cif.gz_D | mycobacterial respiratory complex i, fully-inserted quinone | 0.9709 | 40 | 440 |
| 8e73-assembly1.cif.gz_S2 | vigna radiata supercomplex i+iii2 (full bridge) | 0.968 | 56 | 440 |
| 7qsn-assembly1.cif.gz_D | bovine complex i in lipid nanodisc, deactive-apo | 0.9654 | 61 | 440 |
| 7ard-assembly1.cif.gz_D | cryo-em structure of polytomella complex-i (complete composition) | 0.9647 | 44 | 440 |
| 8bq6-assembly1.cif.gz_D | cryo-em structure of the arabidopsis thaliana i+iii2 supercomplex (complete conformation 2 composition) | 0.9634 | 42 | 440 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WJH5_38_440_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.9708 | 40 | 440 | 1.10.645.10 |
| af_P9WJH5_38_440_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.9637 | 40 | 440 | 1.10.645.10 |
| af_P33599_211_596_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.9538 | 42 | 440 | 1.10.645.10 |
| af_P33599_211_596_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.9466 | 42 | 440 | 1.10.645.10 |
| af_P16431_180_537_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.9465 | 42 | 431 | 1.10.645.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6G3WKU9-F1-model_v4 | NADH dehydrogenase subunit D | 0.9889 | 157 | 325 |
GO:0016651
GO:0048038 GO:0051287 |
| AF-A0A5K1HSC0-F1-model_v4 | NADH-quinone oxidoreductase subunit D domain-containing protein | 0.9881 | 195 | 319 |
GO:0009535
GO:0016651 GO:0048038 GO:0051287 |
| AF-A0A7V9PQV1-F1-model_v4 | NADH-quinone oxidoreductase subunit D (EC 1.6.5.11) | 0.9854 | 58 | 440 |
GO:0016651
GO:0048038 GO:0051287 |
| AF-A0A5Q0UUT2-F1-model_v4 | NADH-plastoquinone oxidoreductase subunit 7 | 0.9853 | 106 | 321 |
GO:0009535
GO:0016651 GO:0048038 GO:0051287 |
| AF-A0A4R2U8P3-F1-model_v4 | deleted | 0.9851 | 86 | 440 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar