F495360

General Info

Members Datasets Scaffolds Average Seq Length
1692 464 3384 168

Family's Representative Sequence

Representative Sequence 3300049577|Ga0501041_0115562|Ga0501041_0115562_633_1202
Length 189
Sequence MKRSEKEQLVTELREKMVGAKALYYTDFTGLNVKRMTELRRRLRKAGVEYVVIKNTLALRAVNESGLTGQRLRGPTGVVIGKDPIAAAKVLADFAKEFDAKPEVKGGLLEGKQIDVAQVKKLAALPSREQMLADLGAGLMSPMAAFVGALNGLLYMFAGALDDGPRPVGSGTGSDDHGYYSTRSRGHNG

Samples

Sample ID Description Type Environment
1 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
89 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
90 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
119 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
120 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
121 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
122 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
144 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
224 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
228 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
229 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
230 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
231 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
232 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
233 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
234 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
235 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
236 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
237 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
238 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
239 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
240 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
241 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
242 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
243 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
244 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
245 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
246 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
247 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
248 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
249 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
250 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
251 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
252 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
253 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
254 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
255 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
256 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
257 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
258 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
259 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
260 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
261 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
262 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
263 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
264 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
265 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
266 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
267 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
268 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
269 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
270 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
271 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
272 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
273 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
274 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
275 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
276 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
277 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
278 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
279 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
280 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
281 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
282 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
283 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
284 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
285 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
286 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
287 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
288 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
289 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
290 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
291 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
292 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
293 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
294 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
295 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
296 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
297 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
298 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
299 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
300 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
301 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
302 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
303 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
304 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
305 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
306 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
307 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
308 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
309 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
310 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
311 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
312 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
313 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
314 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
315 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
316 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
317 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
318 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
319 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
320 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
321 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
322 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
323 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
324 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
325 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
326 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
327 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
328 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
329 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
330 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
331 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
332 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
333 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
334 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
335 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
336 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
337 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
338 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
339 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
340 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
341 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
342 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
343 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
344 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
345 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
346 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
347 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
348 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
349 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
350 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
351 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
352 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
353 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
354 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
355 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
356 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
357 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
358 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
359 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
360 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
361 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
362 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
363 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
364 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
365 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
366 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
367 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
368 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
369 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
370 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
371 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
372 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
373 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
374 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
375 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
376 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
377 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
378 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
379 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
380 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
381 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
386 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
387 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
388 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
398 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
402 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
403 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
410 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
411 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
412 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
413 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
414 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
415 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
416 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
417 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
418 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
419 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
420 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
421 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
422 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
423 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
424 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
425 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
426 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
427 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
428 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
429 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
430 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
431 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
432 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
433 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
434 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
435 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
436 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
437 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
438 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
439 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
440 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
441 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
442 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
443 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
445 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
446 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
447 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
448 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
449 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
450 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
451 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
452 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
453 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
454 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
455 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
456 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
457 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
458 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
459 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
460 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
463 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
464 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.4
Metatranscriptomes 2.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.83
Rhizosphere 97.75
Stem 0
Stem Tuber 0
Unclassified 3.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501041_0115562 3300049577 Bacteria 1666
2 LJQas_1008719 3300000549 Bacteria 1229
3 JGI24737J22298_10047709 3300001990 Bacteria 1305
4 JGI24735J21928_10152635 3300002067 Unclassified 667
5 JGI24750J21931_1010721 3300002070 Unclassified 1198
6 JGI26145J50221_1002425 3300003371 Bacteria 1468
7 Ga0058861_10085796 3300004800 Bacteria 1858
8 Ga0058861_10097294 3300004800 Bacteria 1402
9 Ga0058861_10124789 3300004800 Bacteria 5820
10 Ga0058861_10157639 3300004800 Bacteria 6475
11 Ga0058861_11844075 3300004800 Bacteria 1143
12 Ga0058862_10020038 3300004803 Bacteria 947
13 Ga0058862_10123762 3300004803 Bacteria 2815
14 Ga0058862_10283756 3300004803 Bacteria 1871
15 Ga0058862_10288296 3300004803 Bacteria 7548
16 Ga0058862_12486219 3300004803 Bacteria 882
17 Ga0058862_12612346 3300004803 Bacteria 1160
18 Ga0058862_12737859 3300004803 Bacteria 1315
19 Ga0058862_12847149 3300004803 Bacteria 714
20 Ga0065712_10175774 3300005290 Bacteria 1213
21 Ga0065715_10092142 3300005293 Bacteria 5307
22 Ga0065715_10100313 3300005293 Bacteria 3317
23 Ga0065707_10155111 3300005295 Bacteria 1617
24 Ga0070658_10022117 3300005327 Bacteria 5100
25 Ga0070658_10046451 3300005327 Bacteria 3513
26 Ga0070658_10105917 3300005327 Bacteria 2326
27 Ga0070658_10108142 3300005327 Bacteria 2302
28 Ga0070658_10127177 3300005327 Bacteria 2121
29 Ga0070658_10129323 3300005327 Bacteria 2104
30 Ga0070658_10241595 3300005327 Bacteria 1531
31 Ga0070658_10696827 3300005327 Bacteria 881
32 Ga0070658_10816000 3300005327 Bacteria 810
33 Ga0070658_10829537 3300005327 Bacteria 803
34 Ga0070658_11347551 3300005327 Bacteria 619
35 Ga0070658_11375869 3300005327 Bacteria 613
36 Ga0070676_10000852 3300005328 Bacteria 15089
37 Ga0070676_10057418 3300005328 Bacteria 2303
38 Ga0070676_10073120 3300005328 Bacteria 2062
39 Ga0070683_100017450 3300005329 Bacteria 6345
40 Ga0070683_100017633 3300005329 Bacteria 6310
41 Ga0070683_100031156 3300005329 Bacteria 4847
42 Ga0070683_100042520 3300005329 Bacteria 4184
43 Ga0070683_100050790 3300005329 Bacteria 3840
44 Ga0070683_100051102 3300005329 Bacteria 3827
45 Ga0070683_100057657 3300005329 Bacteria 3608
46 Ga0070683_100076000 3300005329 Bacteria 3139
47 Ga0070683_100111127 3300005329 Bacteria 2585
48 Ga0070683_100111963 3300005329 Bacteria 2575
49 Ga0070683_100125609 3300005329 Bacteria 2425
50 Ga0070683_100138611 3300005329 Bacteria 2304
51 Ga0070683_100152247 3300005329 Bacteria 2193
52 Ga0070683_100155893 3300005329 Bacteria 2165
53 Ga0070683_100176228 3300005329 Bacteria 2030
54 Ga0070683_100259623 3300005329 Bacteria 1652
55 Ga0070683_100302256 3300005329 Bacteria 1522
56 Ga0070683_100342173 3300005329 Bacteria 1424
57 Ga0070683_100348871 3300005329 Bacteria 1409
58 Ga0070683_100495736 3300005329 Bacteria 1167
59 Ga0070683_101543960 3300005329 Bacteria 638
60 Ga0070690_100045525 3300005330 Bacteria 2787
61 Ga0070690_100080505 3300005330 Bacteria 2130
62 Ga0070690_100261442 3300005330 Bacteria 1228
63 Ga0070690_100284359 3300005330 Bacteria 1181
64 Ga0070690_100566124 3300005330 Bacteria 858
65 Ga0070690_100630757 3300005330 Bacteria 816
66 Ga0070690_100691126 3300005330 Bacteria 783
67 Ga0070670_100031678 3300005331 Bacteria 4554
68 Ga0070670_100048175 3300005331 Bacteria 3667
69 Ga0070670_100156530 3300005331 Bacteria 1974
70 Ga0070670_100183926 3300005331 Bacteria 1814
71 Ga0070670_100529864 3300005331 Bacteria 1049
72 Ga0070677_10026152 3300005333 Bacteria 2185
73 Ga0068869_100006678 3300005334 Bacteria 7327
74 Ga0068869_100009010 3300005334 Bacteria 6465
75 Ga0068869_100043571 3300005334 Bacteria 3224
76 Ga0070666_10070528 3300005335 Bacteria 2377
77 Ga0070666_10347650 3300005335 Bacteria 1060
78 Ga0070680_100011610 3300005336 Bacteria 6823
79 Ga0070680_100011619 3300005336 Bacteria 6820
80 Ga0070680_100013410 3300005336 Bacteria 6381
81 Ga0070680_100017458 3300005336 Bacteria 5659
82 Ga0070680_100098375 3300005336 Bacteria 2426
83 Ga0070680_100392140 3300005336 Bacteria 1183
84 Ga0070680_100515481 3300005336 Bacteria 1024
85 Ga0070680_100839965 3300005336 Bacteria 792
86 Ga0070682_100002789 3300005337 Bacteria 9676
87 Ga0070682_100022340 3300005337 Bacteria 3746
88 Ga0070682_100335735 3300005337 Bacteria 1122
89 Ga0070682_100348933 3300005337 Bacteria 1103
90 Ga0070682_100876439 3300005337 Bacteria 736
91 Ga0070682_100878646 3300005337 Bacteria 735
92 Ga0068868_100136844 3300005338 Bacteria 2008
93 Ga0068868_100200774 3300005338 Bacteria 1662
94 Ga0068868_100364796 3300005338 Bacteria 1240
95 Ga0068868_100653410 3300005338 Bacteria 937
96 Ga0070660_100025168 3300005339 Bacteria 4422
97 Ga0070660_100055168 3300005339 Bacteria 3070
98 Ga0070660_100080276 3300005339 Bacteria 2559
99 Ga0070660_100145041 3300005339 Bacteria 1906
100 Ga0070660_100426367 3300005339 Bacteria 1099
101 Ga0070660_100445841 3300005339 Bacteria 1073
102 Ga0070660_100491138 3300005339 Bacteria 1021
103 Ga0070660_100552485 3300005339 Bacteria 961
104 Ga0070660_100635638 3300005339 Bacteria 893
105 Ga0070689_100135475 3300005340 Bacteria 1977
106 Ga0070691_10005497 3300005341 Bacteria 5765
107 Ga0070691_10012073 3300005341 Bacteria 3956
108 Ga0070691_10021041 3300005341 Bacteria 3016
109 Ga0070691_10129407 3300005341 Bacteria 1278
110 Ga0070691_10201586 3300005341 Bacteria 1045
111 Ga0070691_10206323 3300005341 Bacteria 1035
112 Ga0070687_100001584 3300005343 Bacteria 8085
113 Ga0070687_100088116 3300005343 Bacteria 1710
114 Ga0070661_100008164 3300005344 Bacteria 7223
115 Ga0070661_100038705 3300005344 Bacteria 3473
116 Ga0070661_100039084 3300005344 Bacteria 3456
117 Ga0070661_100076100 3300005344 Bacteria 2474
118 Ga0070661_100144028 3300005344 Bacteria 1797
119 Ga0070661_100144197 3300005344 Bacteria 1796
120 Ga0070661_100188826 3300005344 Bacteria 1571
121 Ga0070661_100226501 3300005344 Bacteria 1435
122 Ga0070661_100544110 3300005344 Bacteria 933
123 Ga0070661_100684247 3300005344 Bacteria 835
124 Ga0070661_100872494 3300005344 Bacteria 741
125 Ga0070661_101412734 3300005344 Unclassified 586
126 Ga0070692_10001021 3300005345 Bacteria 9643
127 Ga0070692_10003744 3300005345 Bacteria 6248
128 Ga0070692_10211326 3300005345 Bacteria 1142
129 Ga0070692_10213493 3300005345 Bacteria 1137
130 Ga0070692_10226497 3300005345 Bacteria 1107
131 Ga0070692_10277897 3300005345 Bacteria 1014
132 Ga0070692_10281083 3300005345 Bacteria 1009
133 Ga0070692_10309949 3300005345 Bacteria 967
134 Ga0070668_100051201 3300005347 Bacteria 3181
135 Ga0070668_100087088 3300005347 Bacteria 2457
136 Ga0070668_100155116 3300005347 Bacteria 1854
137 Ga0070668_100714470 3300005347 Bacteria 885
138 Ga0070669_100005808 3300005353 Bacteria 8898
139 Ga0070669_100041791 3300005353 Bacteria 3335
140 Ga0070669_100093042 3300005353 Bacteria 2263
141 Ga0070669_100254196 3300005353 Bacteria 1400
142 Ga0070669_100273040 3300005353 Bacteria 1353
143 Ga0070669_100736093 3300005353 Bacteria 835
144 Ga0070675_100011662 3300005354 Bacteria 6887
145 Ga0070675_100072332 3300005354 Bacteria 2862
146 Ga0070675_100115402 3300005354 Bacteria 2276
147 Ga0070675_100185814 3300005354 Bacteria 1798
148 Ga0070675_100351888 3300005354 Bacteria 1306
149 Ga0070675_100396511 3300005354 Bacteria 1231
150 Ga0070675_100490986 3300005354 Bacteria 1105
151 Ga0070675_100626844 3300005354 Bacteria 976
152 Ga0070675_101213162 3300005354 Bacteria 695
153 Ga0070671_100069692 3300005355 Bacteria 2933
154 Ga0070671_100192757 3300005355 Bacteria 1727
155 Ga0070671_100234679 3300005355 Bacteria 1557
156 Ga0070671_100530185 3300005355 Bacteria 1014
157 Ga0070674_100096788 3300005356 Bacteria 2142
158 Ga0070674_100404982 3300005356 Bacteria 1116
159 Ga0070673_100070036 3300005364 Bacteria 2813
160 Ga0070673_100197175 3300005364 Bacteria 1732
161 Ga0070673_100362681 3300005364 Bacteria 1288
162 Ga0070673_100521130 3300005364 Unclassified 1077
163 Ga0070673_100915855 3300005364 Bacteria 813
164 Ga0070673_101019703 3300005364 Bacteria 771
165 Ga0070688_100017758 3300005365 Bacteria 4088
166 Ga0070688_100073684 3300005365 Bacteria 2190
167 Ga0070688_100277589 3300005365 Bacteria 1203
168 Ga0070659_100035632 3300005366 Bacteria 3875
169 Ga0070659_100040972 3300005366 Bacteria 3619
170 Ga0070659_100058072 3300005366 Bacteria 3052
171 Ga0070659_100116203 3300005366 Bacteria 2163
172 Ga0070659_100267284 3300005366 Bacteria 1420
173 Ga0070659_100305102 3300005366 Bacteria 1328
174 Ga0070659_100342020 3300005366 Bacteria 1254
175 Ga0070659_100498800 3300005366 Bacteria 1037
176 Ga0070659_100633433 3300005366 Unclassified 921
177 Ga0070659_100750343 3300005366 Bacteria 846
178 Ga0070659_100829065 3300005366 Bacteria 805
179 Ga0070659_100864544 3300005366 Bacteria 789
180 Ga0070667_100168956 3300005367 Bacteria 1930
181 Ga0070667_100213539 3300005367 Bacteria 1715
182 Ga0070667_100237843 3300005367 Bacteria 1625
183 Ga0070667_100271420 3300005367 Bacteria 1521
184 Ga0070667_100298998 3300005367 Bacteria 1449
185 Ga0070667_100347388 3300005367 Bacteria 1342
186 Ga0070667_100372090 3300005367 Bacteria 1297
187 Ga0070667_100768905 3300005367 Bacteria 893
188 Ga0070667_101540560 3300005367 Bacteria 624
189 Ga0070709_10038698 3300005434 Bacteria 2922
190 Ga0070709_10060989 3300005434 Bacteria 2399
191 Ga0070709_10163831 3300005434 Bacteria 1548
192 Ga0070709_10252174 3300005434 Bacteria 1272
193 Ga0070714_100089794 3300005435 Bacteria 2690
194 Ga0070714_100492315 3300005435 Bacteria 1168
195 Ga0070713_100005886 3300005436 Bacteria 8431
196 Ga0070713_100017836 3300005436 Bacteria 5382
197 Ga0070713_100060655 3300005436 Bacteria 3162
198 Ga0070713_100395574 3300005436 Bacteria 1290
199 Ga0070713_100643096 3300005436 Bacteria 1010
200 Ga0070713_101555207 3300005436 Unclassified 642
201 Ga0070710_10016381 3300005437 Bacteria 3771
202 Ga0070710_10163396 3300005437 Bacteria 1382
203 Ga0070710_10206549 3300005437 Bacteria 1243
204 Ga0070710_10216641 3300005437 Bacteria 1216
205 Ga0070710_10308458 3300005437 Bacteria 1035
206 Ga0070710_10341463 3300005437 Bacteria 989
207 Ga0070701_10031401 3300005438 Bacteria 2635
208 Ga0070701_10142398 3300005438 Bacteria 1373
209 Ga0070711_100016949 3300005439 Bacteria 4632
210 Ga0070711_100021768 3300005439 Bacteria 4149
211 Ga0070711_100062598 3300005439 Bacteria 2594
212 Ga0070711_100111753 3300005439 Bacteria 2006
213 Ga0070711_100132268 3300005439 Bacteria 1860
214 Ga0070705_100115887 3300005440 Bacteria 1721
215 Ga0070700_100009943 3300005441 Bacteria 5235
216 Ga0070700_100257255 3300005441 Bacteria 1255
217 Ga0070700_100300455 3300005441 Bacteria 1172
218 Ga0070700_100313260 3300005441 Bacteria 1150
219 Ga0070700_100381684 3300005441 Bacteria 1054
220 Ga0070700_100577113 3300005441 Bacteria 877
221 Ga0070694_100013152 3300005444 Bacteria 5164
222 Ga0070694_100038068 3300005444 Bacteria 3194
223 Ga0070694_100226977 3300005444 Bacteria 1403
224 Ga0070694_100235153 3300005444 Bacteria 1380
225 Ga0070694_101544251 3300005444 Unclassified 562
226 Ga0070708_100000077 3300005445 Bacteria 63116
227 Ga0070708_100049689 3300005445 Bacteria 3711
228 Ga0070708_100331246 3300005445 Bacteria 1434
229 Ga0070663_100008615 3300005455 Bacteria 6285
230 Ga0070663_100020556 3300005455 Bacteria 4372
231 Ga0070663_100333338 3300005455 Bacteria 1223
232 Ga0070663_100373857 3300005455 Bacteria 1159
233 Ga0070663_100593692 3300005455 Bacteria 930
234 Ga0070663_101007460 3300005455 Bacteria 724
235 Ga0070663_101417552 3300005455 Bacteria 616
236 Ga0070678_100032948 3300005456 Bacteria 3592
237 Ga0070678_100331880 3300005456 Bacteria 1302
238 Ga0070662_100014975 3300005457 Bacteria 5187
239 Ga0070662_100050296 3300005457 Bacteria 3007
240 Ga0070662_100425956 3300005457 Bacteria 1098
241 Ga0070662_100517281 3300005457 Bacteria 997
242 Ga0070662_100648519 3300005457 Bacteria 890
243 Ga0070662_100723981 3300005457 Bacteria 843
244 Ga0070681_10001680 3300005458 Bacteria 19775
245 Ga0070681_10003472 3300005458 Bacteria 14770
246 Ga0070681_10009733 3300005458 Bacteria 9458
247 Ga0070681_10028142 3300005458 Bacteria 5651
248 Ga0070681_10106558 3300005458 Bacteria 2744
249 Ga0070681_10138741 3300005458 Bacteria 2361
250 Ga0070681_10185256 3300005458 Bacteria 2002
251 Ga0070681_10193078 3300005458 Bacteria 1956
252 Ga0070681_10205939 3300005458 Bacteria 1884
253 Ga0070681_10538112 3300005458 Bacteria 1082
254 Ga0070681_10704329 3300005458 Bacteria 926
255 Ga0068867_100106438 3300005459 Bacteria 2148
256 Ga0068867_100148600 3300005459 Bacteria 1839
257 Ga0068867_100199913 3300005459 Bacteria 1599
258 Ga0068867_100287495 3300005459 Bacteria 1350
259 Ga0068867_100592272 3300005459 Bacteria 966
260 Ga0068867_101837729 3300005459 Unclassified 570
261 Ga0070685_10068364 3300005466 Bacteria 2098
262 Ga0070706_100120646 3300005467 Bacteria 2444
263 Ga0070706_101510368 3300005467 Bacteria 614
264 Ga0070707_100007168 3300005468 Bacteria 10339
265 Ga0070707_100253528 3300005468 Bacteria 1712
266 Ga0070707_100342049 3300005468 Bacteria 1453
267 Ga0070707_100634610 3300005468 Bacteria 1031
268 Ga0070707_100758309 3300005468 Bacteria 934
269 Ga0070698_100002723 3300005471 Bacteria 19438
270 Ga0070698_100057554 3300005471 Bacteria 3933
271 Ga0070698_100108125 3300005471 Bacteria 2748
272 Ga0070698_100889228 3300005471 Bacteria 836
273 Ga0070699_100060134 3300005518 Bacteria 3292
274 Ga0070699_100088378 3300005518 Bacteria 2706
275 Ga0070699_100090852 3300005518 Bacteria 2669
276 Ga0070699_100596483 3300005518 Bacteria 1007
277 Ga0070679_100009717 3300005530 Bacteria 9099
278 Ga0070679_100012748 3300005530 Bacteria 8039
279 Ga0070679_100015827 3300005530 Bacteria 7256
280 Ga0070679_100020806 3300005530 Bacteria 6399
281 Ga0070679_100023321 3300005530 Bacteria 6055
282 Ga0070679_100027822 3300005530 Bacteria 5569
283 Ga0070679_100037625 3300005530 Bacteria 4808
284 Ga0070679_100039848 3300005530 Bacteria 4670
285 Ga0070679_100060996 3300005530 Bacteria 3759
286 Ga0070679_100101144 3300005530 Bacteria 2869
287 Ga0070679_100103099 3300005530 Bacteria 2839
288 Ga0070679_100112406 3300005530 Bacteria 2710
289 Ga0070679_100128217 3300005530 Bacteria 2519
290 Ga0070679_100142801 3300005530 Bacteria 2373
291 Ga0070679_100192718 3300005530 Bacteria 2007
292 Ga0070679_100200506 3300005530 Bacteria 1962
293 Ga0070679_100311153 3300005530 Bacteria 1525
294 Ga0070679_100322503 3300005530 Bacteria 1494
295 Ga0070679_100410499 3300005530 Bacteria 1300
296 Ga0070679_100479063 3300005530 Bacteria 1189
297 Ga0070679_100574002 3300005530 Bacteria 1071
298 Ga0070679_101118399 3300005530 Bacteria 733
299 Ga0070684_100014785 3300005535 Bacteria 6333
300 Ga0070684_100026374 3300005535 Bacteria 4894
301 Ga0070684_100035907 3300005535 Bacteria 4244
302 Ga0070684_100052003 3300005535 Bacteria 3560
303 Ga0070684_100058231 3300005535 Bacteria 3376
304 Ga0070684_100066581 3300005535 Bacteria 3162
305 Ga0070684_100102320 3300005535 Bacteria 2560
306 Ga0070684_100116273 3300005535 Bacteria 2402
307 Ga0070684_100137395 3300005535 Bacteria 2209
308 Ga0070684_100162192 3300005535 Bacteria 2028
309 Ga0070684_100164894 3300005535 Bacteria 2011
310 Ga0070684_100182647 3300005535 Bacteria 1907
311 Ga0070684_100223370 3300005535 Bacteria 1718
312 Ga0070684_100241211 3300005535 Bacteria 1651
313 Ga0070684_100250871 3300005535 Bacteria 1617
314 Ga0070684_100325651 3300005535 Bacteria 1412
315 Ga0070684_100450563 3300005535 Bacteria 1189
316 Ga0070684_100543423 3300005535 Bacteria 1078
317 Ga0070684_100602378 3300005535 Bacteria 1022
318 Ga0070684_101725757 3300005535 Bacteria 591
319 Ga0070697_100049568 3300005536 Bacteria 3408
320 Ga0070697_100146086 3300005536 Bacteria 1991
321 Ga0068853_100145351 3300005539 Bacteria 2131
322 Ga0068853_100435858 3300005539 Bacteria 1231
323 Ga0068853_100442252 3300005539 Bacteria 1222
324 Ga0068853_100543028 3300005539 Bacteria 1100
325 Ga0070672_100014900 3300005543 Bacteria 5520
326 Ga0070672_100064908 3300005543 Bacteria 2886
327 Ga0070672_100515601 3300005543 Bacteria 1035
328 Ga0070672_100590692 3300005543 Bacteria 966
329 Ga0070686_100668131 3300005544 Bacteria 825
330 Ga0070695_100028830 3300005545 Bacteria 3447
331 Ga0070695_100041194 3300005545 Bacteria 2927
332 Ga0070695_100063440 3300005545 Bacteria 2401
333 Ga0070695_100745403 3300005545 Bacteria 781
334 Ga0070696_100000705 3300005546 Bacteria 21330
335 Ga0070696_100173225 3300005546 Bacteria 1596
336 Ga0070696_100350796 3300005546 Bacteria 1143
337 Ga0070696_100414085 3300005546 Bacteria 1057
338 Ga0070693_100014943 3300005547 Bacteria 3991
339 Ga0070693_100029698 3300005547 Bacteria 2983
340 Ga0070693_100422162 3300005547 Bacteria 929
341 Ga0070693_100438949 3300005547 Bacteria 914
342 Ga0070693_100497709 3300005547 Bacteria 864
343 Ga0070693_100568544 3300005547 Bacteria 814
344 Ga0070665_101286161 3300005548 Bacteria 741
345 Ga0070665_101747369 3300005548 Bacteria 629
346 Ga0070665_101827349 3300005548 Bacteria 614
347 Ga0070704_100044905 3300005549 Bacteria 3073
348 Ga0070704_100050759 3300005549 Bacteria 2918
349 Ga0070704_100451470 3300005549 Bacteria 1107
350 Ga0068855_100029696 3300005563 Bacteria 6536
351 Ga0068855_100195616 3300005563 Bacteria 2278
352 Ga0068855_100555033 3300005563 Bacteria 1243
353 Ga0068855_100622794 3300005563 Bacteria 1162
354 Ga0068855_100668675 3300005563 Bacteria 1114
355 Ga0068855_100730057 3300005563 Bacteria 1058
356 Ga0068855_101225127 3300005563 Bacteria 779
357 Ga0068855_101521558 3300005563 Bacteria 686
358 Ga0070664_100038733 3300005564 Bacteria 4014
359 Ga0070664_100072000 3300005564 Bacteria 2963
360 Ga0070664_100096586 3300005564 Bacteria 2564
361 Ga0070664_100139755 3300005564 Bacteria 2132
362 Ga0070664_100211881 3300005564 Bacteria 1732
363 Ga0070664_100258903 3300005564 Bacteria 1565
364 Ga0070664_100266759 3300005564 Bacteria 1541
365 Ga0070664_100289322 3300005564 Bacteria 1479
366 Ga0070664_100591649 3300005564 Bacteria 1028
367 Ga0070664_101094212 3300005564 Unclassified 750
368 Ga0070664_101187223 3300005564 Bacteria 720
369 Ga0068857_100029029 3300005577 Bacteria 4881
370 Ga0068857_100041742 3300005577 Bacteria 4068
371 Ga0068857_100055825 3300005577 Bacteria 3504
372 Ga0068857_100149894 3300005577 Bacteria 2112
373 Ga0068857_100191162 3300005577 Bacteria 1864
374 Ga0068857_100226082 3300005577 Bacteria 1710
375 Ga0068857_100299387 3300005577 Bacteria 1482
376 Ga0068857_100582263 3300005577 Bacteria 1056
377 Ga0068854_100028156 3300005578 Bacteria 3879
378 Ga0068854_100177257 3300005578 Bacteria 1663
379 Ga0068854_100190051 3300005578 Bacteria 1608
380 Ga0068854_100662941 3300005578 Bacteria 897
381 Ga0068854_101002758 3300005578 Bacteria 739
382 Ga0068856_100041437 3300005614 Bacteria 4525
383 Ga0068856_100057303 3300005614 Bacteria 3846
384 Ga0068856_100206334 3300005614 Bacteria 1980
385 Ga0068856_100328720 3300005614 Bacteria 1546
386 Ga0068856_100656999 3300005614 Bacteria 1069
387 Ga0068856_101386106 3300005614 Bacteria 718
388 Ga0070702_100029194 3300005615 Bacteria 2996
389 Ga0070702_100322103 3300005615 Bacteria 1078
390 Ga0068852_100012880 3300005616 Bacteria 6375
391 Ga0068852_100021426 3300005616 Bacteria 5160
392 Ga0068852_100057382 3300005616 Bacteria 3369
393 Ga0068852_100079051 3300005616 Bacteria 2912
394 Ga0068852_100181844 3300005616 Bacteria 1978
395 Ga0068852_100214728 3300005616 Bacteria 1827
396 Ga0068852_100283209 3300005616 Bacteria 1599
397 Ga0068852_100406678 3300005616 Bacteria 1340
398 Ga0068852_100510629 3300005616 Bacteria 1198
399 Ga0068852_100614213 3300005616 Bacteria 1092
400 Ga0068852_101058213 3300005616 Bacteria 831
401 Ga0068852_101280249 3300005616 Bacteria 755
402 Ga0068852_101974946 3300005616 Bacteria 605
403 Ga0068859_100000840 3300005617 Bacteria 31198
404 Ga0068859_100078819 3300005617 Bacteria 3334
405 Ga0068859_100322150 3300005617 Bacteria 1640
406 Ga0068859_100444662 3300005617 Bacteria 1392
407 Ga0068859_100736147 3300005617 Bacteria 1075
408 Ga0068859_100785237 3300005617 Bacteria 1040
409 Ga0068859_100827601 3300005617 Bacteria 1012
410 Ga0068859_101427805 3300005617 Unclassified 763
411 Ga0068864_100009895 3300005618 Bacteria 7864
412 Ga0068864_100115558 3300005618 Bacteria 2394
413 Ga0068864_100192269 3300005618 Bacteria 1871
414 Ga0068864_100317881 3300005618 Bacteria 1462
415 Ga0068864_100360078 3300005618 Bacteria 1374
416 Ga0068864_100672183 3300005618 Bacteria 1010
417 Ga0068864_100985203 3300005618 Bacteria 835
418 Ga0068866_10280017 3300005718 Bacteria 1033
419 Ga0068861_100000975 3300005719 Bacteria 17448
420 Ga0068861_100011996 3300005719 Bacteria 6035
421 Ga0068861_100067772 3300005719 Bacteria 2756
422 Ga0068861_100533317 3300005719 Bacteria 1066
423 Ga0068851_10082854 3300005834 Bacteria 1677
424 Ga0068851_10100896 3300005834 Bacteria 1531
425 Ga0068870_10005093 3300005840 Bacteria 5714
426 Ga0068863_100095919 3300005841 Bacteria 2815
427 Ga0068863_100246948 3300005841 Bacteria 1723
428 Ga0068863_100409739 3300005841 Bacteria 1327
429 Ga0068863_100425021 3300005841 Bacteria 1302
430 Ga0068863_100559769 3300005841 Bacteria 1129
431 Ga0068863_100781071 3300005841 Bacteria 952
432 Ga0068863_101518455 3300005841 Bacteria 678
433 Ga0068858_100072941 3300005842 Bacteria 3186
434 Ga0068858_100156351 3300005842 Bacteria 2145
435 Ga0068858_100300941 3300005842 Bacteria 1530
436 Ga0068858_100653683 3300005842 Bacteria 1022
437 Ga0068860_100004188 3300005843 Bacteria 14782
438 Ga0068860_100019789 3300005843 Bacteria 6526
439 Ga0068860_100056592 3300005843 Bacteria 3727
440 Ga0068860_100543237 3300005843 Bacteria 1164
441 Ga0068860_100853246 3300005843 Bacteria 925
442 Ga0068862_100000764 3300005844 Bacteria 32066
443 Ga0068862_100002514 3300005844 Bacteria 16227
444 Ga0068862_100013561 3300005844 Bacteria 6752
445 Ga0068862_100165433 3300005844 Bacteria 1977
446 Ga0068862_100286295 3300005844 Bacteria 1512
447 Ga0068862_100403955 3300005844 Bacteria 1278
448 Ga0068862_100780633 3300005844 Bacteria 932
449 Ga0081539_10005565 3300005985 Bacteria 12756
450 Ga0070717_10007434 3300006028 Bacteria 8138
451 Ga0070717_10067172 3300006028 Bacteria 2982
452 Ga0075432_10078128 3300006058 Bacteria 1197
453 Ga0070715_10080258 3300006163 Bacteria 1479
454 Ga0070716_100007666 3300006173 Bacteria 5325
455 Ga0070716_100051887 3300006173 Bacteria 2334
456 Ga0070716_100060728 3300006173 Bacteria 2185
457 Ga0070716_100184954 3300006173 Bacteria 1371
458 Ga0070716_100433191 3300006173 Bacteria 954
459 Ga0070712_100004359 3300006175 Bacteria 8726
460 Ga0070712_100099934 3300006175 Bacteria 2142
461 Ga0070712_100134695 3300006175 Bacteria 1877
462 Ga0097621_100073666 3300006237 Bacteria 2827
463 Ga0097621_100251079 3300006237 Bacteria 1549
464 Ga0097621_100455969 3300006237 Bacteria 1152
465 Ga0097621_100928612 3300006237 Bacteria 811
466 Ga0068871_100025360 3300006358 Bacteria 4611
467 Ga0068871_100122576 3300006358 Bacteria 2197
468 Ga0068871_100334181 3300006358 Bacteria 1337
469 Ga0075428_100144106 3300006844 Bacteria 2589
470 Ga0075428_100147317 3300006844 Bacteria 2559
471 Ga0075428_101479410 3300006844 Bacteria 712
472 Ga0075430_100041383 3300006846 Bacteria 3898
473 Ga0075430_100183779 3300006846 Bacteria 1738
474 Ga0075430_100239016 3300006846 Bacteria 1505
475 Ga0075430_100254645 3300006846 Bacteria 1454
476 Ga0075430_100328965 3300006846 Bacteria 1263
477 Ga0075430_100350563 3300006846 Bacteria 1219
478 Ga0075430_100467061 3300006846 Bacteria 1041
479 Ga0075430_100490598 3300006846 Bacteria 1014
480 Ga0075430_100491885 3300006846 Unclassified 1012
481 Ga0075431_100016038 3300006847 Bacteria 7603
482 Ga0075431_100031481 3300006847 Bacteria 5464
483 Ga0075431_100117958 3300006847 Bacteria 2738
484 Ga0075431_100370414 3300006847 Bacteria 1437
485 Ga0075431_100444805 3300006847 Bacteria 1292
486 Ga0075431_100517344 3300006847 Bacteria 1183
487 Ga0075431_100604174 3300006847 Bacteria 1081
488 Ga0075431_100903886 3300006847 Bacteria 852
489 Ga0075431_100907216 3300006847 Unclassified 851
490 Ga0075431_101135439 3300006847 Bacteria 745
491 Ga0075433_10045513 3300006852 Bacteria 3815
492 Ga0075433_10155235 3300006852 Bacteria 2036
493 Ga0075433_10352367 3300006852 Bacteria 1301
494 Ga0075433_10376572 3300006852 Bacteria 1253
495 Ga0075433_10446265 3300006852 Bacteria 1140
496 Ga0075433_10620556 3300006852 Bacteria 949
497 Ga0075434_100051764 3300006871 Bacteria 4080
498 Ga0075434_100073796 3300006871 Bacteria 3405
499 Ga0075434_100097085 3300006871 Bacteria 2951
500 Ga0075434_100128012 3300006871 Bacteria 2557
501 Ga0075434_100168045 3300006871 Bacteria 2213
502 Ga0075434_100192776 3300006871 Bacteria 2058
503 Ga0075434_100489476 3300006871 Bacteria 1251
504 Ga0075429_100009872 3300006880 Bacteria 8276
505 Ga0075429_100144460 3300006880 Bacteria 2082
506 Ga0075429_100774376 3300006880 Bacteria 840
507 Ga0075429_100788841 3300006880 Bacteria 832
508 Ga0068865_100026446 3300006881 Bacteria 3826
509 Ga0068865_100270533 3300006881 Bacteria 1349
510 Ga0068865_100465714 3300006881 Bacteria 1048
511 Ga0068865_100654961 3300006881 Bacteria 893
512 Ga0068865_100709098 3300006881 Bacteria 861
513 Ga0068865_100831936 3300006881 Bacteria 798
514 Ga0068865_101107898 3300006881 Bacteria 698
515 Ga0075436_100127860 3300006914 Bacteria 1780
516 Ga0097620_100000840 3300006931 Bacteria 31198
517 Ga0097620_100078823 3300006931 Bacteria 3334
518 Ga0097620_100322149 3300006931 Bacteria 1640
519 Ga0097620_100444653 3300006931 Bacteria 1392
520 Ga0097620_100736123 3300006931 Bacteria 1075
521 Ga0097620_100785185 3300006931 Bacteria 1040
522 Ga0097620_100827528 3300006931 Bacteria 1012
523 Ga0097620_101427739 3300006931 Unclassified 763
524 Ga0075435_100073739 3300007076 Bacteria 2791
525 Ga0075435_100401682 3300007076 Bacteria 1178
526 Ga0075435_101170526 3300007076 Bacteria 673
527 Ga0105240_10049628 3300009093 Bacteria 5296
528 Ga0105240_10085708 3300009093 Bacteria 3859
529 Ga0105240_10123936 3300009093 Bacteria 3108
530 Ga0105240_10295269 3300009093 Bacteria 1856
531 Ga0105240_10481612 3300009093 Bacteria 1383
532 Ga0105240_10757978 3300009093 Bacteria 1055
533 Ga0105240_11339649 3300009093 Unclassified 754
534 Ga0111539_10012931 3300009094 Bacteria 10445
535 Ga0111539_10123828 3300009094 Bacteria 3030
536 Ga0111539_10158570 3300009094 Bacteria 2647
537 Ga0111539_10577507 3300009094 Bacteria 1309
538 Ga0111539_10802941 3300009094 Bacteria 1095
539 Ga0111539_11361575 3300009094 Bacteria 823
540 Ga0111539_11600993 3300009094 Bacteria 755
541 Ga0105245_10062711 3300009098 Bacteria 3354
542 Ga0105245_10167967 3300009098 Bacteria 2087
543 Ga0105245_10169404 3300009098 Bacteria 2079
544 Ga0105245_10197229 3300009098 Bacteria 1932
545 Ga0105245_10262378 3300009098 Bacteria 1682
546 Ga0105245_12854270 3300009098 Unclassified 535
547 Ga0105247_10265511 3300009101 Bacteria 1178
548 Ga0114129_10006614 3300009147 Bacteria 16457
549 Ga0114129_10030165 3300009147 Bacteria 7680
550 Ga0114129_10045730 3300009147 Bacteria 6153
551 Ga0114129_10088826 3300009147 Bacteria 4284
552 Ga0114129_10329659 3300009147 Bacteria 2027
553 Ga0114129_10397700 3300009147 Bacteria 1816
554 Ga0114129_10464124 3300009147 Bacteria 1659
555 Ga0114129_10854020 3300009147 Bacteria 1157
556 Ga0114129_11815054 3300009147 Bacteria 741
557 Ga0105243_10213297 3300009148 Bacteria 1701
558 Ga0105243_10648984 3300009148 Bacteria 1023
559 Ga0105243_10870702 3300009148 Bacteria 894
560 Ga0105241_10122969 3300009174 Bacteria 2092
561 Ga0105241_10171243 3300009174 Bacteria 1794
562 Ga0105241_10174438 3300009174 Bacteria 1778
563 Ga0105241_10518799 3300009174 Bacteria 1065
564 Ga0105241_11718166 3300009174 Unclassified 610
565 Ga0105242_10040715 3300009176 Bacteria 3745
566 Ga0105242_10147772 3300009176 Bacteria 2046
567 Ga0105242_10155761 3300009176 Bacteria 1996
568 Ga0105242_10394983 3300009176 Bacteria 1289
569 Ga0105248_10023633 3300009177 Bacteria 6829
570 Ga0105248_10052133 3300009177 Bacteria 4591
571 Ga0105248_10061326 3300009177 Bacteria 4223
572 Ga0105248_10086866 3300009177 Bacteria 3519
573 Ga0105248_10228771 3300009177 Bacteria 2093
574 Ga0105248_10798793 3300009177 Bacteria 1065
575 Ga0105248_11500021 3300009177 Bacteria 763
576 Ga0105248_11709380 3300009177 Bacteria 713
577 Ga0105248_12364966 3300009177 Bacteria 605
578 Ga0105237_10078219 3300009545 Bacteria 3297
579 Ga0105237_10090173 3300009545 Bacteria 3055
580 Ga0105237_10183927 3300009545 Bacteria 2090
581 Ga0105237_10476859 3300009545 Bacteria 1254
582 Ga0105237_10525293 3300009545 Bacteria 1190
583 Ga0105237_10814341 3300009545 Bacteria 941
584 Ga0105237_11011136 3300009545 Bacteria 838
585 Ga0105238_10040059 3300009551 Bacteria 4749
586 Ga0105238_10043144 3300009551 Bacteria 4564
587 Ga0105238_10224491 3300009551 Bacteria 1855
588 Ga0105238_10250412 3300009551 Bacteria 1750
589 Ga0105249_10000580 3300009553 Bacteria 33471
590 Ga0105249_10008223 3300009553 Bacteria 9087
591 Ga0105249_10033683 3300009553 Bacteria 4639
592 Ga0105249_10165723 3300009553 Bacteria 2139
593 Ga0105239_10245626 3300010375 Bacteria 2010
594 Ga0105239_10988881 3300010375 Bacteria 967
595 Ga0105246_10697954 3300011119 Bacteria 889
596 Ga0157322_1006879 3300012490 Bacteria 827
597 Ga0157319_1006020 3300012497 Bacteria 856
598 Ga0157316_1013239 3300012510 Bacteria 804
599 Ga0157327_1019168 3300012512 Bacteria 754
600 Ga0157326_1032801 3300012513 Unclassified 695
601 Ga0157373_10091074 3300013100 Bacteria 2148
602 Ga0157373_10201675 3300013100 Bacteria 1402
603 Ga0157373_10247497 3300013100 Bacteria 1260
604 Ga0157373_10387344 3300013100 Bacteria 1000
605 Ga0157373_10464580 3300013100 Bacteria 912
606 Ga0157373_10916467 3300013100 Bacteria 651
607 Ga0157371_10009172 3300013102 Bacteria 7812
608 Ga0157371_10012727 3300013102 Bacteria 6414
609 Ga0157371_10020379 3300013102 Bacteria 4880
610 Ga0157371_10311267 3300013102 Bacteria 1141
611 Ga0157371_10395832 3300013102 Bacteria 1010
612 Ga0157371_10420135 3300013102 Bacteria 980
613 Ga0157370_10046798 3300013104 Bacteria 4147
614 Ga0157370_10081133 3300013104 Bacteria 3053
615 Ga0157370_10237486 3300013104 Bacteria 1687
616 Ga0157370_10269109 3300013104 Bacteria 1574
617 Ga0157370_10297515 3300013104 Bacteria 1490
618 Ga0157370_10341656 3300013104 Bacteria 1380
619 Ga0157370_10553291 3300013104 Bacteria 1055
620 Ga0157370_10841357 3300013104 Bacteria 834
621 Ga0157370_11038713 3300013104 Bacteria 741
622 Ga0157370_11472282 3300013104 Bacteria 612
623 Ga0157369_10048625 3300013105 Bacteria 4602
624 Ga0157369_10076054 3300013105 Bacteria 3599
625 Ga0157369_10101552 3300013105 Bacteria 3065
626 Ga0157369_10195230 3300013105 Bacteria 2126
627 Ga0157369_10404342 3300013105 Bacteria 1416
628 Ga0157369_10510628 3300013105 Bacteria 1243
629 Ga0157369_10551555 3300013105 Bacteria 1191
630 Ga0157369_10572508 3300013105 Bacteria 1167
631 Ga0157369_11000355 3300013105 Bacteria 856
632 Ga0157369_11264956 3300013105 Bacteria 752
633 Ga0157369_11386440 3300013105 Bacteria 716
634 Ga0157374_10370254 3300013296 Bacteria 1426
635 Ga0157374_10460112 3300013296 Bacteria 1274
636 Ga0157374_10831697 3300013296 Bacteria 940
637 Ga0157374_11006852 3300013296 Bacteria 852
638 Ga0157374_11246215 3300013296 Bacteria 765
639 Ga0157378_10093067 3300013297 Bacteria 2743
640 Ga0157378_10339700 3300013297 Bacteria 1464
641 Ga0157378_10460758 3300013297 Bacteria 1263
642 Ga0157378_10639900 3300013297 Bacteria 1078
643 Ga0157378_10997599 3300013297 Bacteria 872
644 Ga0157378_11113140 3300013297 Bacteria 827
645 Ga0163162_10006136 3300013306 Bacteria 11634
646 Ga0163162_10009455 3300013306 Bacteria 9479
647 Ga0163162_10038079 3300013306 Bacteria 4800
648 Ga0163162_10069939 3300013306 Bacteria 3562
649 Ga0163162_10084701 3300013306 Bacteria 3246
650 Ga0163162_10092253 3300013306 Bacteria 3112
651 Ga0163162_10493368 3300013306 Bacteria 1355
652 Ga0163162_10925965 3300013306 Bacteria 984
653 Ga0157372_10006474 3300013307 Bacteria 12464
654 Ga0157372_10021748 3300013307 Bacteria 6932
655 Ga0157372_10029257 3300013307 Bacteria 6014
656 Ga0157372_10046943 3300013307 Bacteria 4796
657 Ga0157372_10054000 3300013307 Bacteria 4480
658 Ga0157372_10083855 3300013307 Bacteria 3610
659 Ga0157372_10225830 3300013307 Bacteria 2171
660 Ga0157372_10411950 3300013307 Bacteria 1575
661 Ga0157372_10759654 3300013307 Bacteria 1127
662 Ga0157372_10776592 3300013307 Bacteria 1114
663 Ga0157372_10828160 3300013307 Bacteria 1075
664 Ga0157372_11406547 3300013307 Bacteria 804
665 Ga0157372_12336517 3300013307 Bacteria 614
666 Ga0157375_10040171 3300013308 Bacteria 4508
667 Ga0157375_10070436 3300013308 Bacteria 3507
668 Ga0157375_10123400 3300013308 Bacteria 2703
669 Ga0157375_10133080 3300013308 Bacteria 2608
670 Ga0157375_10169512 3300013308 Bacteria 2330
671 Ga0157375_10269363 3300013308 Bacteria 1865
672 Ga0157375_10330809 3300013308 Bacteria 1688
673 Ga0157375_10728439 3300013308 Bacteria 1144
674 Ga0163163_10298797 3300014325 Bacteria 1663
675 Ga0163163_10354626 3300014325 Bacteria 1523
676 Ga0157380_10030368 3300014326 Bacteria 4138
677 Ga0157380_10046242 3300014326 Bacteria 3417
678 Ga0157380_10056313 3300014326 Bacteria 3126
679 Ga0157380_10215943 3300014326 Bacteria 1713
680 Ga0157380_12505398 3300014326 Bacteria 582
681 Ga0182008_10005592 3300014497 Bacteria 7127
682 Ga0182008_10084545 3300014497 Bacteria 1563
683 Ga0157377_10025247 3300014745 Bacteria 3168
684 Ga0157377_10072944 3300014745 Bacteria 1988
685 Ga0157377_10231286 3300014745 Bacteria 1189
686 Ga0157377_10308259 3300014745 Bacteria 1047
687 Ga0157377_10553269 3300014745 Bacteria 813
688 Ga0157377_10776685 3300014745 Bacteria 704
689 Ga0157379_10009212 3300014968 Bacteria 8597
690 Ga0157379_10030841 3300014968 Bacteria 4774
691 Ga0157379_10326032 3300014968 Bacteria 1402
692 Ga0157379_10331232 3300014968 Bacteria 1391
693 Ga0157376_10211824 3300014969 Bacteria 1789
694 Ga0157376_10295568 3300014969 Bacteria 1531
695 Ga0157376_11352195 3300014969 Bacteria 743
696 Ga0157376_11524031 3300014969 Bacteria 702
697 Ga0157376_12117430 3300014969 Unclassified 601
698 Ga0182007_10049562 3300015262 Bacteria 1387
699 Ga0182007_10067735 3300015262 Bacteria 1169
700 Ga0182007_10111613 3300015262 Bacteria 910
701 Ga0163161_10037844 3300017792 Bacteria 3458
702 Ga0163161_10363149 3300017792 Bacteria 1154
703 Ga0163161_10692071 3300017792 Bacteria 848
704 Ga0206356_10783001 3300020070 Bacteria 1762
705 Ga0206356_11270514 3300020070 Bacteria 2049
706 Ga0206352_10325843 3300020078 Bacteria 1377
707 Ga0206352_11174930 3300020078 Bacteria 850
708 Ga0206353_10065830 3300020082 Bacteria 1490
709 Ga0206353_11480673 3300020082 Bacteria 1814
710 Ga0213876_10083566 3300021384 Bacteria 1689
711 Ga0207697_10066728 3300025315 Bacteria 1504
712 Ga0207682_10009572 3300025893 Bacteria 3820
713 Ga0207682_10012840 3300025893 Bacteria 3268
714 Ga0207692_10129111 3300025898 Bacteria 1425
715 Ga0207692_10198757 3300025898 Bacteria 1177
716 Ga0207692_10548282 3300025898 Unclassified 738
717 Ga0207642_10057205 3300025899 Bacteria 1792
718 Ga0207680_10104846 3300025903 Bacteria 1823
719 Ga0207647_10046677 3300025904 Bacteria 2698
720 Ga0207647_10113869 3300025904 Bacteria 1598
721 Ga0207699_10042051 3300025906 Bacteria 2644
722 Ga0207699_10043781 3300025906 Bacteria 2603
723 Ga0207699_10101168 3300025906 Bacteria 1829
724 Ga0207699_10211141 3300025906 Bacteria 1320
725 Ga0207645_10000909 3300025907 Bacteria 24558
726 Ga0207645_10041571 3300025907 Bacteria 2942
727 Ga0207645_10082589 3300025907 Bacteria 2060
728 Ga0207643_10007697 3300025908 Bacteria 5786
729 Ga0207643_10106534 3300025908 Bacteria 1648
730 Ga0207705_10003811 3300025909 Bacteria 11467
731 Ga0207705_10003951 3300025909 Bacteria 11274
732 Ga0207705_10030503 3300025909 Bacteria 3847
733 Ga0207705_10032601 3300025909 Bacteria 3724
734 Ga0207705_10042973 3300025909 Bacteria 3245
735 Ga0207705_10054666 3300025909 Bacteria 2878
736 Ga0207705_10092273 3300025909 Bacteria 2219
737 Ga0207705_10098584 3300025909 Bacteria 2147
738 Ga0207705_10151333 3300025909 Bacteria 1739
739 Ga0207705_10181400 3300025909 Bacteria 1589
740 Ga0207705_10594575 3300025909 Bacteria 860
741 Ga0207684_10157468 3300025910 Bacteria 1955
742 Ga0207684_10206775 3300025910 Bacteria 1693
743 Ga0207684_10612518 3300025910 Bacteria 929
744 Ga0207654_10014086 3300025911 Bacteria 4126
745 Ga0207654_10016525 3300025911 Bacteria 3844
746 Ga0207654_10055737 3300025911 Bacteria 2290
747 Ga0207654_10087604 3300025911 Bacteria 1890
748 Ga0207654_10235406 3300025911 Bacteria 1221
749 Ga0207707_10004840 3300025912 Bacteria 11810
750 Ga0207707_10007889 3300025912 Bacteria 9257
751 Ga0207707_10009646 3300025912 Bacteria 8375
752 Ga0207707_10010596 3300025912 Bacteria 8006
753 Ga0207707_10017467 3300025912 Bacteria 6255
754 Ga0207707_10052930 3300025912 Bacteria 3533
755 Ga0207707_10072756 3300025912 Bacteria 2996
756 Ga0207707_10080450 3300025912 Bacteria 2845
757 Ga0207707_10086625 3300025912 Bacteria 2737
758 Ga0207707_10109370 3300025912 Bacteria 2416
759 Ga0207707_10197346 3300025912 Bacteria 1755
760 Ga0207707_10212461 3300025912 Bacteria 1685
761 Ga0207707_10217043 3300025912 Bacteria 1665
762 Ga0207707_10231609 3300025912 Bacteria 1607
763 Ga0207707_10551186 3300025912 Bacteria 979
764 Ga0207707_10649299 3300025912 Unclassified 889
765 Ga0207695_10002872 3300025913 Bacteria 24998
766 Ga0207695_10070333 3300025913 Bacteria 3578
767 Ga0207695_10098281 3300025913 Bacteria 2927
768 Ga0207695_11220623 3300025913 Bacteria 632
769 Ga0207671_10050059 3300025914 Bacteria 3093
770 Ga0207671_10075363 3300025914 Bacteria 2523
771 Ga0207671_10760032 3300025914 Bacteria 770
772 Ga0207671_11100181 3300025914 Bacteria 624
773 Ga0207693_10024434 3300025915 Bacteria 4795
774 Ga0207693_10067286 3300025915 Bacteria 2805
775 Ga0207693_10203837 3300025915 Bacteria 1555
776 Ga0207663_10015456 3300025916 Bacteria 4211
777 Ga0207663_10065283 3300025916 Bacteria 2326
778 Ga0207663_10070815 3300025916 Bacteria 2248
779 Ga0207663_10448449 3300025916 Bacteria 995
780 Ga0207663_10648009 3300025916 Bacteria 833
781 Ga0207660_10003947 3300025917 Bacteria 9667
782 Ga0207660_10005546 3300025917 Bacteria 8196
783 Ga0207660_10013616 3300025917 Bacteria 5333
784 Ga0207660_10015415 3300025917 Bacteria 5044
785 Ga0207660_10219632 3300025917 Bacteria 1491
786 Ga0207660_10253445 3300025917 Bacteria 1389
787 Ga0207660_10256531 3300025917 Bacteria 1381
788 Ga0207660_10267249 3300025917 Bacteria 1354
789 Ga0207660_10335292 3300025917 Bacteria 1210
790 Ga0207660_10393328 3300025917 Bacteria 1116
791 Ga0207660_10785627 3300025917 Unclassified 777
792 Ga0207662_10000695 3300025918 Bacteria 15329
793 Ga0207662_10025034 3300025918 Bacteria 3436
794 Ga0207662_10065411 3300025918 Bacteria 2189
795 Ga0207662_10128649 3300025918 Bacteria 1594
796 Ga0207662_10400789 3300025918 Bacteria 930
797 Ga0207657_10001221 3300025919 Bacteria 27402
798 Ga0207657_10062853 3300025919 Bacteria 3177
799 Ga0207657_10065284 3300025919 Bacteria 3103
800 Ga0207657_10070109 3300025919 Bacteria 2972
801 Ga0207657_10216093 3300025919 Bacteria 1537
802 Ga0207649_10009969 3300025920 Bacteria 5206
803 Ga0207649_10030909 3300025920 Bacteria 3177
804 Ga0207649_10094406 3300025920 Bacteria 1965
805 Ga0207649_10104596 3300025920 Bacteria 1880
806 Ga0207649_10188036 3300025920 Bacteria 1450
807 Ga0207649_10218226 3300025920 Bacteria 1357
808 Ga0207649_10440212 3300025920 Unclassified 982
809 Ga0207649_10747572 3300025920 Bacteria 761
810 Ga0207649_11001588 3300025920 Bacteria 657
811 Ga0207649_11042501 3300025920 Bacteria 644
812 Ga0207649_11176478 3300025920 Unclassified 606
813 Ga0207652_10010525 3300025921 Bacteria 7444
814 Ga0207652_10019070 3300025921 Bacteria 5635
815 Ga0207652_10022531 3300025921 Bacteria 5212
816 Ga0207652_10024939 3300025921 Bacteria 4966
817 Ga0207652_10030387 3300025921 Bacteria 4524
818 Ga0207652_10030393 3300025921 Bacteria 4524
819 Ga0207652_10038617 3300025921 Bacteria 4049
820 Ga0207652_10051472 3300025921 Bacteria 3531
821 Ga0207652_10053487 3300025921 Bacteria 3468
822 Ga0207652_10059206 3300025921 Bacteria 3301
823 Ga0207652_10060752 3300025921 Bacteria 3261
824 Ga0207652_10095623 3300025921 Bacteria 2617
825 Ga0207652_10112378 3300025921 Bacteria 2417
826 Ga0207652_10122094 3300025921 Bacteria 2318
827 Ga0207652_10221021 3300025921 Bacteria 1707
828 Ga0207652_10320564 3300025921 Bacteria 1399
829 Ga0207652_10513127 3300025921 Bacteria 1079
830 Ga0207652_11001863 3300025921 Unclassified 734
831 Ga0207652_11061457 3300025921 Bacteria 710
832 Ga0207646_10036759 3300025922 Bacteria 4420
833 Ga0207646_10387026 3300025922 Bacteria 1263
834 Ga0207646_11374739 3300025922 Unclassified 615
835 Ga0207681_10000921 3300025923 Bacteria 19202
836 Ga0207681_10003904 3300025923 Bacteria 9252
837 Ga0207681_10133321 3300025923 Bacteria 1839
838 Ga0207694_10032019 3300025924 Bacteria 4022
839 Ga0207694_10093377 3300025924 Bacteria 2376
840 Ga0207694_10131681 3300025924 Bacteria 2005
841 Ga0207694_10774552 3300025924 Bacteria 810
842 Ga0207694_11163998 3300025924 Bacteria 653
843 Ga0207650_10008332 3300025925 Bacteria 7076
844 Ga0207650_10010847 3300025925 Bacteria 6262
845 Ga0207650_10024087 3300025925 Bacteria 4323
846 Ga0207650_10138484 3300025925 Bacteria 1911
847 Ga0207650_10452033 3300025925 Bacteria 1069
848 Ga0207659_10033893 3300025926 Bacteria 3517
849 Ga0207659_10053327 3300025926 Bacteria 2884
850 Ga0207659_10066710 3300025926 Bacteria 2612
851 Ga0207659_10070326 3300025926 Bacteria 2552
852 Ga0207659_10086822 3300025926 Bacteria 2327
853 Ga0207659_10423006 3300025926 Bacteria 1118
854 Ga0207659_10833149 3300025926 Bacteria 793
855 Ga0207659_11403709 3300025926 Unclassified 599
856 Ga0207687_10037121 3300025927 Bacteria 3322
857 Ga0207687_10150311 3300025927 Bacteria 1776
858 Ga0207687_10154144 3300025927 Bacteria 1756
859 Ga0207687_10280132 3300025927 Bacteria 1336
860 Ga0207700_10005401 3300025928 Bacteria 7636
861 Ga0207700_10011785 3300025928 Bacteria 5596
862 Ga0207700_10115511 3300025928 Bacteria 2167
863 Ga0207700_10183149 3300025928 Bacteria 1755
864 Ga0207664_10024119 3300025929 Bacteria 4568
865 Ga0207664_10058055 3300025929 Bacteria 3077
866 Ga0207664_10274609 3300025929 Bacteria 1477
867 Ga0207644_10017509 3300025931 Bacteria 4840
868 Ga0207644_10042676 3300025931 Bacteria 3215
869 Ga0207644_10131979 3300025931 Bacteria 1913
870 Ga0207644_10287457 3300025931 Bacteria 1321
871 Ga0207644_10770691 3300025931 Bacteria 804
872 Ga0207690_10005614 3300025932 Bacteria 7414
873 Ga0207690_10039477 3300025932 Bacteria 3080
874 Ga0207690_10076583 3300025932 Bacteria 2323
875 Ga0207690_10083806 3300025932 Bacteria 2233
876 Ga0207690_10100949 3300025932 Bacteria 2060
877 Ga0207690_10195197 3300025932 Bacteria 1534
878 Ga0207690_10232962 3300025932 Bacteria 1415
879 Ga0207690_10610324 3300025932 Bacteria 891
880 Ga0207690_11400371 3300025932 Unclassified 585
881 Ga0207706_10002035 3300025933 Bacteria 19832
882 Ga0207706_10021302 3300025933 Bacteria 5824
883 Ga0207706_10058994 3300025933 Bacteria 3380
884 Ga0207706_10078626 3300025933 Bacteria 2901
885 Ga0207706_10191043 3300025933 Bacteria 1797
886 Ga0207706_10222084 3300025933 Bacteria 1654
887 Ga0207706_10286537 3300025933 Bacteria 1436
888 Ga0207706_10506177 3300025933 Bacteria 1042
889 Ga0207706_10530792 3300025933 Bacteria 1014
890 Ga0207706_10792886 3300025933 Bacteria 805
891 Ga0207686_10063591 3300025934 Bacteria 2347
892 Ga0207686_10145758 3300025934 Bacteria 1642
893 Ga0207686_10333273 3300025934 Bacteria 1137
894 Ga0207709_10375504 3300025935 Bacteria 1080
895 Ga0207709_11152533 3300025935 Bacteria 638
896 Ga0207670_10201560 3300025936 Bacteria 1512
897 Ga0207670_10310221 3300025936 Bacteria 1238
898 Ga0207670_10482896 3300025936 Bacteria 1004
899 Ga0207669_10225585 3300025937 Bacteria 1378
900 Ga0207669_10397710 3300025937 Bacteria 1078
901 Ga0207704_10003676 3300025938 Bacteria 6974
902 Ga0207704_10143905 3300025938 Bacteria 1672
903 Ga0207704_10228873 3300025938 Bacteria 1381
904 Ga0207704_10302377 3300025938 Bacteria 1226
905 Ga0207704_10690514 3300025938 Bacteria 844
906 Ga0207665_10007307 3300025939 Bacteria 7307
907 Ga0207665_10047631 3300025939 Bacteria 2875
908 Ga0207665_10055046 3300025939 Bacteria 2683
909 Ga0207665_10083405 3300025939 Bacteria 2204
910 Ga0207665_10366321 3300025939 Bacteria 1091
911 Ga0207691_10031365 3300025940 Bacteria 4961
912 Ga0207691_10078519 3300025940 Bacteria 2971
913 Ga0207691_10091256 3300025940 Bacteria 2730
914 Ga0207691_10114355 3300025940 Bacteria 2398
915 Ga0207691_10117042 3300025940 Bacteria 2365
916 Ga0207691_10139985 3300025940 Bacteria 2133
917 Ga0207691_10196036 3300025940 Bacteria 1760
918 Ga0207691_10300080 3300025940 Bacteria 1380
919 Ga0207711_10030916 3300025941 Bacteria 4517
920 Ga0207711_10035753 3300025941 Bacteria 4212
921 Ga0207711_10448035 3300025941 Bacteria 1202
922 Ga0207711_10499913 3300025941 Bacteria 1133
923 Ga0207711_10675824 3300025941 Bacteria 963
924 Ga0207689_10002743 3300025942 Bacteria 16288
925 Ga0207689_10004653 3300025942 Bacteria 12412
926 Ga0207689_10115700 3300025942 Bacteria 2204
927 Ga0207689_10650612 3300025942 Bacteria 888
928 Ga0207661_10000283 3300025944 Bacteria 32486
929 Ga0207661_10022845 3300025944 Bacteria 4716
930 Ga0207661_10024896 3300025944 Bacteria 4543
931 Ga0207661_10032109 3300025944 Bacteria 4065
932 Ga0207661_10032571 3300025944 Bacteria 4039
933 Ga0207661_10033441 3300025944 Bacteria 3990
934 Ga0207661_10034228 3300025944 Bacteria 3949
935 Ga0207661_10040186 3300025944 Bacteria 3675
936 Ga0207661_10043331 3300025944 Bacteria 3551
937 Ga0207661_10052340 3300025944 Bacteria 3261
938 Ga0207661_10078935 3300025944 Bacteria 2712
939 Ga0207661_10120202 3300025944 Bacteria 2235
940 Ga0207661_10133091 3300025944 Bacteria 2132
941 Ga0207661_10164939 3300025944 Bacteria 1924
942 Ga0207661_10191767 3300025944 Bacteria 1792
943 Ga0207661_10330196 3300025944 Bacteria 1372
944 Ga0207661_10429027 3300025944 Bacteria 1201
945 Ga0207661_10700213 3300025944 Bacteria 932
946 Ga0207679_10000582 3300025945 Bacteria 24408
947 Ga0207679_10002943 3300025945 Bacteria 10549
948 Ga0207679_10005438 3300025945 Bacteria 7980
949 Ga0207679_10012892 3300025945 Bacteria 5468
950 Ga0207679_10106820 3300025945 Bacteria 2201
951 Ga0207679_10244714 3300025945 Bacteria 1521
952 Ga0207679_10246648 3300025945 Bacteria 1516
953 Ga0207679_10846872 3300025945 Unclassified 835
954 Ga0207679_10939675 3300025945 Bacteria 792
955 Ga0207679_11024059 3300025945 Unclassified 757
956 Ga0207679_11142734 3300025945 Unclassified 715
957 Ga0207667_10023205 3300025949 Bacteria 6833
958 Ga0207667_10123502 3300025949 Bacteria 2667
959 Ga0207667_10282749 3300025949 Bacteria 1695
960 Ga0207667_10296693 3300025949 Bacteria 1651
961 Ga0207667_10399427 3300025949 Bacteria 1400
962 Ga0207667_10555533 3300025949 Bacteria 1161
963 Ga0207667_11205444 3300025949 Bacteria 736
964 Ga0207651_10049298 3300025960 Bacteria 2852
965 Ga0207651_10059532 3300025960 Bacteria 2646
966 Ga0207651_10127416 3300025960 Bacteria 1942
967 Ga0207651_10354095 3300025960 Bacteria 1237
968 Ga0207651_10864518 3300025960 Bacteria 804
969 Ga0207651_10956532 3300025960 Bacteria 764
970 Ga0207651_11201331 3300025960 Unclassified 681
971 Ga0207712_10000596 3300025961 Bacteria 28910
972 Ga0207712_10009138 3300025961 Bacteria 6272
973 Ga0207712_10307834 3300025961 Bacteria 1303
974 Ga0207712_10542610 3300025961 Bacteria 999
975 Ga0207712_10730864 3300025961 Bacteria 866
976 Ga0207668_10002447 3300025972 Bacteria 10832
977 Ga0207668_10057777 3300025972 Bacteria 2708
978 Ga0207668_10780417 3300025972 Bacteria 845
979 Ga0207640_10003334 3300025981 Bacteria 8655
980 Ga0207640_10082778 3300025981 Bacteria 2198
981 Ga0207640_10093505 3300025981 Bacteria 2089
982 Ga0207640_10157883 3300025981 Bacteria 1674
983 Ga0207658_10048536 3300025986 Bacteria 3113
984 Ga0207658_10092199 3300025986 Bacteria 2353
985 Ga0207658_10163877 3300025986 Bacteria 1824
986 Ga0207658_10288807 3300025986 Bacteria 1409
987 Ga0207658_10326477 3300025986 Bacteria 1330
988 Ga0207658_10392764 3300025986 Bacteria 1217
989 Ga0207658_10573601 3300025986 Bacteria 1011
990 Ga0207658_11006515 3300025986 Bacteria 760
991 Ga0207677_10043997 3300026023 Bacteria 2972
992 Ga0207677_10109304 3300026023 Bacteria 2055
993 Ga0207703_10008320 3300026035 Bacteria 8196
994 Ga0207703_10086206 3300026035 Bacteria 2630
995 Ga0207703_10207911 3300026035 Bacteria 1743
996 Ga0207639_10006779 3300026041 Bacteria 7798
997 Ga0207639_10030610 3300026041 Bacteria 3948
998 Ga0207678_10004647 3300026067 Bacteria 12330
999 Ga0207678_10043220 3300026067 Bacteria 3900
1000 Ga0207678_10086730 3300026067 Bacteria 2675
1001 Ga0207678_10311581 3300026067 Bacteria 1353
1002 Ga0207678_10470336 3300026067 Bacteria 1094
1003 Ga0207708_10004898 3300026075 Bacteria 9870
1004 Ga0207708_10015391 3300026075 Bacteria 5738
1005 Ga0207708_10230197 3300026075 Bacteria 1488
1006 Ga0207708_10283465 3300026075 Bacteria 1343
1007 Ga0207708_10473194 3300026075 Bacteria 1047
1008 Ga0207708_10914246 3300026075 Bacteria 760
1009 Ga0207708_11309569 3300026075 Unclassified 635
1010 Ga0207702_10059273 3300026078 Bacteria 3261
1011 Ga0207702_10066121 3300026078 Bacteria 3098
1012 Ga0207702_10128018 3300026078 Bacteria 2282
1013 Ga0207702_10254414 3300026078 Bacteria 1651
1014 Ga0207702_10300475 3300026078 Bacteria 1523
1015 Ga0207702_10362301 3300026078 Bacteria 1390
1016 Ga0207702_10409846 3300026078 Bacteria 1309
1017 Ga0207702_10434302 3300026078 Bacteria 1271
1018 Ga0207641_10011831 3300026088 Bacteria 7160
1019 Ga0207641_10051528 3300026088 Bacteria 3486
1020 Ga0207641_10156827 3300026088 Bacteria 2066
1021 Ga0207641_10444388 3300026088 Bacteria 1252
1022 Ga0207641_10488199 3300026088 Bacteria 1195
1023 Ga0207648_10050849 3300026089 Bacteria 3623
1024 Ga0207648_10078510 3300026089 Bacteria 2879
1025 Ga0207648_10160589 3300026089 Bacteria 1985
1026 Ga0207648_10226026 3300026089 Bacteria 1664
1027 Ga0207648_10280164 3300026089 Bacteria 1491
1028 Ga0207648_10343769 3300026089 Bacteria 1344
1029 Ga0207648_10457233 3300026089 Bacteria 1163
1030 Ga0207648_10509219 3300026089 Bacteria 1102
1031 Ga0207648_10770790 3300026089 Bacteria 894
1032 Ga0207676_10003341 3300026095 Bacteria 11375
1033 Ga0207676_10060399 3300026095 Bacteria 2998
1034 Ga0207676_10076932 3300026095 Bacteria 2698
1035 Ga0207676_10950945 3300026095 Unclassified 845
1036 Ga0207674_10000393 3300026116 Bacteria 56512
1037 Ga0207674_10037409 3300026116 Bacteria 5048
1038 Ga0207674_10052391 3300026116 Bacteria 4162
1039 Ga0207674_10086730 3300026116 Bacteria 3124
1040 Ga0207674_10162014 3300026116 Bacteria 2191
1041 Ga0207674_10162129 3300026116 Bacteria 2190
1042 Ga0207674_10199528 3300026116 Bacteria 1950
1043 Ga0207674_10602524 3300026116 Unclassified 1061
1044 Ga0207674_11103797 3300026116 Bacteria 763
1045 Ga0207675_100035125 3300026118 Bacteria 4676
1046 Ga0207675_100066788 3300026118 Bacteria 3361
1047 Ga0207675_100251963 3300026118 Bacteria 1709
1048 Ga0207675_100288971 3300026118 Bacteria 1595
1049 Ga0207683_10011631 3300026121 Bacteria 7512
1050 Ga0207683_10065766 3300026121 Bacteria 3197
1051 Ga0207683_10133251 3300026121 Bacteria 2236
1052 Ga0207683_10356212 3300026121 Bacteria 1343
1053 Ga0207683_10469575 3300026121 Bacteria 1161
1054 Ga0207698_10003179 3300026142 Bacteria 9853
1055 Ga0207698_10110213 3300026142 Bacteria 2305
1056 Ga0207698_10111646 3300026142 Bacteria 2292
1057 Ga0207698_10156911 3300026142 Bacteria 1984
1058 Ga0207698_10205773 3300026142 Bacteria 1766
1059 Ga0207698_10211634 3300026142 Bacteria 1745
1060 Ga0207698_10415751 3300026142 Bacteria 1289
1061 Ga0207698_10495048 3300026142 Bacteria 1188
1062 Ga0207698_10576244 3300026142 Bacteria 1107
1063 Ga0207698_11163073 3300026142 Bacteria 785
1064 Ga0209973_1016475 3300027252 Bacteria 942
1065 Ga0209969_1004422 3300027360 Bacteria 1966
1066 Ga0209969_1030639 3300027360 Bacteria 822
1067 Ga0209967_1004046 3300027364 Bacteria 1939
1068 Ga0209981_1025450 3300027378 Unclassified 856
1069 Ga0209996_1002715 3300027395 Bacteria 2199
1070 Ga0209984_1001682 3300027424 Bacteria 2412
1071 Ga0210000_1024268 3300027462 Bacteria 935
1072 Ga0210000_1032642 3300027462 Bacteria 817
1073 Ga0209995_1003547 3300027471 Bacteria 2484
1074 Ga0209968_1000569 3300027526 Bacteria 5714
1075 Ga0209968_1003722 3300027526 Bacteria 2287
1076 Ga0209968_1005690 3300027526 Bacteria 1872
1077 Ga0209999_1001998 3300027543 Bacteria 3558
1078 Ga0209999_1015607 3300027543 Bacteria 1382
1079 Ga0209970_1000622 3300027614 Bacteria 6138
1080 Ga0209983_1002684 3300027665 Bacteria 3861
1081 Ga0209983_1043003 3300027665 Bacteria 980
1082 Ga0209971_1000924 3300027682 Bacteria 7567
1083 Ga0209971_1012252 3300027682 Bacteria 2029
1084 Ga0209966_1000766 3300027695 Bacteria 6626
1085 Ga0209966_1018755 3300027695 Bacteria 1327
1086 Ga0209966_1024816 3300027695 Bacteria 1187
1087 Ga0209998_10001270 3300027717 Bacteria 6170
1088 Ga0209998_10002526 3300027717 Bacteria 4167
1089 Ga0209974_10000553 3300027876 Bacteria 12476
1090 Ga0209974_10004293 3300027876 Bacteria 5081
1091 Ga0209974_10270091 3300027876 Bacteria 644
1092 Ga0207428_10026272 3300027907 Bacteria 4861
1093 Ga0207428_10063585 3300027907 Bacteria 2915
1094 Ga0207428_10302674 3300027907 Bacteria 1183
1095 Ga0207428_10562785 3300027907 Bacteria 824
1096 Ga0207428_10625205 3300027907 Bacteria 774
1097 Ga0207428_10901635 3300027907 Bacteria 625
1098 Ga0268266_10062029 3300028379 Bacteria 3225
1099 Ga0268266_10476443 3300028379 Bacteria 1189
1100 Ga0268265_10003125 3300028380 Bacteria 12070
1101 Ga0268265_10004276 3300028380 Bacteria 9964
1102 Ga0268265_10012616 3300028380 Bacteria 5730
1103 Ga0268265_10112369 3300028380 Bacteria 2227
1104 Ga0268265_10259200 3300028380 Bacteria 1545
1105 Ga0268265_10699297 3300028380 Bacteria 979
1106 Ga0268265_11221677 3300028380 Bacteria 750
1107 Ga0268264_10108473 3300028381 Bacteria 2427
1108 Ga0268264_10152207 3300028381 Bacteria 2075
1109 Ga0268264_10617802 3300028381 Bacteria 1070
1110 Ga0268264_11071362 3300028381 Bacteria 814
1111 Ga0316182_1261896 3300030745 Bacteria 938
1112 Ga0316182_1379587 3300030745 Bacteria 1181
1113 Ga0316182_1386424 3300030745 Bacteria 713
1114 Ga0265329_10045799 3300031242 Bacteria 1398
1115 Ga0265340_10088642 3300031247 Bacteria 1449
1116 Ga0265327_10004242 3300031251 Bacteria 12852
1117 Ga0265316_10180769 3300031344 Bacteria 1571
1118 Ga0307408_100002257 3300031548 Bacteria 13743
1119 Ga0307408_100005087 3300031548 Bacteria 8821
1120 Ga0307408_100064252 3300031548 Bacteria 2687
1121 Ga0307408_100250678 3300031548 Bacteria 1460
1122 Ga0307408_100517971 3300031548 Bacteria 1047
1123 Ga0307408_100645533 3300031548 Bacteria 946
1124 Ga0307408_101457208 3300031548 Bacteria 646
1125 Ga0307408_101821817 3300031548 Bacteria 582
1126 Ga0265314_10003494 3300031711 Bacteria 15169
1127 Ga0265314_10032497 3300031711 Bacteria 3838
1128 Ga0307405_10000393 3300031731 Bacteria 16379
1129 Ga0307405_10013731 3300031731 Bacteria 4328
1130 Ga0307405_10068958 3300031731 Bacteria 2265
1131 Ga0307405_10112556 3300031731 Bacteria 1847
1132 Ga0307405_10116031 3300031731 Bacteria 1823
1133 Ga0307405_10134272 3300031731 Bacteria 1715
1134 Ga0307405_10326055 3300031731 Bacteria 1175
1135 Ga0307405_10462222 3300031731 Bacteria 1009
1136 Ga0307405_11039212 3300031731 Bacteria 701
1137 Ga0307413_10002711 3300031824 Bacteria 7264
1138 Ga0307413_10018606 3300031824 Bacteria 3650
1139 Ga0307413_10025417 3300031824 Bacteria 3246
1140 Ga0307413_10035504 3300031824 Bacteria 2860
1141 Ga0307413_10131137 3300031824 Bacteria 1716
1142 Ga0307413_10336426 3300031824 Bacteria 1159
1143 Ga0307413_10538509 3300031824 Bacteria 945
1144 Ga0307410_10009624 3300031852 Bacteria 5433
1145 Ga0307410_10012945 3300031852 Bacteria 4846
1146 Ga0307410_10028873 3300031852 Bacteria 3524
1147 Ga0307410_10120218 3300031852 Bacteria 1914
1148 Ga0307410_10203073 3300031852 Bacteria 1514
1149 Ga0307410_10213940 3300031852 Bacteria 1478
1150 Ga0307410_10351161 3300031852 Bacteria 1178
1151 Ga0307410_10368859 3300031852 Bacteria 1152
1152 Ga0307410_10397097 3300031852 Bacteria 1113
1153 Ga0307410_10465426 3300031852 Bacteria 1034
1154 Ga0307410_10741337 3300031852 Unclassified 831
1155 Ga0307410_11404178 3300031852 Bacteria 613
1156 Ga0307406_10002236 3300031901 Bacteria 10539
1157 Ga0307406_10002275 3300031901 Bacteria 10446
1158 Ga0307406_10031805 3300031901 Bacteria 3216
1159 Ga0307406_10038979 3300031901 Bacteria 2944
1160 Ga0307406_10086657 3300031901 Bacteria 2097
1161 Ga0307406_10112385 3300031901 Bacteria 1878
1162 Ga0307406_10441163 3300031901 Bacteria 1042
1163 Ga0307406_10604777 3300031901 Bacteria 904
1164 Ga0307406_10827485 3300031901 Bacteria 783
1165 Ga0307406_11068608 3300031901 Bacteria 695
1166 Ga0307406_11098349 3300031901 Bacteria 687
1167 Ga0307406_11202909 3300031901 Unclassified 658
1168 Ga0307407_10002439 3300031903 Bacteria 7282
1169 Ga0307407_10008217 3300031903 Bacteria 4776
1170 Ga0307407_10025879 3300031903 Bacteria 3099
1171 Ga0307407_10026314 3300031903 Bacteria 3078
1172 Ga0307407_10056184 3300031903 Bacteria 2277
1173 Ga0307407_10100259 3300031903 Bacteria 1796
1174 Ga0307407_10116140 3300031903 Bacteria 1688
1175 Ga0307407_10214253 3300031903 Bacteria 1298
1176 Ga0307407_10264661 3300031903 Bacteria 1184
1177 Ga0307412_10061115 3300031911 Bacteria 2531
1178 Ga0307412_10106474 3300031911 Bacteria 1994
1179 Ga0307412_10110574 3300031911 Bacteria 1961
1180 Ga0307412_10430971 3300031911 Bacteria 1081
1181 Ga0307412_10776448 3300031911 Bacteria 829
1182 Ga0307409_100007004 3300031995 Bacteria 6699
1183 Ga0307409_100013524 3300031995 Bacteria 5257
1184 Ga0307409_100033936 3300031995 Bacteria 3720
1185 Ga0307409_100053133 3300031995 Bacteria 3111
1186 Ga0307409_100079698 3300031995 Bacteria 2640
1187 Ga0307409_100088383 3300031995 Bacteria 2529
1188 Ga0307409_100310418 3300031995 Bacteria 1471
1189 Ga0307409_100798589 3300031995 Bacteria 951
1190 Ga0307416_100001410 3300032002 Bacteria 13026
1191 Ga0307416_100004575 3300032002 Bacteria 8362
1192 Ga0307416_100077891 3300032002 Bacteria 2786
1193 Ga0307416_100086493 3300032002 Bacteria 2672
1194 Ga0307416_100106648 3300032002 Bacteria 2456
1195 Ga0307416_100148020 3300032002 Bacteria 2148
1196 Ga0307416_100169464 3300032002 Bacteria 2030
1197 Ga0307416_100505078 3300032002 Bacteria 1274
1198 Ga0307416_100557524 3300032002 Bacteria 1220
1199 Ga0307416_100640730 3300032002 Bacteria 1146
1200 Ga0307416_100748296 3300032002 Bacteria 1070
1201 Ga0307416_101028054 3300032002 Bacteria 927
1202 Ga0307416_101279839 3300032002 Bacteria 839
1203 Ga0307414_10021292 3300032004 Bacteria 4064
1204 Ga0307414_10029119 3300032004 Bacteria 3590
1205 Ga0307414_10101375 3300032004 Bacteria 2167
1206 Ga0307414_10169550 3300032004 Bacteria 1743
1207 Ga0307414_10170092 3300032004 Bacteria 1741
1208 Ga0307414_11111437 3300032004 Bacteria 730
1209 Ga0307411_10006203 3300032005 Bacteria 5956
1210 Ga0307411_10007886 3300032005 Bacteria 5469
1211 Ga0307411_10018407 3300032005 Bacteria 4005
1212 Ga0307411_10039445 3300032005 Bacteria 2987
1213 Ga0307411_10057273 3300032005 Bacteria 2573
1214 Ga0307411_10238532 3300032005 Bacteria 1422
1215 Ga0307411_10245593 3300032005 Bacteria 1404
1216 Ga0307411_10250612 3300032005 Bacteria 1392
1217 Ga0307411_10418317 3300032005 Bacteria 1113
1218 Ga0307415_100008524 3300032126 Bacteria 5689
1219 Ga0307415_100008871 3300032126 Bacteria 5601
1220 Ga0307415_100121793 3300032126 Bacteria 1957
1221 Ga0307415_100123143 3300032126 Bacteria 1948
1222 Ga0307415_100164995 3300032126 Bacteria 1721
1223 Ga0307415_100176560 3300032126 Bacteria 1671
1224 Ga0307415_100511153 3300032126 Bacteria 1052
1225 Ga0307415_100608132 3300032126 Bacteria 974
1226 Ga0307415_100724967 3300032126 Bacteria 900
1227 Ga0307415_101587937 3300032126 Bacteria 628
1228 Ga0307415_101744109 3300032126 Unclassified 601
1229 Ga0373948_0011529 3300034817 Bacteria 1565
1230 Ga0373958_0025875 3300034819 Bacteria 1120
1231 Ga0373958_0031089 3300034819 Bacteria 1047
1232 Ga0373959_0003885 3300034820 Bacteria 2391
1233 Ga0373926_0004875 3300035083 Bacteria 4410
1234 Ga0373929_0014598 3300035085 Bacteria 1520
1235 Ga0373934_0001950 3300035086 Bacteria 7563
1236 Ga0373934_0017874 3300035086 Bacteria 2709
1237 Ga0373940_0043179 3300035088 Bacteria 1245
1238 Ga0373940_0044261 3300035088 Bacteria 1233
1239 Ga0373944_0247503 3300035089 Bacteria 657
1240 Ga0373949_0019486 3300035090 Bacteria 1546
1241 Ga0373952_0035326 3300035092 Bacteria 1131
1242 Ga0373952_0113436 3300035092 Unclassified 728
1243 Ga0373923_0052282 3300035111 Bacteria 1716
1244 Ga0373939_0004065 3300035114 Bacteria 3446
1245 Ga0373939_0104699 3300035114 Bacteria 976
1246 Ga0373941_0004689 3300035115 Bacteria 3175
1247 Ga0373941_0040016 3300035115 Bacteria 1444
1248 Ga0373945_0008197 3300035116 Bacteria 3398
1249 Ga0373945_0010977 3300035116 Bacteria 2989
1250 Ga0373953_0012022 3300035117 Bacteria 3055
1251 Ga0373953_0171740 3300035117 Bacteria 933
1252 Ga0373954_0032792 3300035118 Bacteria 2402
1253 Ga0373957_0007100 3300035120 Bacteria 3566
1254 Ga0373957_0270146 3300035120 Bacteria 718
1255 Ga0373960_0013130 3300035121 Bacteria 2072
1256 Ga0373960_0055009 3300035121 Bacteria 1192
1257 Ga0373960_0072608 3300035121 Bacteria 1067
1258 Ga0373943_0002422 3300035170 Bacteria 8464
1259 Ga0373946_0002485 3300035171 Bacteria 6507
1260 Ga0373955_0001621 3300035172 Bacteria 9637
1261 Ga0373955_0010972 3300035172 Bacteria 4301
1262 Ga0373955_0239824 3300035172 Bacteria 1086
1263 Ga0373942_0012467 3300035207 Bacteria 2031
1264 Ga0373961_0042255 3300035241 Bacteria 1321
1265 Ga0373961_0049360 3300035241 Bacteria 1243
1266 Ga0373961_0050034 3300035241 Bacteria 1237
1267 Ga0373961_0081022 3300035241 Bacteria 1021
1268 Ga0373962_0040324 3300035242 Bacteria 1313
1269 Ga0373924_0046941 3300035410 Bacteria 1781
1270 Ga0373931_0010909 3300035691 Bacteria 4375
1271 Ga0373931_0848899 3300035691 Unclassified 611
1272 Ga0373935_0001207 3300035692 Bacteria 14241
1273 Ga0373935_0160633 3300035692 Bacteria 1531
1274 Ga0373935_0209603 3300035692 Bacteria 1350
1275 Ga0373935_0293890 3300035692 Bacteria 1147
1276 Ga0373935_0319523 3300035692 Bacteria 1101
1277 Ga0373927_0012867 3300035695 Bacteria 5563
1278 Ga0373927_0024739 3300035695 Bacteria 3923
1279 Ga0373927_0133583 3300035695 Bacteria 1621
1280 Ga0373927_0241346 3300035695 Bacteria 1187
1281 Ga0373927_0295112 3300035695 Bacteria 1067
1282 Ga0373933_0071250 3300035724 Bacteria 2115
1283 Ga0373947_0000036 3300035725 Bacteria 64977
1284 Ga0373937_0028903 3300036401 Bacteria 5020
1285 Ga0373937_0030183 3300036401 Bacteria 4910
1286 Ga0373937_0294252 3300036401 Bacteria 1534
1287 Ga0373937_0349015 3300036401 Bacteria 1401
1288 Ga0373937_1405769 3300036401 Bacteria 645
1289 Ga0373925_0002900 3300037068 Bacteria 13548
1290 Ga0373925_0079107 3300037068 Bacteria 2497
1291 Ga0395899_0024945 3300037312 Bacteria 4516
1292 Ga0395899_0252138 3300037312 Bacteria 1211
1293 Ga0395900_0018069 3300037418 Bacteria 7198
1294 Ga0395898_0092700 3300037466 Bacteria 2905
1295 Ga0395898_1325841 3300037466 Bacteria 649
1296 Ga0395905_0024022 3300037471 Bacteria 5753
1297 Ga0395905_0518557 3300037471 Bacteria 1092
1298 Ga0395905_1111444 3300037471 Bacteria 694
1299 Ga0436364_1341442 3300037853 Bacteria 902
1300 Ga0395901_0013649 3300038443 Bacteria 8258
1301 Ga0395901_0433913 3300038443 Bacteria 1346
1302 Ga0395901_0971620 3300038443 Bacteria 827
1303 Ga0436365_0453863 3300039437 Bacteria 6719
1304 Ga0436365_0527755 3300039437 Bacteria 984
1305 Ga0436365_1474633 3300039437 Bacteria 818
1306 Ga0436363_1364797 3300039450 Bacteria 651
1307 Ga0439439_0048612 3300041406 Bacteria 1110
1308 Ga0439439_0056597 3300041406 Bacteria 1036
1309 Ga0439461_0106727 3300041410 Unclassified 687
1310 Ga0451849_0697007 3300041505 Bacteria 666
1311 Ga0439433_0045714 3300041999 Bacteria 1025
1312 Ga0439448_0165838 3300042005 Bacteria 770
1313 Ga0439432_112596 3300042006 Bacteria 809
1314 Ga0439449_0137510 3300042007 Bacteria 909
1315 Ga0439457_077101 3300042014 Bacteria 764
1316 Ga0450914_038316 3300042118 Bacteria 601
1317 Ga0439434_0045677 3300042435 Bacteria 1351
1318 Ga0439464_0014107 3300042439 Bacteria 2146
1319 Ga0450918_048213 3300042531 Unclassified 773
1320 Ga0451577_0052812 3300042876 Bacteria 3629
1321 Ga0451577_0061827 3300042876 Bacteria 3339
1322 Ga0451577_0272209 3300042876 Bacteria 1534
1323 Ga0453683_0422606 3300044673 Bacteria 860
1324 Ga0453683_1051357 3300044673 Unclassified 542
1325 Ga0466965_0367195 3300044683 Bacteria 791
1326 Ga0466966_0002321 3300044684 Bacteria 12398
1327 Ga0466966_0405162 3300044684 Bacteria 820
1328 Ga0466961_0193427 3300044693 Bacteria 1260
1329 Ga0466961_0252437 3300044693 Bacteria 1083
1330 Ga0453684_0007935 3300044712 Bacteria 19255
1331 Ga0453684_0680474 3300044712 Bacteria 1120
1332 Ga0466959_0083014 3300045049 Bacteria 2308
1333 Ga0466959_0102056 3300045049 Bacteria 2053
1334 Ga0466959_0159260 3300045049 Bacteria 1588
1335 Ga0451576_0055578 3300045051 Bacteria 4141
1336 Ga0451576_0299384 3300045051 Bacteria 1682
1337 Ga0451576_0394688 3300045051 Bacteria 1450
1338 Ga0451576_0646029 3300045051 Bacteria 1112
1339 Ga0466958_0320546 3300045836 Bacteria 996
1340 Ga0466967_0016772 3300045976 Bacteria 5789
1341 Ga0466967_0197468 3300045976 Bacteria 1904
1342 Ga0495592_0059098 3300046454 Bacteria 2825
1343 Ga0495592_0090958 3300046454 Bacteria 2189
1344 Ga0495603_0000774 3300046455 Bacteria 18264
1345 Ga0495603_0061064 3300046455 Bacteria 2226
1346 Ga0495603_0391216 3300046455 Bacteria 797
1347 Ga0495629_0025246 3300046459 Bacteria 4226
1348 Ga0495629_0046147 3300046459 Bacteria 3056
1349 Ga0495629_0051921 3300046459 Bacteria 2869
1350 Ga0495629_0129738 3300046459 Bacteria 1756
1351 Ga0495629_0135653 3300046459 Bacteria 1713
1352 Ga0495651_0007272 3300046462 Bacteria 8463
1353 Ga0495653_0026336 3300046463 Bacteria 4664
1354 Ga0495653_0190493 3300046463 Bacteria 1400
1355 Ga0495580_0000048 3300046472 Bacteria 68571
1356 Ga0495580_0005246 3300046472 Bacteria 10769
1357 Ga0495580_0251168 3300046472 Bacteria 1211
1358 Ga0495580_0317252 3300046472 Bacteria 1059
1359 Ga0495580_0603293 3300046472 Bacteria 725
1360 Ga0495582_0000179 3300046473 Bacteria 34488
1361 Ga0495582_0089405 3300046473 Bacteria 1716
1362 Ga0495582_0190051 3300046473 Bacteria 1171
1363 Ga0495582_0190118 3300046473 Bacteria 1171
1364 Ga0495639_0000917 3300046475 Bacteria 13315
1365 Ga0495639_0025267 3300046475 Bacteria 2619
1366 Ga0495639_0124255 3300046475 Bacteria 1232
1367 Ga0495639_0128318 3300046475 Bacteria 1213
1368 Ga0495639_0153678 3300046475 Bacteria 1111
1369 Ga0495662_0045613 3300046476 Bacteria 2116
1370 Ga0495662_0148930 3300046476 Bacteria 1152
1371 Ga0495664_0052972 3300046477 Bacteria 2413
1372 Ga0495664_0065508 3300046477 Bacteria 2166
1373 Ga0495664_0119664 3300046477 Bacteria 1593
1374 Ga0495664_0200678 3300046477 Bacteria 1209
1375 Ga0495585_0484234 3300046492 Bacteria 589
1376 Ga0495594_0023704 3300046499 Bacteria 3290
1377 Ga0495594_0050634 3300046499 Bacteria 2285
1378 Ga0495594_0056042 3300046499 Bacteria 2174
1379 Ga0495594_0082577 3300046499 Bacteria 1795
1380 Ga0495594_0150217 3300046499 Bacteria 1322
1381 Ga0495596_0059166 3300046500 Bacteria 1494
1382 Ga0495608_0031708 3300046511 Bacteria 3572
1383 Ga0495618_0288660 3300046514 Bacteria 1021
1384 Ga0495620_0049369 3300046515 Bacteria 1801
1385 Ga0495628_0101738 3300046516 Bacteria 2217
1386 Ga0495628_0149404 3300046516 Bacteria 1780
1387 Ga0495628_0180853 3300046516 Bacteria 1595
1388 Ga0495628_0499176 3300046516 Bacteria 879
1389 Ga0495630_0004558 3300046517 Bacteria 9711
1390 Ga0495630_0085911 3300046517 Bacteria 2375
1391 Ga0495630_0188289 3300046517 Bacteria 1574
1392 Ga0495631_0265938 3300046518 Bacteria 731
1393 Ga0495644_0121267 3300046523 Bacteria 995
1394 Ga0495666_0036458 3300046526 Bacteria 2395
1395 Ga0495642_0091528 3300046528 Bacteria 1288
1396 Ga0495642_0251978 3300046528 Bacteria 772
1397 Ga0495652_0075969 3300046529 Bacteria 2788
1398 Ga0495652_0108848 3300046529 Bacteria 2232
1399 Ga0495665_0000002 3300046531 Bacteria 128983
1400 Ga0495665_0037940 3300046531 Bacteria 2570
1401 Ga0495665_0044551 3300046531 Bacteria 2357
1402 Ga0495665_0104079 3300046531 Bacteria 1489
1403 Ga0495665_0195919 3300046531 Bacteria 1048
1404 Ga0495665_0228634 3300046531 Bacteria 961
1405 Ga0495640_0045556 3300046533 Bacteria 3043
1406 Ga0495640_0521255 3300046533 Unclassified 722
1407 Ga0495586_0075598 3300046535 Bacteria 1844
1408 Ga0495586_0239426 3300046535 Bacteria 1034
1409 Ga0495587_0009315 3300046536 Bacteria 6297
1410 Ga0495587_0020967 3300046536 Bacteria 4031
1411 Ga0495587_0071142 3300046536 Bacteria 2023
1412 Ga0495587_0307965 3300046536 Bacteria 885
1413 Ga0495598_0188507 3300046537 Bacteria 739
1414 Ga0495621_0257239 3300046539 Bacteria 714
1415 Ga0495645_0004375 3300046543 Bacteria 9647
1416 Ga0495645_0144276 3300046543 Bacteria 1658
1417 Ga0495645_0182107 3300046543 Bacteria 1438
1418 Ga0495622_0104163 3300046557 Bacteria 1300
1419 Ga0495667_0012198 3300046559 Bacteria 5821
1420 Ga0495667_0012237 3300046559 Bacteria 5814
1421 Ga0495667_0096831 3300046559 Bacteria 1910
1422 Ga0495667_0202194 3300046559 Bacteria 1271
1423 Ga0495667_0476114 3300046559 Unclassified 783
1424 Ga0495634_0078582 3300046642 Bacteria 2161
1425 Ga0495634_0085652 3300046642 Bacteria 2053
1426 Ga0495634_0135824 3300046642 Bacteria 1565
1427 Ga0495635_0073192 3300046663 Bacteria 2347
1428 Ga0495635_0200298 3300046663 Bacteria 1354
1429 Ga0495635_0238196 3300046663 Bacteria 1228
1430 Ga0495659_0168281 3300046664 Bacteria 888
1431 Ga0495659_0337323 3300046664 Bacteria 642
1432 Ga0495588_0000464 3300046674 Bacteria 20343
1433 Ga0495588_0200108 3300046674 Bacteria 1055
1434 Ga0495588_0462174 3300046674 Bacteria 666
1435 Ga0495588_0660673 3300046674 Bacteria 547
1436 Ga0495657_0007724 3300046675 Bacteria 8274
1437 Ga0495657_0353614 3300046675 Bacteria 869
1438 Ga0495599_0017331 3300046678 Bacteria 4477
1439 Ga0495599_0022659 3300046678 Bacteria 3922
1440 Ga0495599_0060889 3300046678 Bacteria 2360
1441 Ga0495623_0009437 3300046679 Bacteria 6334
1442 Ga0495623_0019422 3300046679 Bacteria 4393
1443 Ga0495623_0116001 3300046679 Bacteria 1618
1444 Ga0495658_0000017 3300046683 Bacteria 93346
1445 Ga0495658_0034200 3300046683 Bacteria 2787
1446 Ga0495658_0085320 3300046683 Bacteria 1861
1447 Ga0495658_0088542 3300046683 Bacteria 1830
1448 Ga0495669_0162868 3300046684 Bacteria 1059
1449 Ga0495669_0295436 3300046684 Bacteria 780
1450 Ga0495613_0024110 3300046689 Bacteria 4534
1451 Ga0495613_0095423 3300046689 Bacteria 2151
1452 Ga0495613_0264410 3300046689 Bacteria 1197
1453 Ga0495613_0272776 3300046689 Bacteria 1176
1454 Ga0495670_0152555 3300046691 Bacteria 1212
1455 Ga0495600_0030035 3300046809 Bacteria 3520
1456 Ga0495600_0068897 3300046809 Bacteria 2312
1457 Ga0495600_0373586 3300046809 Unclassified 890
1458 Ga0495581_0000312 3300047315 Bacteria 23854
1459 Ga0495581_0015316 3300047315 Bacteria 4452
1460 Ga0495581_0155211 3300047315 Bacteria 1338
1461 Ga0495581_0426975 3300047315 Bacteria 772
1462 Ga0495604_0034670 3300047317 Bacteria 3992
1463 Ga0495604_0169824 3300047317 Bacteria 1535
1464 Ga0495604_0261367 3300047317 Bacteria 1176
1465 Ga0495604_0379121 3300047317 Bacteria 935
1466 Ga0495636_0181890 3300047318 Bacteria 954
1467 Ga0495674_0024914 3300047319 Bacteria 5491
1468 Ga0495674_0092120 3300047319 Bacteria 2588
1469 Ga0495674_0174987 3300047319 Bacteria 1789
1470 Ga0495672_0003004 3300047320 Bacteria 14831
1471 Ga0495676_0120349 3300047321 Bacteria 1911
1472 Ga0495680_0091173 3300047322 Bacteria 2285
1473 Ga0495680_0197314 3300047322 Bacteria 1445
1474 Ga0495680_0314323 3300047322 Bacteria 1097
1475 Ga0495675_0026681 3300047444 Bacteria 3683
1476 Ga0495675_0114593 3300047444 Bacteria 1681
1477 Ga0495675_0173492 3300047444 Bacteria 1323
1478 Ga0495675_0192174 3300047444 Bacteria 1245
1479 Ga0495677_0054921 3300047445 Bacteria 1470
1480 Ga0495677_0127135 3300047445 Bacteria 974
1481 Ga0495685_079177 3300047447 Bacteria 1095
1482 Ga0495681_0169572 3300047470 Bacteria 904
1483 Ga0495684_0010619 3300047471 Bacteria 7118
1484 Ga0495684_0051096 3300047471 Bacteria 3155
1485 Ga0495684_0170599 3300047471 Bacteria 1618
1486 Ga0495593_0000009 3300047673 Bacteria 85608
1487 Ga0495593_0225905 3300047673 Bacteria 939
1488 Ga0495593_0253689 3300047673 Bacteria 881
1489 Ga0495602_0139637 3300048088 Bacteria 1919
1490 Ga0495602_0391914 3300048088 Bacteria 992
1491 Ga0495614_0000005 3300048089 Bacteria 74692
1492 Ga0495614_0080470 3300048089 Bacteria 1411
1493 Ga0495614_0104335 3300048089 Bacteria 1242
1494 Ga0495615_0004404 3300048090 Bacteria 2457
1495 Ga0496100_0051928 3300048903 Bacteria 2663
1496 Ga0496102_0045307 3300048905 Bacteria 3993
1497 Ga0496102_0372073 3300048905 Bacteria 1345
1498 Ga0496103_0063254 3300048906 Bacteria 2305
1499 Ga0496104_0035477 3300048907 Bacteria 4656
1500 Ga0496104_0188251 3300048907 Bacteria 1975
1501 Ga0496105_0034848 3300048908 Bacteria 4142
1502 Ga0496105_0481339 3300048908 Bacteria 976
1503 Ga0496106_0092000 3300048909 Bacteria 2342
1504 Ga0496106_0098435 3300048909 Bacteria 2266
1505 Ga0496107_0096470 3300048910 Bacteria 2164
1506 Ga0496107_0638516 3300048910 Unclassified 785
1507 Ga0496108_0138948 3300048911 Bacteria 2092
1508 Ga0496108_0515253 3300048911 Bacteria 1044
1509 Ga0496109_0062007 3300048912 Bacteria 3419
1510 Ga0496109_0213158 3300048912 Bacteria 1816
1511 Ga0496110_0131572 3300048913 Bacteria 2260
1512 Ga0496110_0331004 3300048913 Bacteria 1387
1513 Ga0496110_0864425 3300048913 Bacteria 810
1514 Ga0496111_0588139 3300048914 Unclassified 815
1515 Ga0496112_0007357 3300048915 Bacteria 9768
1516 Ga0496112_0011512 3300048915 Bacteria 8082
1517 Ga0496112_0061746 3300048915 Bacteria 3695
1518 Ga0496112_0125606 3300048915 Bacteria 2536
1519 Ga0496112_0159113 3300048915 Bacteria 2225
1520 Ga0496112_0198054 3300048915 Bacteria 1969
1521 Ga0496112_0337636 3300048915 Bacteria 1450
1522 Ga0496113_0034556 3300048916 Bacteria 3689
1523 Ga0496113_0125789 3300048916 Bacteria 2007
1524 Ga0496115_0303651 3300048918 Bacteria 1308
1525 Ga0496115_0720737 3300048918 Bacteria 782
1526 Ga0501306_013293 3300049127 Bacteria 1072
1527 Ga0501306_019523 3300049127 Bacteria 935
1528 Ga0501308_023243 3300049128 Bacteria 790
1529 Ga0501309_001393 3300049129 Bacteria 2360
1530 Ga0501309_010333 3300049129 Bacteria 1202
1531 Ga0501307_000980 3300049162 Bacteria 2228
1532 Ga0501307_001114 3300049162 Bacteria 2158
1533 Ga0501307_007862 3300049162 Bacteria 1186
1534 Ga0501307_038351 3300049162 Bacteria 688
1535 Ga0501291_123184 3300049514 Bacteria 564
1536 Ga0501298_028587 3300049521 Bacteria 1083
1537 Ga0501299_052756 3300049522 Unclassified 844
1538 Ga0501311_002476 3300049527 Bacteria 1773
1539 Ga0501311_004538 3300049527 Bacteria 1482
1540 Ga0501311_016925 3300049527 Bacteria 955
1541 Ga0501312_056549 3300049528 Bacteria 672
1542 Ga0501313_004470 3300049529 Bacteria 1438
1543 Ga0501315_021987 3300049531 Bacteria 867
1544 Ga0501316_009249 3300049532 Bacteria 1102
1545 Ga0501316_010847 3300049532 Bacteria 1043
1546 Ga0501316_011289 3300049532 Bacteria 1029
1547 Ga0501317_013796 3300049533 Bacteria 1015
1548 Ga0501320_023190 3300049536 Bacteria 732
1549 Ga0501323_008090 3300049539 Bacteria 1214
1550 Ga0501323_026219 3300049539 Bacteria 797
1551 Ga0501324_001625 3300049540 Bacteria 1528
1552 Ga0501031_0074621 3300049568 Bacteria 2209
1553 Ga0501031_0209344 3300049568 Bacteria 1271
1554 Ga0501032_0033574 3300049569 Bacteria 3515
1555 Ga0501033_0466893 3300049570 Bacteria 875
1556 Ga0501034_0556562 3300049571 Bacteria 1056
1557 Ga0501034_0642092 3300049571 Bacteria 964
1558 Ga0501036_0127060 3300049572 Bacteria 2153
1559 Ga0501037_0308337 3300049573 Bacteria 1098
1560 Ga0501038_0513461 3300049574 Bacteria 915
1561 Ga0501038_0712879 3300049574 Unclassified 751
1562 Ga0501039_0375285 3300049575 Bacteria 1117
1563 Ga0501040_0431791 3300049576 Bacteria 947
1564 Ga0501043_0055578 3300049579 Bacteria 3110
1565 Ga0501043_0185422 3300049579 Bacteria 1620
1566 Ga0501046_0129806 3300049580 Bacteria 1912
1567 Ga0501047_0014779 3300049581 Bacteria 7430
1568 Ga0501047_0196179 3300049581 Bacteria 1881
1569 Ga0501067_0399161 3300049583 Bacteria 767
1570 Ga0501070_0061451 3300049586 Bacteria 3112
1571 Ga0501070_0106773 3300049586 Bacteria 2314
1572 Ga0501071_0079085 3300049587 Bacteria 2404
1573 Ga0501071_0331773 3300049587 Bacteria 1156
1574 Ga0501072_1237048 3300049588 Bacteria 579
1575 Ga0501073_0268094 3300049589 Bacteria 1178
1576 Ga0501073_0393792 3300049589 Bacteria 957
1577 Ga0501074_0214188 3300049590 Bacteria 1372
1578 Ga0501074_0553289 3300049590 Unclassified 814
1579 Ga0501075_0126690 3300049591 Bacteria 1944
1580 Ga0501075_0180257 3300049591 Bacteria 1612
1581 Ga0501076_0325659 3300049592 Bacteria 1260
1582 Ga0501076_0984491 3300049592 Unclassified 695
1583 Ga0501198_083668 3300049649 Bacteria 622
1584 Ga0501202_164123 3300049652 Bacteria 590
1585 Ga0501206_056896 3300049653 Bacteria 634
1586 Ga0501207_069832 3300049654 Bacteria 658
1587 Ga0501217_024873 3300049661 Bacteria 1436
1588 Ga0501224_007129 3300049664 Bacteria 1626
1589 Ga0501227_032223 3300049665 Bacteria 1263
1590 Ga0501227_164012 3300049665 Bacteria 619
1591 Ga0501233_032767 3300049668 Bacteria 1184
1592 Ga0501235_001630 3300049669 Bacteria 4824
1593 Ga0501248_016002 3300049678 Bacteria 728
1594 Ga0501249_002095 3300049679 Bacteria 4061
1595 Ga0501250_022605 3300049680 Bacteria 825
1596 Ga0501257_071687 3300049686 Bacteria 886
1597 Ga0501257_104848 3300049686 Bacteria 745
1598 Ga0501259_034647 3300049688 Bacteria 969
1599 Ga0501261_023703 3300049690 Bacteria 895
1600 Ga0501219_006160 3300049703 Bacteria 858
1601 Ga0501225_0007423 3300049705 Bacteria 3175
1602 Ga0501234_006534 3300049707 Bacteria 1824
1603 Ga0501079_0110450 3300049741 Bacteria 2136
1604 Ga0501079_0180034 3300049741 Bacteria 1649
1605 Ga0501080_0053870 3300049742 Bacteria 3747
1606 Ga0501080_0212868 3300049742 Bacteria 1771
1607 Ga0501080_0641315 3300049742 Bacteria 940
1608 Ga0501080_0738704 3300049742 Bacteria 866
1609 Ga0501081_0086410 3300049743 Bacteria 2202
1610 Ga0501083_0369517 3300049744 Bacteria 933
1611 Ga0501232_010651 3300049757 Bacteria 1041
1612 Ga0501266_005651 3300049763 Bacteria 1555
1613 Ga0501268_001269 3300049765 Bacteria 3106
1614 Ga0501268_055351 3300049765 Bacteria 776
1615 Ga0501272_007479 3300049769 Bacteria 1185
1616 Ga0501035_0046302 3300049822 Bacteria 3912
1617 Ga0501035_0210590 3300049822 Bacteria 1663
1618 Ga0501035_0324916 3300049822 Bacteria 1292
1619 Ga0501045_0418500 3300049824 Bacteria 997
1620 Ga0501212_076168 3300049851 Bacteria 601
1621 nmdc:mga05p37_1266157_c1 3300050507 Bacteria 755
1622 nmdc:mga05p37_160485_c1 3300050507 Bacteria 2746
1623 nmdc:mga05p37_19612_c1 3300050507 Bacteria 8178
1624 nmdc:mga05p37_271519_c1 3300050507 Bacteria 2026
1625 nmdc:mga05p37_3917_c1 3300050507 Bacteria 17431
1626 nmdc:mga05p37_82274_c1 3300050507 Bacteria 3967
1627 nmdc:mga09592_140785_c1 3300050508 Bacteria 2079
1628 nmdc:mga09592_15413_c1 3300050508 Bacteria 6245
1629 nmdc:mga09592_188306_c1 3300050508 Bacteria 1786
1630 nmdc:mga09592_227605_c1 3300050508 Bacteria 1615
1631 nmdc:mga09592_40739_c1 3300050508 Bacteria 3903
1632 nmdc:mga09592_430636_c1 3300050508 Bacteria 1139
1633 nmdc:mga09592_49688_c1 3300050508 Bacteria 3536
1634 nmdc:mga0qj67_158748_c1 3300050509 Bacteria 1836
1635 nmdc:mga0qj67_177890_c1 3300050509 Bacteria 1728
1636 nmdc:mga0qj67_187451_c1 3300050509 Bacteria 1681
1637 nmdc:mga0qj67_247879_c1 3300050509 Bacteria 1445
1638 nmdc:mga0qj67_26425_c1 3300050509 Bacteria 4494
1639 nmdc:mga0qj67_321506_c1 3300050509 Bacteria 1252
1640 nmdc:mga0qj67_366205_c1 3300050509 Bacteria 1164
1641 nmdc:mga0qj67_40140_c1 3300050509 Bacteria 3678
1642 nmdc:mga0qj67_62146_c1 3300050509 Bacteria 2968
1643 nmdc:mga06r32_11453_c1 3300050510 Bacteria 7986
1644 nmdc:mga06r32_1194161_c1 3300050510 Bacteria 707
1645 nmdc:mga06r32_29589_c1 3300050510 Bacteria 5135
1646 nmdc:mga06r32_355255_c1 3300050510 Bacteria 1450
1647 nmdc:mga06r32_438043_c1 3300050510 Bacteria 1287
1648 nmdc:mga06r32_455925_c1 3300050510 Bacteria 1258
1649 nmdc:mga06r32_651335_c1 3300050510 Bacteria 1021
1650 nmdc:mga06r32_88199_c1 3300050510 Bacteria 3028
1651 nmdc:mga08y16_145790_c1 3300050511 Bacteria 2461
1652 nmdc:mga08y16_146631_c1 3300050511 Bacteria 2454
1653 nmdc:mga08y16_168077_c1 3300050511 Bacteria 2279
1654 nmdc:mga08y16_27513_c1 3300050511 Bacteria 5991
1655 nmdc:mga08y16_33336_c1 3300050511 Bacteria 5409
1656 nmdc:mga08y16_84658_c1 3300050511 Bacteria 3305
1657 nmdc:mga0n895_10875_c1 3300050512 Bacteria 8079
1658 nmdc:mga0n895_14066_c1 3300050512 Bacteria 7253
1659 nmdc:mga0n895_147262_c1 3300050512 Bacteria 2384
1660 nmdc:mga0n895_235374_c1 3300050512 Bacteria 1859
1661 nmdc:mga0n895_436895_c1 3300050512 Bacteria 1322
1662 nmdc:mga0n895_69021_c1 3300050512 Bacteria 3501
1663 nmdc:mga0n895_84154_c1 3300050512 Bacteria 3174
1664 nmdc:mga0n895_90735_c1 3300050512 Bacteria 3058
1665 nmdc:mga0rr50_1032596_c1 3300050513 Bacteria 700
1666 nmdc:mga0rr50_114549_c1 3300050513 Bacteria 2138
1667 nmdc:mga0rr50_138710_c1 3300050513 Bacteria 1954
1668 nmdc:mga0rr50_462521_c1 3300050513 Bacteria 1076
1669 nmdc:mga0rr50_63406_c1 3300050513 Bacteria 2791
1670 nmdc:mga0a205_196515_c1 3300050515 Bacteria 1908
1671 nmdc:mga0a205_28550_c1 3300050515 Bacteria 5335
1672 nmdc:mga0a205_294033_c1 3300050515 Bacteria 1498
1673 nmdc:mga0a205_36134_c1 3300050515 Bacteria 4746
1674 nmdc:mga0a205_6528_c1 3300050515 Bacteria 10547
1675 Ga0495601_0155460 3300053077 Bacteria 1493
1676 Ga0495601_0423665 3300053077 Bacteria 862
1677 Ga0495612_0132552 3300053078 Bacteria 1077
1678 Ga0495612_0200960 3300053078 Bacteria 879
1679 Ga0495595_0137986 3300053084 Bacteria 1195
1680 Ga0495595_0226027 3300053084 Bacteria 934
1681 Ga0501084_0106476 3300054114 Bacteria 2356
1682 Ga0501084_0309154 3300054114 Bacteria 1335
1683 Ga0590075_070669 3300059424 Bacteria 902
1684 Ga0590077_039989 3300059426 Bacteria 1040
1685 Ga0590077_062781 3300059426 Bacteria 843
1686 Ga0587108_012874 3300059653 Bacteria 728
1687 Ga0587111_0045632 3300060346 Unclassified 950
1688 Ga0501082_0053239 3300060353 Bacteria 3489
1689 Ga0501082_0204266 3300060353 Bacteria 1719
1690 Ga0501082_0552852 3300060353 Bacteria 1007
1691 Ga0466962_0175353 3300061719 Bacteria 1045
1692 Ga0530510_0532243 3300061734 Bacteria 892
1693 Ga0501041_0115562
1694 LJQas_1008719
1695 JGI24737J22298_10047709
1696 JGI24735J21928_10152635
1697 JGI24750J21931_1010721
1698 JGI26145J50221_1002425
1699 Ga0058861_10085796
1700 Ga0058861_10097294
1701 Ga0058861_10124789
1702 Ga0058861_10157639
1703 Ga0058861_11844075
1704 Ga0058862_10020038
1705 Ga0058862_10123762
1706 Ga0058862_10283756
1707 Ga0058862_10288296
1708 Ga0058862_12486219
1709 Ga0058862_12612346
1710 Ga0058862_12737859
1711 Ga0058862_12847149
1712 Ga0065712_10175774
1713 Ga0065715_10092142
1714 Ga0065715_10100313
1715 Ga0065707_10155111
1716 Ga0070658_10022117
1717 Ga0070658_10046451
1718 Ga0070658_10105917
1719 Ga0070658_10108142
1720 Ga0070658_10127177
1721 Ga0070658_10129323
1722 Ga0070658_10241595
1723 Ga0070658_10696827
1724 Ga0070658_10816000
1725 Ga0070658_10829537
1726 Ga0070658_11347551
1727 Ga0070658_11375869
1728 Ga0070676_10000852
1729 Ga0070676_10057418
1730 Ga0070676_10073120
1731 Ga0070683_100017450
1732 Ga0070683_100017633
1733 Ga0070683_100031156
1734 Ga0070683_100042520
1735 Ga0070683_100050790
1736 Ga0070683_100051102
1737 Ga0070683_100057657
1738 Ga0070683_100076000
1739 Ga0070683_100111127
1740 Ga0070683_100111963
1741 Ga0070683_100125609
1742 Ga0070683_100138611
1743 Ga0070683_100152247
1744 Ga0070683_100155893
1745 Ga0070683_100176228
1746 Ga0070683_100259623
1747 Ga0070683_100302256
1748 Ga0070683_100342173
1749 Ga0070683_100348871
1750 Ga0070683_100495736
1751 Ga0070683_101543960
1752 Ga0070690_100045525
1753 Ga0070690_100080505
1754 Ga0070690_100261442
1755 Ga0070690_100284359
1756 Ga0070690_100566124
1757 Ga0070690_100630757
1758 Ga0070690_100691126
1759 Ga0070670_100031678
1760 Ga0070670_100048175
1761 Ga0070670_100156530
1762 Ga0070670_100183926
1763 Ga0070670_100529864
1764 Ga0070677_10026152
1765 Ga0068869_100006678
1766 Ga0068869_100009010
1767 Ga0068869_100043571
1768 Ga0070666_10070528
1769 Ga0070666_10347650
1770 Ga0070680_100011610
1771 Ga0070680_100011619
1772 Ga0070680_100013410
1773 Ga0070680_100017458
1774 Ga0070680_100098375
1775 Ga0070680_100392140
1776 Ga0070680_100515481
1777 Ga0070680_100839965
1778 Ga0070682_100002789
1779 Ga0070682_100022340
1780 Ga0070682_100335735
1781 Ga0070682_100348933
1782 Ga0070682_100876439
1783 Ga0070682_100878646
1784 Ga0068868_100136844
1785 Ga0068868_100200774
1786 Ga0068868_100364796
1787 Ga0068868_100653410
1788 Ga0070660_100025168
1789 Ga0070660_100055168
1790 Ga0070660_100080276
1791 Ga0070660_100145041
1792 Ga0070660_100426367
1793 Ga0070660_100445841
1794 Ga0070660_100491138
1795 Ga0070660_100552485
1796 Ga0070660_100635638
1797 Ga0070689_100135475
1798 Ga0070691_10005497
1799 Ga0070691_10012073
1800 Ga0070691_10021041
1801 Ga0070691_10129407
1802 Ga0070691_10201586
1803 Ga0070691_10206323
1804 Ga0070687_100001584
1805 Ga0070687_100088116
1806 Ga0070661_100008164
1807 Ga0070661_100038705
1808 Ga0070661_100039084
1809 Ga0070661_100076100
1810 Ga0070661_100144028
1811 Ga0070661_100144197
1812 Ga0070661_100188826
1813 Ga0070661_100226501
1814 Ga0070661_100544110
1815 Ga0070661_100684247
1816 Ga0070661_100872494
1817 Ga0070661_101412734
1818 Ga0070692_10001021
1819 Ga0070692_10003744
1820 Ga0070692_10211326
1821 Ga0070692_10213493
1822 Ga0070692_10226497
1823 Ga0070692_10277897
1824 Ga0070692_10281083
1825 Ga0070692_10309949
1826 Ga0070668_100051201
1827 Ga0070668_100087088
1828 Ga0070668_100155116
1829 Ga0070668_100714470
1830 Ga0070669_100005808
1831 Ga0070669_100041791
1832 Ga0070669_100093042
1833 Ga0070669_100254196
1834 Ga0070669_100273040
1835 Ga0070669_100736093
1836 Ga0070675_100011662
1837 Ga0070675_100072332
1838 Ga0070675_100115402
1839 Ga0070675_100185814
1840 Ga0070675_100351888
1841 Ga0070675_100396511
1842 Ga0070675_100490986
1843 Ga0070675_100626844
1844 Ga0070675_101213162
1845 Ga0070671_100069692
1846 Ga0070671_100192757
1847 Ga0070671_100234679
1848 Ga0070671_100530185
1849 Ga0070674_100096788
1850 Ga0070674_100404982
1851 Ga0070673_100070036
1852 Ga0070673_100197175
1853 Ga0070673_100362681
1854 Ga0070673_100521130
1855 Ga0070673_100915855
1856 Ga0070673_101019703
1857 Ga0070688_100017758
1858 Ga0070688_100073684
1859 Ga0070688_100277589
1860 Ga0070659_100035632
1861 Ga0070659_100040972
1862 Ga0070659_100058072
1863 Ga0070659_100116203
1864 Ga0070659_100267284
1865 Ga0070659_100305102
1866 Ga0070659_100342020
1867 Ga0070659_100498800
1868 Ga0070659_100633433
1869 Ga0070659_100750343
1870 Ga0070659_100829065
1871 Ga0070659_100864544
1872 Ga0070667_100168956
1873 Ga0070667_100213539
1874 Ga0070667_100237843
1875 Ga0070667_100271420
1876 Ga0070667_100298998
1877 Ga0070667_100347388
1878 Ga0070667_100372090
1879 Ga0070667_100768905
1880 Ga0070667_101540560
1881 Ga0070709_10038698
1882 Ga0070709_10060989
1883 Ga0070709_10163831
1884 Ga0070709_10252174
1885 Ga0070714_100089794
1886 Ga0070714_100492315
1887 Ga0070713_100005886
1888 Ga0070713_100017836
1889 Ga0070713_100060655
1890 Ga0070713_100395574
1891 Ga0070713_100643096
1892 Ga0070713_101555207
1893 Ga0070710_10016381
1894 Ga0070710_10163396
1895 Ga0070710_10206549
1896 Ga0070710_10216641
1897 Ga0070710_10308458
1898 Ga0070710_10341463
1899 Ga0070701_10031401
1900 Ga0070701_10142398
1901 Ga0070711_100016949
1902 Ga0070711_100021768
1903 Ga0070711_100062598
1904 Ga0070711_100111753
1905 Ga0070711_100132268
1906 Ga0070705_100115887
1907 Ga0070700_100009943
1908 Ga0070700_100257255
1909 Ga0070700_100300455
1910 Ga0070700_100313260
1911 Ga0070700_100381684
1912 Ga0070700_100577113
1913 Ga0070694_100013152
1914 Ga0070694_100038068
1915 Ga0070694_100226977
1916 Ga0070694_100235153
1917 Ga0070694_101544251
1918 Ga0070708_100000077
1919 Ga0070708_100049689
1920 Ga0070708_100331246
1921 Ga0070663_100008615
1922 Ga0070663_100020556
1923 Ga0070663_100333338
1924 Ga0070663_100373857
1925 Ga0070663_100593692
1926 Ga0070663_101007460
1927 Ga0070663_101417552
1928 Ga0070678_100032948
1929 Ga0070678_100331880
1930 Ga0070662_100014975
1931 Ga0070662_100050296
1932 Ga0070662_100425956
1933 Ga0070662_100517281
1934 Ga0070662_100648519
1935 Ga0070662_100723981
1936 Ga0070681_10001680
1937 Ga0070681_10003472
1938 Ga0070681_10009733
1939 Ga0070681_10028142
1940 Ga0070681_10106558
1941 Ga0070681_10138741
1942 Ga0070681_10185256
1943 Ga0070681_10193078
1944 Ga0070681_10205939
1945 Ga0070681_10538112
1946 Ga0070681_10704329
1947 Ga0068867_100106438
1948 Ga0068867_100148600
1949 Ga0068867_100199913
1950 Ga0068867_100287495
1951 Ga0068867_100592272
1952 Ga0068867_101837729
1953 Ga0070685_10068364
1954 Ga0070706_100120646
1955 Ga0070706_101510368
1956 Ga0070707_100007168
1957 Ga0070707_100253528
1958 Ga0070707_100342049
1959 Ga0070707_100634610
1960 Ga0070707_100758309
1961 Ga0070698_100002723
1962 Ga0070698_100057554
1963 Ga0070698_100108125
1964 Ga0070698_100889228
1965 Ga0070699_100060134
1966 Ga0070699_100088378
1967 Ga0070699_100090852
1968 Ga0070699_100596483
1969 Ga0070679_100009717
1970 Ga0070679_100012748
1971 Ga0070679_100015827
1972 Ga0070679_100020806
1973 Ga0070679_100023321
1974 Ga0070679_100027822
1975 Ga0070679_100037625
1976 Ga0070679_100039848
1977 Ga0070679_100060996
1978 Ga0070679_100101144
1979 Ga0070679_100103099
1980 Ga0070679_100112406
1981 Ga0070679_100128217
1982 Ga0070679_100142801
1983 Ga0070679_100192718
1984 Ga0070679_100200506
1985 Ga0070679_100311153
1986 Ga0070679_100322503
1987 Ga0070679_100410499
1988 Ga0070679_100479063
1989 Ga0070679_100574002
1990 Ga0070679_101118399
1991 Ga0070684_100014785
1992 Ga0070684_100026374
1993 Ga0070684_100035907
1994 Ga0070684_100052003
1995 Ga0070684_100058231
1996 Ga0070684_100066581
1997 Ga0070684_100102320
1998 Ga0070684_100116273
1999 Ga0070684_100137395
2000 Ga0070684_100162192
2001 Ga0070684_100164894
2002 Ga0070684_100182647
2003 Ga0070684_100223370
2004 Ga0070684_100241211
2005 Ga0070684_100250871
2006 Ga0070684_100325651
2007 Ga0070684_100450563
2008 Ga0070684_100543423
2009 Ga0070684_100602378
2010 Ga0070684_101725757
2011 Ga0070697_100049568
2012 Ga0070697_100146086
2013 Ga0068853_100145351
2014 Ga0068853_100435858
2015 Ga0068853_100442252
2016 Ga0068853_100543028
2017 Ga0070672_100014900
2018 Ga0070672_100064908
2019 Ga0070672_100515601
2020 Ga0070672_100590692
2021 Ga0070686_100668131
2022 Ga0070695_100028830
2023 Ga0070695_100041194
2024 Ga0070695_100063440
2025 Ga0070695_100745403
2026 Ga0070696_100000705
2027 Ga0070696_100173225
2028 Ga0070696_100350796
2029 Ga0070696_100414085
2030 Ga0070693_100014943
2031 Ga0070693_100029698
2032 Ga0070693_100422162
2033 Ga0070693_100438949
2034 Ga0070693_100497709
2035 Ga0070693_100568544
2036 Ga0070665_101286161
2037 Ga0070665_101747369
2038 Ga0070665_101827349
2039 Ga0070704_100044905
2040 Ga0070704_100050759
2041 Ga0070704_100451470
2042 Ga0068855_100029696
2043 Ga0068855_100195616
2044 Ga0068855_100555033
2045 Ga0068855_100622794
2046 Ga0068855_100668675
2047 Ga0068855_100730057
2048 Ga0068855_101225127
2049 Ga0068855_101521558
2050 Ga0070664_100038733
2051 Ga0070664_100072000
2052 Ga0070664_100096586
2053 Ga0070664_100139755
2054 Ga0070664_100211881
2055 Ga0070664_100258903
2056 Ga0070664_100266759
2057 Ga0070664_100289322
2058 Ga0070664_100591649
2059 Ga0070664_101094212
2060 Ga0070664_101187223
2061 Ga0068857_100029029
2062 Ga0068857_100041742
2063 Ga0068857_100055825
2064 Ga0068857_100149894
2065 Ga0068857_100191162
2066 Ga0068857_100226082
2067 Ga0068857_100299387
2068 Ga0068857_100582263
2069 Ga0068854_100028156
2070 Ga0068854_100177257
2071 Ga0068854_100190051
2072 Ga0068854_100662941
2073 Ga0068854_101002758
2074 Ga0068856_100041437
2075 Ga0068856_100057303
2076 Ga0068856_100206334
2077 Ga0068856_100328720
2078 Ga0068856_100656999
2079 Ga0068856_101386106
2080 Ga0070702_100029194
2081 Ga0070702_100322103
2082 Ga0068852_100012880
2083 Ga0068852_100021426
2084 Ga0068852_100057382
2085 Ga0068852_100079051
2086 Ga0068852_100181844
2087 Ga0068852_100214728
2088 Ga0068852_100283209
2089 Ga0068852_100406678
2090 Ga0068852_100510629
2091 Ga0068852_100614213
2092 Ga0068852_101058213
2093 Ga0068852_101280249
2094 Ga0068852_101974946
2095 Ga0068859_100000840
2096 Ga0068859_100078819
2097 Ga0068859_100322150
2098 Ga0068859_100444662
2099 Ga0068859_100736147
2100 Ga0068859_100785237
2101 Ga0068859_100827601
2102 Ga0068859_101427805
2103 Ga0068864_100009895
2104 Ga0068864_100115558
2105 Ga0068864_100192269
2106 Ga0068864_100317881
2107 Ga0068864_100360078
2108 Ga0068864_100672183
2109 Ga0068864_100985203
2110 Ga0068866_10280017
2111 Ga0068861_100000975
2112 Ga0068861_100011996
2113 Ga0068861_100067772
2114 Ga0068861_100533317
2115 Ga0068851_10082854
2116 Ga0068851_10100896
2117 Ga0068870_10005093
2118 Ga0068863_100095919
2119 Ga0068863_100246948
2120 Ga0068863_100409739
2121 Ga0068863_100425021
2122 Ga0068863_100559769
2123 Ga0068863_100781071
2124 Ga0068863_101518455
2125 Ga0068858_100072941
2126 Ga0068858_100156351
2127 Ga0068858_100300941
2128 Ga0068858_100653683
2129 Ga0068860_100004188
2130 Ga0068860_100019789
2131 Ga0068860_100056592
2132 Ga0068860_100543237
2133 Ga0068860_100853246
2134 Ga0068862_100000764
2135 Ga0068862_100002514
2136 Ga0068862_100013561
2137 Ga0068862_100165433
2138 Ga0068862_100286295
2139 Ga0068862_100403955
2140 Ga0068862_100780633
2141 Ga0081539_10005565
2142 Ga0070717_10007434
2143 Ga0070717_10067172
2144 Ga0075432_10078128
2145 Ga0070715_10080258
2146 Ga0070716_100007666
2147 Ga0070716_100051887
2148 Ga0070716_100060728
2149 Ga0070716_100184954
2150 Ga0070716_100433191
2151 Ga0070712_100004359
2152 Ga0070712_100099934
2153 Ga0070712_100134695
2154 Ga0097621_100073666
2155 Ga0097621_100251079
2156 Ga0097621_100455969
2157 Ga0097621_100928612
2158 Ga0068871_100025360
2159 Ga0068871_100122576
2160 Ga0068871_100334181
2161 Ga0075428_100144106
2162 Ga0075428_100147317
2163 Ga0075428_101479410
2164 Ga0075430_100041383
2165 Ga0075430_100183779
2166 Ga0075430_100239016
2167 Ga0075430_100254645
2168 Ga0075430_100328965
2169 Ga0075430_100350563
2170 Ga0075430_100467061
2171 Ga0075430_100490598
2172 Ga0075430_100491885
2173 Ga0075431_100016038
2174 Ga0075431_100031481
2175 Ga0075431_100117958
2176 Ga0075431_100370414
2177 Ga0075431_100444805
2178 Ga0075431_100517344
2179 Ga0075431_100604174
2180 Ga0075431_100903886
2181 Ga0075431_100907216
2182 Ga0075431_101135439
2183 Ga0075433_10045513
2184 Ga0075433_10155235
2185 Ga0075433_10352367
2186 Ga0075433_10376572
2187 Ga0075433_10446265
2188 Ga0075433_10620556
2189 Ga0075434_100051764
2190 Ga0075434_100073796
2191 Ga0075434_100097085
2192 Ga0075434_100128012
2193 Ga0075434_100168045
2194 Ga0075434_100192776
2195 Ga0075434_100489476
2196 Ga0075429_100009872
2197 Ga0075429_100144460
2198 Ga0075429_100774376
2199 Ga0075429_100788841
2200 Ga0068865_100026446
2201 Ga0068865_100270533
2202 Ga0068865_100465714
2203 Ga0068865_100654961
2204 Ga0068865_100709098
2205 Ga0068865_100831936
2206 Ga0068865_101107898
2207 Ga0075436_100127860
2208 Ga0097620_100000840
2209 Ga0097620_100078823
2210 Ga0097620_100322149
2211 Ga0097620_100444653
2212 Ga0097620_100736123
2213 Ga0097620_100785185
2214 Ga0097620_100827528
2215 Ga0097620_101427739
2216 Ga0075435_100073739
2217 Ga0075435_100401682
2218 Ga0075435_101170526
2219 Ga0105240_10049628
2220 Ga0105240_10085708
2221 Ga0105240_10123936
2222 Ga0105240_10295269
2223 Ga0105240_10481612
2224 Ga0105240_10757978
2225 Ga0105240_11339649
2226 Ga0111539_10012931
2227 Ga0111539_10123828
2228 Ga0111539_10158570
2229 Ga0111539_10577507
2230 Ga0111539_10802941
2231 Ga0111539_11361575
2232 Ga0111539_11600993
2233 Ga0105245_10062711
2234 Ga0105245_10167967
2235 Ga0105245_10169404
2236 Ga0105245_10197229
2237 Ga0105245_10262378
2238 Ga0105245_12854270
2239 Ga0105247_10265511
2240 Ga0114129_10006614
2241 Ga0114129_10030165
2242 Ga0114129_10045730
2243 Ga0114129_10088826
2244 Ga0114129_10329659
2245 Ga0114129_10397700
2246 Ga0114129_10464124
2247 Ga0114129_10854020
2248 Ga0114129_11815054
2249 Ga0105243_10213297
2250 Ga0105243_10648984
2251 Ga0105243_10870702
2252 Ga0105241_10122969
2253 Ga0105241_10171243
2254 Ga0105241_10174438
2255 Ga0105241_10518799
2256 Ga0105241_11718166
2257 Ga0105242_10040715
2258 Ga0105242_10147772
2259 Ga0105242_10155761
2260 Ga0105242_10394983
2261 Ga0105248_10023633
2262 Ga0105248_10052133
2263 Ga0105248_10061326
2264 Ga0105248_10086866
2265 Ga0105248_10228771
2266 Ga0105248_10798793
2267 Ga0105248_11500021
2268 Ga0105248_11709380
2269 Ga0105248_12364966
2270 Ga0105237_10078219
2271 Ga0105237_10090173
2272 Ga0105237_10183927
2273 Ga0105237_10476859
2274 Ga0105237_10525293
2275 Ga0105237_10814341
2276 Ga0105237_11011136
2277 Ga0105238_10040059
2278 Ga0105238_10043144
2279 Ga0105238_10224491
2280 Ga0105238_10250412
2281 Ga0105249_10000580
2282 Ga0105249_10008223
2283 Ga0105249_10033683
2284 Ga0105249_10165723
2285 Ga0105239_10245626
2286 Ga0105239_10988881
2287 Ga0105246_10697954
2288 Ga0157322_1006879
2289 Ga0157319_1006020
2290 Ga0157316_1013239
2291 Ga0157327_1019168
2292 Ga0157326_1032801
2293 Ga0157373_10091074
2294 Ga0157373_10201675
2295 Ga0157373_10247497
2296 Ga0157373_10387344
2297 Ga0157373_10464580
2298 Ga0157373_10916467
2299 Ga0157371_10009172
2300 Ga0157371_10012727
2301 Ga0157371_10020379
2302 Ga0157371_10311267
2303 Ga0157371_10395832
2304 Ga0157371_10420135
2305 Ga0157370_10046798
2306 Ga0157370_10081133
2307 Ga0157370_10237486
2308 Ga0157370_10269109
2309 Ga0157370_10297515
2310 Ga0157370_10341656
2311 Ga0157370_10553291
2312 Ga0157370_10841357
2313 Ga0157370_11038713
2314 Ga0157370_11472282
2315 Ga0157369_10048625
2316 Ga0157369_10076054
2317 Ga0157369_10101552
2318 Ga0157369_10195230
2319 Ga0157369_10404342
2320 Ga0157369_10510628
2321 Ga0157369_10551555
2322 Ga0157369_10572508
2323 Ga0157369_11000355
2324 Ga0157369_11264956
2325 Ga0157369_11386440
2326 Ga0157374_10370254
2327 Ga0157374_10460112
2328 Ga0157374_10831697
2329 Ga0157374_11006852
2330 Ga0157374_11246215
2331 Ga0157378_10093067
2332 Ga0157378_10339700
2333 Ga0157378_10460758
2334 Ga0157378_10639900
2335 Ga0157378_10997599
2336 Ga0157378_11113140
2337 Ga0163162_10006136
2338 Ga0163162_10009455
2339 Ga0163162_10038079
2340 Ga0163162_10069939
2341 Ga0163162_10084701
2342 Ga0163162_10092253
2343 Ga0163162_10493368
2344 Ga0163162_10925965
2345 Ga0157372_10006474
2346 Ga0157372_10021748
2347 Ga0157372_10029257
2348 Ga0157372_10046943
2349 Ga0157372_10054000
2350 Ga0157372_10083855
2351 Ga0157372_10225830
2352 Ga0157372_10411950
2353 Ga0157372_10759654
2354 Ga0157372_10776592
2355 Ga0157372_10828160
2356 Ga0157372_11406547
2357 Ga0157372_12336517
2358 Ga0157375_10040171
2359 Ga0157375_10070436
2360 Ga0157375_10123400
2361 Ga0157375_10133080
2362 Ga0157375_10169512
2363 Ga0157375_10269363
2364 Ga0157375_10330809
2365 Ga0157375_10728439
2366 Ga0163163_10298797
2367 Ga0163163_10354626
2368 Ga0157380_10030368
2369 Ga0157380_10046242
2370 Ga0157380_10056313
2371 Ga0157380_10215943
2372 Ga0157380_12505398
2373 Ga0182008_10005592
2374 Ga0182008_10084545
2375 Ga0157377_10025247
2376 Ga0157377_10072944
2377 Ga0157377_10231286
2378 Ga0157377_10308259
2379 Ga0157377_10553269
2380 Ga0157377_10776685
2381 Ga0157379_10009212
2382 Ga0157379_10030841
2383 Ga0157379_10326032
2384 Ga0157379_10331232
2385 Ga0157376_10211824
2386 Ga0157376_10295568
2387 Ga0157376_11352195
2388 Ga0157376_11524031
2389 Ga0157376_12117430
2390 Ga0182007_10049562
2391 Ga0182007_10067735
2392 Ga0182007_10111613
2393 Ga0163161_10037844
2394 Ga0163161_10363149
2395 Ga0163161_10692071
2396 Ga0206356_10783001
2397 Ga0206356_11270514
2398 Ga0206352_10325843
2399 Ga0206352_11174930
2400 Ga0206353_10065830
2401 Ga0206353_11480673
2402 Ga0213876_10083566
2403 Ga0207697_10066728
2404 Ga0207682_10009572
2405 Ga0207682_10012840
2406 Ga0207692_10129111
2407 Ga0207692_10198757
2408 Ga0207692_10548282
2409 Ga0207642_10057205
2410 Ga0207680_10104846
2411 Ga0207647_10046677
2412 Ga0207647_10113869
2413 Ga0207699_10042051
2414 Ga0207699_10043781
2415 Ga0207699_10101168
2416 Ga0207699_10211141
2417 Ga0207645_10000909
2418 Ga0207645_10041571
2419 Ga0207645_10082589
2420 Ga0207643_10007697
2421 Ga0207643_10106534
2422 Ga0207705_10003811
2423 Ga0207705_10003951
2424 Ga0207705_10030503
2425 Ga0207705_10032601
2426 Ga0207705_10042973
2427 Ga0207705_10054666
2428 Ga0207705_10092273
2429 Ga0207705_10098584
2430 Ga0207705_10151333
2431 Ga0207705_10181400
2432 Ga0207705_10594575
2433 Ga0207684_10157468
2434 Ga0207684_10206775
2435 Ga0207684_10612518
2436 Ga0207654_10014086
2437 Ga0207654_10016525
2438 Ga0207654_10055737
2439 Ga0207654_10087604
2440 Ga0207654_10235406
2441 Ga0207707_10004840
2442 Ga0207707_10007889
2443 Ga0207707_10009646
2444 Ga0207707_10010596
2445 Ga0207707_10017467
2446 Ga0207707_10052930
2447 Ga0207707_10072756
2448 Ga0207707_10080450
2449 Ga0207707_10086625
2450 Ga0207707_10109370
2451 Ga0207707_10197346
2452 Ga0207707_10212461
2453 Ga0207707_10217043
2454 Ga0207707_10231609
2455 Ga0207707_10551186
2456 Ga0207707_10649299
2457 Ga0207695_10002872
2458 Ga0207695_10070333
2459 Ga0207695_10098281
2460 Ga0207695_11220623
2461 Ga0207671_10050059
2462 Ga0207671_10075363
2463 Ga0207671_10760032
2464 Ga0207671_11100181
2465 Ga0207693_10024434
2466 Ga0207693_10067286
2467 Ga0207693_10203837
2468 Ga0207663_10015456
2469 Ga0207663_10065283
2470 Ga0207663_10070815
2471 Ga0207663_10448449
2472 Ga0207663_10648009
2473 Ga0207660_10003947
2474 Ga0207660_10005546
2475 Ga0207660_10013616
2476 Ga0207660_10015415
2477 Ga0207660_10219632
2478 Ga0207660_10253445
2479 Ga0207660_10256531
2480 Ga0207660_10267249
2481 Ga0207660_10335292
2482 Ga0207660_10393328
2483 Ga0207660_10785627
2484 Ga0207662_10000695
2485 Ga0207662_10025034
2486 Ga0207662_10065411
2487 Ga0207662_10128649
2488 Ga0207662_10400789
2489 Ga0207657_10001221
2490 Ga0207657_10062853
2491 Ga0207657_10065284
2492 Ga0207657_10070109
2493 Ga0207657_10216093
2494 Ga0207649_10009969
2495 Ga0207649_10030909
2496 Ga0207649_10094406
2497 Ga0207649_10104596
2498 Ga0207649_10188036
2499 Ga0207649_10218226
2500 Ga0207649_10440212
2501 Ga0207649_10747572
2502 Ga0207649_11001588
2503 Ga0207649_11042501
2504 Ga0207649_11176478
2505 Ga0207652_10010525
2506 Ga0207652_10019070
2507 Ga0207652_10022531
2508 Ga0207652_10024939
2509 Ga0207652_10030387
2510 Ga0207652_10030393
2511 Ga0207652_10038617
2512 Ga0207652_10051472
2513 Ga0207652_10053487
2514 Ga0207652_10059206
2515 Ga0207652_10060752
2516 Ga0207652_10095623
2517 Ga0207652_10112378
2518 Ga0207652_10122094
2519 Ga0207652_10221021
2520 Ga0207652_10320564
2521 Ga0207652_10513127
2522 Ga0207652_11001863
2523 Ga0207652_11061457
2524 Ga0207646_10036759
2525 Ga0207646_10387026
2526 Ga0207646_11374739
2527 Ga0207681_10000921
2528 Ga0207681_10003904
2529 Ga0207681_10133321
2530 Ga0207694_10032019
2531 Ga0207694_10093377
2532 Ga0207694_10131681
2533 Ga0207694_10774552
2534 Ga0207694_11163998
2535 Ga0207650_10008332
2536 Ga0207650_10010847
2537 Ga0207650_10024087
2538 Ga0207650_10138484
2539 Ga0207650_10452033
2540 Ga0207659_10033893
2541 Ga0207659_10053327
2542 Ga0207659_10066710
2543 Ga0207659_10070326
2544 Ga0207659_10086822
2545 Ga0207659_10423006
2546 Ga0207659_10833149
2547 Ga0207659_11403709
2548 Ga0207687_10037121
2549 Ga0207687_10150311
2550 Ga0207687_10154144
2551 Ga0207687_10280132
2552 Ga0207700_10005401
2553 Ga0207700_10011785
2554 Ga0207700_10115511
2555 Ga0207700_10183149
2556 Ga0207664_10024119
2557 Ga0207664_10058055
2558 Ga0207664_10274609
2559 Ga0207644_10017509
2560 Ga0207644_10042676
2561 Ga0207644_10131979
2562 Ga0207644_10287457
2563 Ga0207644_10770691
2564 Ga0207690_10005614
2565 Ga0207690_10039477
2566 Ga0207690_10076583
2567 Ga0207690_10083806
2568 Ga0207690_10100949
2569 Ga0207690_10195197
2570 Ga0207690_10232962
2571 Ga0207690_10610324
2572 Ga0207690_11400371
2573 Ga0207706_10002035
2574 Ga0207706_10021302
2575 Ga0207706_10058994
2576 Ga0207706_10078626
2577 Ga0207706_10191043
2578 Ga0207706_10222084
2579 Ga0207706_10286537
2580 Ga0207706_10506177
2581 Ga0207706_10530792
2582 Ga0207706_10792886
2583 Ga0207686_10063591
2584 Ga0207686_10145758
2585 Ga0207686_10333273
2586 Ga0207709_10375504
2587 Ga0207709_11152533
2588 Ga0207670_10201560
2589 Ga0207670_10310221
2590 Ga0207670_10482896
2591 Ga0207669_10225585
2592 Ga0207669_10397710
2593 Ga0207704_10003676
2594 Ga0207704_10143905
2595 Ga0207704_10228873
2596 Ga0207704_10302377
2597 Ga0207704_10690514
2598 Ga0207665_10007307
2599 Ga0207665_10047631
2600 Ga0207665_10055046
2601 Ga0207665_10083405
2602 Ga0207665_10366321
2603 Ga0207691_10031365
2604 Ga0207691_10078519
2605 Ga0207691_10091256
2606 Ga0207691_10114355
2607 Ga0207691_10117042
2608 Ga0207691_10139985
2609 Ga0207691_10196036
2610 Ga0207691_10300080
2611 Ga0207711_10030916
2612 Ga0207711_10035753
2613 Ga0207711_10448035
2614 Ga0207711_10499913
2615 Ga0207711_10675824
2616 Ga0207689_10002743
2617 Ga0207689_10004653
2618 Ga0207689_10115700
2619 Ga0207689_10650612
2620 Ga0207661_10000283
2621 Ga0207661_10022845
2622 Ga0207661_10024896
2623 Ga0207661_10032109
2624 Ga0207661_10032571
2625 Ga0207661_10033441
2626 Ga0207661_10034228
2627 Ga0207661_10040186
2628 Ga0207661_10043331
2629 Ga0207661_10052340
2630 Ga0207661_10078935
2631 Ga0207661_10120202
2632 Ga0207661_10133091
2633 Ga0207661_10164939
2634 Ga0207661_10191767
2635 Ga0207661_10330196
2636 Ga0207661_10429027
2637 Ga0207661_10700213
2638 Ga0207679_10000582
2639 Ga0207679_10002943
2640 Ga0207679_10005438
2641 Ga0207679_10012892
2642 Ga0207679_10106820
2643 Ga0207679_10244714
2644 Ga0207679_10246648
2645 Ga0207679_10846872
2646 Ga0207679_10939675
2647 Ga0207679_11024059
2648 Ga0207679_11142734
2649 Ga0207667_10023205
2650 Ga0207667_10123502
2651 Ga0207667_10282749
2652 Ga0207667_10296693
2653 Ga0207667_10399427
2654 Ga0207667_10555533
2655 Ga0207667_11205444
2656 Ga0207651_10049298
2657 Ga0207651_10059532
2658 Ga0207651_10127416
2659 Ga0207651_10354095
2660 Ga0207651_10864518
2661 Ga0207651_10956532
2662 Ga0207651_11201331
2663 Ga0207712_10000596
2664 Ga0207712_10009138
2665 Ga0207712_10307834
2666 Ga0207712_10542610
2667 Ga0207712_10730864
2668 Ga0207668_10002447
2669 Ga0207668_10057777
2670 Ga0207668_10780417
2671 Ga0207640_10003334
2672 Ga0207640_10082778
2673 Ga0207640_10093505
2674 Ga0207640_10157883
2675 Ga0207658_10048536
2676 Ga0207658_10092199
2677 Ga0207658_10163877
2678 Ga0207658_10288807
2679 Ga0207658_10326477
2680 Ga0207658_10392764
2681 Ga0207658_10573601
2682 Ga0207658_11006515
2683 Ga0207677_10043997
2684 Ga0207677_10109304
2685 Ga0207703_10008320
2686 Ga0207703_10086206
2687 Ga0207703_10207911
2688 Ga0207639_10006779
2689 Ga0207639_10030610
2690 Ga0207678_10004647
2691 Ga0207678_10043220
2692 Ga0207678_10086730
2693 Ga0207678_10311581
2694 Ga0207678_10470336
2695 Ga0207708_10004898
2696 Ga0207708_10015391
2697 Ga0207708_10230197
2698 Ga0207708_10283465
2699 Ga0207708_10473194
2700 Ga0207708_10914246
2701 Ga0207708_11309569
2702 Ga0207702_10059273
2703 Ga0207702_10066121
2704 Ga0207702_10128018
2705 Ga0207702_10254414
2706 Ga0207702_10300475
2707 Ga0207702_10362301
2708 Ga0207702_10409846
2709 Ga0207702_10434302
2710 Ga0207641_10011831
2711 Ga0207641_10051528
2712 Ga0207641_10156827
2713 Ga0207641_10444388
2714 Ga0207641_10488199
2715 Ga0207648_10050849
2716 Ga0207648_10078510
2717 Ga0207648_10160589
2718 Ga0207648_10226026
2719 Ga0207648_10280164
2720 Ga0207648_10343769
2721 Ga0207648_10457233
2722 Ga0207648_10509219
2723 Ga0207648_10770790
2724 Ga0207676_10003341
2725 Ga0207676_10060399
2726 Ga0207676_10076932
2727 Ga0207676_10950945
2728 Ga0207674_10000393
2729 Ga0207674_10037409
2730 Ga0207674_10052391
2731 Ga0207674_10086730
2732 Ga0207674_10162014
2733 Ga0207674_10162129
2734 Ga0207674_10199528
2735 Ga0207674_10602524
2736 Ga0207674_11103797
2737 Ga0207675_100035125
2738 Ga0207675_100066788
2739 Ga0207675_100251963
2740 Ga0207675_100288971
2741 Ga0207683_10011631
2742 Ga0207683_10065766
2743 Ga0207683_10133251
2744 Ga0207683_10356212
2745 Ga0207683_10469575
2746 Ga0207698_10003179
2747 Ga0207698_10110213
2748 Ga0207698_10111646
2749 Ga0207698_10156911
2750 Ga0207698_10205773
2751 Ga0207698_10211634
2752 Ga0207698_10415751
2753 Ga0207698_10495048
2754 Ga0207698_10576244
2755 Ga0207698_11163073
2756 Ga0209973_1016475
2757 Ga0209969_1004422
2758 Ga0209969_1030639
2759 Ga0209967_1004046
2760 Ga0209981_1025450
2761 Ga0209996_1002715
2762 Ga0209984_1001682
2763 Ga0210000_1024268
2764 Ga0210000_1032642
2765 Ga0209995_1003547
2766 Ga0209968_1000569
2767 Ga0209968_1003722
2768 Ga0209968_1005690
2769 Ga0209999_1001998
2770 Ga0209999_1015607
2771 Ga0209970_1000622
2772 Ga0209983_1002684
2773 Ga0209983_1043003
2774 Ga0209971_1000924
2775 Ga0209971_1012252
2776 Ga0209966_1000766
2777 Ga0209966_1018755
2778 Ga0209966_1024816
2779 Ga0209998_10001270
2780 Ga0209998_10002526
2781 Ga0209974_10000553
2782 Ga0209974_10004293
2783 Ga0209974_10270091
2784 Ga0207428_10026272
2785 Ga0207428_10063585
2786 Ga0207428_10302674
2787 Ga0207428_10562785
2788 Ga0207428_10625205
2789 Ga0207428_10901635
2790 Ga0268266_10062029
2791 Ga0268266_10476443
2792 Ga0268265_10003125
2793 Ga0268265_10004276
2794 Ga0268265_10012616
2795 Ga0268265_10112369
2796 Ga0268265_10259200
2797 Ga0268265_10699297
2798 Ga0268265_11221677
2799 Ga0268264_10108473
2800 Ga0268264_10152207
2801 Ga0268264_10617802
2802 Ga0268264_11071362
2803 Ga0316182_1261896
2804 Ga0316182_1379587
2805 Ga0316182_1386424
2806 Ga0265329_10045799
2807 Ga0265340_10088642
2808 Ga0265327_10004242
2809 Ga0265316_10180769
2810 Ga0307408_100002257
2811 Ga0307408_100005087
2812 Ga0307408_100064252
2813 Ga0307408_100250678
2814 Ga0307408_100517971
2815 Ga0307408_100645533
2816 Ga0307408_101457208
2817 Ga0307408_101821817
2818 Ga0265314_10003494
2819 Ga0265314_10032497
2820 Ga0307405_10000393
2821 Ga0307405_10013731
2822 Ga0307405_10068958
2823 Ga0307405_10112556
2824 Ga0307405_10116031
2825 Ga0307405_10134272
2826 Ga0307405_10326055
2827 Ga0307405_10462222
2828 Ga0307405_11039212
2829 Ga0307413_10002711
2830 Ga0307413_10018606
2831 Ga0307413_10025417
2832 Ga0307413_10035504
2833 Ga0307413_10131137
2834 Ga0307413_10336426
2835 Ga0307413_10538509
2836 Ga0307410_10009624
2837 Ga0307410_10012945
2838 Ga0307410_10028873
2839 Ga0307410_10120218
2840 Ga0307410_10203073
2841 Ga0307410_10213940
2842 Ga0307410_10351161
2843 Ga0307410_10368859
2844 Ga0307410_10397097
2845 Ga0307410_10465426
2846 Ga0307410_10741337
2847 Ga0307410_11404178
2848 Ga0307406_10002236
2849 Ga0307406_10002275
2850 Ga0307406_10031805
2851 Ga0307406_10038979
2852 Ga0307406_10086657
2853 Ga0307406_10112385
2854 Ga0307406_10441163
2855 Ga0307406_10604777
2856 Ga0307406_10827485
2857 Ga0307406_11068608
2858 Ga0307406_11098349
2859 Ga0307406_11202909
2860 Ga0307407_10002439
2861 Ga0307407_10008217
2862 Ga0307407_10025879
2863 Ga0307407_10026314
2864 Ga0307407_10056184
2865 Ga0307407_10100259
2866 Ga0307407_10116140
2867 Ga0307407_10214253
2868 Ga0307407_10264661
2869 Ga0307412_10061115
2870 Ga0307412_10106474
2871 Ga0307412_10110574
2872 Ga0307412_10430971
2873 Ga0307412_10776448
2874 Ga0307409_100007004
2875 Ga0307409_100013524
2876 Ga0307409_100033936
2877 Ga0307409_100053133
2878 Ga0307409_100079698
2879 Ga0307409_100088383
2880 Ga0307409_100310418
2881 Ga0307409_100798589
2882 Ga0307416_100001410
2883 Ga0307416_100004575
2884 Ga0307416_100077891
2885 Ga0307416_100086493
2886 Ga0307416_100106648
2887 Ga0307416_100148020
2888 Ga0307416_100169464
2889 Ga0307416_100505078
2890 Ga0307416_100557524
2891 Ga0307416_100640730
2892 Ga0307416_100748296
2893 Ga0307416_101028054
2894 Ga0307416_101279839
2895 Ga0307414_10021292
2896 Ga0307414_10029119
2897 Ga0307414_10101375
2898 Ga0307414_10169550
2899 Ga0307414_10170092
2900 Ga0307414_11111437
2901 Ga0307411_10006203
2902 Ga0307411_10007886
2903 Ga0307411_10018407
2904 Ga0307411_10039445
2905 Ga0307411_10057273
2906 Ga0307411_10238532
2907 Ga0307411_10245593
2908 Ga0307411_10250612
2909 Ga0307411_10418317
2910 Ga0307415_100008524
2911 Ga0307415_100008871
2912 Ga0307415_100121793
2913 Ga0307415_100123143
2914 Ga0307415_100164995
2915 Ga0307415_100176560
2916 Ga0307415_100511153
2917 Ga0307415_100608132
2918 Ga0307415_100724967
2919 Ga0307415_101587937
2920 Ga0307415_101744109
2921 Ga0373948_0011529
2922 Ga0373958_0025875
2923 Ga0373958_0031089
2924 Ga0373959_0003885
2925 Ga0373926_0004875
2926 Ga0373929_0014598
2927 Ga0373934_0001950
2928 Ga0373934_0017874
2929 Ga0373940_0043179
2930 Ga0373940_0044261
2931 Ga0373944_0247503
2932 Ga0373949_0019486
2933 Ga0373952_0035326
2934 Ga0373952_0113436
2935 Ga0373923_0052282
2936 Ga0373939_0004065
2937 Ga0373939_0104699
2938 Ga0373941_0004689
2939 Ga0373941_0040016
2940 Ga0373945_0008197
2941 Ga0373945_0010977
2942 Ga0373953_0012022
2943 Ga0373953_0171740
2944 Ga0373954_0032792
2945 Ga0373957_0007100
2946 Ga0373957_0270146
2947 Ga0373960_0013130
2948 Ga0373960_0055009
2949 Ga0373960_0072608
2950 Ga0373943_0002422
2951 Ga0373946_0002485
2952 Ga0373955_0001621
2953 Ga0373955_0010972
2954 Ga0373955_0239824
2955 Ga0373942_0012467
2956 Ga0373961_0042255
2957 Ga0373961_0049360
2958 Ga0373961_0050034
2959 Ga0373961_0081022
2960 Ga0373962_0040324
2961 Ga0373924_0046941
2962 Ga0373931_0010909
2963 Ga0373931_0848899
2964 Ga0373935_0001207
2965 Ga0373935_0160633
2966 Ga0373935_0209603
2967 Ga0373935_0293890
2968 Ga0373935_0319523
2969 Ga0373927_0012867
2970 Ga0373927_0024739
2971 Ga0373927_0133583
2972 Ga0373927_0241346
2973 Ga0373927_0295112
2974 Ga0373933_0071250
2975 Ga0373947_0000036
2976 Ga0373937_0028903
2977 Ga0373937_0030183
2978 Ga0373937_0294252
2979 Ga0373937_0349015
2980 Ga0373937_1405769
2981 Ga0373925_0002900
2982 Ga0373925_0079107
2983 Ga0395899_0024945
2984 Ga0395899_0252138
2985 Ga0395900_0018069
2986 Ga0395898_0092700
2987 Ga0395898_1325841
2988 Ga0395905_0024022
2989 Ga0395905_0518557
2990 Ga0395905_1111444
2991 Ga0436364_1341442
2992 Ga0395901_0013649
2993 Ga0395901_0433913
2994 Ga0395901_0971620
2995 Ga0436365_0453863
2996 Ga0436365_0527755
2997 Ga0436365_1474633
2998 Ga0436363_1364797
2999 Ga0439439_0048612
3000 Ga0439439_0056597
3001 Ga0439461_0106727
3002 Ga0451849_0697007
3003 Ga0439433_0045714
3004 Ga0439448_0165838
3005 Ga0439432_112596
3006 Ga0439449_0137510
3007 Ga0439457_077101
3008 Ga0450914_038316
3009 Ga0439434_0045677
3010 Ga0439464_0014107
3011 Ga0450918_048213
3012 Ga0451577_0052812
3013 Ga0451577_0061827
3014 Ga0451577_0272209
3015 Ga0453683_0422606
3016 Ga0453683_1051357
3017 Ga0466965_0367195
3018 Ga0466966_0002321
3019 Ga0466966_0405162
3020 Ga0466961_0193427
3021 Ga0466961_0252437
3022 Ga0453684_0007935
3023 Ga0453684_0680474
3024 Ga0466959_0083014
3025 Ga0466959_0102056
3026 Ga0466959_0159260
3027 Ga0451576_0055578
3028 Ga0451576_0299384
3029 Ga0451576_0394688
3030 Ga0451576_0646029
3031 Ga0466958_0320546
3032 Ga0466967_0016772
3033 Ga0466967_0197468
3034 Ga0495592_0059098
3035 Ga0495592_0090958
3036 Ga0495603_0000774
3037 Ga0495603_0061064
3038 Ga0495603_0391216
3039 Ga0495629_0025246
3040 Ga0495629_0046147
3041 Ga0495629_0051921
3042 Ga0495629_0129738
3043 Ga0495629_0135653
3044 Ga0495651_0007272
3045 Ga0495653_0026336
3046 Ga0495653_0190493
3047 Ga0495580_0000048
3048 Ga0495580_0005246
3049 Ga0495580_0251168
3050 Ga0495580_0317252
3051 Ga0495580_0603293
3052 Ga0495582_0000179
3053 Ga0495582_0089405
3054 Ga0495582_0190051
3055 Ga0495582_0190118
3056 Ga0495639_0000917
3057 Ga0495639_0025267
3058 Ga0495639_0124255
3059 Ga0495639_0128318
3060 Ga0495639_0153678
3061 Ga0495662_0045613
3062 Ga0495662_0148930
3063 Ga0495664_0052972
3064 Ga0495664_0065508
3065 Ga0495664_0119664
3066 Ga0495664_0200678
3067 Ga0495585_0484234
3068 Ga0495594_0023704
3069 Ga0495594_0050634
3070 Ga0495594_0056042
3071 Ga0495594_0082577
3072 Ga0495594_0150217
3073 Ga0495596_0059166
3074 Ga0495608_0031708
3075 Ga0495618_0288660
3076 Ga0495620_0049369
3077 Ga0495628_0101738
3078 Ga0495628_0149404
3079 Ga0495628_0180853
3080 Ga0495628_0499176
3081 Ga0495630_0004558
3082 Ga0495630_0085911
3083 Ga0495630_0188289
3084 Ga0495631_0265938
3085 Ga0495644_0121267
3086 Ga0495666_0036458
3087 Ga0495642_0091528
3088 Ga0495642_0251978
3089 Ga0495652_0075969
3090 Ga0495652_0108848
3091 Ga0495665_0000002
3092 Ga0495665_0037940
3093 Ga0495665_0044551
3094 Ga0495665_0104079
3095 Ga0495665_0195919
3096 Ga0495665_0228634
3097 Ga0495640_0045556
3098 Ga0495640_0521255
3099 Ga0495586_0075598
3100 Ga0495586_0239426
3101 Ga0495587_0009315
3102 Ga0495587_0020967
3103 Ga0495587_0071142
3104 Ga0495587_0307965
3105 Ga0495598_0188507
3106 Ga0495621_0257239
3107 Ga0495645_0004375
3108 Ga0495645_0144276
3109 Ga0495645_0182107
3110 Ga0495622_0104163
3111 Ga0495667_0012198
3112 Ga0495667_0012237
3113 Ga0495667_0096831
3114 Ga0495667_0202194
3115 Ga0495667_0476114
3116 Ga0495634_0078582
3117 Ga0495634_0085652
3118 Ga0495634_0135824
3119 Ga0495635_0073192
3120 Ga0495635_0200298
3121 Ga0495635_0238196
3122 Ga0495659_0168281
3123 Ga0495659_0337323
3124 Ga0495588_0000464
3125 Ga0495588_0200108
3126 Ga0495588_0462174
3127 Ga0495588_0660673
3128 Ga0495657_0007724
3129 Ga0495657_0353614
3130 Ga0495599_0017331
3131 Ga0495599_0022659
3132 Ga0495599_0060889
3133 Ga0495623_0009437
3134 Ga0495623_0019422
3135 Ga0495623_0116001
3136 Ga0495658_0000017
3137 Ga0495658_0034200
3138 Ga0495658_0085320
3139 Ga0495658_0088542
3140 Ga0495669_0162868
3141 Ga0495669_0295436
3142 Ga0495613_0024110
3143 Ga0495613_0095423
3144 Ga0495613_0264410
3145 Ga0495613_0272776
3146 Ga0495670_0152555
3147 Ga0495600_0030035
3148 Ga0495600_0068897
3149 Ga0495600_0373586
3150 Ga0495581_0000312
3151 Ga0495581_0015316
3152 Ga0495581_0155211
3153 Ga0495581_0426975
3154 Ga0495604_0034670
3155 Ga0495604_0169824
3156 Ga0495604_0261367
3157 Ga0495604_0379121
3158 Ga0495636_0181890
3159 Ga0495674_0024914
3160 Ga0495674_0092120
3161 Ga0495674_0174987
3162 Ga0495672_0003004
3163 Ga0495676_0120349
3164 Ga0495680_0091173
3165 Ga0495680_0197314
3166 Ga0495680_0314323
3167 Ga0495675_0026681
3168 Ga0495675_0114593
3169 Ga0495675_0173492
3170 Ga0495675_0192174
3171 Ga0495677_0054921
3172 Ga0495677_0127135
3173 Ga0495685_079177
3174 Ga0495681_0169572
3175 Ga0495684_0010619
3176 Ga0495684_0051096
3177 Ga0495684_0170599
3178 Ga0495593_0000009
3179 Ga0495593_0225905
3180 Ga0495593_0253689
3181 Ga0495602_0139637
3182 Ga0495602_0391914
3183 Ga0495614_0000005
3184 Ga0495614_0080470
3185 Ga0495614_0104335
3186 Ga0495615_0004404
3187 Ga0496100_0051928
3188 Ga0496102_0045307
3189 Ga0496102_0372073
3190 Ga0496103_0063254
3191 Ga0496104_0035477
3192 Ga0496104_0188251
3193 Ga0496105_0034848
3194 Ga0496105_0481339
3195 Ga0496106_0092000
3196 Ga0496106_0098435
3197 Ga0496107_0096470
3198 Ga0496107_0638516
3199 Ga0496108_0138948
3200 Ga0496108_0515253
3201 Ga0496109_0062007
3202 Ga0496109_0213158
3203 Ga0496110_0131572
3204 Ga0496110_0331004
3205 Ga0496110_0864425
3206 Ga0496111_0588139
3207 Ga0496112_0007357
3208 Ga0496112_0011512
3209 Ga0496112_0061746
3210 Ga0496112_0125606
3211 Ga0496112_0159113
3212 Ga0496112_0198054
3213 Ga0496112_0337636
3214 Ga0496113_0034556
3215 Ga0496113_0125789
3216 Ga0496115_0303651
3217 Ga0496115_0720737
3218 Ga0501306_013293
3219 Ga0501306_019523
3220 Ga0501308_023243
3221 Ga0501309_001393
3222 Ga0501309_010333
3223 Ga0501307_000980
3224 Ga0501307_001114
3225 Ga0501307_007862
3226 Ga0501307_038351
3227 Ga0501291_123184
3228 Ga0501298_028587
3229 Ga0501299_052756
3230 Ga0501311_002476
3231 Ga0501311_004538
3232 Ga0501311_016925
3233 Ga0501312_056549
3234 Ga0501313_004470
3235 Ga0501315_021987
3236 Ga0501316_009249
3237 Ga0501316_010847
3238 Ga0501316_011289
3239 Ga0501317_013796
3240 Ga0501320_023190
3241 Ga0501323_008090
3242 Ga0501323_026219
3243 Ga0501324_001625
3244 Ga0501031_0074621
3245 Ga0501031_0209344
3246 Ga0501032_0033574
3247 Ga0501033_0466893
3248 Ga0501034_0556562
3249 Ga0501034_0642092
3250 Ga0501036_0127060
3251 Ga0501037_0308337
3252 Ga0501038_0513461
3253 Ga0501038_0712879
3254 Ga0501039_0375285
3255 Ga0501040_0431791
3256 Ga0501043_0055578
3257 Ga0501043_0185422
3258 Ga0501046_0129806
3259 Ga0501047_0014779
3260 Ga0501047_0196179
3261 Ga0501067_0399161
3262 Ga0501070_0061451
3263 Ga0501070_0106773
3264 Ga0501071_0079085
3265 Ga0501071_0331773
3266 Ga0501072_1237048
3267 Ga0501073_0268094
3268 Ga0501073_0393792
3269 Ga0501074_0214188
3270 Ga0501074_0553289
3271 Ga0501075_0126690
3272 Ga0501075_0180257
3273 Ga0501076_0325659
3274 Ga0501076_0984491
3275 Ga0501198_083668
3276 Ga0501202_164123
3277 Ga0501206_056896
3278 Ga0501207_069832
3279 Ga0501217_024873
3280 Ga0501224_007129
3281 Ga0501227_032223
3282 Ga0501227_164012
3283 Ga0501233_032767
3284 Ga0501235_001630
3285 Ga0501248_016002
3286 Ga0501249_002095
3287 Ga0501250_022605
3288 Ga0501257_071687
3289 Ga0501257_104848
3290 Ga0501259_034647
3291 Ga0501261_023703
3292 Ga0501219_006160
3293 Ga0501225_0007423
3294 Ga0501234_006534
3295 Ga0501079_0110450
3296 Ga0501079_0180034
3297 Ga0501080_0053870
3298 Ga0501080_0212868
3299 Ga0501080_0641315
3300 Ga0501080_0738704
3301 Ga0501081_0086410
3302 Ga0501083_0369517
3303 Ga0501232_010651
3304 Ga0501266_005651
3305 Ga0501268_001269
3306 Ga0501268_055351
3307 Ga0501272_007479
3308 Ga0501035_0046302
3309 Ga0501035_0210590
3310 Ga0501035_0324916
3311 Ga0501045_0418500
3312 Ga0501212_076168
3313 nmdc:mga05p37_1266157_c1
3314 nmdc:mga05p37_160485_c1
3315 nmdc:mga05p37_19612_c1
3316 nmdc:mga05p37_271519_c1
3317 nmdc:mga05p37_3917_c1
3318 nmdc:mga05p37_82274_c1
3319 nmdc:mga09592_140785_c1
3320 nmdc:mga09592_15413_c1
3321 nmdc:mga09592_188306_c1
3322 nmdc:mga09592_227605_c1
3323 nmdc:mga09592_40739_c1
3324 nmdc:mga09592_430636_c1
3325 nmdc:mga09592_49688_c1
3326 nmdc:mga0qj67_158748_c1
3327 nmdc:mga0qj67_177890_c1
3328 nmdc:mga0qj67_187451_c1
3329 nmdc:mga0qj67_247879_c1
3330 nmdc:mga0qj67_26425_c1
3331 nmdc:mga0qj67_321506_c1
3332 nmdc:mga0qj67_366205_c1
3333 nmdc:mga0qj67_40140_c1
3334 nmdc:mga0qj67_62146_c1
3335 nmdc:mga06r32_11453_c1
3336 nmdc:mga06r32_1194161_c1
3337 nmdc:mga06r32_29589_c1
3338 nmdc:mga06r32_355255_c1
3339 nmdc:mga06r32_438043_c1
3340 nmdc:mga06r32_455925_c1
3341 nmdc:mga06r32_651335_c1
3342 nmdc:mga06r32_88199_c1
3343 nmdc:mga08y16_145790_c1
3344 nmdc:mga08y16_146631_c1
3345 nmdc:mga08y16_168077_c1
3346 nmdc:mga08y16_27513_c1
3347 nmdc:mga08y16_33336_c1
3348 nmdc:mga08y16_84658_c1
3349 nmdc:mga0n895_10875_c1
3350 nmdc:mga0n895_14066_c1
3351 nmdc:mga0n895_147262_c1
3352 nmdc:mga0n895_235374_c1
3353 nmdc:mga0n895_436895_c1
3354 nmdc:mga0n895_69021_c1
3355 nmdc:mga0n895_84154_c1
3356 nmdc:mga0n895_90735_c1
3357 nmdc:mga0rr50_1032596_c1
3358 nmdc:mga0rr50_114549_c1
3359 nmdc:mga0rr50_138710_c1
3360 nmdc:mga0rr50_462521_c1
3361 nmdc:mga0rr50_63406_c1
3362 nmdc:mga0a205_196515_c1
3363 nmdc:mga0a205_28550_c1
3364 nmdc:mga0a205_294033_c1
3365 nmdc:mga0a205_36134_c1
3366 nmdc:mga0a205_6528_c1
3367 Ga0495601_0155460
3368 Ga0495601_0423665
3369 Ga0495612_0132552
3370 Ga0495612_0200960
3371 Ga0495595_0137986
3372 Ga0495595_0226027
3373 Ga0501084_0106476
3374 Ga0501084_0309154
3375 Ga0590075_070669
3376 Ga0590077_039989
3377 Ga0590077_062781
3378 Ga0587108_012874
3379 Ga0587111_0045632
3380 Ga0501082_0053239
3381 Ga0501082_0204266
3382 Ga0501082_0552852
3383 Ga0466962_0175353
3384 Ga0530510_0532243

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00466

Ribosomal_L10

Ribosomal protein L10

1

96

0.98

Map