F495360
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1692 | 464 | 3384 | 168 |
Family's Representative Sequence
| Representative Sequence | 3300049577|Ga0501041_0115562|Ga0501041_0115562_633_1202 |
| Length | 189 |
| Sequence | MKRSEKEQLVTELREKMVGAKALYYTDFTGLNVKRMTELRRRLRKAGVEYVVIKNTLALRAVNESGLTGQRLRGPTGVVIGKDPIAAAKVLADFAKEFDAKPEVKGGLLEGKQIDVAQVKKLAALPSREQMLADLGAGLMSPMAAFVGALNGLLYMFAGALDDGPRPVGSGTGSDDHGYYSTRSRGHNG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 6 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 7 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 87 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 89 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 119 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 120 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 121 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 122 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 123 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 135 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 144 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 224 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 228 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 229 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 230 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 231 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 232 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 233 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 234 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 235 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 236 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 237 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 238 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 239 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 240 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 241 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 242 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 243 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 244 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 245 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 246 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 247 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 248 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 249 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 250 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 251 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 253 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 254 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 255 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 257 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 258 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 259 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 260 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 261 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 262 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 264 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 266 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 268 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 269 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 270 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 271 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 272 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 273 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 274 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 275 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 278 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 279 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 280 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 281 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 282 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 283 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 284 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 285 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 286 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 287 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 288 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 289 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 290 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 291 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 292 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 293 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 294 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 295 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 296 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 297 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 298 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 299 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 300 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 301 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 302 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 303 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 304 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 305 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 306 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 307 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 369 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 370 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 371 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 372 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 373 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 374 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 375 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 376 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 377 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 378 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 379 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 380 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 381 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 386 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 387 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 388 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 418 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 419 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 420 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 421 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 422 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 423 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 424 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 425 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 426 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 427 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 428 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 429 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 430 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 431 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 432 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 433 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 434 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 435 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 440 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 441 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 442 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 443 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 446 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 454 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 459 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 460 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 461 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 462 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 464 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.4 |
| Metatranscriptomes | 2.6 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.83 |
| Rhizosphere | 97.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501041_0115562 | 3300049577 | Bacteria | 1666 |
| 2 | LJQas_1008719 | 3300000549 | Bacteria | 1229 |
| 3 | JGI24737J22298_10047709 | 3300001990 | Bacteria | 1305 |
| 4 | JGI24735J21928_10152635 | 3300002067 | Unclassified | 667 |
| 5 | JGI24750J21931_1010721 | 3300002070 | Unclassified | 1198 |
| 6 | JGI26145J50221_1002425 | 3300003371 | Bacteria | 1468 |
| 7 | Ga0058861_10085796 | 3300004800 | Bacteria | 1858 |
| 8 | Ga0058861_10097294 | 3300004800 | Bacteria | 1402 |
| 9 | Ga0058861_10124789 | 3300004800 | Bacteria | 5820 |
| 10 | Ga0058861_10157639 | 3300004800 | Bacteria | 6475 |
| 11 | Ga0058861_11844075 | 3300004800 | Bacteria | 1143 |
| 12 | Ga0058862_10020038 | 3300004803 | Bacteria | 947 |
| 13 | Ga0058862_10123762 | 3300004803 | Bacteria | 2815 |
| 14 | Ga0058862_10283756 | 3300004803 | Bacteria | 1871 |
| 15 | Ga0058862_10288296 | 3300004803 | Bacteria | 7548 |
| 16 | Ga0058862_12486219 | 3300004803 | Bacteria | 882 |
| 17 | Ga0058862_12612346 | 3300004803 | Bacteria | 1160 |
| 18 | Ga0058862_12737859 | 3300004803 | Bacteria | 1315 |
| 19 | Ga0058862_12847149 | 3300004803 | Bacteria | 714 |
| 20 | Ga0065712_10175774 | 3300005290 | Bacteria | 1213 |
| 21 | Ga0065715_10092142 | 3300005293 | Bacteria | 5307 |
| 22 | Ga0065715_10100313 | 3300005293 | Bacteria | 3317 |
| 23 | Ga0065707_10155111 | 3300005295 | Bacteria | 1617 |
| 24 | Ga0070658_10022117 | 3300005327 | Bacteria | 5100 |
| 25 | Ga0070658_10046451 | 3300005327 | Bacteria | 3513 |
| 26 | Ga0070658_10105917 | 3300005327 | Bacteria | 2326 |
| 27 | Ga0070658_10108142 | 3300005327 | Bacteria | 2302 |
| 28 | Ga0070658_10127177 | 3300005327 | Bacteria | 2121 |
| 29 | Ga0070658_10129323 | 3300005327 | Bacteria | 2104 |
| 30 | Ga0070658_10241595 | 3300005327 | Bacteria | 1531 |
| 31 | Ga0070658_10696827 | 3300005327 | Bacteria | 881 |
| 32 | Ga0070658_10816000 | 3300005327 | Bacteria | 810 |
| 33 | Ga0070658_10829537 | 3300005327 | Bacteria | 803 |
| 34 | Ga0070658_11347551 | 3300005327 | Bacteria | 619 |
| 35 | Ga0070658_11375869 | 3300005327 | Bacteria | 613 |
| 36 | Ga0070676_10000852 | 3300005328 | Bacteria | 15089 |
| 37 | Ga0070676_10057418 | 3300005328 | Bacteria | 2303 |
| 38 | Ga0070676_10073120 | 3300005328 | Bacteria | 2062 |
| 39 | Ga0070683_100017450 | 3300005329 | Bacteria | 6345 |
| 40 | Ga0070683_100017633 | 3300005329 | Bacteria | 6310 |
| 41 | Ga0070683_100031156 | 3300005329 | Bacteria | 4847 |
| 42 | Ga0070683_100042520 | 3300005329 | Bacteria | 4184 |
| 43 | Ga0070683_100050790 | 3300005329 | Bacteria | 3840 |
| 44 | Ga0070683_100051102 | 3300005329 | Bacteria | 3827 |
| 45 | Ga0070683_100057657 | 3300005329 | Bacteria | 3608 |
| 46 | Ga0070683_100076000 | 3300005329 | Bacteria | 3139 |
| 47 | Ga0070683_100111127 | 3300005329 | Bacteria | 2585 |
| 48 | Ga0070683_100111963 | 3300005329 | Bacteria | 2575 |
| 49 | Ga0070683_100125609 | 3300005329 | Bacteria | 2425 |
| 50 | Ga0070683_100138611 | 3300005329 | Bacteria | 2304 |
| 51 | Ga0070683_100152247 | 3300005329 | Bacteria | 2193 |
| 52 | Ga0070683_100155893 | 3300005329 | Bacteria | 2165 |
| 53 | Ga0070683_100176228 | 3300005329 | Bacteria | 2030 |
| 54 | Ga0070683_100259623 | 3300005329 | Bacteria | 1652 |
| 55 | Ga0070683_100302256 | 3300005329 | Bacteria | 1522 |
| 56 | Ga0070683_100342173 | 3300005329 | Bacteria | 1424 |
| 57 | Ga0070683_100348871 | 3300005329 | Bacteria | 1409 |
| 58 | Ga0070683_100495736 | 3300005329 | Bacteria | 1167 |
| 59 | Ga0070683_101543960 | 3300005329 | Bacteria | 638 |
| 60 | Ga0070690_100045525 | 3300005330 | Bacteria | 2787 |
| 61 | Ga0070690_100080505 | 3300005330 | Bacteria | 2130 |
| 62 | Ga0070690_100261442 | 3300005330 | Bacteria | 1228 |
| 63 | Ga0070690_100284359 | 3300005330 | Bacteria | 1181 |
| 64 | Ga0070690_100566124 | 3300005330 | Bacteria | 858 |
| 65 | Ga0070690_100630757 | 3300005330 | Bacteria | 816 |
| 66 | Ga0070690_100691126 | 3300005330 | Bacteria | 783 |
| 67 | Ga0070670_100031678 | 3300005331 | Bacteria | 4554 |
| 68 | Ga0070670_100048175 | 3300005331 | Bacteria | 3667 |
| 69 | Ga0070670_100156530 | 3300005331 | Bacteria | 1974 |
| 70 | Ga0070670_100183926 | 3300005331 | Bacteria | 1814 |
| 71 | Ga0070670_100529864 | 3300005331 | Bacteria | 1049 |
| 72 | Ga0070677_10026152 | 3300005333 | Bacteria | 2185 |
| 73 | Ga0068869_100006678 | 3300005334 | Bacteria | 7327 |
| 74 | Ga0068869_100009010 | 3300005334 | Bacteria | 6465 |
| 75 | Ga0068869_100043571 | 3300005334 | Bacteria | 3224 |
| 76 | Ga0070666_10070528 | 3300005335 | Bacteria | 2377 |
| 77 | Ga0070666_10347650 | 3300005335 | Bacteria | 1060 |
| 78 | Ga0070680_100011610 | 3300005336 | Bacteria | 6823 |
| 79 | Ga0070680_100011619 | 3300005336 | Bacteria | 6820 |
| 80 | Ga0070680_100013410 | 3300005336 | Bacteria | 6381 |
| 81 | Ga0070680_100017458 | 3300005336 | Bacteria | 5659 |
| 82 | Ga0070680_100098375 | 3300005336 | Bacteria | 2426 |
| 83 | Ga0070680_100392140 | 3300005336 | Bacteria | 1183 |
| 84 | Ga0070680_100515481 | 3300005336 | Bacteria | 1024 |
| 85 | Ga0070680_100839965 | 3300005336 | Bacteria | 792 |
| 86 | Ga0070682_100002789 | 3300005337 | Bacteria | 9676 |
| 87 | Ga0070682_100022340 | 3300005337 | Bacteria | 3746 |
| 88 | Ga0070682_100335735 | 3300005337 | Bacteria | 1122 |
| 89 | Ga0070682_100348933 | 3300005337 | Bacteria | 1103 |
| 90 | Ga0070682_100876439 | 3300005337 | Bacteria | 736 |
| 91 | Ga0070682_100878646 | 3300005337 | Bacteria | 735 |
| 92 | Ga0068868_100136844 | 3300005338 | Bacteria | 2008 |
| 93 | Ga0068868_100200774 | 3300005338 | Bacteria | 1662 |
| 94 | Ga0068868_100364796 | 3300005338 | Bacteria | 1240 |
| 95 | Ga0068868_100653410 | 3300005338 | Bacteria | 937 |
| 96 | Ga0070660_100025168 | 3300005339 | Bacteria | 4422 |
| 97 | Ga0070660_100055168 | 3300005339 | Bacteria | 3070 |
| 98 | Ga0070660_100080276 | 3300005339 | Bacteria | 2559 |
| 99 | Ga0070660_100145041 | 3300005339 | Bacteria | 1906 |
| 100 | Ga0070660_100426367 | 3300005339 | Bacteria | 1099 |
| 101 | Ga0070660_100445841 | 3300005339 | Bacteria | 1073 |
| 102 | Ga0070660_100491138 | 3300005339 | Bacteria | 1021 |
| 103 | Ga0070660_100552485 | 3300005339 | Bacteria | 961 |
| 104 | Ga0070660_100635638 | 3300005339 | Bacteria | 893 |
| 105 | Ga0070689_100135475 | 3300005340 | Bacteria | 1977 |
| 106 | Ga0070691_10005497 | 3300005341 | Bacteria | 5765 |
| 107 | Ga0070691_10012073 | 3300005341 | Bacteria | 3956 |
| 108 | Ga0070691_10021041 | 3300005341 | Bacteria | 3016 |
| 109 | Ga0070691_10129407 | 3300005341 | Bacteria | 1278 |
| 110 | Ga0070691_10201586 | 3300005341 | Bacteria | 1045 |
| 111 | Ga0070691_10206323 | 3300005341 | Bacteria | 1035 |
| 112 | Ga0070687_100001584 | 3300005343 | Bacteria | 8085 |
| 113 | Ga0070687_100088116 | 3300005343 | Bacteria | 1710 |
| 114 | Ga0070661_100008164 | 3300005344 | Bacteria | 7223 |
| 115 | Ga0070661_100038705 | 3300005344 | Bacteria | 3473 |
| 116 | Ga0070661_100039084 | 3300005344 | Bacteria | 3456 |
| 117 | Ga0070661_100076100 | 3300005344 | Bacteria | 2474 |
| 118 | Ga0070661_100144028 | 3300005344 | Bacteria | 1797 |
| 119 | Ga0070661_100144197 | 3300005344 | Bacteria | 1796 |
| 120 | Ga0070661_100188826 | 3300005344 | Bacteria | 1571 |
| 121 | Ga0070661_100226501 | 3300005344 | Bacteria | 1435 |
| 122 | Ga0070661_100544110 | 3300005344 | Bacteria | 933 |
| 123 | Ga0070661_100684247 | 3300005344 | Bacteria | 835 |
| 124 | Ga0070661_100872494 | 3300005344 | Bacteria | 741 |
| 125 | Ga0070661_101412734 | 3300005344 | Unclassified | 586 |
| 126 | Ga0070692_10001021 | 3300005345 | Bacteria | 9643 |
| 127 | Ga0070692_10003744 | 3300005345 | Bacteria | 6248 |
| 128 | Ga0070692_10211326 | 3300005345 | Bacteria | 1142 |
| 129 | Ga0070692_10213493 | 3300005345 | Bacteria | 1137 |
| 130 | Ga0070692_10226497 | 3300005345 | Bacteria | 1107 |
| 131 | Ga0070692_10277897 | 3300005345 | Bacteria | 1014 |
| 132 | Ga0070692_10281083 | 3300005345 | Bacteria | 1009 |
| 133 | Ga0070692_10309949 | 3300005345 | Bacteria | 967 |
| 134 | Ga0070668_100051201 | 3300005347 | Bacteria | 3181 |
| 135 | Ga0070668_100087088 | 3300005347 | Bacteria | 2457 |
| 136 | Ga0070668_100155116 | 3300005347 | Bacteria | 1854 |
| 137 | Ga0070668_100714470 | 3300005347 | Bacteria | 885 |
| 138 | Ga0070669_100005808 | 3300005353 | Bacteria | 8898 |
| 139 | Ga0070669_100041791 | 3300005353 | Bacteria | 3335 |
| 140 | Ga0070669_100093042 | 3300005353 | Bacteria | 2263 |
| 141 | Ga0070669_100254196 | 3300005353 | Bacteria | 1400 |
| 142 | Ga0070669_100273040 | 3300005353 | Bacteria | 1353 |
| 143 | Ga0070669_100736093 | 3300005353 | Bacteria | 835 |
| 144 | Ga0070675_100011662 | 3300005354 | Bacteria | 6887 |
| 145 | Ga0070675_100072332 | 3300005354 | Bacteria | 2862 |
| 146 | Ga0070675_100115402 | 3300005354 | Bacteria | 2276 |
| 147 | Ga0070675_100185814 | 3300005354 | Bacteria | 1798 |
| 148 | Ga0070675_100351888 | 3300005354 | Bacteria | 1306 |
| 149 | Ga0070675_100396511 | 3300005354 | Bacteria | 1231 |
| 150 | Ga0070675_100490986 | 3300005354 | Bacteria | 1105 |
| 151 | Ga0070675_100626844 | 3300005354 | Bacteria | 976 |
| 152 | Ga0070675_101213162 | 3300005354 | Bacteria | 695 |
| 153 | Ga0070671_100069692 | 3300005355 | Bacteria | 2933 |
| 154 | Ga0070671_100192757 | 3300005355 | Bacteria | 1727 |
| 155 | Ga0070671_100234679 | 3300005355 | Bacteria | 1557 |
| 156 | Ga0070671_100530185 | 3300005355 | Bacteria | 1014 |
| 157 | Ga0070674_100096788 | 3300005356 | Bacteria | 2142 |
| 158 | Ga0070674_100404982 | 3300005356 | Bacteria | 1116 |
| 159 | Ga0070673_100070036 | 3300005364 | Bacteria | 2813 |
| 160 | Ga0070673_100197175 | 3300005364 | Bacteria | 1732 |
| 161 | Ga0070673_100362681 | 3300005364 | Bacteria | 1288 |
| 162 | Ga0070673_100521130 | 3300005364 | Unclassified | 1077 |
| 163 | Ga0070673_100915855 | 3300005364 | Bacteria | 813 |
| 164 | Ga0070673_101019703 | 3300005364 | Bacteria | 771 |
| 165 | Ga0070688_100017758 | 3300005365 | Bacteria | 4088 |
| 166 | Ga0070688_100073684 | 3300005365 | Bacteria | 2190 |
| 167 | Ga0070688_100277589 | 3300005365 | Bacteria | 1203 |
| 168 | Ga0070659_100035632 | 3300005366 | Bacteria | 3875 |
| 169 | Ga0070659_100040972 | 3300005366 | Bacteria | 3619 |
| 170 | Ga0070659_100058072 | 3300005366 | Bacteria | 3052 |
| 171 | Ga0070659_100116203 | 3300005366 | Bacteria | 2163 |
| 172 | Ga0070659_100267284 | 3300005366 | Bacteria | 1420 |
| 173 | Ga0070659_100305102 | 3300005366 | Bacteria | 1328 |
| 174 | Ga0070659_100342020 | 3300005366 | Bacteria | 1254 |
| 175 | Ga0070659_100498800 | 3300005366 | Bacteria | 1037 |
| 176 | Ga0070659_100633433 | 3300005366 | Unclassified | 921 |
| 177 | Ga0070659_100750343 | 3300005366 | Bacteria | 846 |
| 178 | Ga0070659_100829065 | 3300005366 | Bacteria | 805 |
| 179 | Ga0070659_100864544 | 3300005366 | Bacteria | 789 |
| 180 | Ga0070667_100168956 | 3300005367 | Bacteria | 1930 |
| 181 | Ga0070667_100213539 | 3300005367 | Bacteria | 1715 |
| 182 | Ga0070667_100237843 | 3300005367 | Bacteria | 1625 |
| 183 | Ga0070667_100271420 | 3300005367 | Bacteria | 1521 |
| 184 | Ga0070667_100298998 | 3300005367 | Bacteria | 1449 |
| 185 | Ga0070667_100347388 | 3300005367 | Bacteria | 1342 |
| 186 | Ga0070667_100372090 | 3300005367 | Bacteria | 1297 |
| 187 | Ga0070667_100768905 | 3300005367 | Bacteria | 893 |
| 188 | Ga0070667_101540560 | 3300005367 | Bacteria | 624 |
| 189 | Ga0070709_10038698 | 3300005434 | Bacteria | 2922 |
| 190 | Ga0070709_10060989 | 3300005434 | Bacteria | 2399 |
| 191 | Ga0070709_10163831 | 3300005434 | Bacteria | 1548 |
| 192 | Ga0070709_10252174 | 3300005434 | Bacteria | 1272 |
| 193 | Ga0070714_100089794 | 3300005435 | Bacteria | 2690 |
| 194 | Ga0070714_100492315 | 3300005435 | Bacteria | 1168 |
| 195 | Ga0070713_100005886 | 3300005436 | Bacteria | 8431 |
| 196 | Ga0070713_100017836 | 3300005436 | Bacteria | 5382 |
| 197 | Ga0070713_100060655 | 3300005436 | Bacteria | 3162 |
| 198 | Ga0070713_100395574 | 3300005436 | Bacteria | 1290 |
| 199 | Ga0070713_100643096 | 3300005436 | Bacteria | 1010 |
| 200 | Ga0070713_101555207 | 3300005436 | Unclassified | 642 |
| 201 | Ga0070710_10016381 | 3300005437 | Bacteria | 3771 |
| 202 | Ga0070710_10163396 | 3300005437 | Bacteria | 1382 |
| 203 | Ga0070710_10206549 | 3300005437 | Bacteria | 1243 |
| 204 | Ga0070710_10216641 | 3300005437 | Bacteria | 1216 |
| 205 | Ga0070710_10308458 | 3300005437 | Bacteria | 1035 |
| 206 | Ga0070710_10341463 | 3300005437 | Bacteria | 989 |
| 207 | Ga0070701_10031401 | 3300005438 | Bacteria | 2635 |
| 208 | Ga0070701_10142398 | 3300005438 | Bacteria | 1373 |
| 209 | Ga0070711_100016949 | 3300005439 | Bacteria | 4632 |
| 210 | Ga0070711_100021768 | 3300005439 | Bacteria | 4149 |
| 211 | Ga0070711_100062598 | 3300005439 | Bacteria | 2594 |
| 212 | Ga0070711_100111753 | 3300005439 | Bacteria | 2006 |
| 213 | Ga0070711_100132268 | 3300005439 | Bacteria | 1860 |
| 214 | Ga0070705_100115887 | 3300005440 | Bacteria | 1721 |
| 215 | Ga0070700_100009943 | 3300005441 | Bacteria | 5235 |
| 216 | Ga0070700_100257255 | 3300005441 | Bacteria | 1255 |
| 217 | Ga0070700_100300455 | 3300005441 | Bacteria | 1172 |
| 218 | Ga0070700_100313260 | 3300005441 | Bacteria | 1150 |
| 219 | Ga0070700_100381684 | 3300005441 | Bacteria | 1054 |
| 220 | Ga0070700_100577113 | 3300005441 | Bacteria | 877 |
| 221 | Ga0070694_100013152 | 3300005444 | Bacteria | 5164 |
| 222 | Ga0070694_100038068 | 3300005444 | Bacteria | 3194 |
| 223 | Ga0070694_100226977 | 3300005444 | Bacteria | 1403 |
| 224 | Ga0070694_100235153 | 3300005444 | Bacteria | 1380 |
| 225 | Ga0070694_101544251 | 3300005444 | Unclassified | 562 |
| 226 | Ga0070708_100000077 | 3300005445 | Bacteria | 63116 |
| 227 | Ga0070708_100049689 | 3300005445 | Bacteria | 3711 |
| 228 | Ga0070708_100331246 | 3300005445 | Bacteria | 1434 |
| 229 | Ga0070663_100008615 | 3300005455 | Bacteria | 6285 |
| 230 | Ga0070663_100020556 | 3300005455 | Bacteria | 4372 |
| 231 | Ga0070663_100333338 | 3300005455 | Bacteria | 1223 |
| 232 | Ga0070663_100373857 | 3300005455 | Bacteria | 1159 |
| 233 | Ga0070663_100593692 | 3300005455 | Bacteria | 930 |
| 234 | Ga0070663_101007460 | 3300005455 | Bacteria | 724 |
| 235 | Ga0070663_101417552 | 3300005455 | Bacteria | 616 |
| 236 | Ga0070678_100032948 | 3300005456 | Bacteria | 3592 |
| 237 | Ga0070678_100331880 | 3300005456 | Bacteria | 1302 |
| 238 | Ga0070662_100014975 | 3300005457 | Bacteria | 5187 |
| 239 | Ga0070662_100050296 | 3300005457 | Bacteria | 3007 |
| 240 | Ga0070662_100425956 | 3300005457 | Bacteria | 1098 |
| 241 | Ga0070662_100517281 | 3300005457 | Bacteria | 997 |
| 242 | Ga0070662_100648519 | 3300005457 | Bacteria | 890 |
| 243 | Ga0070662_100723981 | 3300005457 | Bacteria | 843 |
| 244 | Ga0070681_10001680 | 3300005458 | Bacteria | 19775 |
| 245 | Ga0070681_10003472 | 3300005458 | Bacteria | 14770 |
| 246 | Ga0070681_10009733 | 3300005458 | Bacteria | 9458 |
| 247 | Ga0070681_10028142 | 3300005458 | Bacteria | 5651 |
| 248 | Ga0070681_10106558 | 3300005458 | Bacteria | 2744 |
| 249 | Ga0070681_10138741 | 3300005458 | Bacteria | 2361 |
| 250 | Ga0070681_10185256 | 3300005458 | Bacteria | 2002 |
| 251 | Ga0070681_10193078 | 3300005458 | Bacteria | 1956 |
| 252 | Ga0070681_10205939 | 3300005458 | Bacteria | 1884 |
| 253 | Ga0070681_10538112 | 3300005458 | Bacteria | 1082 |
| 254 | Ga0070681_10704329 | 3300005458 | Bacteria | 926 |
| 255 | Ga0068867_100106438 | 3300005459 | Bacteria | 2148 |
| 256 | Ga0068867_100148600 | 3300005459 | Bacteria | 1839 |
| 257 | Ga0068867_100199913 | 3300005459 | Bacteria | 1599 |
| 258 | Ga0068867_100287495 | 3300005459 | Bacteria | 1350 |
| 259 | Ga0068867_100592272 | 3300005459 | Bacteria | 966 |
| 260 | Ga0068867_101837729 | 3300005459 | Unclassified | 570 |
| 261 | Ga0070685_10068364 | 3300005466 | Bacteria | 2098 |
| 262 | Ga0070706_100120646 | 3300005467 | Bacteria | 2444 |
| 263 | Ga0070706_101510368 | 3300005467 | Bacteria | 614 |
| 264 | Ga0070707_100007168 | 3300005468 | Bacteria | 10339 |
| 265 | Ga0070707_100253528 | 3300005468 | Bacteria | 1712 |
| 266 | Ga0070707_100342049 | 3300005468 | Bacteria | 1453 |
| 267 | Ga0070707_100634610 | 3300005468 | Bacteria | 1031 |
| 268 | Ga0070707_100758309 | 3300005468 | Bacteria | 934 |
| 269 | Ga0070698_100002723 | 3300005471 | Bacteria | 19438 |
| 270 | Ga0070698_100057554 | 3300005471 | Bacteria | 3933 |
| 271 | Ga0070698_100108125 | 3300005471 | Bacteria | 2748 |
| 272 | Ga0070698_100889228 | 3300005471 | Bacteria | 836 |
| 273 | Ga0070699_100060134 | 3300005518 | Bacteria | 3292 |
| 274 | Ga0070699_100088378 | 3300005518 | Bacteria | 2706 |
| 275 | Ga0070699_100090852 | 3300005518 | Bacteria | 2669 |
| 276 | Ga0070699_100596483 | 3300005518 | Bacteria | 1007 |
| 277 | Ga0070679_100009717 | 3300005530 | Bacteria | 9099 |
| 278 | Ga0070679_100012748 | 3300005530 | Bacteria | 8039 |
| 279 | Ga0070679_100015827 | 3300005530 | Bacteria | 7256 |
| 280 | Ga0070679_100020806 | 3300005530 | Bacteria | 6399 |
| 281 | Ga0070679_100023321 | 3300005530 | Bacteria | 6055 |
| 282 | Ga0070679_100027822 | 3300005530 | Bacteria | 5569 |
| 283 | Ga0070679_100037625 | 3300005530 | Bacteria | 4808 |
| 284 | Ga0070679_100039848 | 3300005530 | Bacteria | 4670 |
| 285 | Ga0070679_100060996 | 3300005530 | Bacteria | 3759 |
| 286 | Ga0070679_100101144 | 3300005530 | Bacteria | 2869 |
| 287 | Ga0070679_100103099 | 3300005530 | Bacteria | 2839 |
| 288 | Ga0070679_100112406 | 3300005530 | Bacteria | 2710 |
| 289 | Ga0070679_100128217 | 3300005530 | Bacteria | 2519 |
| 290 | Ga0070679_100142801 | 3300005530 | Bacteria | 2373 |
| 291 | Ga0070679_100192718 | 3300005530 | Bacteria | 2007 |
| 292 | Ga0070679_100200506 | 3300005530 | Bacteria | 1962 |
| 293 | Ga0070679_100311153 | 3300005530 | Bacteria | 1525 |
| 294 | Ga0070679_100322503 | 3300005530 | Bacteria | 1494 |
| 295 | Ga0070679_100410499 | 3300005530 | Bacteria | 1300 |
| 296 | Ga0070679_100479063 | 3300005530 | Bacteria | 1189 |
| 297 | Ga0070679_100574002 | 3300005530 | Bacteria | 1071 |
| 298 | Ga0070679_101118399 | 3300005530 | Bacteria | 733 |
| 299 | Ga0070684_100014785 | 3300005535 | Bacteria | 6333 |
| 300 | Ga0070684_100026374 | 3300005535 | Bacteria | 4894 |
| 301 | Ga0070684_100035907 | 3300005535 | Bacteria | 4244 |
| 302 | Ga0070684_100052003 | 3300005535 | Bacteria | 3560 |
| 303 | Ga0070684_100058231 | 3300005535 | Bacteria | 3376 |
| 304 | Ga0070684_100066581 | 3300005535 | Bacteria | 3162 |
| 305 | Ga0070684_100102320 | 3300005535 | Bacteria | 2560 |
| 306 | Ga0070684_100116273 | 3300005535 | Bacteria | 2402 |
| 307 | Ga0070684_100137395 | 3300005535 | Bacteria | 2209 |
| 308 | Ga0070684_100162192 | 3300005535 | Bacteria | 2028 |
| 309 | Ga0070684_100164894 | 3300005535 | Bacteria | 2011 |
| 310 | Ga0070684_100182647 | 3300005535 | Bacteria | 1907 |
| 311 | Ga0070684_100223370 | 3300005535 | Bacteria | 1718 |
| 312 | Ga0070684_100241211 | 3300005535 | Bacteria | 1651 |
| 313 | Ga0070684_100250871 | 3300005535 | Bacteria | 1617 |
| 314 | Ga0070684_100325651 | 3300005535 | Bacteria | 1412 |
| 315 | Ga0070684_100450563 | 3300005535 | Bacteria | 1189 |
| 316 | Ga0070684_100543423 | 3300005535 | Bacteria | 1078 |
| 317 | Ga0070684_100602378 | 3300005535 | Bacteria | 1022 |
| 318 | Ga0070684_101725757 | 3300005535 | Bacteria | 591 |
| 319 | Ga0070697_100049568 | 3300005536 | Bacteria | 3408 |
| 320 | Ga0070697_100146086 | 3300005536 | Bacteria | 1991 |
| 321 | Ga0068853_100145351 | 3300005539 | Bacteria | 2131 |
| 322 | Ga0068853_100435858 | 3300005539 | Bacteria | 1231 |
| 323 | Ga0068853_100442252 | 3300005539 | Bacteria | 1222 |
| 324 | Ga0068853_100543028 | 3300005539 | Bacteria | 1100 |
| 325 | Ga0070672_100014900 | 3300005543 | Bacteria | 5520 |
| 326 | Ga0070672_100064908 | 3300005543 | Bacteria | 2886 |
| 327 | Ga0070672_100515601 | 3300005543 | Bacteria | 1035 |
| 328 | Ga0070672_100590692 | 3300005543 | Bacteria | 966 |
| 329 | Ga0070686_100668131 | 3300005544 | Bacteria | 825 |
| 330 | Ga0070695_100028830 | 3300005545 | Bacteria | 3447 |
| 331 | Ga0070695_100041194 | 3300005545 | Bacteria | 2927 |
| 332 | Ga0070695_100063440 | 3300005545 | Bacteria | 2401 |
| 333 | Ga0070695_100745403 | 3300005545 | Bacteria | 781 |
| 334 | Ga0070696_100000705 | 3300005546 | Bacteria | 21330 |
| 335 | Ga0070696_100173225 | 3300005546 | Bacteria | 1596 |
| 336 | Ga0070696_100350796 | 3300005546 | Bacteria | 1143 |
| 337 | Ga0070696_100414085 | 3300005546 | Bacteria | 1057 |
| 338 | Ga0070693_100014943 | 3300005547 | Bacteria | 3991 |
| 339 | Ga0070693_100029698 | 3300005547 | Bacteria | 2983 |
| 340 | Ga0070693_100422162 | 3300005547 | Bacteria | 929 |
| 341 | Ga0070693_100438949 | 3300005547 | Bacteria | 914 |
| 342 | Ga0070693_100497709 | 3300005547 | Bacteria | 864 |
| 343 | Ga0070693_100568544 | 3300005547 | Bacteria | 814 |
| 344 | Ga0070665_101286161 | 3300005548 | Bacteria | 741 |
| 345 | Ga0070665_101747369 | 3300005548 | Bacteria | 629 |
| 346 | Ga0070665_101827349 | 3300005548 | Bacteria | 614 |
| 347 | Ga0070704_100044905 | 3300005549 | Bacteria | 3073 |
| 348 | Ga0070704_100050759 | 3300005549 | Bacteria | 2918 |
| 349 | Ga0070704_100451470 | 3300005549 | Bacteria | 1107 |
| 350 | Ga0068855_100029696 | 3300005563 | Bacteria | 6536 |
| 351 | Ga0068855_100195616 | 3300005563 | Bacteria | 2278 |
| 352 | Ga0068855_100555033 | 3300005563 | Bacteria | 1243 |
| 353 | Ga0068855_100622794 | 3300005563 | Bacteria | 1162 |
| 354 | Ga0068855_100668675 | 3300005563 | Bacteria | 1114 |
| 355 | Ga0068855_100730057 | 3300005563 | Bacteria | 1058 |
| 356 | Ga0068855_101225127 | 3300005563 | Bacteria | 779 |
| 357 | Ga0068855_101521558 | 3300005563 | Bacteria | 686 |
| 358 | Ga0070664_100038733 | 3300005564 | Bacteria | 4014 |
| 359 | Ga0070664_100072000 | 3300005564 | Bacteria | 2963 |
| 360 | Ga0070664_100096586 | 3300005564 | Bacteria | 2564 |
| 361 | Ga0070664_100139755 | 3300005564 | Bacteria | 2132 |
| 362 | Ga0070664_100211881 | 3300005564 | Bacteria | 1732 |
| 363 | Ga0070664_100258903 | 3300005564 | Bacteria | 1565 |
| 364 | Ga0070664_100266759 | 3300005564 | Bacteria | 1541 |
| 365 | Ga0070664_100289322 | 3300005564 | Bacteria | 1479 |
| 366 | Ga0070664_100591649 | 3300005564 | Bacteria | 1028 |
| 367 | Ga0070664_101094212 | 3300005564 | Unclassified | 750 |
| 368 | Ga0070664_101187223 | 3300005564 | Bacteria | 720 |
| 369 | Ga0068857_100029029 | 3300005577 | Bacteria | 4881 |
| 370 | Ga0068857_100041742 | 3300005577 | Bacteria | 4068 |
| 371 | Ga0068857_100055825 | 3300005577 | Bacteria | 3504 |
| 372 | Ga0068857_100149894 | 3300005577 | Bacteria | 2112 |
| 373 | Ga0068857_100191162 | 3300005577 | Bacteria | 1864 |
| 374 | Ga0068857_100226082 | 3300005577 | Bacteria | 1710 |
| 375 | Ga0068857_100299387 | 3300005577 | Bacteria | 1482 |
| 376 | Ga0068857_100582263 | 3300005577 | Bacteria | 1056 |
| 377 | Ga0068854_100028156 | 3300005578 | Bacteria | 3879 |
| 378 | Ga0068854_100177257 | 3300005578 | Bacteria | 1663 |
| 379 | Ga0068854_100190051 | 3300005578 | Bacteria | 1608 |
| 380 | Ga0068854_100662941 | 3300005578 | Bacteria | 897 |
| 381 | Ga0068854_101002758 | 3300005578 | Bacteria | 739 |
| 382 | Ga0068856_100041437 | 3300005614 | Bacteria | 4525 |
| 383 | Ga0068856_100057303 | 3300005614 | Bacteria | 3846 |
| 384 | Ga0068856_100206334 | 3300005614 | Bacteria | 1980 |
| 385 | Ga0068856_100328720 | 3300005614 | Bacteria | 1546 |
| 386 | Ga0068856_100656999 | 3300005614 | Bacteria | 1069 |
| 387 | Ga0068856_101386106 | 3300005614 | Bacteria | 718 |
| 388 | Ga0070702_100029194 | 3300005615 | Bacteria | 2996 |
| 389 | Ga0070702_100322103 | 3300005615 | Bacteria | 1078 |
| 390 | Ga0068852_100012880 | 3300005616 | Bacteria | 6375 |
| 391 | Ga0068852_100021426 | 3300005616 | Bacteria | 5160 |
| 392 | Ga0068852_100057382 | 3300005616 | Bacteria | 3369 |
| 393 | Ga0068852_100079051 | 3300005616 | Bacteria | 2912 |
| 394 | Ga0068852_100181844 | 3300005616 | Bacteria | 1978 |
| 395 | Ga0068852_100214728 | 3300005616 | Bacteria | 1827 |
| 396 | Ga0068852_100283209 | 3300005616 | Bacteria | 1599 |
| 397 | Ga0068852_100406678 | 3300005616 | Bacteria | 1340 |
| 398 | Ga0068852_100510629 | 3300005616 | Bacteria | 1198 |
| 399 | Ga0068852_100614213 | 3300005616 | Bacteria | 1092 |
| 400 | Ga0068852_101058213 | 3300005616 | Bacteria | 831 |
| 401 | Ga0068852_101280249 | 3300005616 | Bacteria | 755 |
| 402 | Ga0068852_101974946 | 3300005616 | Bacteria | 605 |
| 403 | Ga0068859_100000840 | 3300005617 | Bacteria | 31198 |
| 404 | Ga0068859_100078819 | 3300005617 | Bacteria | 3334 |
| 405 | Ga0068859_100322150 | 3300005617 | Bacteria | 1640 |
| 406 | Ga0068859_100444662 | 3300005617 | Bacteria | 1392 |
| 407 | Ga0068859_100736147 | 3300005617 | Bacteria | 1075 |
| 408 | Ga0068859_100785237 | 3300005617 | Bacteria | 1040 |
| 409 | Ga0068859_100827601 | 3300005617 | Bacteria | 1012 |
| 410 | Ga0068859_101427805 | 3300005617 | Unclassified | 763 |
| 411 | Ga0068864_100009895 | 3300005618 | Bacteria | 7864 |
| 412 | Ga0068864_100115558 | 3300005618 | Bacteria | 2394 |
| 413 | Ga0068864_100192269 | 3300005618 | Bacteria | 1871 |
| 414 | Ga0068864_100317881 | 3300005618 | Bacteria | 1462 |
| 415 | Ga0068864_100360078 | 3300005618 | Bacteria | 1374 |
| 416 | Ga0068864_100672183 | 3300005618 | Bacteria | 1010 |
| 417 | Ga0068864_100985203 | 3300005618 | Bacteria | 835 |
| 418 | Ga0068866_10280017 | 3300005718 | Bacteria | 1033 |
| 419 | Ga0068861_100000975 | 3300005719 | Bacteria | 17448 |
| 420 | Ga0068861_100011996 | 3300005719 | Bacteria | 6035 |
| 421 | Ga0068861_100067772 | 3300005719 | Bacteria | 2756 |
| 422 | Ga0068861_100533317 | 3300005719 | Bacteria | 1066 |
| 423 | Ga0068851_10082854 | 3300005834 | Bacteria | 1677 |
| 424 | Ga0068851_10100896 | 3300005834 | Bacteria | 1531 |
| 425 | Ga0068870_10005093 | 3300005840 | Bacteria | 5714 |
| 426 | Ga0068863_100095919 | 3300005841 | Bacteria | 2815 |
| 427 | Ga0068863_100246948 | 3300005841 | Bacteria | 1723 |
| 428 | Ga0068863_100409739 | 3300005841 | Bacteria | 1327 |
| 429 | Ga0068863_100425021 | 3300005841 | Bacteria | 1302 |
| 430 | Ga0068863_100559769 | 3300005841 | Bacteria | 1129 |
| 431 | Ga0068863_100781071 | 3300005841 | Bacteria | 952 |
| 432 | Ga0068863_101518455 | 3300005841 | Bacteria | 678 |
| 433 | Ga0068858_100072941 | 3300005842 | Bacteria | 3186 |
| 434 | Ga0068858_100156351 | 3300005842 | Bacteria | 2145 |
| 435 | Ga0068858_100300941 | 3300005842 | Bacteria | 1530 |
| 436 | Ga0068858_100653683 | 3300005842 | Bacteria | 1022 |
| 437 | Ga0068860_100004188 | 3300005843 | Bacteria | 14782 |
| 438 | Ga0068860_100019789 | 3300005843 | Bacteria | 6526 |
| 439 | Ga0068860_100056592 | 3300005843 | Bacteria | 3727 |
| 440 | Ga0068860_100543237 | 3300005843 | Bacteria | 1164 |
| 441 | Ga0068860_100853246 | 3300005843 | Bacteria | 925 |
| 442 | Ga0068862_100000764 | 3300005844 | Bacteria | 32066 |
| 443 | Ga0068862_100002514 | 3300005844 | Bacteria | 16227 |
| 444 | Ga0068862_100013561 | 3300005844 | Bacteria | 6752 |
| 445 | Ga0068862_100165433 | 3300005844 | Bacteria | 1977 |
| 446 | Ga0068862_100286295 | 3300005844 | Bacteria | 1512 |
| 447 | Ga0068862_100403955 | 3300005844 | Bacteria | 1278 |
| 448 | Ga0068862_100780633 | 3300005844 | Bacteria | 932 |
| 449 | Ga0081539_10005565 | 3300005985 | Bacteria | 12756 |
| 450 | Ga0070717_10007434 | 3300006028 | Bacteria | 8138 |
| 451 | Ga0070717_10067172 | 3300006028 | Bacteria | 2982 |
| 452 | Ga0075432_10078128 | 3300006058 | Bacteria | 1197 |
| 453 | Ga0070715_10080258 | 3300006163 | Bacteria | 1479 |
| 454 | Ga0070716_100007666 | 3300006173 | Bacteria | 5325 |
| 455 | Ga0070716_100051887 | 3300006173 | Bacteria | 2334 |
| 456 | Ga0070716_100060728 | 3300006173 | Bacteria | 2185 |
| 457 | Ga0070716_100184954 | 3300006173 | Bacteria | 1371 |
| 458 | Ga0070716_100433191 | 3300006173 | Bacteria | 954 |
| 459 | Ga0070712_100004359 | 3300006175 | Bacteria | 8726 |
| 460 | Ga0070712_100099934 | 3300006175 | Bacteria | 2142 |
| 461 | Ga0070712_100134695 | 3300006175 | Bacteria | 1877 |
| 462 | Ga0097621_100073666 | 3300006237 | Bacteria | 2827 |
| 463 | Ga0097621_100251079 | 3300006237 | Bacteria | 1549 |
| 464 | Ga0097621_100455969 | 3300006237 | Bacteria | 1152 |
| 465 | Ga0097621_100928612 | 3300006237 | Bacteria | 811 |
| 466 | Ga0068871_100025360 | 3300006358 | Bacteria | 4611 |
| 467 | Ga0068871_100122576 | 3300006358 | Bacteria | 2197 |
| 468 | Ga0068871_100334181 | 3300006358 | Bacteria | 1337 |
| 469 | Ga0075428_100144106 | 3300006844 | Bacteria | 2589 |
| 470 | Ga0075428_100147317 | 3300006844 | Bacteria | 2559 |
| 471 | Ga0075428_101479410 | 3300006844 | Bacteria | 712 |
| 472 | Ga0075430_100041383 | 3300006846 | Bacteria | 3898 |
| 473 | Ga0075430_100183779 | 3300006846 | Bacteria | 1738 |
| 474 | Ga0075430_100239016 | 3300006846 | Bacteria | 1505 |
| 475 | Ga0075430_100254645 | 3300006846 | Bacteria | 1454 |
| 476 | Ga0075430_100328965 | 3300006846 | Bacteria | 1263 |
| 477 | Ga0075430_100350563 | 3300006846 | Bacteria | 1219 |
| 478 | Ga0075430_100467061 | 3300006846 | Bacteria | 1041 |
| 479 | Ga0075430_100490598 | 3300006846 | Bacteria | 1014 |
| 480 | Ga0075430_100491885 | 3300006846 | Unclassified | 1012 |
| 481 | Ga0075431_100016038 | 3300006847 | Bacteria | 7603 |
| 482 | Ga0075431_100031481 | 3300006847 | Bacteria | 5464 |
| 483 | Ga0075431_100117958 | 3300006847 | Bacteria | 2738 |
| 484 | Ga0075431_100370414 | 3300006847 | Bacteria | 1437 |
| 485 | Ga0075431_100444805 | 3300006847 | Bacteria | 1292 |
| 486 | Ga0075431_100517344 | 3300006847 | Bacteria | 1183 |
| 487 | Ga0075431_100604174 | 3300006847 | Bacteria | 1081 |
| 488 | Ga0075431_100903886 | 3300006847 | Bacteria | 852 |
| 489 | Ga0075431_100907216 | 3300006847 | Unclassified | 851 |
| 490 | Ga0075431_101135439 | 3300006847 | Bacteria | 745 |
| 491 | Ga0075433_10045513 | 3300006852 | Bacteria | 3815 |
| 492 | Ga0075433_10155235 | 3300006852 | Bacteria | 2036 |
| 493 | Ga0075433_10352367 | 3300006852 | Bacteria | 1301 |
| 494 | Ga0075433_10376572 | 3300006852 | Bacteria | 1253 |
| 495 | Ga0075433_10446265 | 3300006852 | Bacteria | 1140 |
| 496 | Ga0075433_10620556 | 3300006852 | Bacteria | 949 |
| 497 | Ga0075434_100051764 | 3300006871 | Bacteria | 4080 |
| 498 | Ga0075434_100073796 | 3300006871 | Bacteria | 3405 |
| 499 | Ga0075434_100097085 | 3300006871 | Bacteria | 2951 |
| 500 | Ga0075434_100128012 | 3300006871 | Bacteria | 2557 |
| 501 | Ga0075434_100168045 | 3300006871 | Bacteria | 2213 |
| 502 | Ga0075434_100192776 | 3300006871 | Bacteria | 2058 |
| 503 | Ga0075434_100489476 | 3300006871 | Bacteria | 1251 |
| 504 | Ga0075429_100009872 | 3300006880 | Bacteria | 8276 |
| 505 | Ga0075429_100144460 | 3300006880 | Bacteria | 2082 |
| 506 | Ga0075429_100774376 | 3300006880 | Bacteria | 840 |
| 507 | Ga0075429_100788841 | 3300006880 | Bacteria | 832 |
| 508 | Ga0068865_100026446 | 3300006881 | Bacteria | 3826 |
| 509 | Ga0068865_100270533 | 3300006881 | Bacteria | 1349 |
| 510 | Ga0068865_100465714 | 3300006881 | Bacteria | 1048 |
| 511 | Ga0068865_100654961 | 3300006881 | Bacteria | 893 |
| 512 | Ga0068865_100709098 | 3300006881 | Bacteria | 861 |
| 513 | Ga0068865_100831936 | 3300006881 | Bacteria | 798 |
| 514 | Ga0068865_101107898 | 3300006881 | Bacteria | 698 |
| 515 | Ga0075436_100127860 | 3300006914 | Bacteria | 1780 |
| 516 | Ga0097620_100000840 | 3300006931 | Bacteria | 31198 |
| 517 | Ga0097620_100078823 | 3300006931 | Bacteria | 3334 |
| 518 | Ga0097620_100322149 | 3300006931 | Bacteria | 1640 |
| 519 | Ga0097620_100444653 | 3300006931 | Bacteria | 1392 |
| 520 | Ga0097620_100736123 | 3300006931 | Bacteria | 1075 |
| 521 | Ga0097620_100785185 | 3300006931 | Bacteria | 1040 |
| 522 | Ga0097620_100827528 | 3300006931 | Bacteria | 1012 |
| 523 | Ga0097620_101427739 | 3300006931 | Unclassified | 763 |
| 524 | Ga0075435_100073739 | 3300007076 | Bacteria | 2791 |
| 525 | Ga0075435_100401682 | 3300007076 | Bacteria | 1178 |
| 526 | Ga0075435_101170526 | 3300007076 | Bacteria | 673 |
| 527 | Ga0105240_10049628 | 3300009093 | Bacteria | 5296 |
| 528 | Ga0105240_10085708 | 3300009093 | Bacteria | 3859 |
| 529 | Ga0105240_10123936 | 3300009093 | Bacteria | 3108 |
| 530 | Ga0105240_10295269 | 3300009093 | Bacteria | 1856 |
| 531 | Ga0105240_10481612 | 3300009093 | Bacteria | 1383 |
| 532 | Ga0105240_10757978 | 3300009093 | Bacteria | 1055 |
| 533 | Ga0105240_11339649 | 3300009093 | Unclassified | 754 |
| 534 | Ga0111539_10012931 | 3300009094 | Bacteria | 10445 |
| 535 | Ga0111539_10123828 | 3300009094 | Bacteria | 3030 |
| 536 | Ga0111539_10158570 | 3300009094 | Bacteria | 2647 |
| 537 | Ga0111539_10577507 | 3300009094 | Bacteria | 1309 |
| 538 | Ga0111539_10802941 | 3300009094 | Bacteria | 1095 |
| 539 | Ga0111539_11361575 | 3300009094 | Bacteria | 823 |
| 540 | Ga0111539_11600993 | 3300009094 | Bacteria | 755 |
| 541 | Ga0105245_10062711 | 3300009098 | Bacteria | 3354 |
| 542 | Ga0105245_10167967 | 3300009098 | Bacteria | 2087 |
| 543 | Ga0105245_10169404 | 3300009098 | Bacteria | 2079 |
| 544 | Ga0105245_10197229 | 3300009098 | Bacteria | 1932 |
| 545 | Ga0105245_10262378 | 3300009098 | Bacteria | 1682 |
| 546 | Ga0105245_12854270 | 3300009098 | Unclassified | 535 |
| 547 | Ga0105247_10265511 | 3300009101 | Bacteria | 1178 |
| 548 | Ga0114129_10006614 | 3300009147 | Bacteria | 16457 |
| 549 | Ga0114129_10030165 | 3300009147 | Bacteria | 7680 |
| 550 | Ga0114129_10045730 | 3300009147 | Bacteria | 6153 |
| 551 | Ga0114129_10088826 | 3300009147 | Bacteria | 4284 |
| 552 | Ga0114129_10329659 | 3300009147 | Bacteria | 2027 |
| 553 | Ga0114129_10397700 | 3300009147 | Bacteria | 1816 |
| 554 | Ga0114129_10464124 | 3300009147 | Bacteria | 1659 |
| 555 | Ga0114129_10854020 | 3300009147 | Bacteria | 1157 |
| 556 | Ga0114129_11815054 | 3300009147 | Bacteria | 741 |
| 557 | Ga0105243_10213297 | 3300009148 | Bacteria | 1701 |
| 558 | Ga0105243_10648984 | 3300009148 | Bacteria | 1023 |
| 559 | Ga0105243_10870702 | 3300009148 | Bacteria | 894 |
| 560 | Ga0105241_10122969 | 3300009174 | Bacteria | 2092 |
| 561 | Ga0105241_10171243 | 3300009174 | Bacteria | 1794 |
| 562 | Ga0105241_10174438 | 3300009174 | Bacteria | 1778 |
| 563 | Ga0105241_10518799 | 3300009174 | Bacteria | 1065 |
| 564 | Ga0105241_11718166 | 3300009174 | Unclassified | 610 |
| 565 | Ga0105242_10040715 | 3300009176 | Bacteria | 3745 |
| 566 | Ga0105242_10147772 | 3300009176 | Bacteria | 2046 |
| 567 | Ga0105242_10155761 | 3300009176 | Bacteria | 1996 |
| 568 | Ga0105242_10394983 | 3300009176 | Bacteria | 1289 |
| 569 | Ga0105248_10023633 | 3300009177 | Bacteria | 6829 |
| 570 | Ga0105248_10052133 | 3300009177 | Bacteria | 4591 |
| 571 | Ga0105248_10061326 | 3300009177 | Bacteria | 4223 |
| 572 | Ga0105248_10086866 | 3300009177 | Bacteria | 3519 |
| 573 | Ga0105248_10228771 | 3300009177 | Bacteria | 2093 |
| 574 | Ga0105248_10798793 | 3300009177 | Bacteria | 1065 |
| 575 | Ga0105248_11500021 | 3300009177 | Bacteria | 763 |
| 576 | Ga0105248_11709380 | 3300009177 | Bacteria | 713 |
| 577 | Ga0105248_12364966 | 3300009177 | Bacteria | 605 |
| 578 | Ga0105237_10078219 | 3300009545 | Bacteria | 3297 |
| 579 | Ga0105237_10090173 | 3300009545 | Bacteria | 3055 |
| 580 | Ga0105237_10183927 | 3300009545 | Bacteria | 2090 |
| 581 | Ga0105237_10476859 | 3300009545 | Bacteria | 1254 |
| 582 | Ga0105237_10525293 | 3300009545 | Bacteria | 1190 |
| 583 | Ga0105237_10814341 | 3300009545 | Bacteria | 941 |
| 584 | Ga0105237_11011136 | 3300009545 | Bacteria | 838 |
| 585 | Ga0105238_10040059 | 3300009551 | Bacteria | 4749 |
| 586 | Ga0105238_10043144 | 3300009551 | Bacteria | 4564 |
| 587 | Ga0105238_10224491 | 3300009551 | Bacteria | 1855 |
| 588 | Ga0105238_10250412 | 3300009551 | Bacteria | 1750 |
| 589 | Ga0105249_10000580 | 3300009553 | Bacteria | 33471 |
| 590 | Ga0105249_10008223 | 3300009553 | Bacteria | 9087 |
| 591 | Ga0105249_10033683 | 3300009553 | Bacteria | 4639 |
| 592 | Ga0105249_10165723 | 3300009553 | Bacteria | 2139 |
| 593 | Ga0105239_10245626 | 3300010375 | Bacteria | 2010 |
| 594 | Ga0105239_10988881 | 3300010375 | Bacteria | 967 |
| 595 | Ga0105246_10697954 | 3300011119 | Bacteria | 889 |
| 596 | Ga0157322_1006879 | 3300012490 | Bacteria | 827 |
| 597 | Ga0157319_1006020 | 3300012497 | Bacteria | 856 |
| 598 | Ga0157316_1013239 | 3300012510 | Bacteria | 804 |
| 599 | Ga0157327_1019168 | 3300012512 | Bacteria | 754 |
| 600 | Ga0157326_1032801 | 3300012513 | Unclassified | 695 |
| 601 | Ga0157373_10091074 | 3300013100 | Bacteria | 2148 |
| 602 | Ga0157373_10201675 | 3300013100 | Bacteria | 1402 |
| 603 | Ga0157373_10247497 | 3300013100 | Bacteria | 1260 |
| 604 | Ga0157373_10387344 | 3300013100 | Bacteria | 1000 |
| 605 | Ga0157373_10464580 | 3300013100 | Bacteria | 912 |
| 606 | Ga0157373_10916467 | 3300013100 | Bacteria | 651 |
| 607 | Ga0157371_10009172 | 3300013102 | Bacteria | 7812 |
| 608 | Ga0157371_10012727 | 3300013102 | Bacteria | 6414 |
| 609 | Ga0157371_10020379 | 3300013102 | Bacteria | 4880 |
| 610 | Ga0157371_10311267 | 3300013102 | Bacteria | 1141 |
| 611 | Ga0157371_10395832 | 3300013102 | Bacteria | 1010 |
| 612 | Ga0157371_10420135 | 3300013102 | Bacteria | 980 |
| 613 | Ga0157370_10046798 | 3300013104 | Bacteria | 4147 |
| 614 | Ga0157370_10081133 | 3300013104 | Bacteria | 3053 |
| 615 | Ga0157370_10237486 | 3300013104 | Bacteria | 1687 |
| 616 | Ga0157370_10269109 | 3300013104 | Bacteria | 1574 |
| 617 | Ga0157370_10297515 | 3300013104 | Bacteria | 1490 |
| 618 | Ga0157370_10341656 | 3300013104 | Bacteria | 1380 |
| 619 | Ga0157370_10553291 | 3300013104 | Bacteria | 1055 |
| 620 | Ga0157370_10841357 | 3300013104 | Bacteria | 834 |
| 621 | Ga0157370_11038713 | 3300013104 | Bacteria | 741 |
| 622 | Ga0157370_11472282 | 3300013104 | Bacteria | 612 |
| 623 | Ga0157369_10048625 | 3300013105 | Bacteria | 4602 |
| 624 | Ga0157369_10076054 | 3300013105 | Bacteria | 3599 |
| 625 | Ga0157369_10101552 | 3300013105 | Bacteria | 3065 |
| 626 | Ga0157369_10195230 | 3300013105 | Bacteria | 2126 |
| 627 | Ga0157369_10404342 | 3300013105 | Bacteria | 1416 |
| 628 | Ga0157369_10510628 | 3300013105 | Bacteria | 1243 |
| 629 | Ga0157369_10551555 | 3300013105 | Bacteria | 1191 |
| 630 | Ga0157369_10572508 | 3300013105 | Bacteria | 1167 |
| 631 | Ga0157369_11000355 | 3300013105 | Bacteria | 856 |
| 632 | Ga0157369_11264956 | 3300013105 | Bacteria | 752 |
| 633 | Ga0157369_11386440 | 3300013105 | Bacteria | 716 |
| 634 | Ga0157374_10370254 | 3300013296 | Bacteria | 1426 |
| 635 | Ga0157374_10460112 | 3300013296 | Bacteria | 1274 |
| 636 | Ga0157374_10831697 | 3300013296 | Bacteria | 940 |
| 637 | Ga0157374_11006852 | 3300013296 | Bacteria | 852 |
| 638 | Ga0157374_11246215 | 3300013296 | Bacteria | 765 |
| 639 | Ga0157378_10093067 | 3300013297 | Bacteria | 2743 |
| 640 | Ga0157378_10339700 | 3300013297 | Bacteria | 1464 |
| 641 | Ga0157378_10460758 | 3300013297 | Bacteria | 1263 |
| 642 | Ga0157378_10639900 | 3300013297 | Bacteria | 1078 |
| 643 | Ga0157378_10997599 | 3300013297 | Bacteria | 872 |
| 644 | Ga0157378_11113140 | 3300013297 | Bacteria | 827 |
| 645 | Ga0163162_10006136 | 3300013306 | Bacteria | 11634 |
| 646 | Ga0163162_10009455 | 3300013306 | Bacteria | 9479 |
| 647 | Ga0163162_10038079 | 3300013306 | Bacteria | 4800 |
| 648 | Ga0163162_10069939 | 3300013306 | Bacteria | 3562 |
| 649 | Ga0163162_10084701 | 3300013306 | Bacteria | 3246 |
| 650 | Ga0163162_10092253 | 3300013306 | Bacteria | 3112 |
| 651 | Ga0163162_10493368 | 3300013306 | Bacteria | 1355 |
| 652 | Ga0163162_10925965 | 3300013306 | Bacteria | 984 |
| 653 | Ga0157372_10006474 | 3300013307 | Bacteria | 12464 |
| 654 | Ga0157372_10021748 | 3300013307 | Bacteria | 6932 |
| 655 | Ga0157372_10029257 | 3300013307 | Bacteria | 6014 |
| 656 | Ga0157372_10046943 | 3300013307 | Bacteria | 4796 |
| 657 | Ga0157372_10054000 | 3300013307 | Bacteria | 4480 |
| 658 | Ga0157372_10083855 | 3300013307 | Bacteria | 3610 |
| 659 | Ga0157372_10225830 | 3300013307 | Bacteria | 2171 |
| 660 | Ga0157372_10411950 | 3300013307 | Bacteria | 1575 |
| 661 | Ga0157372_10759654 | 3300013307 | Bacteria | 1127 |
| 662 | Ga0157372_10776592 | 3300013307 | Bacteria | 1114 |
| 663 | Ga0157372_10828160 | 3300013307 | Bacteria | 1075 |
| 664 | Ga0157372_11406547 | 3300013307 | Bacteria | 804 |
| 665 | Ga0157372_12336517 | 3300013307 | Bacteria | 614 |
| 666 | Ga0157375_10040171 | 3300013308 | Bacteria | 4508 |
| 667 | Ga0157375_10070436 | 3300013308 | Bacteria | 3507 |
| 668 | Ga0157375_10123400 | 3300013308 | Bacteria | 2703 |
| 669 | Ga0157375_10133080 | 3300013308 | Bacteria | 2608 |
| 670 | Ga0157375_10169512 | 3300013308 | Bacteria | 2330 |
| 671 | Ga0157375_10269363 | 3300013308 | Bacteria | 1865 |
| 672 | Ga0157375_10330809 | 3300013308 | Bacteria | 1688 |
| 673 | Ga0157375_10728439 | 3300013308 | Bacteria | 1144 |
| 674 | Ga0163163_10298797 | 3300014325 | Bacteria | 1663 |
| 675 | Ga0163163_10354626 | 3300014325 | Bacteria | 1523 |
| 676 | Ga0157380_10030368 | 3300014326 | Bacteria | 4138 |
| 677 | Ga0157380_10046242 | 3300014326 | Bacteria | 3417 |
| 678 | Ga0157380_10056313 | 3300014326 | Bacteria | 3126 |
| 679 | Ga0157380_10215943 | 3300014326 | Bacteria | 1713 |
| 680 | Ga0157380_12505398 | 3300014326 | Bacteria | 582 |
| 681 | Ga0182008_10005592 | 3300014497 | Bacteria | 7127 |
| 682 | Ga0182008_10084545 | 3300014497 | Bacteria | 1563 |
| 683 | Ga0157377_10025247 | 3300014745 | Bacteria | 3168 |
| 684 | Ga0157377_10072944 | 3300014745 | Bacteria | 1988 |
| 685 | Ga0157377_10231286 | 3300014745 | Bacteria | 1189 |
| 686 | Ga0157377_10308259 | 3300014745 | Bacteria | 1047 |
| 687 | Ga0157377_10553269 | 3300014745 | Bacteria | 813 |
| 688 | Ga0157377_10776685 | 3300014745 | Bacteria | 704 |
| 689 | Ga0157379_10009212 | 3300014968 | Bacteria | 8597 |
| 690 | Ga0157379_10030841 | 3300014968 | Bacteria | 4774 |
| 691 | Ga0157379_10326032 | 3300014968 | Bacteria | 1402 |
| 692 | Ga0157379_10331232 | 3300014968 | Bacteria | 1391 |
| 693 | Ga0157376_10211824 | 3300014969 | Bacteria | 1789 |
| 694 | Ga0157376_10295568 | 3300014969 | Bacteria | 1531 |
| 695 | Ga0157376_11352195 | 3300014969 | Bacteria | 743 |
| 696 | Ga0157376_11524031 | 3300014969 | Bacteria | 702 |
| 697 | Ga0157376_12117430 | 3300014969 | Unclassified | 601 |
| 698 | Ga0182007_10049562 | 3300015262 | Bacteria | 1387 |
| 699 | Ga0182007_10067735 | 3300015262 | Bacteria | 1169 |
| 700 | Ga0182007_10111613 | 3300015262 | Bacteria | 910 |
| 701 | Ga0163161_10037844 | 3300017792 | Bacteria | 3458 |
| 702 | Ga0163161_10363149 | 3300017792 | Bacteria | 1154 |
| 703 | Ga0163161_10692071 | 3300017792 | Bacteria | 848 |
| 704 | Ga0206356_10783001 | 3300020070 | Bacteria | 1762 |
| 705 | Ga0206356_11270514 | 3300020070 | Bacteria | 2049 |
| 706 | Ga0206352_10325843 | 3300020078 | Bacteria | 1377 |
| 707 | Ga0206352_11174930 | 3300020078 | Bacteria | 850 |
| 708 | Ga0206353_10065830 | 3300020082 | Bacteria | 1490 |
| 709 | Ga0206353_11480673 | 3300020082 | Bacteria | 1814 |
| 710 | Ga0213876_10083566 | 3300021384 | Bacteria | 1689 |
| 711 | Ga0207697_10066728 | 3300025315 | Bacteria | 1504 |
| 712 | Ga0207682_10009572 | 3300025893 | Bacteria | 3820 |
| 713 | Ga0207682_10012840 | 3300025893 | Bacteria | 3268 |
| 714 | Ga0207692_10129111 | 3300025898 | Bacteria | 1425 |
| 715 | Ga0207692_10198757 | 3300025898 | Bacteria | 1177 |
| 716 | Ga0207692_10548282 | 3300025898 | Unclassified | 738 |
| 717 | Ga0207642_10057205 | 3300025899 | Bacteria | 1792 |
| 718 | Ga0207680_10104846 | 3300025903 | Bacteria | 1823 |
| 719 | Ga0207647_10046677 | 3300025904 | Bacteria | 2698 |
| 720 | Ga0207647_10113869 | 3300025904 | Bacteria | 1598 |
| 721 | Ga0207699_10042051 | 3300025906 | Bacteria | 2644 |
| 722 | Ga0207699_10043781 | 3300025906 | Bacteria | 2603 |
| 723 | Ga0207699_10101168 | 3300025906 | Bacteria | 1829 |
| 724 | Ga0207699_10211141 | 3300025906 | Bacteria | 1320 |
| 725 | Ga0207645_10000909 | 3300025907 | Bacteria | 24558 |
| 726 | Ga0207645_10041571 | 3300025907 | Bacteria | 2942 |
| 727 | Ga0207645_10082589 | 3300025907 | Bacteria | 2060 |
| 728 | Ga0207643_10007697 | 3300025908 | Bacteria | 5786 |
| 729 | Ga0207643_10106534 | 3300025908 | Bacteria | 1648 |
| 730 | Ga0207705_10003811 | 3300025909 | Bacteria | 11467 |
| 731 | Ga0207705_10003951 | 3300025909 | Bacteria | 11274 |
| 732 | Ga0207705_10030503 | 3300025909 | Bacteria | 3847 |
| 733 | Ga0207705_10032601 | 3300025909 | Bacteria | 3724 |
| 734 | Ga0207705_10042973 | 3300025909 | Bacteria | 3245 |
| 735 | Ga0207705_10054666 | 3300025909 | Bacteria | 2878 |
| 736 | Ga0207705_10092273 | 3300025909 | Bacteria | 2219 |
| 737 | Ga0207705_10098584 | 3300025909 | Bacteria | 2147 |
| 738 | Ga0207705_10151333 | 3300025909 | Bacteria | 1739 |
| 739 | Ga0207705_10181400 | 3300025909 | Bacteria | 1589 |
| 740 | Ga0207705_10594575 | 3300025909 | Bacteria | 860 |
| 741 | Ga0207684_10157468 | 3300025910 | Bacteria | 1955 |
| 742 | Ga0207684_10206775 | 3300025910 | Bacteria | 1693 |
| 743 | Ga0207684_10612518 | 3300025910 | Bacteria | 929 |
| 744 | Ga0207654_10014086 | 3300025911 | Bacteria | 4126 |
| 745 | Ga0207654_10016525 | 3300025911 | Bacteria | 3844 |
| 746 | Ga0207654_10055737 | 3300025911 | Bacteria | 2290 |
| 747 | Ga0207654_10087604 | 3300025911 | Bacteria | 1890 |
| 748 | Ga0207654_10235406 | 3300025911 | Bacteria | 1221 |
| 749 | Ga0207707_10004840 | 3300025912 | Bacteria | 11810 |
| 750 | Ga0207707_10007889 | 3300025912 | Bacteria | 9257 |
| 751 | Ga0207707_10009646 | 3300025912 | Bacteria | 8375 |
| 752 | Ga0207707_10010596 | 3300025912 | Bacteria | 8006 |
| 753 | Ga0207707_10017467 | 3300025912 | Bacteria | 6255 |
| 754 | Ga0207707_10052930 | 3300025912 | Bacteria | 3533 |
| 755 | Ga0207707_10072756 | 3300025912 | Bacteria | 2996 |
| 756 | Ga0207707_10080450 | 3300025912 | Bacteria | 2845 |
| 757 | Ga0207707_10086625 | 3300025912 | Bacteria | 2737 |
| 758 | Ga0207707_10109370 | 3300025912 | Bacteria | 2416 |
| 759 | Ga0207707_10197346 | 3300025912 | Bacteria | 1755 |
| 760 | Ga0207707_10212461 | 3300025912 | Bacteria | 1685 |
| 761 | Ga0207707_10217043 | 3300025912 | Bacteria | 1665 |
| 762 | Ga0207707_10231609 | 3300025912 | Bacteria | 1607 |
| 763 | Ga0207707_10551186 | 3300025912 | Bacteria | 979 |
| 764 | Ga0207707_10649299 | 3300025912 | Unclassified | 889 |
| 765 | Ga0207695_10002872 | 3300025913 | Bacteria | 24998 |
| 766 | Ga0207695_10070333 | 3300025913 | Bacteria | 3578 |
| 767 | Ga0207695_10098281 | 3300025913 | Bacteria | 2927 |
| 768 | Ga0207695_11220623 | 3300025913 | Bacteria | 632 |
| 769 | Ga0207671_10050059 | 3300025914 | Bacteria | 3093 |
| 770 | Ga0207671_10075363 | 3300025914 | Bacteria | 2523 |
| 771 | Ga0207671_10760032 | 3300025914 | Bacteria | 770 |
| 772 | Ga0207671_11100181 | 3300025914 | Bacteria | 624 |
| 773 | Ga0207693_10024434 | 3300025915 | Bacteria | 4795 |
| 774 | Ga0207693_10067286 | 3300025915 | Bacteria | 2805 |
| 775 | Ga0207693_10203837 | 3300025915 | Bacteria | 1555 |
| 776 | Ga0207663_10015456 | 3300025916 | Bacteria | 4211 |
| 777 | Ga0207663_10065283 | 3300025916 | Bacteria | 2326 |
| 778 | Ga0207663_10070815 | 3300025916 | Bacteria | 2248 |
| 779 | Ga0207663_10448449 | 3300025916 | Bacteria | 995 |
| 780 | Ga0207663_10648009 | 3300025916 | Bacteria | 833 |
| 781 | Ga0207660_10003947 | 3300025917 | Bacteria | 9667 |
| 782 | Ga0207660_10005546 | 3300025917 | Bacteria | 8196 |
| 783 | Ga0207660_10013616 | 3300025917 | Bacteria | 5333 |
| 784 | Ga0207660_10015415 | 3300025917 | Bacteria | 5044 |
| 785 | Ga0207660_10219632 | 3300025917 | Bacteria | 1491 |
| 786 | Ga0207660_10253445 | 3300025917 | Bacteria | 1389 |
| 787 | Ga0207660_10256531 | 3300025917 | Bacteria | 1381 |
| 788 | Ga0207660_10267249 | 3300025917 | Bacteria | 1354 |
| 789 | Ga0207660_10335292 | 3300025917 | Bacteria | 1210 |
| 790 | Ga0207660_10393328 | 3300025917 | Bacteria | 1116 |
| 791 | Ga0207660_10785627 | 3300025917 | Unclassified | 777 |
| 792 | Ga0207662_10000695 | 3300025918 | Bacteria | 15329 |
| 793 | Ga0207662_10025034 | 3300025918 | Bacteria | 3436 |
| 794 | Ga0207662_10065411 | 3300025918 | Bacteria | 2189 |
| 795 | Ga0207662_10128649 | 3300025918 | Bacteria | 1594 |
| 796 | Ga0207662_10400789 | 3300025918 | Bacteria | 930 |
| 797 | Ga0207657_10001221 | 3300025919 | Bacteria | 27402 |
| 798 | Ga0207657_10062853 | 3300025919 | Bacteria | 3177 |
| 799 | Ga0207657_10065284 | 3300025919 | Bacteria | 3103 |
| 800 | Ga0207657_10070109 | 3300025919 | Bacteria | 2972 |
| 801 | Ga0207657_10216093 | 3300025919 | Bacteria | 1537 |
| 802 | Ga0207649_10009969 | 3300025920 | Bacteria | 5206 |
| 803 | Ga0207649_10030909 | 3300025920 | Bacteria | 3177 |
| 804 | Ga0207649_10094406 | 3300025920 | Bacteria | 1965 |
| 805 | Ga0207649_10104596 | 3300025920 | Bacteria | 1880 |
| 806 | Ga0207649_10188036 | 3300025920 | Bacteria | 1450 |
| 807 | Ga0207649_10218226 | 3300025920 | Bacteria | 1357 |
| 808 | Ga0207649_10440212 | 3300025920 | Unclassified | 982 |
| 809 | Ga0207649_10747572 | 3300025920 | Bacteria | 761 |
| 810 | Ga0207649_11001588 | 3300025920 | Bacteria | 657 |
| 811 | Ga0207649_11042501 | 3300025920 | Bacteria | 644 |
| 812 | Ga0207649_11176478 | 3300025920 | Unclassified | 606 |
| 813 | Ga0207652_10010525 | 3300025921 | Bacteria | 7444 |
| 814 | Ga0207652_10019070 | 3300025921 | Bacteria | 5635 |
| 815 | Ga0207652_10022531 | 3300025921 | Bacteria | 5212 |
| 816 | Ga0207652_10024939 | 3300025921 | Bacteria | 4966 |
| 817 | Ga0207652_10030387 | 3300025921 | Bacteria | 4524 |
| 818 | Ga0207652_10030393 | 3300025921 | Bacteria | 4524 |
| 819 | Ga0207652_10038617 | 3300025921 | Bacteria | 4049 |
| 820 | Ga0207652_10051472 | 3300025921 | Bacteria | 3531 |
| 821 | Ga0207652_10053487 | 3300025921 | Bacteria | 3468 |
| 822 | Ga0207652_10059206 | 3300025921 | Bacteria | 3301 |
| 823 | Ga0207652_10060752 | 3300025921 | Bacteria | 3261 |
| 824 | Ga0207652_10095623 | 3300025921 | Bacteria | 2617 |
| 825 | Ga0207652_10112378 | 3300025921 | Bacteria | 2417 |
| 826 | Ga0207652_10122094 | 3300025921 | Bacteria | 2318 |
| 827 | Ga0207652_10221021 | 3300025921 | Bacteria | 1707 |
| 828 | Ga0207652_10320564 | 3300025921 | Bacteria | 1399 |
| 829 | Ga0207652_10513127 | 3300025921 | Bacteria | 1079 |
| 830 | Ga0207652_11001863 | 3300025921 | Unclassified | 734 |
| 831 | Ga0207652_11061457 | 3300025921 | Bacteria | 710 |
| 832 | Ga0207646_10036759 | 3300025922 | Bacteria | 4420 |
| 833 | Ga0207646_10387026 | 3300025922 | Bacteria | 1263 |
| 834 | Ga0207646_11374739 | 3300025922 | Unclassified | 615 |
| 835 | Ga0207681_10000921 | 3300025923 | Bacteria | 19202 |
| 836 | Ga0207681_10003904 | 3300025923 | Bacteria | 9252 |
| 837 | Ga0207681_10133321 | 3300025923 | Bacteria | 1839 |
| 838 | Ga0207694_10032019 | 3300025924 | Bacteria | 4022 |
| 839 | Ga0207694_10093377 | 3300025924 | Bacteria | 2376 |
| 840 | Ga0207694_10131681 | 3300025924 | Bacteria | 2005 |
| 841 | Ga0207694_10774552 | 3300025924 | Bacteria | 810 |
| 842 | Ga0207694_11163998 | 3300025924 | Bacteria | 653 |
| 843 | Ga0207650_10008332 | 3300025925 | Bacteria | 7076 |
| 844 | Ga0207650_10010847 | 3300025925 | Bacteria | 6262 |
| 845 | Ga0207650_10024087 | 3300025925 | Bacteria | 4323 |
| 846 | Ga0207650_10138484 | 3300025925 | Bacteria | 1911 |
| 847 | Ga0207650_10452033 | 3300025925 | Bacteria | 1069 |
| 848 | Ga0207659_10033893 | 3300025926 | Bacteria | 3517 |
| 849 | Ga0207659_10053327 | 3300025926 | Bacteria | 2884 |
| 850 | Ga0207659_10066710 | 3300025926 | Bacteria | 2612 |
| 851 | Ga0207659_10070326 | 3300025926 | Bacteria | 2552 |
| 852 | Ga0207659_10086822 | 3300025926 | Bacteria | 2327 |
| 853 | Ga0207659_10423006 | 3300025926 | Bacteria | 1118 |
| 854 | Ga0207659_10833149 | 3300025926 | Bacteria | 793 |
| 855 | Ga0207659_11403709 | 3300025926 | Unclassified | 599 |
| 856 | Ga0207687_10037121 | 3300025927 | Bacteria | 3322 |
| 857 | Ga0207687_10150311 | 3300025927 | Bacteria | 1776 |
| 858 | Ga0207687_10154144 | 3300025927 | Bacteria | 1756 |
| 859 | Ga0207687_10280132 | 3300025927 | Bacteria | 1336 |
| 860 | Ga0207700_10005401 | 3300025928 | Bacteria | 7636 |
| 861 | Ga0207700_10011785 | 3300025928 | Bacteria | 5596 |
| 862 | Ga0207700_10115511 | 3300025928 | Bacteria | 2167 |
| 863 | Ga0207700_10183149 | 3300025928 | Bacteria | 1755 |
| 864 | Ga0207664_10024119 | 3300025929 | Bacteria | 4568 |
| 865 | Ga0207664_10058055 | 3300025929 | Bacteria | 3077 |
| 866 | Ga0207664_10274609 | 3300025929 | Bacteria | 1477 |
| 867 | Ga0207644_10017509 | 3300025931 | Bacteria | 4840 |
| 868 | Ga0207644_10042676 | 3300025931 | Bacteria | 3215 |
| 869 | Ga0207644_10131979 | 3300025931 | Bacteria | 1913 |
| 870 | Ga0207644_10287457 | 3300025931 | Bacteria | 1321 |
| 871 | Ga0207644_10770691 | 3300025931 | Bacteria | 804 |
| 872 | Ga0207690_10005614 | 3300025932 | Bacteria | 7414 |
| 873 | Ga0207690_10039477 | 3300025932 | Bacteria | 3080 |
| 874 | Ga0207690_10076583 | 3300025932 | Bacteria | 2323 |
| 875 | Ga0207690_10083806 | 3300025932 | Bacteria | 2233 |
| 876 | Ga0207690_10100949 | 3300025932 | Bacteria | 2060 |
| 877 | Ga0207690_10195197 | 3300025932 | Bacteria | 1534 |
| 878 | Ga0207690_10232962 | 3300025932 | Bacteria | 1415 |
| 879 | Ga0207690_10610324 | 3300025932 | Bacteria | 891 |
| 880 | Ga0207690_11400371 | 3300025932 | Unclassified | 585 |
| 881 | Ga0207706_10002035 | 3300025933 | Bacteria | 19832 |
| 882 | Ga0207706_10021302 | 3300025933 | Bacteria | 5824 |
| 883 | Ga0207706_10058994 | 3300025933 | Bacteria | 3380 |
| 884 | Ga0207706_10078626 | 3300025933 | Bacteria | 2901 |
| 885 | Ga0207706_10191043 | 3300025933 | Bacteria | 1797 |
| 886 | Ga0207706_10222084 | 3300025933 | Bacteria | 1654 |
| 887 | Ga0207706_10286537 | 3300025933 | Bacteria | 1436 |
| 888 | Ga0207706_10506177 | 3300025933 | Bacteria | 1042 |
| 889 | Ga0207706_10530792 | 3300025933 | Bacteria | 1014 |
| 890 | Ga0207706_10792886 | 3300025933 | Bacteria | 805 |
| 891 | Ga0207686_10063591 | 3300025934 | Bacteria | 2347 |
| 892 | Ga0207686_10145758 | 3300025934 | Bacteria | 1642 |
| 893 | Ga0207686_10333273 | 3300025934 | Bacteria | 1137 |
| 894 | Ga0207709_10375504 | 3300025935 | Bacteria | 1080 |
| 895 | Ga0207709_11152533 | 3300025935 | Bacteria | 638 |
| 896 | Ga0207670_10201560 | 3300025936 | Bacteria | 1512 |
| 897 | Ga0207670_10310221 | 3300025936 | Bacteria | 1238 |
| 898 | Ga0207670_10482896 | 3300025936 | Bacteria | 1004 |
| 899 | Ga0207669_10225585 | 3300025937 | Bacteria | 1378 |
| 900 | Ga0207669_10397710 | 3300025937 | Bacteria | 1078 |
| 901 | Ga0207704_10003676 | 3300025938 | Bacteria | 6974 |
| 902 | Ga0207704_10143905 | 3300025938 | Bacteria | 1672 |
| 903 | Ga0207704_10228873 | 3300025938 | Bacteria | 1381 |
| 904 | Ga0207704_10302377 | 3300025938 | Bacteria | 1226 |
| 905 | Ga0207704_10690514 | 3300025938 | Bacteria | 844 |
| 906 | Ga0207665_10007307 | 3300025939 | Bacteria | 7307 |
| 907 | Ga0207665_10047631 | 3300025939 | Bacteria | 2875 |
| 908 | Ga0207665_10055046 | 3300025939 | Bacteria | 2683 |
| 909 | Ga0207665_10083405 | 3300025939 | Bacteria | 2204 |
| 910 | Ga0207665_10366321 | 3300025939 | Bacteria | 1091 |
| 911 | Ga0207691_10031365 | 3300025940 | Bacteria | 4961 |
| 912 | Ga0207691_10078519 | 3300025940 | Bacteria | 2971 |
| 913 | Ga0207691_10091256 | 3300025940 | Bacteria | 2730 |
| 914 | Ga0207691_10114355 | 3300025940 | Bacteria | 2398 |
| 915 | Ga0207691_10117042 | 3300025940 | Bacteria | 2365 |
| 916 | Ga0207691_10139985 | 3300025940 | Bacteria | 2133 |
| 917 | Ga0207691_10196036 | 3300025940 | Bacteria | 1760 |
| 918 | Ga0207691_10300080 | 3300025940 | Bacteria | 1380 |
| 919 | Ga0207711_10030916 | 3300025941 | Bacteria | 4517 |
| 920 | Ga0207711_10035753 | 3300025941 | Bacteria | 4212 |
| 921 | Ga0207711_10448035 | 3300025941 | Bacteria | 1202 |
| 922 | Ga0207711_10499913 | 3300025941 | Bacteria | 1133 |
| 923 | Ga0207711_10675824 | 3300025941 | Bacteria | 963 |
| 924 | Ga0207689_10002743 | 3300025942 | Bacteria | 16288 |
| 925 | Ga0207689_10004653 | 3300025942 | Bacteria | 12412 |
| 926 | Ga0207689_10115700 | 3300025942 | Bacteria | 2204 |
| 927 | Ga0207689_10650612 | 3300025942 | Bacteria | 888 |
| 928 | Ga0207661_10000283 | 3300025944 | Bacteria | 32486 |
| 929 | Ga0207661_10022845 | 3300025944 | Bacteria | 4716 |
| 930 | Ga0207661_10024896 | 3300025944 | Bacteria | 4543 |
| 931 | Ga0207661_10032109 | 3300025944 | Bacteria | 4065 |
| 932 | Ga0207661_10032571 | 3300025944 | Bacteria | 4039 |
| 933 | Ga0207661_10033441 | 3300025944 | Bacteria | 3990 |
| 934 | Ga0207661_10034228 | 3300025944 | Bacteria | 3949 |
| 935 | Ga0207661_10040186 | 3300025944 | Bacteria | 3675 |
| 936 | Ga0207661_10043331 | 3300025944 | Bacteria | 3551 |
| 937 | Ga0207661_10052340 | 3300025944 | Bacteria | 3261 |
| 938 | Ga0207661_10078935 | 3300025944 | Bacteria | 2712 |
| 939 | Ga0207661_10120202 | 3300025944 | Bacteria | 2235 |
| 940 | Ga0207661_10133091 | 3300025944 | Bacteria | 2132 |
| 941 | Ga0207661_10164939 | 3300025944 | Bacteria | 1924 |
| 942 | Ga0207661_10191767 | 3300025944 | Bacteria | 1792 |
| 943 | Ga0207661_10330196 | 3300025944 | Bacteria | 1372 |
| 944 | Ga0207661_10429027 | 3300025944 | Bacteria | 1201 |
| 945 | Ga0207661_10700213 | 3300025944 | Bacteria | 932 |
| 946 | Ga0207679_10000582 | 3300025945 | Bacteria | 24408 |
| 947 | Ga0207679_10002943 | 3300025945 | Bacteria | 10549 |
| 948 | Ga0207679_10005438 | 3300025945 | Bacteria | 7980 |
| 949 | Ga0207679_10012892 | 3300025945 | Bacteria | 5468 |
| 950 | Ga0207679_10106820 | 3300025945 | Bacteria | 2201 |
| 951 | Ga0207679_10244714 | 3300025945 | Bacteria | 1521 |
| 952 | Ga0207679_10246648 | 3300025945 | Bacteria | 1516 |
| 953 | Ga0207679_10846872 | 3300025945 | Unclassified | 835 |
| 954 | Ga0207679_10939675 | 3300025945 | Bacteria | 792 |
| 955 | Ga0207679_11024059 | 3300025945 | Unclassified | 757 |
| 956 | Ga0207679_11142734 | 3300025945 | Unclassified | 715 |
| 957 | Ga0207667_10023205 | 3300025949 | Bacteria | 6833 |
| 958 | Ga0207667_10123502 | 3300025949 | Bacteria | 2667 |
| 959 | Ga0207667_10282749 | 3300025949 | Bacteria | 1695 |
| 960 | Ga0207667_10296693 | 3300025949 | Bacteria | 1651 |
| 961 | Ga0207667_10399427 | 3300025949 | Bacteria | 1400 |
| 962 | Ga0207667_10555533 | 3300025949 | Bacteria | 1161 |
| 963 | Ga0207667_11205444 | 3300025949 | Bacteria | 736 |
| 964 | Ga0207651_10049298 | 3300025960 | Bacteria | 2852 |
| 965 | Ga0207651_10059532 | 3300025960 | Bacteria | 2646 |
| 966 | Ga0207651_10127416 | 3300025960 | Bacteria | 1942 |
| 967 | Ga0207651_10354095 | 3300025960 | Bacteria | 1237 |
| 968 | Ga0207651_10864518 | 3300025960 | Bacteria | 804 |
| 969 | Ga0207651_10956532 | 3300025960 | Bacteria | 764 |
| 970 | Ga0207651_11201331 | 3300025960 | Unclassified | 681 |
| 971 | Ga0207712_10000596 | 3300025961 | Bacteria | 28910 |
| 972 | Ga0207712_10009138 | 3300025961 | Bacteria | 6272 |
| 973 | Ga0207712_10307834 | 3300025961 | Bacteria | 1303 |
| 974 | Ga0207712_10542610 | 3300025961 | Bacteria | 999 |
| 975 | Ga0207712_10730864 | 3300025961 | Bacteria | 866 |
| 976 | Ga0207668_10002447 | 3300025972 | Bacteria | 10832 |
| 977 | Ga0207668_10057777 | 3300025972 | Bacteria | 2708 |
| 978 | Ga0207668_10780417 | 3300025972 | Bacteria | 845 |
| 979 | Ga0207640_10003334 | 3300025981 | Bacteria | 8655 |
| 980 | Ga0207640_10082778 | 3300025981 | Bacteria | 2198 |
| 981 | Ga0207640_10093505 | 3300025981 | Bacteria | 2089 |
| 982 | Ga0207640_10157883 | 3300025981 | Bacteria | 1674 |
| 983 | Ga0207658_10048536 | 3300025986 | Bacteria | 3113 |
| 984 | Ga0207658_10092199 | 3300025986 | Bacteria | 2353 |
| 985 | Ga0207658_10163877 | 3300025986 | Bacteria | 1824 |
| 986 | Ga0207658_10288807 | 3300025986 | Bacteria | 1409 |
| 987 | Ga0207658_10326477 | 3300025986 | Bacteria | 1330 |
| 988 | Ga0207658_10392764 | 3300025986 | Bacteria | 1217 |
| 989 | Ga0207658_10573601 | 3300025986 | Bacteria | 1011 |
| 990 | Ga0207658_11006515 | 3300025986 | Bacteria | 760 |
| 991 | Ga0207677_10043997 | 3300026023 | Bacteria | 2972 |
| 992 | Ga0207677_10109304 | 3300026023 | Bacteria | 2055 |
| 993 | Ga0207703_10008320 | 3300026035 | Bacteria | 8196 |
| 994 | Ga0207703_10086206 | 3300026035 | Bacteria | 2630 |
| 995 | Ga0207703_10207911 | 3300026035 | Bacteria | 1743 |
| 996 | Ga0207639_10006779 | 3300026041 | Bacteria | 7798 |
| 997 | Ga0207639_10030610 | 3300026041 | Bacteria | 3948 |
| 998 | Ga0207678_10004647 | 3300026067 | Bacteria | 12330 |
| 999 | Ga0207678_10043220 | 3300026067 | Bacteria | 3900 |
| 1000 | Ga0207678_10086730 | 3300026067 | Bacteria | 2675 |
| 1001 | Ga0207678_10311581 | 3300026067 | Bacteria | 1353 |
| 1002 | Ga0207678_10470336 | 3300026067 | Bacteria | 1094 |
| 1003 | Ga0207708_10004898 | 3300026075 | Bacteria | 9870 |
| 1004 | Ga0207708_10015391 | 3300026075 | Bacteria | 5738 |
| 1005 | Ga0207708_10230197 | 3300026075 | Bacteria | 1488 |
| 1006 | Ga0207708_10283465 | 3300026075 | Bacteria | 1343 |
| 1007 | Ga0207708_10473194 | 3300026075 | Bacteria | 1047 |
| 1008 | Ga0207708_10914246 | 3300026075 | Bacteria | 760 |
| 1009 | Ga0207708_11309569 | 3300026075 | Unclassified | 635 |
| 1010 | Ga0207702_10059273 | 3300026078 | Bacteria | 3261 |
| 1011 | Ga0207702_10066121 | 3300026078 | Bacteria | 3098 |
| 1012 | Ga0207702_10128018 | 3300026078 | Bacteria | 2282 |
| 1013 | Ga0207702_10254414 | 3300026078 | Bacteria | 1651 |
| 1014 | Ga0207702_10300475 | 3300026078 | Bacteria | 1523 |
| 1015 | Ga0207702_10362301 | 3300026078 | Bacteria | 1390 |
| 1016 | Ga0207702_10409846 | 3300026078 | Bacteria | 1309 |
| 1017 | Ga0207702_10434302 | 3300026078 | Bacteria | 1271 |
| 1018 | Ga0207641_10011831 | 3300026088 | Bacteria | 7160 |
| 1019 | Ga0207641_10051528 | 3300026088 | Bacteria | 3486 |
| 1020 | Ga0207641_10156827 | 3300026088 | Bacteria | 2066 |
| 1021 | Ga0207641_10444388 | 3300026088 | Bacteria | 1252 |
| 1022 | Ga0207641_10488199 | 3300026088 | Bacteria | 1195 |
| 1023 | Ga0207648_10050849 | 3300026089 | Bacteria | 3623 |
| 1024 | Ga0207648_10078510 | 3300026089 | Bacteria | 2879 |
| 1025 | Ga0207648_10160589 | 3300026089 | Bacteria | 1985 |
| 1026 | Ga0207648_10226026 | 3300026089 | Bacteria | 1664 |
| 1027 | Ga0207648_10280164 | 3300026089 | Bacteria | 1491 |
| 1028 | Ga0207648_10343769 | 3300026089 | Bacteria | 1344 |
| 1029 | Ga0207648_10457233 | 3300026089 | Bacteria | 1163 |
| 1030 | Ga0207648_10509219 | 3300026089 | Bacteria | 1102 |
| 1031 | Ga0207648_10770790 | 3300026089 | Bacteria | 894 |
| 1032 | Ga0207676_10003341 | 3300026095 | Bacteria | 11375 |
| 1033 | Ga0207676_10060399 | 3300026095 | Bacteria | 2998 |
| 1034 | Ga0207676_10076932 | 3300026095 | Bacteria | 2698 |
| 1035 | Ga0207676_10950945 | 3300026095 | Unclassified | 845 |
| 1036 | Ga0207674_10000393 | 3300026116 | Bacteria | 56512 |
| 1037 | Ga0207674_10037409 | 3300026116 | Bacteria | 5048 |
| 1038 | Ga0207674_10052391 | 3300026116 | Bacteria | 4162 |
| 1039 | Ga0207674_10086730 | 3300026116 | Bacteria | 3124 |
| 1040 | Ga0207674_10162014 | 3300026116 | Bacteria | 2191 |
| 1041 | Ga0207674_10162129 | 3300026116 | Bacteria | 2190 |
| 1042 | Ga0207674_10199528 | 3300026116 | Bacteria | 1950 |
| 1043 | Ga0207674_10602524 | 3300026116 | Unclassified | 1061 |
| 1044 | Ga0207674_11103797 | 3300026116 | Bacteria | 763 |
| 1045 | Ga0207675_100035125 | 3300026118 | Bacteria | 4676 |
| 1046 | Ga0207675_100066788 | 3300026118 | Bacteria | 3361 |
| 1047 | Ga0207675_100251963 | 3300026118 | Bacteria | 1709 |
| 1048 | Ga0207675_100288971 | 3300026118 | Bacteria | 1595 |
| 1049 | Ga0207683_10011631 | 3300026121 | Bacteria | 7512 |
| 1050 | Ga0207683_10065766 | 3300026121 | Bacteria | 3197 |
| 1051 | Ga0207683_10133251 | 3300026121 | Bacteria | 2236 |
| 1052 | Ga0207683_10356212 | 3300026121 | Bacteria | 1343 |
| 1053 | Ga0207683_10469575 | 3300026121 | Bacteria | 1161 |
| 1054 | Ga0207698_10003179 | 3300026142 | Bacteria | 9853 |
| 1055 | Ga0207698_10110213 | 3300026142 | Bacteria | 2305 |
| 1056 | Ga0207698_10111646 | 3300026142 | Bacteria | 2292 |
| 1057 | Ga0207698_10156911 | 3300026142 | Bacteria | 1984 |
| 1058 | Ga0207698_10205773 | 3300026142 | Bacteria | 1766 |
| 1059 | Ga0207698_10211634 | 3300026142 | Bacteria | 1745 |
| 1060 | Ga0207698_10415751 | 3300026142 | Bacteria | 1289 |
| 1061 | Ga0207698_10495048 | 3300026142 | Bacteria | 1188 |
| 1062 | Ga0207698_10576244 | 3300026142 | Bacteria | 1107 |
| 1063 | Ga0207698_11163073 | 3300026142 | Bacteria | 785 |
| 1064 | Ga0209973_1016475 | 3300027252 | Bacteria | 942 |
| 1065 | Ga0209969_1004422 | 3300027360 | Bacteria | 1966 |
| 1066 | Ga0209969_1030639 | 3300027360 | Bacteria | 822 |
| 1067 | Ga0209967_1004046 | 3300027364 | Bacteria | 1939 |
| 1068 | Ga0209981_1025450 | 3300027378 | Unclassified | 856 |
| 1069 | Ga0209996_1002715 | 3300027395 | Bacteria | 2199 |
| 1070 | Ga0209984_1001682 | 3300027424 | Bacteria | 2412 |
| 1071 | Ga0210000_1024268 | 3300027462 | Bacteria | 935 |
| 1072 | Ga0210000_1032642 | 3300027462 | Bacteria | 817 |
| 1073 | Ga0209995_1003547 | 3300027471 | Bacteria | 2484 |
| 1074 | Ga0209968_1000569 | 3300027526 | Bacteria | 5714 |
| 1075 | Ga0209968_1003722 | 3300027526 | Bacteria | 2287 |
| 1076 | Ga0209968_1005690 | 3300027526 | Bacteria | 1872 |
| 1077 | Ga0209999_1001998 | 3300027543 | Bacteria | 3558 |
| 1078 | Ga0209999_1015607 | 3300027543 | Bacteria | 1382 |
| 1079 | Ga0209970_1000622 | 3300027614 | Bacteria | 6138 |
| 1080 | Ga0209983_1002684 | 3300027665 | Bacteria | 3861 |
| 1081 | Ga0209983_1043003 | 3300027665 | Bacteria | 980 |
| 1082 | Ga0209971_1000924 | 3300027682 | Bacteria | 7567 |
| 1083 | Ga0209971_1012252 | 3300027682 | Bacteria | 2029 |
| 1084 | Ga0209966_1000766 | 3300027695 | Bacteria | 6626 |
| 1085 | Ga0209966_1018755 | 3300027695 | Bacteria | 1327 |
| 1086 | Ga0209966_1024816 | 3300027695 | Bacteria | 1187 |
| 1087 | Ga0209998_10001270 | 3300027717 | Bacteria | 6170 |
| 1088 | Ga0209998_10002526 | 3300027717 | Bacteria | 4167 |
| 1089 | Ga0209974_10000553 | 3300027876 | Bacteria | 12476 |
| 1090 | Ga0209974_10004293 | 3300027876 | Bacteria | 5081 |
| 1091 | Ga0209974_10270091 | 3300027876 | Bacteria | 644 |
| 1092 | Ga0207428_10026272 | 3300027907 | Bacteria | 4861 |
| 1093 | Ga0207428_10063585 | 3300027907 | Bacteria | 2915 |
| 1094 | Ga0207428_10302674 | 3300027907 | Bacteria | 1183 |
| 1095 | Ga0207428_10562785 | 3300027907 | Bacteria | 824 |
| 1096 | Ga0207428_10625205 | 3300027907 | Bacteria | 774 |
| 1097 | Ga0207428_10901635 | 3300027907 | Bacteria | 625 |
| 1098 | Ga0268266_10062029 | 3300028379 | Bacteria | 3225 |
| 1099 | Ga0268266_10476443 | 3300028379 | Bacteria | 1189 |
| 1100 | Ga0268265_10003125 | 3300028380 | Bacteria | 12070 |
| 1101 | Ga0268265_10004276 | 3300028380 | Bacteria | 9964 |
| 1102 | Ga0268265_10012616 | 3300028380 | Bacteria | 5730 |
| 1103 | Ga0268265_10112369 | 3300028380 | Bacteria | 2227 |
| 1104 | Ga0268265_10259200 | 3300028380 | Bacteria | 1545 |
| 1105 | Ga0268265_10699297 | 3300028380 | Bacteria | 979 |
| 1106 | Ga0268265_11221677 | 3300028380 | Bacteria | 750 |
| 1107 | Ga0268264_10108473 | 3300028381 | Bacteria | 2427 |
| 1108 | Ga0268264_10152207 | 3300028381 | Bacteria | 2075 |
| 1109 | Ga0268264_10617802 | 3300028381 | Bacteria | 1070 |
| 1110 | Ga0268264_11071362 | 3300028381 | Bacteria | 814 |
| 1111 | Ga0316182_1261896 | 3300030745 | Bacteria | 938 |
| 1112 | Ga0316182_1379587 | 3300030745 | Bacteria | 1181 |
| 1113 | Ga0316182_1386424 | 3300030745 | Bacteria | 713 |
| 1114 | Ga0265329_10045799 | 3300031242 | Bacteria | 1398 |
| 1115 | Ga0265340_10088642 | 3300031247 | Bacteria | 1449 |
| 1116 | Ga0265327_10004242 | 3300031251 | Bacteria | 12852 |
| 1117 | Ga0265316_10180769 | 3300031344 | Bacteria | 1571 |
| 1118 | Ga0307408_100002257 | 3300031548 | Bacteria | 13743 |
| 1119 | Ga0307408_100005087 | 3300031548 | Bacteria | 8821 |
| 1120 | Ga0307408_100064252 | 3300031548 | Bacteria | 2687 |
| 1121 | Ga0307408_100250678 | 3300031548 | Bacteria | 1460 |
| 1122 | Ga0307408_100517971 | 3300031548 | Bacteria | 1047 |
| 1123 | Ga0307408_100645533 | 3300031548 | Bacteria | 946 |
| 1124 | Ga0307408_101457208 | 3300031548 | Bacteria | 646 |
| 1125 | Ga0307408_101821817 | 3300031548 | Bacteria | 582 |
| 1126 | Ga0265314_10003494 | 3300031711 | Bacteria | 15169 |
| 1127 | Ga0265314_10032497 | 3300031711 | Bacteria | 3838 |
| 1128 | Ga0307405_10000393 | 3300031731 | Bacteria | 16379 |
| 1129 | Ga0307405_10013731 | 3300031731 | Bacteria | 4328 |
| 1130 | Ga0307405_10068958 | 3300031731 | Bacteria | 2265 |
| 1131 | Ga0307405_10112556 | 3300031731 | Bacteria | 1847 |
| 1132 | Ga0307405_10116031 | 3300031731 | Bacteria | 1823 |
| 1133 | Ga0307405_10134272 | 3300031731 | Bacteria | 1715 |
| 1134 | Ga0307405_10326055 | 3300031731 | Bacteria | 1175 |
| 1135 | Ga0307405_10462222 | 3300031731 | Bacteria | 1009 |
| 1136 | Ga0307405_11039212 | 3300031731 | Bacteria | 701 |
| 1137 | Ga0307413_10002711 | 3300031824 | Bacteria | 7264 |
| 1138 | Ga0307413_10018606 | 3300031824 | Bacteria | 3650 |
| 1139 | Ga0307413_10025417 | 3300031824 | Bacteria | 3246 |
| 1140 | Ga0307413_10035504 | 3300031824 | Bacteria | 2860 |
| 1141 | Ga0307413_10131137 | 3300031824 | Bacteria | 1716 |
| 1142 | Ga0307413_10336426 | 3300031824 | Bacteria | 1159 |
| 1143 | Ga0307413_10538509 | 3300031824 | Bacteria | 945 |
| 1144 | Ga0307410_10009624 | 3300031852 | Bacteria | 5433 |
| 1145 | Ga0307410_10012945 | 3300031852 | Bacteria | 4846 |
| 1146 | Ga0307410_10028873 | 3300031852 | Bacteria | 3524 |
| 1147 | Ga0307410_10120218 | 3300031852 | Bacteria | 1914 |
| 1148 | Ga0307410_10203073 | 3300031852 | Bacteria | 1514 |
| 1149 | Ga0307410_10213940 | 3300031852 | Bacteria | 1478 |
| 1150 | Ga0307410_10351161 | 3300031852 | Bacteria | 1178 |
| 1151 | Ga0307410_10368859 | 3300031852 | Bacteria | 1152 |
| 1152 | Ga0307410_10397097 | 3300031852 | Bacteria | 1113 |
| 1153 | Ga0307410_10465426 | 3300031852 | Bacteria | 1034 |
| 1154 | Ga0307410_10741337 | 3300031852 | Unclassified | 831 |
| 1155 | Ga0307410_11404178 | 3300031852 | Bacteria | 613 |
| 1156 | Ga0307406_10002236 | 3300031901 | Bacteria | 10539 |
| 1157 | Ga0307406_10002275 | 3300031901 | Bacteria | 10446 |
| 1158 | Ga0307406_10031805 | 3300031901 | Bacteria | 3216 |
| 1159 | Ga0307406_10038979 | 3300031901 | Bacteria | 2944 |
| 1160 | Ga0307406_10086657 | 3300031901 | Bacteria | 2097 |
| 1161 | Ga0307406_10112385 | 3300031901 | Bacteria | 1878 |
| 1162 | Ga0307406_10441163 | 3300031901 | Bacteria | 1042 |
| 1163 | Ga0307406_10604777 | 3300031901 | Bacteria | 904 |
| 1164 | Ga0307406_10827485 | 3300031901 | Bacteria | 783 |
| 1165 | Ga0307406_11068608 | 3300031901 | Bacteria | 695 |
| 1166 | Ga0307406_11098349 | 3300031901 | Bacteria | 687 |
| 1167 | Ga0307406_11202909 | 3300031901 | Unclassified | 658 |
| 1168 | Ga0307407_10002439 | 3300031903 | Bacteria | 7282 |
| 1169 | Ga0307407_10008217 | 3300031903 | Bacteria | 4776 |
| 1170 | Ga0307407_10025879 | 3300031903 | Bacteria | 3099 |
| 1171 | Ga0307407_10026314 | 3300031903 | Bacteria | 3078 |
| 1172 | Ga0307407_10056184 | 3300031903 | Bacteria | 2277 |
| 1173 | Ga0307407_10100259 | 3300031903 | Bacteria | 1796 |
| 1174 | Ga0307407_10116140 | 3300031903 | Bacteria | 1688 |
| 1175 | Ga0307407_10214253 | 3300031903 | Bacteria | 1298 |
| 1176 | Ga0307407_10264661 | 3300031903 | Bacteria | 1184 |
| 1177 | Ga0307412_10061115 | 3300031911 | Bacteria | 2531 |
| 1178 | Ga0307412_10106474 | 3300031911 | Bacteria | 1994 |
| 1179 | Ga0307412_10110574 | 3300031911 | Bacteria | 1961 |
| 1180 | Ga0307412_10430971 | 3300031911 | Bacteria | 1081 |
| 1181 | Ga0307412_10776448 | 3300031911 | Bacteria | 829 |
| 1182 | Ga0307409_100007004 | 3300031995 | Bacteria | 6699 |
| 1183 | Ga0307409_100013524 | 3300031995 | Bacteria | 5257 |
| 1184 | Ga0307409_100033936 | 3300031995 | Bacteria | 3720 |
| 1185 | Ga0307409_100053133 | 3300031995 | Bacteria | 3111 |
| 1186 | Ga0307409_100079698 | 3300031995 | Bacteria | 2640 |
| 1187 | Ga0307409_100088383 | 3300031995 | Bacteria | 2529 |
| 1188 | Ga0307409_100310418 | 3300031995 | Bacteria | 1471 |
| 1189 | Ga0307409_100798589 | 3300031995 | Bacteria | 951 |
| 1190 | Ga0307416_100001410 | 3300032002 | Bacteria | 13026 |
| 1191 | Ga0307416_100004575 | 3300032002 | Bacteria | 8362 |
| 1192 | Ga0307416_100077891 | 3300032002 | Bacteria | 2786 |
| 1193 | Ga0307416_100086493 | 3300032002 | Bacteria | 2672 |
| 1194 | Ga0307416_100106648 | 3300032002 | Bacteria | 2456 |
| 1195 | Ga0307416_100148020 | 3300032002 | Bacteria | 2148 |
| 1196 | Ga0307416_100169464 | 3300032002 | Bacteria | 2030 |
| 1197 | Ga0307416_100505078 | 3300032002 | Bacteria | 1274 |
| 1198 | Ga0307416_100557524 | 3300032002 | Bacteria | 1220 |
| 1199 | Ga0307416_100640730 | 3300032002 | Bacteria | 1146 |
| 1200 | Ga0307416_100748296 | 3300032002 | Bacteria | 1070 |
| 1201 | Ga0307416_101028054 | 3300032002 | Bacteria | 927 |
| 1202 | Ga0307416_101279839 | 3300032002 | Bacteria | 839 |
| 1203 | Ga0307414_10021292 | 3300032004 | Bacteria | 4064 |
| 1204 | Ga0307414_10029119 | 3300032004 | Bacteria | 3590 |
| 1205 | Ga0307414_10101375 | 3300032004 | Bacteria | 2167 |
| 1206 | Ga0307414_10169550 | 3300032004 | Bacteria | 1743 |
| 1207 | Ga0307414_10170092 | 3300032004 | Bacteria | 1741 |
| 1208 | Ga0307414_11111437 | 3300032004 | Bacteria | 730 |
| 1209 | Ga0307411_10006203 | 3300032005 | Bacteria | 5956 |
| 1210 | Ga0307411_10007886 | 3300032005 | Bacteria | 5469 |
| 1211 | Ga0307411_10018407 | 3300032005 | Bacteria | 4005 |
| 1212 | Ga0307411_10039445 | 3300032005 | Bacteria | 2987 |
| 1213 | Ga0307411_10057273 | 3300032005 | Bacteria | 2573 |
| 1214 | Ga0307411_10238532 | 3300032005 | Bacteria | 1422 |
| 1215 | Ga0307411_10245593 | 3300032005 | Bacteria | 1404 |
| 1216 | Ga0307411_10250612 | 3300032005 | Bacteria | 1392 |
| 1217 | Ga0307411_10418317 | 3300032005 | Bacteria | 1113 |
| 1218 | Ga0307415_100008524 | 3300032126 | Bacteria | 5689 |
| 1219 | Ga0307415_100008871 | 3300032126 | Bacteria | 5601 |
| 1220 | Ga0307415_100121793 | 3300032126 | Bacteria | 1957 |
| 1221 | Ga0307415_100123143 | 3300032126 | Bacteria | 1948 |
| 1222 | Ga0307415_100164995 | 3300032126 | Bacteria | 1721 |
| 1223 | Ga0307415_100176560 | 3300032126 | Bacteria | 1671 |
| 1224 | Ga0307415_100511153 | 3300032126 | Bacteria | 1052 |
| 1225 | Ga0307415_100608132 | 3300032126 | Bacteria | 974 |
| 1226 | Ga0307415_100724967 | 3300032126 | Bacteria | 900 |
| 1227 | Ga0307415_101587937 | 3300032126 | Bacteria | 628 |
| 1228 | Ga0307415_101744109 | 3300032126 | Unclassified | 601 |
| 1229 | Ga0373948_0011529 | 3300034817 | Bacteria | 1565 |
| 1230 | Ga0373958_0025875 | 3300034819 | Bacteria | 1120 |
| 1231 | Ga0373958_0031089 | 3300034819 | Bacteria | 1047 |
| 1232 | Ga0373959_0003885 | 3300034820 | Bacteria | 2391 |
| 1233 | Ga0373926_0004875 | 3300035083 | Bacteria | 4410 |
| 1234 | Ga0373929_0014598 | 3300035085 | Bacteria | 1520 |
| 1235 | Ga0373934_0001950 | 3300035086 | Bacteria | 7563 |
| 1236 | Ga0373934_0017874 | 3300035086 | Bacteria | 2709 |
| 1237 | Ga0373940_0043179 | 3300035088 | Bacteria | 1245 |
| 1238 | Ga0373940_0044261 | 3300035088 | Bacteria | 1233 |
| 1239 | Ga0373944_0247503 | 3300035089 | Bacteria | 657 |
| 1240 | Ga0373949_0019486 | 3300035090 | Bacteria | 1546 |
| 1241 | Ga0373952_0035326 | 3300035092 | Bacteria | 1131 |
| 1242 | Ga0373952_0113436 | 3300035092 | Unclassified | 728 |
| 1243 | Ga0373923_0052282 | 3300035111 | Bacteria | 1716 |
| 1244 | Ga0373939_0004065 | 3300035114 | Bacteria | 3446 |
| 1245 | Ga0373939_0104699 | 3300035114 | Bacteria | 976 |
| 1246 | Ga0373941_0004689 | 3300035115 | Bacteria | 3175 |
| 1247 | Ga0373941_0040016 | 3300035115 | Bacteria | 1444 |
| 1248 | Ga0373945_0008197 | 3300035116 | Bacteria | 3398 |
| 1249 | Ga0373945_0010977 | 3300035116 | Bacteria | 2989 |
| 1250 | Ga0373953_0012022 | 3300035117 | Bacteria | 3055 |
| 1251 | Ga0373953_0171740 | 3300035117 | Bacteria | 933 |
| 1252 | Ga0373954_0032792 | 3300035118 | Bacteria | 2402 |
| 1253 | Ga0373957_0007100 | 3300035120 | Bacteria | 3566 |
| 1254 | Ga0373957_0270146 | 3300035120 | Bacteria | 718 |
| 1255 | Ga0373960_0013130 | 3300035121 | Bacteria | 2072 |
| 1256 | Ga0373960_0055009 | 3300035121 | Bacteria | 1192 |
| 1257 | Ga0373960_0072608 | 3300035121 | Bacteria | 1067 |
| 1258 | Ga0373943_0002422 | 3300035170 | Bacteria | 8464 |
| 1259 | Ga0373946_0002485 | 3300035171 | Bacteria | 6507 |
| 1260 | Ga0373955_0001621 | 3300035172 | Bacteria | 9637 |
| 1261 | Ga0373955_0010972 | 3300035172 | Bacteria | 4301 |
| 1262 | Ga0373955_0239824 | 3300035172 | Bacteria | 1086 |
| 1263 | Ga0373942_0012467 | 3300035207 | Bacteria | 2031 |
| 1264 | Ga0373961_0042255 | 3300035241 | Bacteria | 1321 |
| 1265 | Ga0373961_0049360 | 3300035241 | Bacteria | 1243 |
| 1266 | Ga0373961_0050034 | 3300035241 | Bacteria | 1237 |
| 1267 | Ga0373961_0081022 | 3300035241 | Bacteria | 1021 |
| 1268 | Ga0373962_0040324 | 3300035242 | Bacteria | 1313 |
| 1269 | Ga0373924_0046941 | 3300035410 | Bacteria | 1781 |
| 1270 | Ga0373931_0010909 | 3300035691 | Bacteria | 4375 |
| 1271 | Ga0373931_0848899 | 3300035691 | Unclassified | 611 |
| 1272 | Ga0373935_0001207 | 3300035692 | Bacteria | 14241 |
| 1273 | Ga0373935_0160633 | 3300035692 | Bacteria | 1531 |
| 1274 | Ga0373935_0209603 | 3300035692 | Bacteria | 1350 |
| 1275 | Ga0373935_0293890 | 3300035692 | Bacteria | 1147 |
| 1276 | Ga0373935_0319523 | 3300035692 | Bacteria | 1101 |
| 1277 | Ga0373927_0012867 | 3300035695 | Bacteria | 5563 |
| 1278 | Ga0373927_0024739 | 3300035695 | Bacteria | 3923 |
| 1279 | Ga0373927_0133583 | 3300035695 | Bacteria | 1621 |
| 1280 | Ga0373927_0241346 | 3300035695 | Bacteria | 1187 |
| 1281 | Ga0373927_0295112 | 3300035695 | Bacteria | 1067 |
| 1282 | Ga0373933_0071250 | 3300035724 | Bacteria | 2115 |
| 1283 | Ga0373947_0000036 | 3300035725 | Bacteria | 64977 |
| 1284 | Ga0373937_0028903 | 3300036401 | Bacteria | 5020 |
| 1285 | Ga0373937_0030183 | 3300036401 | Bacteria | 4910 |
| 1286 | Ga0373937_0294252 | 3300036401 | Bacteria | 1534 |
| 1287 | Ga0373937_0349015 | 3300036401 | Bacteria | 1401 |
| 1288 | Ga0373937_1405769 | 3300036401 | Bacteria | 645 |
| 1289 | Ga0373925_0002900 | 3300037068 | Bacteria | 13548 |
| 1290 | Ga0373925_0079107 | 3300037068 | Bacteria | 2497 |
| 1291 | Ga0395899_0024945 | 3300037312 | Bacteria | 4516 |
| 1292 | Ga0395899_0252138 | 3300037312 | Bacteria | 1211 |
| 1293 | Ga0395900_0018069 | 3300037418 | Bacteria | 7198 |
| 1294 | Ga0395898_0092700 | 3300037466 | Bacteria | 2905 |
| 1295 | Ga0395898_1325841 | 3300037466 | Bacteria | 649 |
| 1296 | Ga0395905_0024022 | 3300037471 | Bacteria | 5753 |
| 1297 | Ga0395905_0518557 | 3300037471 | Bacteria | 1092 |
| 1298 | Ga0395905_1111444 | 3300037471 | Bacteria | 694 |
| 1299 | Ga0436364_1341442 | 3300037853 | Bacteria | 902 |
| 1300 | Ga0395901_0013649 | 3300038443 | Bacteria | 8258 |
| 1301 | Ga0395901_0433913 | 3300038443 | Bacteria | 1346 |
| 1302 | Ga0395901_0971620 | 3300038443 | Bacteria | 827 |
| 1303 | Ga0436365_0453863 | 3300039437 | Bacteria | 6719 |
| 1304 | Ga0436365_0527755 | 3300039437 | Bacteria | 984 |
| 1305 | Ga0436365_1474633 | 3300039437 | Bacteria | 818 |
| 1306 | Ga0436363_1364797 | 3300039450 | Bacteria | 651 |
| 1307 | Ga0439439_0048612 | 3300041406 | Bacteria | 1110 |
| 1308 | Ga0439439_0056597 | 3300041406 | Bacteria | 1036 |
| 1309 | Ga0439461_0106727 | 3300041410 | Unclassified | 687 |
| 1310 | Ga0451849_0697007 | 3300041505 | Bacteria | 666 |
| 1311 | Ga0439433_0045714 | 3300041999 | Bacteria | 1025 |
| 1312 | Ga0439448_0165838 | 3300042005 | Bacteria | 770 |
| 1313 | Ga0439432_112596 | 3300042006 | Bacteria | 809 |
| 1314 | Ga0439449_0137510 | 3300042007 | Bacteria | 909 |
| 1315 | Ga0439457_077101 | 3300042014 | Bacteria | 764 |
| 1316 | Ga0450914_038316 | 3300042118 | Bacteria | 601 |
| 1317 | Ga0439434_0045677 | 3300042435 | Bacteria | 1351 |
| 1318 | Ga0439464_0014107 | 3300042439 | Bacteria | 2146 |
| 1319 | Ga0450918_048213 | 3300042531 | Unclassified | 773 |
| 1320 | Ga0451577_0052812 | 3300042876 | Bacteria | 3629 |
| 1321 | Ga0451577_0061827 | 3300042876 | Bacteria | 3339 |
| 1322 | Ga0451577_0272209 | 3300042876 | Bacteria | 1534 |
| 1323 | Ga0453683_0422606 | 3300044673 | Bacteria | 860 |
| 1324 | Ga0453683_1051357 | 3300044673 | Unclassified | 542 |
| 1325 | Ga0466965_0367195 | 3300044683 | Bacteria | 791 |
| 1326 | Ga0466966_0002321 | 3300044684 | Bacteria | 12398 |
| 1327 | Ga0466966_0405162 | 3300044684 | Bacteria | 820 |
| 1328 | Ga0466961_0193427 | 3300044693 | Bacteria | 1260 |
| 1329 | Ga0466961_0252437 | 3300044693 | Bacteria | 1083 |
| 1330 | Ga0453684_0007935 | 3300044712 | Bacteria | 19255 |
| 1331 | Ga0453684_0680474 | 3300044712 | Bacteria | 1120 |
| 1332 | Ga0466959_0083014 | 3300045049 | Bacteria | 2308 |
| 1333 | Ga0466959_0102056 | 3300045049 | Bacteria | 2053 |
| 1334 | Ga0466959_0159260 | 3300045049 | Bacteria | 1588 |
| 1335 | Ga0451576_0055578 | 3300045051 | Bacteria | 4141 |
| 1336 | Ga0451576_0299384 | 3300045051 | Bacteria | 1682 |
| 1337 | Ga0451576_0394688 | 3300045051 | Bacteria | 1450 |
| 1338 | Ga0451576_0646029 | 3300045051 | Bacteria | 1112 |
| 1339 | Ga0466958_0320546 | 3300045836 | Bacteria | 996 |
| 1340 | Ga0466967_0016772 | 3300045976 | Bacteria | 5789 |
| 1341 | Ga0466967_0197468 | 3300045976 | Bacteria | 1904 |
| 1342 | Ga0495592_0059098 | 3300046454 | Bacteria | 2825 |
| 1343 | Ga0495592_0090958 | 3300046454 | Bacteria | 2189 |
| 1344 | Ga0495603_0000774 | 3300046455 | Bacteria | 18264 |
| 1345 | Ga0495603_0061064 | 3300046455 | Bacteria | 2226 |
| 1346 | Ga0495603_0391216 | 3300046455 | Bacteria | 797 |
| 1347 | Ga0495629_0025246 | 3300046459 | Bacteria | 4226 |
| 1348 | Ga0495629_0046147 | 3300046459 | Bacteria | 3056 |
| 1349 | Ga0495629_0051921 | 3300046459 | Bacteria | 2869 |
| 1350 | Ga0495629_0129738 | 3300046459 | Bacteria | 1756 |
| 1351 | Ga0495629_0135653 | 3300046459 | Bacteria | 1713 |
| 1352 | Ga0495651_0007272 | 3300046462 | Bacteria | 8463 |
| 1353 | Ga0495653_0026336 | 3300046463 | Bacteria | 4664 |
| 1354 | Ga0495653_0190493 | 3300046463 | Bacteria | 1400 |
| 1355 | Ga0495580_0000048 | 3300046472 | Bacteria | 68571 |
| 1356 | Ga0495580_0005246 | 3300046472 | Bacteria | 10769 |
| 1357 | Ga0495580_0251168 | 3300046472 | Bacteria | 1211 |
| 1358 | Ga0495580_0317252 | 3300046472 | Bacteria | 1059 |
| 1359 | Ga0495580_0603293 | 3300046472 | Bacteria | 725 |
| 1360 | Ga0495582_0000179 | 3300046473 | Bacteria | 34488 |
| 1361 | Ga0495582_0089405 | 3300046473 | Bacteria | 1716 |
| 1362 | Ga0495582_0190051 | 3300046473 | Bacteria | 1171 |
| 1363 | Ga0495582_0190118 | 3300046473 | Bacteria | 1171 |
| 1364 | Ga0495639_0000917 | 3300046475 | Bacteria | 13315 |
| 1365 | Ga0495639_0025267 | 3300046475 | Bacteria | 2619 |
| 1366 | Ga0495639_0124255 | 3300046475 | Bacteria | 1232 |
| 1367 | Ga0495639_0128318 | 3300046475 | Bacteria | 1213 |
| 1368 | Ga0495639_0153678 | 3300046475 | Bacteria | 1111 |
| 1369 | Ga0495662_0045613 | 3300046476 | Bacteria | 2116 |
| 1370 | Ga0495662_0148930 | 3300046476 | Bacteria | 1152 |
| 1371 | Ga0495664_0052972 | 3300046477 | Bacteria | 2413 |
| 1372 | Ga0495664_0065508 | 3300046477 | Bacteria | 2166 |
| 1373 | Ga0495664_0119664 | 3300046477 | Bacteria | 1593 |
| 1374 | Ga0495664_0200678 | 3300046477 | Bacteria | 1209 |
| 1375 | Ga0495585_0484234 | 3300046492 | Bacteria | 589 |
| 1376 | Ga0495594_0023704 | 3300046499 | Bacteria | 3290 |
| 1377 | Ga0495594_0050634 | 3300046499 | Bacteria | 2285 |
| 1378 | Ga0495594_0056042 | 3300046499 | Bacteria | 2174 |
| 1379 | Ga0495594_0082577 | 3300046499 | Bacteria | 1795 |
| 1380 | Ga0495594_0150217 | 3300046499 | Bacteria | 1322 |
| 1381 | Ga0495596_0059166 | 3300046500 | Bacteria | 1494 |
| 1382 | Ga0495608_0031708 | 3300046511 | Bacteria | 3572 |
| 1383 | Ga0495618_0288660 | 3300046514 | Bacteria | 1021 |
| 1384 | Ga0495620_0049369 | 3300046515 | Bacteria | 1801 |
| 1385 | Ga0495628_0101738 | 3300046516 | Bacteria | 2217 |
| 1386 | Ga0495628_0149404 | 3300046516 | Bacteria | 1780 |
| 1387 | Ga0495628_0180853 | 3300046516 | Bacteria | 1595 |
| 1388 | Ga0495628_0499176 | 3300046516 | Bacteria | 879 |
| 1389 | Ga0495630_0004558 | 3300046517 | Bacteria | 9711 |
| 1390 | Ga0495630_0085911 | 3300046517 | Bacteria | 2375 |
| 1391 | Ga0495630_0188289 | 3300046517 | Bacteria | 1574 |
| 1392 | Ga0495631_0265938 | 3300046518 | Bacteria | 731 |
| 1393 | Ga0495644_0121267 | 3300046523 | Bacteria | 995 |
| 1394 | Ga0495666_0036458 | 3300046526 | Bacteria | 2395 |
| 1395 | Ga0495642_0091528 | 3300046528 | Bacteria | 1288 |
| 1396 | Ga0495642_0251978 | 3300046528 | Bacteria | 772 |
| 1397 | Ga0495652_0075969 | 3300046529 | Bacteria | 2788 |
| 1398 | Ga0495652_0108848 | 3300046529 | Bacteria | 2232 |
| 1399 | Ga0495665_0000002 | 3300046531 | Bacteria | 128983 |
| 1400 | Ga0495665_0037940 | 3300046531 | Bacteria | 2570 |
| 1401 | Ga0495665_0044551 | 3300046531 | Bacteria | 2357 |
| 1402 | Ga0495665_0104079 | 3300046531 | Bacteria | 1489 |
| 1403 | Ga0495665_0195919 | 3300046531 | Bacteria | 1048 |
| 1404 | Ga0495665_0228634 | 3300046531 | Bacteria | 961 |
| 1405 | Ga0495640_0045556 | 3300046533 | Bacteria | 3043 |
| 1406 | Ga0495640_0521255 | 3300046533 | Unclassified | 722 |
| 1407 | Ga0495586_0075598 | 3300046535 | Bacteria | 1844 |
| 1408 | Ga0495586_0239426 | 3300046535 | Bacteria | 1034 |
| 1409 | Ga0495587_0009315 | 3300046536 | Bacteria | 6297 |
| 1410 | Ga0495587_0020967 | 3300046536 | Bacteria | 4031 |
| 1411 | Ga0495587_0071142 | 3300046536 | Bacteria | 2023 |
| 1412 | Ga0495587_0307965 | 3300046536 | Bacteria | 885 |
| 1413 | Ga0495598_0188507 | 3300046537 | Bacteria | 739 |
| 1414 | Ga0495621_0257239 | 3300046539 | Bacteria | 714 |
| 1415 | Ga0495645_0004375 | 3300046543 | Bacteria | 9647 |
| 1416 | Ga0495645_0144276 | 3300046543 | Bacteria | 1658 |
| 1417 | Ga0495645_0182107 | 3300046543 | Bacteria | 1438 |
| 1418 | Ga0495622_0104163 | 3300046557 | Bacteria | 1300 |
| 1419 | Ga0495667_0012198 | 3300046559 | Bacteria | 5821 |
| 1420 | Ga0495667_0012237 | 3300046559 | Bacteria | 5814 |
| 1421 | Ga0495667_0096831 | 3300046559 | Bacteria | 1910 |
| 1422 | Ga0495667_0202194 | 3300046559 | Bacteria | 1271 |
| 1423 | Ga0495667_0476114 | 3300046559 | Unclassified | 783 |
| 1424 | Ga0495634_0078582 | 3300046642 | Bacteria | 2161 |
| 1425 | Ga0495634_0085652 | 3300046642 | Bacteria | 2053 |
| 1426 | Ga0495634_0135824 | 3300046642 | Bacteria | 1565 |
| 1427 | Ga0495635_0073192 | 3300046663 | Bacteria | 2347 |
| 1428 | Ga0495635_0200298 | 3300046663 | Bacteria | 1354 |
| 1429 | Ga0495635_0238196 | 3300046663 | Bacteria | 1228 |
| 1430 | Ga0495659_0168281 | 3300046664 | Bacteria | 888 |
| 1431 | Ga0495659_0337323 | 3300046664 | Bacteria | 642 |
| 1432 | Ga0495588_0000464 | 3300046674 | Bacteria | 20343 |
| 1433 | Ga0495588_0200108 | 3300046674 | Bacteria | 1055 |
| 1434 | Ga0495588_0462174 | 3300046674 | Bacteria | 666 |
| 1435 | Ga0495588_0660673 | 3300046674 | Bacteria | 547 |
| 1436 | Ga0495657_0007724 | 3300046675 | Bacteria | 8274 |
| 1437 | Ga0495657_0353614 | 3300046675 | Bacteria | 869 |
| 1438 | Ga0495599_0017331 | 3300046678 | Bacteria | 4477 |
| 1439 | Ga0495599_0022659 | 3300046678 | Bacteria | 3922 |
| 1440 | Ga0495599_0060889 | 3300046678 | Bacteria | 2360 |
| 1441 | Ga0495623_0009437 | 3300046679 | Bacteria | 6334 |
| 1442 | Ga0495623_0019422 | 3300046679 | Bacteria | 4393 |
| 1443 | Ga0495623_0116001 | 3300046679 | Bacteria | 1618 |
| 1444 | Ga0495658_0000017 | 3300046683 | Bacteria | 93346 |
| 1445 | Ga0495658_0034200 | 3300046683 | Bacteria | 2787 |
| 1446 | Ga0495658_0085320 | 3300046683 | Bacteria | 1861 |
| 1447 | Ga0495658_0088542 | 3300046683 | Bacteria | 1830 |
| 1448 | Ga0495669_0162868 | 3300046684 | Bacteria | 1059 |
| 1449 | Ga0495669_0295436 | 3300046684 | Bacteria | 780 |
| 1450 | Ga0495613_0024110 | 3300046689 | Bacteria | 4534 |
| 1451 | Ga0495613_0095423 | 3300046689 | Bacteria | 2151 |
| 1452 | Ga0495613_0264410 | 3300046689 | Bacteria | 1197 |
| 1453 | Ga0495613_0272776 | 3300046689 | Bacteria | 1176 |
| 1454 | Ga0495670_0152555 | 3300046691 | Bacteria | 1212 |
| 1455 | Ga0495600_0030035 | 3300046809 | Bacteria | 3520 |
| 1456 | Ga0495600_0068897 | 3300046809 | Bacteria | 2312 |
| 1457 | Ga0495600_0373586 | 3300046809 | Unclassified | 890 |
| 1458 | Ga0495581_0000312 | 3300047315 | Bacteria | 23854 |
| 1459 | Ga0495581_0015316 | 3300047315 | Bacteria | 4452 |
| 1460 | Ga0495581_0155211 | 3300047315 | Bacteria | 1338 |
| 1461 | Ga0495581_0426975 | 3300047315 | Bacteria | 772 |
| 1462 | Ga0495604_0034670 | 3300047317 | Bacteria | 3992 |
| 1463 | Ga0495604_0169824 | 3300047317 | Bacteria | 1535 |
| 1464 | Ga0495604_0261367 | 3300047317 | Bacteria | 1176 |
| 1465 | Ga0495604_0379121 | 3300047317 | Bacteria | 935 |
| 1466 | Ga0495636_0181890 | 3300047318 | Bacteria | 954 |
| 1467 | Ga0495674_0024914 | 3300047319 | Bacteria | 5491 |
| 1468 | Ga0495674_0092120 | 3300047319 | Bacteria | 2588 |
| 1469 | Ga0495674_0174987 | 3300047319 | Bacteria | 1789 |
| 1470 | Ga0495672_0003004 | 3300047320 | Bacteria | 14831 |
| 1471 | Ga0495676_0120349 | 3300047321 | Bacteria | 1911 |
| 1472 | Ga0495680_0091173 | 3300047322 | Bacteria | 2285 |
| 1473 | Ga0495680_0197314 | 3300047322 | Bacteria | 1445 |
| 1474 | Ga0495680_0314323 | 3300047322 | Bacteria | 1097 |
| 1475 | Ga0495675_0026681 | 3300047444 | Bacteria | 3683 |
| 1476 | Ga0495675_0114593 | 3300047444 | Bacteria | 1681 |
| 1477 | Ga0495675_0173492 | 3300047444 | Bacteria | 1323 |
| 1478 | Ga0495675_0192174 | 3300047444 | Bacteria | 1245 |
| 1479 | Ga0495677_0054921 | 3300047445 | Bacteria | 1470 |
| 1480 | Ga0495677_0127135 | 3300047445 | Bacteria | 974 |
| 1481 | Ga0495685_079177 | 3300047447 | Bacteria | 1095 |
| 1482 | Ga0495681_0169572 | 3300047470 | Bacteria | 904 |
| 1483 | Ga0495684_0010619 | 3300047471 | Bacteria | 7118 |
| 1484 | Ga0495684_0051096 | 3300047471 | Bacteria | 3155 |
| 1485 | Ga0495684_0170599 | 3300047471 | Bacteria | 1618 |
| 1486 | Ga0495593_0000009 | 3300047673 | Bacteria | 85608 |
| 1487 | Ga0495593_0225905 | 3300047673 | Bacteria | 939 |
| 1488 | Ga0495593_0253689 | 3300047673 | Bacteria | 881 |
| 1489 | Ga0495602_0139637 | 3300048088 | Bacteria | 1919 |
| 1490 | Ga0495602_0391914 | 3300048088 | Bacteria | 992 |
| 1491 | Ga0495614_0000005 | 3300048089 | Bacteria | 74692 |
| 1492 | Ga0495614_0080470 | 3300048089 | Bacteria | 1411 |
| 1493 | Ga0495614_0104335 | 3300048089 | Bacteria | 1242 |
| 1494 | Ga0495615_0004404 | 3300048090 | Bacteria | 2457 |
| 1495 | Ga0496100_0051928 | 3300048903 | Bacteria | 2663 |
| 1496 | Ga0496102_0045307 | 3300048905 | Bacteria | 3993 |
| 1497 | Ga0496102_0372073 | 3300048905 | Bacteria | 1345 |
| 1498 | Ga0496103_0063254 | 3300048906 | Bacteria | 2305 |
| 1499 | Ga0496104_0035477 | 3300048907 | Bacteria | 4656 |
| 1500 | Ga0496104_0188251 | 3300048907 | Bacteria | 1975 |
| 1501 | Ga0496105_0034848 | 3300048908 | Bacteria | 4142 |
| 1502 | Ga0496105_0481339 | 3300048908 | Bacteria | 976 |
| 1503 | Ga0496106_0092000 | 3300048909 | Bacteria | 2342 |
| 1504 | Ga0496106_0098435 | 3300048909 | Bacteria | 2266 |
| 1505 | Ga0496107_0096470 | 3300048910 | Bacteria | 2164 |
| 1506 | Ga0496107_0638516 | 3300048910 | Unclassified | 785 |
| 1507 | Ga0496108_0138948 | 3300048911 | Bacteria | 2092 |
| 1508 | Ga0496108_0515253 | 3300048911 | Bacteria | 1044 |
| 1509 | Ga0496109_0062007 | 3300048912 | Bacteria | 3419 |
| 1510 | Ga0496109_0213158 | 3300048912 | Bacteria | 1816 |
| 1511 | Ga0496110_0131572 | 3300048913 | Bacteria | 2260 |
| 1512 | Ga0496110_0331004 | 3300048913 | Bacteria | 1387 |
| 1513 | Ga0496110_0864425 | 3300048913 | Bacteria | 810 |
| 1514 | Ga0496111_0588139 | 3300048914 | Unclassified | 815 |
| 1515 | Ga0496112_0007357 | 3300048915 | Bacteria | 9768 |
| 1516 | Ga0496112_0011512 | 3300048915 | Bacteria | 8082 |
| 1517 | Ga0496112_0061746 | 3300048915 | Bacteria | 3695 |
| 1518 | Ga0496112_0125606 | 3300048915 | Bacteria | 2536 |
| 1519 | Ga0496112_0159113 | 3300048915 | Bacteria | 2225 |
| 1520 | Ga0496112_0198054 | 3300048915 | Bacteria | 1969 |
| 1521 | Ga0496112_0337636 | 3300048915 | Bacteria | 1450 |
| 1522 | Ga0496113_0034556 | 3300048916 | Bacteria | 3689 |
| 1523 | Ga0496113_0125789 | 3300048916 | Bacteria | 2007 |
| 1524 | Ga0496115_0303651 | 3300048918 | Bacteria | 1308 |
| 1525 | Ga0496115_0720737 | 3300048918 | Bacteria | 782 |
| 1526 | Ga0501306_013293 | 3300049127 | Bacteria | 1072 |
| 1527 | Ga0501306_019523 | 3300049127 | Bacteria | 935 |
| 1528 | Ga0501308_023243 | 3300049128 | Bacteria | 790 |
| 1529 | Ga0501309_001393 | 3300049129 | Bacteria | 2360 |
| 1530 | Ga0501309_010333 | 3300049129 | Bacteria | 1202 |
| 1531 | Ga0501307_000980 | 3300049162 | Bacteria | 2228 |
| 1532 | Ga0501307_001114 | 3300049162 | Bacteria | 2158 |
| 1533 | Ga0501307_007862 | 3300049162 | Bacteria | 1186 |
| 1534 | Ga0501307_038351 | 3300049162 | Bacteria | 688 |
| 1535 | Ga0501291_123184 | 3300049514 | Bacteria | 564 |
| 1536 | Ga0501298_028587 | 3300049521 | Bacteria | 1083 |
| 1537 | Ga0501299_052756 | 3300049522 | Unclassified | 844 |
| 1538 | Ga0501311_002476 | 3300049527 | Bacteria | 1773 |
| 1539 | Ga0501311_004538 | 3300049527 | Bacteria | 1482 |
| 1540 | Ga0501311_016925 | 3300049527 | Bacteria | 955 |
| 1541 | Ga0501312_056549 | 3300049528 | Bacteria | 672 |
| 1542 | Ga0501313_004470 | 3300049529 | Bacteria | 1438 |
| 1543 | Ga0501315_021987 | 3300049531 | Bacteria | 867 |
| 1544 | Ga0501316_009249 | 3300049532 | Bacteria | 1102 |
| 1545 | Ga0501316_010847 | 3300049532 | Bacteria | 1043 |
| 1546 | Ga0501316_011289 | 3300049532 | Bacteria | 1029 |
| 1547 | Ga0501317_013796 | 3300049533 | Bacteria | 1015 |
| 1548 | Ga0501320_023190 | 3300049536 | Bacteria | 732 |
| 1549 | Ga0501323_008090 | 3300049539 | Bacteria | 1214 |
| 1550 | Ga0501323_026219 | 3300049539 | Bacteria | 797 |
| 1551 | Ga0501324_001625 | 3300049540 | Bacteria | 1528 |
| 1552 | Ga0501031_0074621 | 3300049568 | Bacteria | 2209 |
| 1553 | Ga0501031_0209344 | 3300049568 | Bacteria | 1271 |
| 1554 | Ga0501032_0033574 | 3300049569 | Bacteria | 3515 |
| 1555 | Ga0501033_0466893 | 3300049570 | Bacteria | 875 |
| 1556 | Ga0501034_0556562 | 3300049571 | Bacteria | 1056 |
| 1557 | Ga0501034_0642092 | 3300049571 | Bacteria | 964 |
| 1558 | Ga0501036_0127060 | 3300049572 | Bacteria | 2153 |
| 1559 | Ga0501037_0308337 | 3300049573 | Bacteria | 1098 |
| 1560 | Ga0501038_0513461 | 3300049574 | Bacteria | 915 |
| 1561 | Ga0501038_0712879 | 3300049574 | Unclassified | 751 |
| 1562 | Ga0501039_0375285 | 3300049575 | Bacteria | 1117 |
| 1563 | Ga0501040_0431791 | 3300049576 | Bacteria | 947 |
| 1564 | Ga0501043_0055578 | 3300049579 | Bacteria | 3110 |
| 1565 | Ga0501043_0185422 | 3300049579 | Bacteria | 1620 |
| 1566 | Ga0501046_0129806 | 3300049580 | Bacteria | 1912 |
| 1567 | Ga0501047_0014779 | 3300049581 | Bacteria | 7430 |
| 1568 | Ga0501047_0196179 | 3300049581 | Bacteria | 1881 |
| 1569 | Ga0501067_0399161 | 3300049583 | Bacteria | 767 |
| 1570 | Ga0501070_0061451 | 3300049586 | Bacteria | 3112 |
| 1571 | Ga0501070_0106773 | 3300049586 | Bacteria | 2314 |
| 1572 | Ga0501071_0079085 | 3300049587 | Bacteria | 2404 |
| 1573 | Ga0501071_0331773 | 3300049587 | Bacteria | 1156 |
| 1574 | Ga0501072_1237048 | 3300049588 | Bacteria | 579 |
| 1575 | Ga0501073_0268094 | 3300049589 | Bacteria | 1178 |
| 1576 | Ga0501073_0393792 | 3300049589 | Bacteria | 957 |
| 1577 | Ga0501074_0214188 | 3300049590 | Bacteria | 1372 |
| 1578 | Ga0501074_0553289 | 3300049590 | Unclassified | 814 |
| 1579 | Ga0501075_0126690 | 3300049591 | Bacteria | 1944 |
| 1580 | Ga0501075_0180257 | 3300049591 | Bacteria | 1612 |
| 1581 | Ga0501076_0325659 | 3300049592 | Bacteria | 1260 |
| 1582 | Ga0501076_0984491 | 3300049592 | Unclassified | 695 |
| 1583 | Ga0501198_083668 | 3300049649 | Bacteria | 622 |
| 1584 | Ga0501202_164123 | 3300049652 | Bacteria | 590 |
| 1585 | Ga0501206_056896 | 3300049653 | Bacteria | 634 |
| 1586 | Ga0501207_069832 | 3300049654 | Bacteria | 658 |
| 1587 | Ga0501217_024873 | 3300049661 | Bacteria | 1436 |
| 1588 | Ga0501224_007129 | 3300049664 | Bacteria | 1626 |
| 1589 | Ga0501227_032223 | 3300049665 | Bacteria | 1263 |
| 1590 | Ga0501227_164012 | 3300049665 | Bacteria | 619 |
| 1591 | Ga0501233_032767 | 3300049668 | Bacteria | 1184 |
| 1592 | Ga0501235_001630 | 3300049669 | Bacteria | 4824 |
| 1593 | Ga0501248_016002 | 3300049678 | Bacteria | 728 |
| 1594 | Ga0501249_002095 | 3300049679 | Bacteria | 4061 |
| 1595 | Ga0501250_022605 | 3300049680 | Bacteria | 825 |
| 1596 | Ga0501257_071687 | 3300049686 | Bacteria | 886 |
| 1597 | Ga0501257_104848 | 3300049686 | Bacteria | 745 |
| 1598 | Ga0501259_034647 | 3300049688 | Bacteria | 969 |
| 1599 | Ga0501261_023703 | 3300049690 | Bacteria | 895 |
| 1600 | Ga0501219_006160 | 3300049703 | Bacteria | 858 |
| 1601 | Ga0501225_0007423 | 3300049705 | Bacteria | 3175 |
| 1602 | Ga0501234_006534 | 3300049707 | Bacteria | 1824 |
| 1603 | Ga0501079_0110450 | 3300049741 | Bacteria | 2136 |
| 1604 | Ga0501079_0180034 | 3300049741 | Bacteria | 1649 |
| 1605 | Ga0501080_0053870 | 3300049742 | Bacteria | 3747 |
| 1606 | Ga0501080_0212868 | 3300049742 | Bacteria | 1771 |
| 1607 | Ga0501080_0641315 | 3300049742 | Bacteria | 940 |
| 1608 | Ga0501080_0738704 | 3300049742 | Bacteria | 866 |
| 1609 | Ga0501081_0086410 | 3300049743 | Bacteria | 2202 |
| 1610 | Ga0501083_0369517 | 3300049744 | Bacteria | 933 |
| 1611 | Ga0501232_010651 | 3300049757 | Bacteria | 1041 |
| 1612 | Ga0501266_005651 | 3300049763 | Bacteria | 1555 |
| 1613 | Ga0501268_001269 | 3300049765 | Bacteria | 3106 |
| 1614 | Ga0501268_055351 | 3300049765 | Bacteria | 776 |
| 1615 | Ga0501272_007479 | 3300049769 | Bacteria | 1185 |
| 1616 | Ga0501035_0046302 | 3300049822 | Bacteria | 3912 |
| 1617 | Ga0501035_0210590 | 3300049822 | Bacteria | 1663 |
| 1618 | Ga0501035_0324916 | 3300049822 | Bacteria | 1292 |
| 1619 | Ga0501045_0418500 | 3300049824 | Bacteria | 997 |
| 1620 | Ga0501212_076168 | 3300049851 | Bacteria | 601 |
| 1621 | nmdc:mga05p37_1266157_c1 | 3300050507 | Bacteria | 755 |
| 1622 | nmdc:mga05p37_160485_c1 | 3300050507 | Bacteria | 2746 |
| 1623 | nmdc:mga05p37_19612_c1 | 3300050507 | Bacteria | 8178 |
| 1624 | nmdc:mga05p37_271519_c1 | 3300050507 | Bacteria | 2026 |
| 1625 | nmdc:mga05p37_3917_c1 | 3300050507 | Bacteria | 17431 |
| 1626 | nmdc:mga05p37_82274_c1 | 3300050507 | Bacteria | 3967 |
| 1627 | nmdc:mga09592_140785_c1 | 3300050508 | Bacteria | 2079 |
| 1628 | nmdc:mga09592_15413_c1 | 3300050508 | Bacteria | 6245 |
| 1629 | nmdc:mga09592_188306_c1 | 3300050508 | Bacteria | 1786 |
| 1630 | nmdc:mga09592_227605_c1 | 3300050508 | Bacteria | 1615 |
| 1631 | nmdc:mga09592_40739_c1 | 3300050508 | Bacteria | 3903 |
| 1632 | nmdc:mga09592_430636_c1 | 3300050508 | Bacteria | 1139 |
| 1633 | nmdc:mga09592_49688_c1 | 3300050508 | Bacteria | 3536 |
| 1634 | nmdc:mga0qj67_158748_c1 | 3300050509 | Bacteria | 1836 |
| 1635 | nmdc:mga0qj67_177890_c1 | 3300050509 | Bacteria | 1728 |
| 1636 | nmdc:mga0qj67_187451_c1 | 3300050509 | Bacteria | 1681 |
| 1637 | nmdc:mga0qj67_247879_c1 | 3300050509 | Bacteria | 1445 |
| 1638 | nmdc:mga0qj67_26425_c1 | 3300050509 | Bacteria | 4494 |
| 1639 | nmdc:mga0qj67_321506_c1 | 3300050509 | Bacteria | 1252 |
| 1640 | nmdc:mga0qj67_366205_c1 | 3300050509 | Bacteria | 1164 |
| 1641 | nmdc:mga0qj67_40140_c1 | 3300050509 | Bacteria | 3678 |
| 1642 | nmdc:mga0qj67_62146_c1 | 3300050509 | Bacteria | 2968 |
| 1643 | nmdc:mga06r32_11453_c1 | 3300050510 | Bacteria | 7986 |
| 1644 | nmdc:mga06r32_1194161_c1 | 3300050510 | Bacteria | 707 |
| 1645 | nmdc:mga06r32_29589_c1 | 3300050510 | Bacteria | 5135 |
| 1646 | nmdc:mga06r32_355255_c1 | 3300050510 | Bacteria | 1450 |
| 1647 | nmdc:mga06r32_438043_c1 | 3300050510 | Bacteria | 1287 |
| 1648 | nmdc:mga06r32_455925_c1 | 3300050510 | Bacteria | 1258 |
| 1649 | nmdc:mga06r32_651335_c1 | 3300050510 | Bacteria | 1021 |
| 1650 | nmdc:mga06r32_88199_c1 | 3300050510 | Bacteria | 3028 |
| 1651 | nmdc:mga08y16_145790_c1 | 3300050511 | Bacteria | 2461 |
| 1652 | nmdc:mga08y16_146631_c1 | 3300050511 | Bacteria | 2454 |
| 1653 | nmdc:mga08y16_168077_c1 | 3300050511 | Bacteria | 2279 |
| 1654 | nmdc:mga08y16_27513_c1 | 3300050511 | Bacteria | 5991 |
| 1655 | nmdc:mga08y16_33336_c1 | 3300050511 | Bacteria | 5409 |
| 1656 | nmdc:mga08y16_84658_c1 | 3300050511 | Bacteria | 3305 |
| 1657 | nmdc:mga0n895_10875_c1 | 3300050512 | Bacteria | 8079 |
| 1658 | nmdc:mga0n895_14066_c1 | 3300050512 | Bacteria | 7253 |
| 1659 | nmdc:mga0n895_147262_c1 | 3300050512 | Bacteria | 2384 |
| 1660 | nmdc:mga0n895_235374_c1 | 3300050512 | Bacteria | 1859 |
| 1661 | nmdc:mga0n895_436895_c1 | 3300050512 | Bacteria | 1322 |
| 1662 | nmdc:mga0n895_69021_c1 | 3300050512 | Bacteria | 3501 |
| 1663 | nmdc:mga0n895_84154_c1 | 3300050512 | Bacteria | 3174 |
| 1664 | nmdc:mga0n895_90735_c1 | 3300050512 | Bacteria | 3058 |
| 1665 | nmdc:mga0rr50_1032596_c1 | 3300050513 | Bacteria | 700 |
| 1666 | nmdc:mga0rr50_114549_c1 | 3300050513 | Bacteria | 2138 |
| 1667 | nmdc:mga0rr50_138710_c1 | 3300050513 | Bacteria | 1954 |
| 1668 | nmdc:mga0rr50_462521_c1 | 3300050513 | Bacteria | 1076 |
| 1669 | nmdc:mga0rr50_63406_c1 | 3300050513 | Bacteria | 2791 |
| 1670 | nmdc:mga0a205_196515_c1 | 3300050515 | Bacteria | 1908 |
| 1671 | nmdc:mga0a205_28550_c1 | 3300050515 | Bacteria | 5335 |
| 1672 | nmdc:mga0a205_294033_c1 | 3300050515 | Bacteria | 1498 |
| 1673 | nmdc:mga0a205_36134_c1 | 3300050515 | Bacteria | 4746 |
| 1674 | nmdc:mga0a205_6528_c1 | 3300050515 | Bacteria | 10547 |
| 1675 | Ga0495601_0155460 | 3300053077 | Bacteria | 1493 |
| 1676 | Ga0495601_0423665 | 3300053077 | Bacteria | 862 |
| 1677 | Ga0495612_0132552 | 3300053078 | Bacteria | 1077 |
| 1678 | Ga0495612_0200960 | 3300053078 | Bacteria | 879 |
| 1679 | Ga0495595_0137986 | 3300053084 | Bacteria | 1195 |
| 1680 | Ga0495595_0226027 | 3300053084 | Bacteria | 934 |
| 1681 | Ga0501084_0106476 | 3300054114 | Bacteria | 2356 |
| 1682 | Ga0501084_0309154 | 3300054114 | Bacteria | 1335 |
| 1683 | Ga0590075_070669 | 3300059424 | Bacteria | 902 |
| 1684 | Ga0590077_039989 | 3300059426 | Bacteria | 1040 |
| 1685 | Ga0590077_062781 | 3300059426 | Bacteria | 843 |
| 1686 | Ga0587108_012874 | 3300059653 | Bacteria | 728 |
| 1687 | Ga0587111_0045632 | 3300060346 | Unclassified | 950 |
| 1688 | Ga0501082_0053239 | 3300060353 | Bacteria | 3489 |
| 1689 | Ga0501082_0204266 | 3300060353 | Bacteria | 1719 |
| 1690 | Ga0501082_0552852 | 3300060353 | Bacteria | 1007 |
| 1691 | Ga0466962_0175353 | 3300061719 | Bacteria | 1045 |
| 1692 | Ga0530510_0532243 | 3300061734 | Bacteria | 892 |
| 1693 | Ga0501041_0115562 | |||
| 1694 | LJQas_1008719 | |||
| 1695 | JGI24737J22298_10047709 | |||
| 1696 | JGI24735J21928_10152635 | |||
| 1697 | JGI24750J21931_1010721 | |||
| 1698 | JGI26145J50221_1002425 | |||
| 1699 | Ga0058861_10085796 | |||
| 1700 | Ga0058861_10097294 | |||
| 1701 | Ga0058861_10124789 | |||
| 1702 | Ga0058861_10157639 | |||
| 1703 | Ga0058861_11844075 | |||
| 1704 | Ga0058862_10020038 | |||
| 1705 | Ga0058862_10123762 | |||
| 1706 | Ga0058862_10283756 | |||
| 1707 | Ga0058862_10288296 | |||
| 1708 | Ga0058862_12486219 | |||
| 1709 | Ga0058862_12612346 | |||
| 1710 | Ga0058862_12737859 | |||
| 1711 | Ga0058862_12847149 | |||
| 1712 | Ga0065712_10175774 | |||
| 1713 | Ga0065715_10092142 | |||
| 1714 | Ga0065715_10100313 | |||
| 1715 | Ga0065707_10155111 | |||
| 1716 | Ga0070658_10022117 | |||
| 1717 | Ga0070658_10046451 | |||
| 1718 | Ga0070658_10105917 | |||
| 1719 | Ga0070658_10108142 | |||
| 1720 | Ga0070658_10127177 | |||
| 1721 | Ga0070658_10129323 | |||
| 1722 | Ga0070658_10241595 | |||
| 1723 | Ga0070658_10696827 | |||
| 1724 | Ga0070658_10816000 | |||
| 1725 | Ga0070658_10829537 | |||
| 1726 | Ga0070658_11347551 | |||
| 1727 | Ga0070658_11375869 | |||
| 1728 | Ga0070676_10000852 | |||
| 1729 | Ga0070676_10057418 | |||
| 1730 | Ga0070676_10073120 | |||
| 1731 | Ga0070683_100017450 | |||
| 1732 | Ga0070683_100017633 | |||
| 1733 | Ga0070683_100031156 | |||
| 1734 | Ga0070683_100042520 | |||
| 1735 | Ga0070683_100050790 | |||
| 1736 | Ga0070683_100051102 | |||
| 1737 | Ga0070683_100057657 | |||
| 1738 | Ga0070683_100076000 | |||
| 1739 | Ga0070683_100111127 | |||
| 1740 | Ga0070683_100111963 | |||
| 1741 | Ga0070683_100125609 | |||
| 1742 | Ga0070683_100138611 | |||
| 1743 | Ga0070683_100152247 | |||
| 1744 | Ga0070683_100155893 | |||
| 1745 | Ga0070683_100176228 | |||
| 1746 | Ga0070683_100259623 | |||
| 1747 | Ga0070683_100302256 | |||
| 1748 | Ga0070683_100342173 | |||
| 1749 | Ga0070683_100348871 | |||
| 1750 | Ga0070683_100495736 | |||
| 1751 | Ga0070683_101543960 | |||
| 1752 | Ga0070690_100045525 | |||
| 1753 | Ga0070690_100080505 | |||
| 1754 | Ga0070690_100261442 | |||
| 1755 | Ga0070690_100284359 | |||
| 1756 | Ga0070690_100566124 | |||
| 1757 | Ga0070690_100630757 | |||
| 1758 | Ga0070690_100691126 | |||
| 1759 | Ga0070670_100031678 | |||
| 1760 | Ga0070670_100048175 | |||
| 1761 | Ga0070670_100156530 | |||
| 1762 | Ga0070670_100183926 | |||
| 1763 | Ga0070670_100529864 | |||
| 1764 | Ga0070677_10026152 | |||
| 1765 | Ga0068869_100006678 | |||
| 1766 | Ga0068869_100009010 | |||
| 1767 | Ga0068869_100043571 | |||
| 1768 | Ga0070666_10070528 | |||
| 1769 | Ga0070666_10347650 | |||
| 1770 | Ga0070680_100011610 | |||
| 1771 | Ga0070680_100011619 | |||
| 1772 | Ga0070680_100013410 | |||
| 1773 | Ga0070680_100017458 | |||
| 1774 | Ga0070680_100098375 | |||
| 1775 | Ga0070680_100392140 | |||
| 1776 | Ga0070680_100515481 | |||
| 1777 | Ga0070680_100839965 | |||
| 1778 | Ga0070682_100002789 | |||
| 1779 | Ga0070682_100022340 | |||
| 1780 | Ga0070682_100335735 | |||
| 1781 | Ga0070682_100348933 | |||
| 1782 | Ga0070682_100876439 | |||
| 1783 | Ga0070682_100878646 | |||
| 1784 | Ga0068868_100136844 | |||
| 1785 | Ga0068868_100200774 | |||
| 1786 | Ga0068868_100364796 | |||
| 1787 | Ga0068868_100653410 | |||
| 1788 | Ga0070660_100025168 | |||
| 1789 | Ga0070660_100055168 | |||
| 1790 | Ga0070660_100080276 | |||
| 1791 | Ga0070660_100145041 | |||
| 1792 | Ga0070660_100426367 | |||
| 1793 | Ga0070660_100445841 | |||
| 1794 | Ga0070660_100491138 | |||
| 1795 | Ga0070660_100552485 | |||
| 1796 | Ga0070660_100635638 | |||
| 1797 | Ga0070689_100135475 | |||
| 1798 | Ga0070691_10005497 | |||
| 1799 | Ga0070691_10012073 | |||
| 1800 | Ga0070691_10021041 | |||
| 1801 | Ga0070691_10129407 | |||
| 1802 | Ga0070691_10201586 | |||
| 1803 | Ga0070691_10206323 | |||
| 1804 | Ga0070687_100001584 | |||
| 1805 | Ga0070687_100088116 | |||
| 1806 | Ga0070661_100008164 | |||
| 1807 | Ga0070661_100038705 | |||
| 1808 | Ga0070661_100039084 | |||
| 1809 | Ga0070661_100076100 | |||
| 1810 | Ga0070661_100144028 | |||
| 1811 | Ga0070661_100144197 | |||
| 1812 | Ga0070661_100188826 | |||
| 1813 | Ga0070661_100226501 | |||
| 1814 | Ga0070661_100544110 | |||
| 1815 | Ga0070661_100684247 | |||
| 1816 | Ga0070661_100872494 | |||
| 1817 | Ga0070661_101412734 | |||
| 1818 | Ga0070692_10001021 | |||
| 1819 | Ga0070692_10003744 | |||
| 1820 | Ga0070692_10211326 | |||
| 1821 | Ga0070692_10213493 | |||
| 1822 | Ga0070692_10226497 | |||
| 1823 | Ga0070692_10277897 | |||
| 1824 | Ga0070692_10281083 | |||
| 1825 | Ga0070692_10309949 | |||
| 1826 | Ga0070668_100051201 | |||
| 1827 | Ga0070668_100087088 | |||
| 1828 | Ga0070668_100155116 | |||
| 1829 | Ga0070668_100714470 | |||
| 1830 | Ga0070669_100005808 | |||
| 1831 | Ga0070669_100041791 | |||
| 1832 | Ga0070669_100093042 | |||
| 1833 | Ga0070669_100254196 | |||
| 1834 | Ga0070669_100273040 | |||
| 1835 | Ga0070669_100736093 | |||
| 1836 | Ga0070675_100011662 | |||
| 1837 | Ga0070675_100072332 | |||
| 1838 | Ga0070675_100115402 | |||
| 1839 | Ga0070675_100185814 | |||
| 1840 | Ga0070675_100351888 | |||
| 1841 | Ga0070675_100396511 | |||
| 1842 | Ga0070675_100490986 | |||
| 1843 | Ga0070675_100626844 | |||
| 1844 | Ga0070675_101213162 | |||
| 1845 | Ga0070671_100069692 | |||
| 1846 | Ga0070671_100192757 | |||
| 1847 | Ga0070671_100234679 | |||
| 1848 | Ga0070671_100530185 | |||
| 1849 | Ga0070674_100096788 | |||
| 1850 | Ga0070674_100404982 | |||
| 1851 | Ga0070673_100070036 | |||
| 1852 | Ga0070673_100197175 | |||
| 1853 | Ga0070673_100362681 | |||
| 1854 | Ga0070673_100521130 | |||
| 1855 | Ga0070673_100915855 | |||
| 1856 | Ga0070673_101019703 | |||
| 1857 | Ga0070688_100017758 | |||
| 1858 | Ga0070688_100073684 | |||
| 1859 | Ga0070688_100277589 | |||
| 1860 | Ga0070659_100035632 | |||
| 1861 | Ga0070659_100040972 | |||
| 1862 | Ga0070659_100058072 | |||
| 1863 | Ga0070659_100116203 | |||
| 1864 | Ga0070659_100267284 | |||
| 1865 | Ga0070659_100305102 | |||
| 1866 | Ga0070659_100342020 | |||
| 1867 | Ga0070659_100498800 | |||
| 1868 | Ga0070659_100633433 | |||
| 1869 | Ga0070659_100750343 | |||
| 1870 | Ga0070659_100829065 | |||
| 1871 | Ga0070659_100864544 | |||
| 1872 | Ga0070667_100168956 | |||
| 1873 | Ga0070667_100213539 | |||
| 1874 | Ga0070667_100237843 | |||
| 1875 | Ga0070667_100271420 | |||
| 1876 | Ga0070667_100298998 | |||
| 1877 | Ga0070667_100347388 | |||
| 1878 | Ga0070667_100372090 | |||
| 1879 | Ga0070667_100768905 | |||
| 1880 | Ga0070667_101540560 | |||
| 1881 | Ga0070709_10038698 | |||
| 1882 | Ga0070709_10060989 | |||
| 1883 | Ga0070709_10163831 | |||
| 1884 | Ga0070709_10252174 | |||
| 1885 | Ga0070714_100089794 | |||
| 1886 | Ga0070714_100492315 | |||
| 1887 | Ga0070713_100005886 | |||
| 1888 | Ga0070713_100017836 | |||
| 1889 | Ga0070713_100060655 | |||
| 1890 | Ga0070713_100395574 | |||
| 1891 | Ga0070713_100643096 | |||
| 1892 | Ga0070713_101555207 | |||
| 1893 | Ga0070710_10016381 | |||
| 1894 | Ga0070710_10163396 | |||
| 1895 | Ga0070710_10206549 | |||
| 1896 | Ga0070710_10216641 | |||
| 1897 | Ga0070710_10308458 | |||
| 1898 | Ga0070710_10341463 | |||
| 1899 | Ga0070701_10031401 | |||
| 1900 | Ga0070701_10142398 | |||
| 1901 | Ga0070711_100016949 | |||
| 1902 | Ga0070711_100021768 | |||
| 1903 | Ga0070711_100062598 | |||
| 1904 | Ga0070711_100111753 | |||
| 1905 | Ga0070711_100132268 | |||
| 1906 | Ga0070705_100115887 | |||
| 1907 | Ga0070700_100009943 | |||
| 1908 | Ga0070700_100257255 | |||
| 1909 | Ga0070700_100300455 | |||
| 1910 | Ga0070700_100313260 | |||
| 1911 | Ga0070700_100381684 | |||
| 1912 | Ga0070700_100577113 | |||
| 1913 | Ga0070694_100013152 | |||
| 1914 | Ga0070694_100038068 | |||
| 1915 | Ga0070694_100226977 | |||
| 1916 | Ga0070694_100235153 | |||
| 1917 | Ga0070694_101544251 | |||
| 1918 | Ga0070708_100000077 | |||
| 1919 | Ga0070708_100049689 | |||
| 1920 | Ga0070708_100331246 | |||
| 1921 | Ga0070663_100008615 | |||
| 1922 | Ga0070663_100020556 | |||
| 1923 | Ga0070663_100333338 | |||
| 1924 | Ga0070663_100373857 | |||
| 1925 | Ga0070663_100593692 | |||
| 1926 | Ga0070663_101007460 | |||
| 1927 | Ga0070663_101417552 | |||
| 1928 | Ga0070678_100032948 | |||
| 1929 | Ga0070678_100331880 | |||
| 1930 | Ga0070662_100014975 | |||
| 1931 | Ga0070662_100050296 | |||
| 1932 | Ga0070662_100425956 | |||
| 1933 | Ga0070662_100517281 | |||
| 1934 | Ga0070662_100648519 | |||
| 1935 | Ga0070662_100723981 | |||
| 1936 | Ga0070681_10001680 | |||
| 1937 | Ga0070681_10003472 | |||
| 1938 | Ga0070681_10009733 | |||
| 1939 | Ga0070681_10028142 | |||
| 1940 | Ga0070681_10106558 | |||
| 1941 | Ga0070681_10138741 | |||
| 1942 | Ga0070681_10185256 | |||
| 1943 | Ga0070681_10193078 | |||
| 1944 | Ga0070681_10205939 | |||
| 1945 | Ga0070681_10538112 | |||
| 1946 | Ga0070681_10704329 | |||
| 1947 | Ga0068867_100106438 | |||
| 1948 | Ga0068867_100148600 | |||
| 1949 | Ga0068867_100199913 | |||
| 1950 | Ga0068867_100287495 | |||
| 1951 | Ga0068867_100592272 | |||
| 1952 | Ga0068867_101837729 | |||
| 1953 | Ga0070685_10068364 | |||
| 1954 | Ga0070706_100120646 | |||
| 1955 | Ga0070706_101510368 | |||
| 1956 | Ga0070707_100007168 | |||
| 1957 | Ga0070707_100253528 | |||
| 1958 | Ga0070707_100342049 | |||
| 1959 | Ga0070707_100634610 | |||
| 1960 | Ga0070707_100758309 | |||
| 1961 | Ga0070698_100002723 | |||
| 1962 | Ga0070698_100057554 | |||
| 1963 | Ga0070698_100108125 | |||
| 1964 | Ga0070698_100889228 | |||
| 1965 | Ga0070699_100060134 | |||
| 1966 | Ga0070699_100088378 | |||
| 1967 | Ga0070699_100090852 | |||
| 1968 | Ga0070699_100596483 | |||
| 1969 | Ga0070679_100009717 | |||
| 1970 | Ga0070679_100012748 | |||
| 1971 | Ga0070679_100015827 | |||
| 1972 | Ga0070679_100020806 | |||
| 1973 | Ga0070679_100023321 | |||
| 1974 | Ga0070679_100027822 | |||
| 1975 | Ga0070679_100037625 | |||
| 1976 | Ga0070679_100039848 | |||
| 1977 | Ga0070679_100060996 | |||
| 1978 | Ga0070679_100101144 | |||
| 1979 | Ga0070679_100103099 | |||
| 1980 | Ga0070679_100112406 | |||
| 1981 | Ga0070679_100128217 | |||
| 1982 | Ga0070679_100142801 | |||
| 1983 | Ga0070679_100192718 | |||
| 1984 | Ga0070679_100200506 | |||
| 1985 | Ga0070679_100311153 | |||
| 1986 | Ga0070679_100322503 | |||
| 1987 | Ga0070679_100410499 | |||
| 1988 | Ga0070679_100479063 | |||
| 1989 | Ga0070679_100574002 | |||
| 1990 | Ga0070679_101118399 | |||
| 1991 | Ga0070684_100014785 | |||
| 1992 | Ga0070684_100026374 | |||
| 1993 | Ga0070684_100035907 | |||
| 1994 | Ga0070684_100052003 | |||
| 1995 | Ga0070684_100058231 | |||
| 1996 | Ga0070684_100066581 | |||
| 1997 | Ga0070684_100102320 | |||
| 1998 | Ga0070684_100116273 | |||
| 1999 | Ga0070684_100137395 | |||
| 2000 | Ga0070684_100162192 | |||
| 2001 | Ga0070684_100164894 | |||
| 2002 | Ga0070684_100182647 | |||
| 2003 | Ga0070684_100223370 | |||
| 2004 | Ga0070684_100241211 | |||
| 2005 | Ga0070684_100250871 | |||
| 2006 | Ga0070684_100325651 | |||
| 2007 | Ga0070684_100450563 | |||
| 2008 | Ga0070684_100543423 | |||
| 2009 | Ga0070684_100602378 | |||
| 2010 | Ga0070684_101725757 | |||
| 2011 | Ga0070697_100049568 | |||
| 2012 | Ga0070697_100146086 | |||
| 2013 | Ga0068853_100145351 | |||
| 2014 | Ga0068853_100435858 | |||
| 2015 | Ga0068853_100442252 | |||
| 2016 | Ga0068853_100543028 | |||
| 2017 | Ga0070672_100014900 | |||
| 2018 | Ga0070672_100064908 | |||
| 2019 | Ga0070672_100515601 | |||
| 2020 | Ga0070672_100590692 | |||
| 2021 | Ga0070686_100668131 | |||
| 2022 | Ga0070695_100028830 | |||
| 2023 | Ga0070695_100041194 | |||
| 2024 | Ga0070695_100063440 | |||
| 2025 | Ga0070695_100745403 | |||
| 2026 | Ga0070696_100000705 | |||
| 2027 | Ga0070696_100173225 | |||
| 2028 | Ga0070696_100350796 | |||
| 2029 | Ga0070696_100414085 | |||
| 2030 | Ga0070693_100014943 | |||
| 2031 | Ga0070693_100029698 | |||
| 2032 | Ga0070693_100422162 | |||
| 2033 | Ga0070693_100438949 | |||
| 2034 | Ga0070693_100497709 | |||
| 2035 | Ga0070693_100568544 | |||
| 2036 | Ga0070665_101286161 | |||
| 2037 | Ga0070665_101747369 | |||
| 2038 | Ga0070665_101827349 | |||
| 2039 | Ga0070704_100044905 | |||
| 2040 | Ga0070704_100050759 | |||
| 2041 | Ga0070704_100451470 | |||
| 2042 | Ga0068855_100029696 | |||
| 2043 | Ga0068855_100195616 | |||
| 2044 | Ga0068855_100555033 | |||
| 2045 | Ga0068855_100622794 | |||
| 2046 | Ga0068855_100668675 | |||
| 2047 | Ga0068855_100730057 | |||
| 2048 | Ga0068855_101225127 | |||
| 2049 | Ga0068855_101521558 | |||
| 2050 | Ga0070664_100038733 | |||
| 2051 | Ga0070664_100072000 | |||
| 2052 | Ga0070664_100096586 | |||
| 2053 | Ga0070664_100139755 | |||
| 2054 | Ga0070664_100211881 | |||
| 2055 | Ga0070664_100258903 | |||
| 2056 | Ga0070664_100266759 | |||
| 2057 | Ga0070664_100289322 | |||
| 2058 | Ga0070664_100591649 | |||
| 2059 | Ga0070664_101094212 | |||
| 2060 | Ga0070664_101187223 | |||
| 2061 | Ga0068857_100029029 | |||
| 2062 | Ga0068857_100041742 | |||
| 2063 | Ga0068857_100055825 | |||
| 2064 | Ga0068857_100149894 | |||
| 2065 | Ga0068857_100191162 | |||
| 2066 | Ga0068857_100226082 | |||
| 2067 | Ga0068857_100299387 | |||
| 2068 | Ga0068857_100582263 | |||
| 2069 | Ga0068854_100028156 | |||
| 2070 | Ga0068854_100177257 | |||
| 2071 | Ga0068854_100190051 | |||
| 2072 | Ga0068854_100662941 | |||
| 2073 | Ga0068854_101002758 | |||
| 2074 | Ga0068856_100041437 | |||
| 2075 | Ga0068856_100057303 | |||
| 2076 | Ga0068856_100206334 | |||
| 2077 | Ga0068856_100328720 | |||
| 2078 | Ga0068856_100656999 | |||
| 2079 | Ga0068856_101386106 | |||
| 2080 | Ga0070702_100029194 | |||
| 2081 | Ga0070702_100322103 | |||
| 2082 | Ga0068852_100012880 | |||
| 2083 | Ga0068852_100021426 | |||
| 2084 | Ga0068852_100057382 | |||
| 2085 | Ga0068852_100079051 | |||
| 2086 | Ga0068852_100181844 | |||
| 2087 | Ga0068852_100214728 | |||
| 2088 | Ga0068852_100283209 | |||
| 2089 | Ga0068852_100406678 | |||
| 2090 | Ga0068852_100510629 | |||
| 2091 | Ga0068852_100614213 | |||
| 2092 | Ga0068852_101058213 | |||
| 2093 | Ga0068852_101280249 | |||
| 2094 | Ga0068852_101974946 | |||
| 2095 | Ga0068859_100000840 | |||
| 2096 | Ga0068859_100078819 | |||
| 2097 | Ga0068859_100322150 | |||
| 2098 | Ga0068859_100444662 | |||
| 2099 | Ga0068859_100736147 | |||
| 2100 | Ga0068859_100785237 | |||
| 2101 | Ga0068859_100827601 | |||
| 2102 | Ga0068859_101427805 | |||
| 2103 | Ga0068864_100009895 | |||
| 2104 | Ga0068864_100115558 | |||
| 2105 | Ga0068864_100192269 | |||
| 2106 | Ga0068864_100317881 | |||
| 2107 | Ga0068864_100360078 | |||
| 2108 | Ga0068864_100672183 | |||
| 2109 | Ga0068864_100985203 | |||
| 2110 | Ga0068866_10280017 | |||
| 2111 | Ga0068861_100000975 | |||
| 2112 | Ga0068861_100011996 | |||
| 2113 | Ga0068861_100067772 | |||
| 2114 | Ga0068861_100533317 | |||
| 2115 | Ga0068851_10082854 | |||
| 2116 | Ga0068851_10100896 | |||
| 2117 | Ga0068870_10005093 | |||
| 2118 | Ga0068863_100095919 | |||
| 2119 | Ga0068863_100246948 | |||
| 2120 | Ga0068863_100409739 | |||
| 2121 | Ga0068863_100425021 | |||
| 2122 | Ga0068863_100559769 | |||
| 2123 | Ga0068863_100781071 | |||
| 2124 | Ga0068863_101518455 | |||
| 2125 | Ga0068858_100072941 | |||
| 2126 | Ga0068858_100156351 | |||
| 2127 | Ga0068858_100300941 | |||
| 2128 | Ga0068858_100653683 | |||
| 2129 | Ga0068860_100004188 | |||
| 2130 | Ga0068860_100019789 | |||
| 2131 | Ga0068860_100056592 | |||
| 2132 | Ga0068860_100543237 | |||
| 2133 | Ga0068860_100853246 | |||
| 2134 | Ga0068862_100000764 | |||
| 2135 | Ga0068862_100002514 | |||
| 2136 | Ga0068862_100013561 | |||
| 2137 | Ga0068862_100165433 | |||
| 2138 | Ga0068862_100286295 | |||
| 2139 | Ga0068862_100403955 | |||
| 2140 | Ga0068862_100780633 | |||
| 2141 | Ga0081539_10005565 | |||
| 2142 | Ga0070717_10007434 | |||
| 2143 | Ga0070717_10067172 | |||
| 2144 | Ga0075432_10078128 | |||
| 2145 | Ga0070715_10080258 | |||
| 2146 | Ga0070716_100007666 | |||
| 2147 | Ga0070716_100051887 | |||
| 2148 | Ga0070716_100060728 | |||
| 2149 | Ga0070716_100184954 | |||
| 2150 | Ga0070716_100433191 | |||
| 2151 | Ga0070712_100004359 | |||
| 2152 | Ga0070712_100099934 | |||
| 2153 | Ga0070712_100134695 | |||
| 2154 | Ga0097621_100073666 | |||
| 2155 | Ga0097621_100251079 | |||
| 2156 | Ga0097621_100455969 | |||
| 2157 | Ga0097621_100928612 | |||
| 2158 | Ga0068871_100025360 | |||
| 2159 | Ga0068871_100122576 | |||
| 2160 | Ga0068871_100334181 | |||
| 2161 | Ga0075428_100144106 | |||
| 2162 | Ga0075428_100147317 | |||
| 2163 | Ga0075428_101479410 | |||
| 2164 | Ga0075430_100041383 | |||
| 2165 | Ga0075430_100183779 | |||
| 2166 | Ga0075430_100239016 | |||
| 2167 | Ga0075430_100254645 | |||
| 2168 | Ga0075430_100328965 | |||
| 2169 | Ga0075430_100350563 | |||
| 2170 | Ga0075430_100467061 | |||
| 2171 | Ga0075430_100490598 | |||
| 2172 | Ga0075430_100491885 | |||
| 2173 | Ga0075431_100016038 | |||
| 2174 | Ga0075431_100031481 | |||
| 2175 | Ga0075431_100117958 | |||
| 2176 | Ga0075431_100370414 | |||
| 2177 | Ga0075431_100444805 | |||
| 2178 | Ga0075431_100517344 | |||
| 2179 | Ga0075431_100604174 | |||
| 2180 | Ga0075431_100903886 | |||
| 2181 | Ga0075431_100907216 | |||
| 2182 | Ga0075431_101135439 | |||
| 2183 | Ga0075433_10045513 | |||
| 2184 | Ga0075433_10155235 | |||
| 2185 | Ga0075433_10352367 | |||
| 2186 | Ga0075433_10376572 | |||
| 2187 | Ga0075433_10446265 | |||
| 2188 | Ga0075433_10620556 | |||
| 2189 | Ga0075434_100051764 | |||
| 2190 | Ga0075434_100073796 | |||
| 2191 | Ga0075434_100097085 | |||
| 2192 | Ga0075434_100128012 | |||
| 2193 | Ga0075434_100168045 | |||
| 2194 | Ga0075434_100192776 | |||
| 2195 | Ga0075434_100489476 | |||
| 2196 | Ga0075429_100009872 | |||
| 2197 | Ga0075429_100144460 | |||
| 2198 | Ga0075429_100774376 | |||
| 2199 | Ga0075429_100788841 | |||
| 2200 | Ga0068865_100026446 | |||
| 2201 | Ga0068865_100270533 | |||
| 2202 | Ga0068865_100465714 | |||
| 2203 | Ga0068865_100654961 | |||
| 2204 | Ga0068865_100709098 | |||
| 2205 | Ga0068865_100831936 | |||
| 2206 | Ga0068865_101107898 | |||
| 2207 | Ga0075436_100127860 | |||
| 2208 | Ga0097620_100000840 | |||
| 2209 | Ga0097620_100078823 | |||
| 2210 | Ga0097620_100322149 | |||
| 2211 | Ga0097620_100444653 | |||
| 2212 | Ga0097620_100736123 | |||
| 2213 | Ga0097620_100785185 | |||
| 2214 | Ga0097620_100827528 | |||
| 2215 | Ga0097620_101427739 | |||
| 2216 | Ga0075435_100073739 | |||
| 2217 | Ga0075435_100401682 | |||
| 2218 | Ga0075435_101170526 | |||
| 2219 | Ga0105240_10049628 | |||
| 2220 | Ga0105240_10085708 | |||
| 2221 | Ga0105240_10123936 | |||
| 2222 | Ga0105240_10295269 | |||
| 2223 | Ga0105240_10481612 | |||
| 2224 | Ga0105240_10757978 | |||
| 2225 | Ga0105240_11339649 | |||
| 2226 | Ga0111539_10012931 | |||
| 2227 | Ga0111539_10123828 | |||
| 2228 | Ga0111539_10158570 | |||
| 2229 | Ga0111539_10577507 | |||
| 2230 | Ga0111539_10802941 | |||
| 2231 | Ga0111539_11361575 | |||
| 2232 | Ga0111539_11600993 | |||
| 2233 | Ga0105245_10062711 | |||
| 2234 | Ga0105245_10167967 | |||
| 2235 | Ga0105245_10169404 | |||
| 2236 | Ga0105245_10197229 | |||
| 2237 | Ga0105245_10262378 | |||
| 2238 | Ga0105245_12854270 | |||
| 2239 | Ga0105247_10265511 | |||
| 2240 | Ga0114129_10006614 | |||
| 2241 | Ga0114129_10030165 | |||
| 2242 | Ga0114129_10045730 | |||
| 2243 | Ga0114129_10088826 | |||
| 2244 | Ga0114129_10329659 | |||
| 2245 | Ga0114129_10397700 | |||
| 2246 | Ga0114129_10464124 | |||
| 2247 | Ga0114129_10854020 | |||
| 2248 | Ga0114129_11815054 | |||
| 2249 | Ga0105243_10213297 | |||
| 2250 | Ga0105243_10648984 | |||
| 2251 | Ga0105243_10870702 | |||
| 2252 | Ga0105241_10122969 | |||
| 2253 | Ga0105241_10171243 | |||
| 2254 | Ga0105241_10174438 | |||
| 2255 | Ga0105241_10518799 | |||
| 2256 | Ga0105241_11718166 | |||
| 2257 | Ga0105242_10040715 | |||
| 2258 | Ga0105242_10147772 | |||
| 2259 | Ga0105242_10155761 | |||
| 2260 | Ga0105242_10394983 | |||
| 2261 | Ga0105248_10023633 | |||
| 2262 | Ga0105248_10052133 | |||
| 2263 | Ga0105248_10061326 | |||
| 2264 | Ga0105248_10086866 | |||
| 2265 | Ga0105248_10228771 | |||
| 2266 | Ga0105248_10798793 | |||
| 2267 | Ga0105248_11500021 | |||
| 2268 | Ga0105248_11709380 | |||
| 2269 | Ga0105248_12364966 | |||
| 2270 | Ga0105237_10078219 | |||
| 2271 | Ga0105237_10090173 | |||
| 2272 | Ga0105237_10183927 | |||
| 2273 | Ga0105237_10476859 | |||
| 2274 | Ga0105237_10525293 | |||
| 2275 | Ga0105237_10814341 | |||
| 2276 | Ga0105237_11011136 | |||
| 2277 | Ga0105238_10040059 | |||
| 2278 | Ga0105238_10043144 | |||
| 2279 | Ga0105238_10224491 | |||
| 2280 | Ga0105238_10250412 | |||
| 2281 | Ga0105249_10000580 | |||
| 2282 | Ga0105249_10008223 | |||
| 2283 | Ga0105249_10033683 | |||
| 2284 | Ga0105249_10165723 | |||
| 2285 | Ga0105239_10245626 | |||
| 2286 | Ga0105239_10988881 | |||
| 2287 | Ga0105246_10697954 | |||
| 2288 | Ga0157322_1006879 | |||
| 2289 | Ga0157319_1006020 | |||
| 2290 | Ga0157316_1013239 | |||
| 2291 | Ga0157327_1019168 | |||
| 2292 | Ga0157326_1032801 | |||
| 2293 | Ga0157373_10091074 | |||
| 2294 | Ga0157373_10201675 | |||
| 2295 | Ga0157373_10247497 | |||
| 2296 | Ga0157373_10387344 | |||
| 2297 | Ga0157373_10464580 | |||
| 2298 | Ga0157373_10916467 | |||
| 2299 | Ga0157371_10009172 | |||
| 2300 | Ga0157371_10012727 | |||
| 2301 | Ga0157371_10020379 | |||
| 2302 | Ga0157371_10311267 | |||
| 2303 | Ga0157371_10395832 | |||
| 2304 | Ga0157371_10420135 | |||
| 2305 | Ga0157370_10046798 | |||
| 2306 | Ga0157370_10081133 | |||
| 2307 | Ga0157370_10237486 | |||
| 2308 | Ga0157370_10269109 | |||
| 2309 | Ga0157370_10297515 | |||
| 2310 | Ga0157370_10341656 | |||
| 2311 | Ga0157370_10553291 | |||
| 2312 | Ga0157370_10841357 | |||
| 2313 | Ga0157370_11038713 | |||
| 2314 | Ga0157370_11472282 | |||
| 2315 | Ga0157369_10048625 | |||
| 2316 | Ga0157369_10076054 | |||
| 2317 | Ga0157369_10101552 | |||
| 2318 | Ga0157369_10195230 | |||
| 2319 | Ga0157369_10404342 | |||
| 2320 | Ga0157369_10510628 | |||
| 2321 | Ga0157369_10551555 | |||
| 2322 | Ga0157369_10572508 | |||
| 2323 | Ga0157369_11000355 | |||
| 2324 | Ga0157369_11264956 | |||
| 2325 | Ga0157369_11386440 | |||
| 2326 | Ga0157374_10370254 | |||
| 2327 | Ga0157374_10460112 | |||
| 2328 | Ga0157374_10831697 | |||
| 2329 | Ga0157374_11006852 | |||
| 2330 | Ga0157374_11246215 | |||
| 2331 | Ga0157378_10093067 | |||
| 2332 | Ga0157378_10339700 | |||
| 2333 | Ga0157378_10460758 | |||
| 2334 | Ga0157378_10639900 | |||
| 2335 | Ga0157378_10997599 | |||
| 2336 | Ga0157378_11113140 | |||
| 2337 | Ga0163162_10006136 | |||
| 2338 | Ga0163162_10009455 | |||
| 2339 | Ga0163162_10038079 | |||
| 2340 | Ga0163162_10069939 | |||
| 2341 | Ga0163162_10084701 | |||
| 2342 | Ga0163162_10092253 | |||
| 2343 | Ga0163162_10493368 | |||
| 2344 | Ga0163162_10925965 | |||
| 2345 | Ga0157372_10006474 | |||
| 2346 | Ga0157372_10021748 | |||
| 2347 | Ga0157372_10029257 | |||
| 2348 | Ga0157372_10046943 | |||
| 2349 | Ga0157372_10054000 | |||
| 2350 | Ga0157372_10083855 | |||
| 2351 | Ga0157372_10225830 | |||
| 2352 | Ga0157372_10411950 | |||
| 2353 | Ga0157372_10759654 | |||
| 2354 | Ga0157372_10776592 | |||
| 2355 | Ga0157372_10828160 | |||
| 2356 | Ga0157372_11406547 | |||
| 2357 | Ga0157372_12336517 | |||
| 2358 | Ga0157375_10040171 | |||
| 2359 | Ga0157375_10070436 | |||
| 2360 | Ga0157375_10123400 | |||
| 2361 | Ga0157375_10133080 | |||
| 2362 | Ga0157375_10169512 | |||
| 2363 | Ga0157375_10269363 | |||
| 2364 | Ga0157375_10330809 | |||
| 2365 | Ga0157375_10728439 | |||
| 2366 | Ga0163163_10298797 | |||
| 2367 | Ga0163163_10354626 | |||
| 2368 | Ga0157380_10030368 | |||
| 2369 | Ga0157380_10046242 | |||
| 2370 | Ga0157380_10056313 | |||
| 2371 | Ga0157380_10215943 | |||
| 2372 | Ga0157380_12505398 | |||
| 2373 | Ga0182008_10005592 | |||
| 2374 | Ga0182008_10084545 | |||
| 2375 | Ga0157377_10025247 | |||
| 2376 | Ga0157377_10072944 | |||
| 2377 | Ga0157377_10231286 | |||
| 2378 | Ga0157377_10308259 | |||
| 2379 | Ga0157377_10553269 | |||
| 2380 | Ga0157377_10776685 | |||
| 2381 | Ga0157379_10009212 | |||
| 2382 | Ga0157379_10030841 | |||
| 2383 | Ga0157379_10326032 | |||
| 2384 | Ga0157379_10331232 | |||
| 2385 | Ga0157376_10211824 | |||
| 2386 | Ga0157376_10295568 | |||
| 2387 | Ga0157376_11352195 | |||
| 2388 | Ga0157376_11524031 | |||
| 2389 | Ga0157376_12117430 | |||
| 2390 | Ga0182007_10049562 | |||
| 2391 | Ga0182007_10067735 | |||
| 2392 | Ga0182007_10111613 | |||
| 2393 | Ga0163161_10037844 | |||
| 2394 | Ga0163161_10363149 | |||
| 2395 | Ga0163161_10692071 | |||
| 2396 | Ga0206356_10783001 | |||
| 2397 | Ga0206356_11270514 | |||
| 2398 | Ga0206352_10325843 | |||
| 2399 | Ga0206352_11174930 | |||
| 2400 | Ga0206353_10065830 | |||
| 2401 | Ga0206353_11480673 | |||
| 2402 | Ga0213876_10083566 | |||
| 2403 | Ga0207697_10066728 | |||
| 2404 | Ga0207682_10009572 | |||
| 2405 | Ga0207682_10012840 | |||
| 2406 | Ga0207692_10129111 | |||
| 2407 | Ga0207692_10198757 | |||
| 2408 | Ga0207692_10548282 | |||
| 2409 | Ga0207642_10057205 | |||
| 2410 | Ga0207680_10104846 | |||
| 2411 | Ga0207647_10046677 | |||
| 2412 | Ga0207647_10113869 | |||
| 2413 | Ga0207699_10042051 | |||
| 2414 | Ga0207699_10043781 | |||
| 2415 | Ga0207699_10101168 | |||
| 2416 | Ga0207699_10211141 | |||
| 2417 | Ga0207645_10000909 | |||
| 2418 | Ga0207645_10041571 | |||
| 2419 | Ga0207645_10082589 | |||
| 2420 | Ga0207643_10007697 | |||
| 2421 | Ga0207643_10106534 | |||
| 2422 | Ga0207705_10003811 | |||
| 2423 | Ga0207705_10003951 | |||
| 2424 | Ga0207705_10030503 | |||
| 2425 | Ga0207705_10032601 | |||
| 2426 | Ga0207705_10042973 | |||
| 2427 | Ga0207705_10054666 | |||
| 2428 | Ga0207705_10092273 | |||
| 2429 | Ga0207705_10098584 | |||
| 2430 | Ga0207705_10151333 | |||
| 2431 | Ga0207705_10181400 | |||
| 2432 | Ga0207705_10594575 | |||
| 2433 | Ga0207684_10157468 | |||
| 2434 | Ga0207684_10206775 | |||
| 2435 | Ga0207684_10612518 | |||
| 2436 | Ga0207654_10014086 | |||
| 2437 | Ga0207654_10016525 | |||
| 2438 | Ga0207654_10055737 | |||
| 2439 | Ga0207654_10087604 | |||
| 2440 | Ga0207654_10235406 | |||
| 2441 | Ga0207707_10004840 | |||
| 2442 | Ga0207707_10007889 | |||
| 2443 | Ga0207707_10009646 | |||
| 2444 | Ga0207707_10010596 | |||
| 2445 | Ga0207707_10017467 | |||
| 2446 | Ga0207707_10052930 | |||
| 2447 | Ga0207707_10072756 | |||
| 2448 | Ga0207707_10080450 | |||
| 2449 | Ga0207707_10086625 | |||
| 2450 | Ga0207707_10109370 | |||
| 2451 | Ga0207707_10197346 | |||
| 2452 | Ga0207707_10212461 | |||
| 2453 | Ga0207707_10217043 | |||
| 2454 | Ga0207707_10231609 | |||
| 2455 | Ga0207707_10551186 | |||
| 2456 | Ga0207707_10649299 | |||
| 2457 | Ga0207695_10002872 | |||
| 2458 | Ga0207695_10070333 | |||
| 2459 | Ga0207695_10098281 | |||
| 2460 | Ga0207695_11220623 | |||
| 2461 | Ga0207671_10050059 | |||
| 2462 | Ga0207671_10075363 | |||
| 2463 | Ga0207671_10760032 | |||
| 2464 | Ga0207671_11100181 | |||
| 2465 | Ga0207693_10024434 | |||
| 2466 | Ga0207693_10067286 | |||
| 2467 | Ga0207693_10203837 | |||
| 2468 | Ga0207663_10015456 | |||
| 2469 | Ga0207663_10065283 | |||
| 2470 | Ga0207663_10070815 | |||
| 2471 | Ga0207663_10448449 | |||
| 2472 | Ga0207663_10648009 | |||
| 2473 | Ga0207660_10003947 | |||
| 2474 | Ga0207660_10005546 | |||
| 2475 | Ga0207660_10013616 | |||
| 2476 | Ga0207660_10015415 | |||
| 2477 | Ga0207660_10219632 | |||
| 2478 | Ga0207660_10253445 | |||
| 2479 | Ga0207660_10256531 | |||
| 2480 | Ga0207660_10267249 | |||
| 2481 | Ga0207660_10335292 | |||
| 2482 | Ga0207660_10393328 | |||
| 2483 | Ga0207660_10785627 | |||
| 2484 | Ga0207662_10000695 | |||
| 2485 | Ga0207662_10025034 | |||
| 2486 | Ga0207662_10065411 | |||
| 2487 | Ga0207662_10128649 | |||
| 2488 | Ga0207662_10400789 | |||
| 2489 | Ga0207657_10001221 | |||
| 2490 | Ga0207657_10062853 | |||
| 2491 | Ga0207657_10065284 | |||
| 2492 | Ga0207657_10070109 | |||
| 2493 | Ga0207657_10216093 | |||
| 2494 | Ga0207649_10009969 | |||
| 2495 | Ga0207649_10030909 | |||
| 2496 | Ga0207649_10094406 | |||
| 2497 | Ga0207649_10104596 | |||
| 2498 | Ga0207649_10188036 | |||
| 2499 | Ga0207649_10218226 | |||
| 2500 | Ga0207649_10440212 | |||
| 2501 | Ga0207649_10747572 | |||
| 2502 | Ga0207649_11001588 | |||
| 2503 | Ga0207649_11042501 | |||
| 2504 | Ga0207649_11176478 | |||
| 2505 | Ga0207652_10010525 | |||
| 2506 | Ga0207652_10019070 | |||
| 2507 | Ga0207652_10022531 | |||
| 2508 | Ga0207652_10024939 | |||
| 2509 | Ga0207652_10030387 | |||
| 2510 | Ga0207652_10030393 | |||
| 2511 | Ga0207652_10038617 | |||
| 2512 | Ga0207652_10051472 | |||
| 2513 | Ga0207652_10053487 | |||
| 2514 | Ga0207652_10059206 | |||
| 2515 | Ga0207652_10060752 | |||
| 2516 | Ga0207652_10095623 | |||
| 2517 | Ga0207652_10112378 | |||
| 2518 | Ga0207652_10122094 | |||
| 2519 | Ga0207652_10221021 | |||
| 2520 | Ga0207652_10320564 | |||
| 2521 | Ga0207652_10513127 | |||
| 2522 | Ga0207652_11001863 | |||
| 2523 | Ga0207652_11061457 | |||
| 2524 | Ga0207646_10036759 | |||
| 2525 | Ga0207646_10387026 | |||
| 2526 | Ga0207646_11374739 | |||
| 2527 | Ga0207681_10000921 | |||
| 2528 | Ga0207681_10003904 | |||
| 2529 | Ga0207681_10133321 | |||
| 2530 | Ga0207694_10032019 | |||
| 2531 | Ga0207694_10093377 | |||
| 2532 | Ga0207694_10131681 | |||
| 2533 | Ga0207694_10774552 | |||
| 2534 | Ga0207694_11163998 | |||
| 2535 | Ga0207650_10008332 | |||
| 2536 | Ga0207650_10010847 | |||
| 2537 | Ga0207650_10024087 | |||
| 2538 | Ga0207650_10138484 | |||
| 2539 | Ga0207650_10452033 | |||
| 2540 | Ga0207659_10033893 | |||
| 2541 | Ga0207659_10053327 | |||
| 2542 | Ga0207659_10066710 | |||
| 2543 | Ga0207659_10070326 | |||
| 2544 | Ga0207659_10086822 | |||
| 2545 | Ga0207659_10423006 | |||
| 2546 | Ga0207659_10833149 | |||
| 2547 | Ga0207659_11403709 | |||
| 2548 | Ga0207687_10037121 | |||
| 2549 | Ga0207687_10150311 | |||
| 2550 | Ga0207687_10154144 | |||
| 2551 | Ga0207687_10280132 | |||
| 2552 | Ga0207700_10005401 | |||
| 2553 | Ga0207700_10011785 | |||
| 2554 | Ga0207700_10115511 | |||
| 2555 | Ga0207700_10183149 | |||
| 2556 | Ga0207664_10024119 | |||
| 2557 | Ga0207664_10058055 | |||
| 2558 | Ga0207664_10274609 | |||
| 2559 | Ga0207644_10017509 | |||
| 2560 | Ga0207644_10042676 | |||
| 2561 | Ga0207644_10131979 | |||
| 2562 | Ga0207644_10287457 | |||
| 2563 | Ga0207644_10770691 | |||
| 2564 | Ga0207690_10005614 | |||
| 2565 | Ga0207690_10039477 | |||
| 2566 | Ga0207690_10076583 | |||
| 2567 | Ga0207690_10083806 | |||
| 2568 | Ga0207690_10100949 | |||
| 2569 | Ga0207690_10195197 | |||
| 2570 | Ga0207690_10232962 | |||
| 2571 | Ga0207690_10610324 | |||
| 2572 | Ga0207690_11400371 | |||
| 2573 | Ga0207706_10002035 | |||
| 2574 | Ga0207706_10021302 | |||
| 2575 | Ga0207706_10058994 | |||
| 2576 | Ga0207706_10078626 | |||
| 2577 | Ga0207706_10191043 | |||
| 2578 | Ga0207706_10222084 | |||
| 2579 | Ga0207706_10286537 | |||
| 2580 | Ga0207706_10506177 | |||
| 2581 | Ga0207706_10530792 | |||
| 2582 | Ga0207706_10792886 | |||
| 2583 | Ga0207686_10063591 | |||
| 2584 | Ga0207686_10145758 | |||
| 2585 | Ga0207686_10333273 | |||
| 2586 | Ga0207709_10375504 | |||
| 2587 | Ga0207709_11152533 | |||
| 2588 | Ga0207670_10201560 | |||
| 2589 | Ga0207670_10310221 | |||
| 2590 | Ga0207670_10482896 | |||
| 2591 | Ga0207669_10225585 | |||
| 2592 | Ga0207669_10397710 | |||
| 2593 | Ga0207704_10003676 | |||
| 2594 | Ga0207704_10143905 | |||
| 2595 | Ga0207704_10228873 | |||
| 2596 | Ga0207704_10302377 | |||
| 2597 | Ga0207704_10690514 | |||
| 2598 | Ga0207665_10007307 | |||
| 2599 | Ga0207665_10047631 | |||
| 2600 | Ga0207665_10055046 | |||
| 2601 | Ga0207665_10083405 | |||
| 2602 | Ga0207665_10366321 | |||
| 2603 | Ga0207691_10031365 | |||
| 2604 | Ga0207691_10078519 | |||
| 2605 | Ga0207691_10091256 | |||
| 2606 | Ga0207691_10114355 | |||
| 2607 | Ga0207691_10117042 | |||
| 2608 | Ga0207691_10139985 | |||
| 2609 | Ga0207691_10196036 | |||
| 2610 | Ga0207691_10300080 | |||
| 2611 | Ga0207711_10030916 | |||
| 2612 | Ga0207711_10035753 | |||
| 2613 | Ga0207711_10448035 | |||
| 2614 | Ga0207711_10499913 | |||
| 2615 | Ga0207711_10675824 | |||
| 2616 | Ga0207689_10002743 | |||
| 2617 | Ga0207689_10004653 | |||
| 2618 | Ga0207689_10115700 | |||
| 2619 | Ga0207689_10650612 | |||
| 2620 | Ga0207661_10000283 | |||
| 2621 | Ga0207661_10022845 | |||
| 2622 | Ga0207661_10024896 | |||
| 2623 | Ga0207661_10032109 | |||
| 2624 | Ga0207661_10032571 | |||
| 2625 | Ga0207661_10033441 | |||
| 2626 | Ga0207661_10034228 | |||
| 2627 | Ga0207661_10040186 | |||
| 2628 | Ga0207661_10043331 | |||
| 2629 | Ga0207661_10052340 | |||
| 2630 | Ga0207661_10078935 | |||
| 2631 | Ga0207661_10120202 | |||
| 2632 | Ga0207661_10133091 | |||
| 2633 | Ga0207661_10164939 | |||
| 2634 | Ga0207661_10191767 | |||
| 2635 | Ga0207661_10330196 | |||
| 2636 | Ga0207661_10429027 | |||
| 2637 | Ga0207661_10700213 | |||
| 2638 | Ga0207679_10000582 | |||
| 2639 | Ga0207679_10002943 | |||
| 2640 | Ga0207679_10005438 | |||
| 2641 | Ga0207679_10012892 | |||
| 2642 | Ga0207679_10106820 | |||
| 2643 | Ga0207679_10244714 | |||
| 2644 | Ga0207679_10246648 | |||
| 2645 | Ga0207679_10846872 | |||
| 2646 | Ga0207679_10939675 | |||
| 2647 | Ga0207679_11024059 | |||
| 2648 | Ga0207679_11142734 | |||
| 2649 | Ga0207667_10023205 | |||
| 2650 | Ga0207667_10123502 | |||
| 2651 | Ga0207667_10282749 | |||
| 2652 | Ga0207667_10296693 | |||
| 2653 | Ga0207667_10399427 | |||
| 2654 | Ga0207667_10555533 | |||
| 2655 | Ga0207667_11205444 | |||
| 2656 | Ga0207651_10049298 | |||
| 2657 | Ga0207651_10059532 | |||
| 2658 | Ga0207651_10127416 | |||
| 2659 | Ga0207651_10354095 | |||
| 2660 | Ga0207651_10864518 | |||
| 2661 | Ga0207651_10956532 | |||
| 2662 | Ga0207651_11201331 | |||
| 2663 | Ga0207712_10000596 | |||
| 2664 | Ga0207712_10009138 | |||
| 2665 | Ga0207712_10307834 | |||
| 2666 | Ga0207712_10542610 | |||
| 2667 | Ga0207712_10730864 | |||
| 2668 | Ga0207668_10002447 | |||
| 2669 | Ga0207668_10057777 | |||
| 2670 | Ga0207668_10780417 | |||
| 2671 | Ga0207640_10003334 | |||
| 2672 | Ga0207640_10082778 | |||
| 2673 | Ga0207640_10093505 | |||
| 2674 | Ga0207640_10157883 | |||
| 2675 | Ga0207658_10048536 | |||
| 2676 | Ga0207658_10092199 | |||
| 2677 | Ga0207658_10163877 | |||
| 2678 | Ga0207658_10288807 | |||
| 2679 | Ga0207658_10326477 | |||
| 2680 | Ga0207658_10392764 | |||
| 2681 | Ga0207658_10573601 | |||
| 2682 | Ga0207658_11006515 | |||
| 2683 | Ga0207677_10043997 | |||
| 2684 | Ga0207677_10109304 | |||
| 2685 | Ga0207703_10008320 | |||
| 2686 | Ga0207703_10086206 | |||
| 2687 | Ga0207703_10207911 | |||
| 2688 | Ga0207639_10006779 | |||
| 2689 | Ga0207639_10030610 | |||
| 2690 | Ga0207678_10004647 | |||
| 2691 | Ga0207678_10043220 | |||
| 2692 | Ga0207678_10086730 | |||
| 2693 | Ga0207678_10311581 | |||
| 2694 | Ga0207678_10470336 | |||
| 2695 | Ga0207708_10004898 | |||
| 2696 | Ga0207708_10015391 | |||
| 2697 | Ga0207708_10230197 | |||
| 2698 | Ga0207708_10283465 | |||
| 2699 | Ga0207708_10473194 | |||
| 2700 | Ga0207708_10914246 | |||
| 2701 | Ga0207708_11309569 | |||
| 2702 | Ga0207702_10059273 | |||
| 2703 | Ga0207702_10066121 | |||
| 2704 | Ga0207702_10128018 | |||
| 2705 | Ga0207702_10254414 | |||
| 2706 | Ga0207702_10300475 | |||
| 2707 | Ga0207702_10362301 | |||
| 2708 | Ga0207702_10409846 | |||
| 2709 | Ga0207702_10434302 | |||
| 2710 | Ga0207641_10011831 | |||
| 2711 | Ga0207641_10051528 | |||
| 2712 | Ga0207641_10156827 | |||
| 2713 | Ga0207641_10444388 | |||
| 2714 | Ga0207641_10488199 | |||
| 2715 | Ga0207648_10050849 | |||
| 2716 | Ga0207648_10078510 | |||
| 2717 | Ga0207648_10160589 | |||
| 2718 | Ga0207648_10226026 | |||
| 2719 | Ga0207648_10280164 | |||
| 2720 | Ga0207648_10343769 | |||
| 2721 | Ga0207648_10457233 | |||
| 2722 | Ga0207648_10509219 | |||
| 2723 | Ga0207648_10770790 | |||
| 2724 | Ga0207676_10003341 | |||
| 2725 | Ga0207676_10060399 | |||
| 2726 | Ga0207676_10076932 | |||
| 2727 | Ga0207676_10950945 | |||
| 2728 | Ga0207674_10000393 | |||
| 2729 | Ga0207674_10037409 | |||
| 2730 | Ga0207674_10052391 | |||
| 2731 | Ga0207674_10086730 | |||
| 2732 | Ga0207674_10162014 | |||
| 2733 | Ga0207674_10162129 | |||
| 2734 | Ga0207674_10199528 | |||
| 2735 | Ga0207674_10602524 | |||
| 2736 | Ga0207674_11103797 | |||
| 2737 | Ga0207675_100035125 | |||
| 2738 | Ga0207675_100066788 | |||
| 2739 | Ga0207675_100251963 | |||
| 2740 | Ga0207675_100288971 | |||
| 2741 | Ga0207683_10011631 | |||
| 2742 | Ga0207683_10065766 | |||
| 2743 | Ga0207683_10133251 | |||
| 2744 | Ga0207683_10356212 | |||
| 2745 | Ga0207683_10469575 | |||
| 2746 | Ga0207698_10003179 | |||
| 2747 | Ga0207698_10110213 | |||
| 2748 | Ga0207698_10111646 | |||
| 2749 | Ga0207698_10156911 | |||
| 2750 | Ga0207698_10205773 | |||
| 2751 | Ga0207698_10211634 | |||
| 2752 | Ga0207698_10415751 | |||
| 2753 | Ga0207698_10495048 | |||
| 2754 | Ga0207698_10576244 | |||
| 2755 | Ga0207698_11163073 | |||
| 2756 | Ga0209973_1016475 | |||
| 2757 | Ga0209969_1004422 | |||
| 2758 | Ga0209969_1030639 | |||
| 2759 | Ga0209967_1004046 | |||
| 2760 | Ga0209981_1025450 | |||
| 2761 | Ga0209996_1002715 | |||
| 2762 | Ga0209984_1001682 | |||
| 2763 | Ga0210000_1024268 | |||
| 2764 | Ga0210000_1032642 | |||
| 2765 | Ga0209995_1003547 | |||
| 2766 | Ga0209968_1000569 | |||
| 2767 | Ga0209968_1003722 | |||
| 2768 | Ga0209968_1005690 | |||
| 2769 | Ga0209999_1001998 | |||
| 2770 | Ga0209999_1015607 | |||
| 2771 | Ga0209970_1000622 | |||
| 2772 | Ga0209983_1002684 | |||
| 2773 | Ga0209983_1043003 | |||
| 2774 | Ga0209971_1000924 | |||
| 2775 | Ga0209971_1012252 | |||
| 2776 | Ga0209966_1000766 | |||
| 2777 | Ga0209966_1018755 | |||
| 2778 | Ga0209966_1024816 | |||
| 2779 | Ga0209998_10001270 | |||
| 2780 | Ga0209998_10002526 | |||
| 2781 | Ga0209974_10000553 | |||
| 2782 | Ga0209974_10004293 | |||
| 2783 | Ga0209974_10270091 | |||
| 2784 | Ga0207428_10026272 | |||
| 2785 | Ga0207428_10063585 | |||
| 2786 | Ga0207428_10302674 | |||
| 2787 | Ga0207428_10562785 | |||
| 2788 | Ga0207428_10625205 | |||
| 2789 | Ga0207428_10901635 | |||
| 2790 | Ga0268266_10062029 | |||
| 2791 | Ga0268266_10476443 | |||
| 2792 | Ga0268265_10003125 | |||
| 2793 | Ga0268265_10004276 | |||
| 2794 | Ga0268265_10012616 | |||
| 2795 | Ga0268265_10112369 | |||
| 2796 | Ga0268265_10259200 | |||
| 2797 | Ga0268265_10699297 | |||
| 2798 | Ga0268265_11221677 | |||
| 2799 | Ga0268264_10108473 | |||
| 2800 | Ga0268264_10152207 | |||
| 2801 | Ga0268264_10617802 | |||
| 2802 | Ga0268264_11071362 | |||
| 2803 | Ga0316182_1261896 | |||
| 2804 | Ga0316182_1379587 | |||
| 2805 | Ga0316182_1386424 | |||
| 2806 | Ga0265329_10045799 | |||
| 2807 | Ga0265340_10088642 | |||
| 2808 | Ga0265327_10004242 | |||
| 2809 | Ga0265316_10180769 | |||
| 2810 | Ga0307408_100002257 | |||
| 2811 | Ga0307408_100005087 | |||
| 2812 | Ga0307408_100064252 | |||
| 2813 | Ga0307408_100250678 | |||
| 2814 | Ga0307408_100517971 | |||
| 2815 | Ga0307408_100645533 | |||
| 2816 | Ga0307408_101457208 | |||
| 2817 | Ga0307408_101821817 | |||
| 2818 | Ga0265314_10003494 | |||
| 2819 | Ga0265314_10032497 | |||
| 2820 | Ga0307405_10000393 | |||
| 2821 | Ga0307405_10013731 | |||
| 2822 | Ga0307405_10068958 | |||
| 2823 | Ga0307405_10112556 | |||
| 2824 | Ga0307405_10116031 | |||
| 2825 | Ga0307405_10134272 | |||
| 2826 | Ga0307405_10326055 | |||
| 2827 | Ga0307405_10462222 | |||
| 2828 | Ga0307405_11039212 | |||
| 2829 | Ga0307413_10002711 | |||
| 2830 | Ga0307413_10018606 | |||
| 2831 | Ga0307413_10025417 | |||
| 2832 | Ga0307413_10035504 | |||
| 2833 | Ga0307413_10131137 | |||
| 2834 | Ga0307413_10336426 | |||
| 2835 | Ga0307413_10538509 | |||
| 2836 | Ga0307410_10009624 | |||
| 2837 | Ga0307410_10012945 | |||
| 2838 | Ga0307410_10028873 | |||
| 2839 | Ga0307410_10120218 | |||
| 2840 | Ga0307410_10203073 | |||
| 2841 | Ga0307410_10213940 | |||
| 2842 | Ga0307410_10351161 | |||
| 2843 | Ga0307410_10368859 | |||
| 2844 | Ga0307410_10397097 | |||
| 2845 | Ga0307410_10465426 | |||
| 2846 | Ga0307410_10741337 | |||
| 2847 | Ga0307410_11404178 | |||
| 2848 | Ga0307406_10002236 | |||
| 2849 | Ga0307406_10002275 | |||
| 2850 | Ga0307406_10031805 | |||
| 2851 | Ga0307406_10038979 | |||
| 2852 | Ga0307406_10086657 | |||
| 2853 | Ga0307406_10112385 | |||
| 2854 | Ga0307406_10441163 | |||
| 2855 | Ga0307406_10604777 | |||
| 2856 | Ga0307406_10827485 | |||
| 2857 | Ga0307406_11068608 | |||
| 2858 | Ga0307406_11098349 | |||
| 2859 | Ga0307406_11202909 | |||
| 2860 | Ga0307407_10002439 | |||
| 2861 | Ga0307407_10008217 | |||
| 2862 | Ga0307407_10025879 | |||
| 2863 | Ga0307407_10026314 | |||
| 2864 | Ga0307407_10056184 | |||
| 2865 | Ga0307407_10100259 | |||
| 2866 | Ga0307407_10116140 | |||
| 2867 | Ga0307407_10214253 | |||
| 2868 | Ga0307407_10264661 | |||
| 2869 | Ga0307412_10061115 | |||
| 2870 | Ga0307412_10106474 | |||
| 2871 | Ga0307412_10110574 | |||
| 2872 | Ga0307412_10430971 | |||
| 2873 | Ga0307412_10776448 | |||
| 2874 | Ga0307409_100007004 | |||
| 2875 | Ga0307409_100013524 | |||
| 2876 | Ga0307409_100033936 | |||
| 2877 | Ga0307409_100053133 | |||
| 2878 | Ga0307409_100079698 | |||
| 2879 | Ga0307409_100088383 | |||
| 2880 | Ga0307409_100310418 | |||
| 2881 | Ga0307409_100798589 | |||
| 2882 | Ga0307416_100001410 | |||
| 2883 | Ga0307416_100004575 | |||
| 2884 | Ga0307416_100077891 | |||
| 2885 | Ga0307416_100086493 | |||
| 2886 | Ga0307416_100106648 | |||
| 2887 | Ga0307416_100148020 | |||
| 2888 | Ga0307416_100169464 | |||
| 2889 | Ga0307416_100505078 | |||
| 2890 | Ga0307416_100557524 | |||
| 2891 | Ga0307416_100640730 | |||
| 2892 | Ga0307416_100748296 | |||
| 2893 | Ga0307416_101028054 | |||
| 2894 | Ga0307416_101279839 | |||
| 2895 | Ga0307414_10021292 | |||
| 2896 | Ga0307414_10029119 | |||
| 2897 | Ga0307414_10101375 | |||
| 2898 | Ga0307414_10169550 | |||
| 2899 | Ga0307414_10170092 | |||
| 2900 | Ga0307414_11111437 | |||
| 2901 | Ga0307411_10006203 | |||
| 2902 | Ga0307411_10007886 | |||
| 2903 | Ga0307411_10018407 | |||
| 2904 | Ga0307411_10039445 | |||
| 2905 | Ga0307411_10057273 | |||
| 2906 | Ga0307411_10238532 | |||
| 2907 | Ga0307411_10245593 | |||
| 2908 | Ga0307411_10250612 | |||
| 2909 | Ga0307411_10418317 | |||
| 2910 | Ga0307415_100008524 | |||
| 2911 | Ga0307415_100008871 | |||
| 2912 | Ga0307415_100121793 | |||
| 2913 | Ga0307415_100123143 | |||
| 2914 | Ga0307415_100164995 | |||
| 2915 | Ga0307415_100176560 | |||
| 2916 | Ga0307415_100511153 | |||
| 2917 | Ga0307415_100608132 | |||
| 2918 | Ga0307415_100724967 | |||
| 2919 | Ga0307415_101587937 | |||
| 2920 | Ga0307415_101744109 | |||
| 2921 | Ga0373948_0011529 | |||
| 2922 | Ga0373958_0025875 | |||
| 2923 | Ga0373958_0031089 | |||
| 2924 | Ga0373959_0003885 | |||
| 2925 | Ga0373926_0004875 | |||
| 2926 | Ga0373929_0014598 | |||
| 2927 | Ga0373934_0001950 | |||
| 2928 | Ga0373934_0017874 | |||
| 2929 | Ga0373940_0043179 | |||
| 2930 | Ga0373940_0044261 | |||
| 2931 | Ga0373944_0247503 | |||
| 2932 | Ga0373949_0019486 | |||
| 2933 | Ga0373952_0035326 | |||
| 2934 | Ga0373952_0113436 | |||
| 2935 | Ga0373923_0052282 | |||
| 2936 | Ga0373939_0004065 | |||
| 2937 | Ga0373939_0104699 | |||
| 2938 | Ga0373941_0004689 | |||
| 2939 | Ga0373941_0040016 | |||
| 2940 | Ga0373945_0008197 | |||
| 2941 | Ga0373945_0010977 | |||
| 2942 | Ga0373953_0012022 | |||
| 2943 | Ga0373953_0171740 | |||
| 2944 | Ga0373954_0032792 | |||
| 2945 | Ga0373957_0007100 | |||
| 2946 | Ga0373957_0270146 | |||
| 2947 | Ga0373960_0013130 | |||
| 2948 | Ga0373960_0055009 | |||
| 2949 | Ga0373960_0072608 | |||
| 2950 | Ga0373943_0002422 | |||
| 2951 | Ga0373946_0002485 | |||
| 2952 | Ga0373955_0001621 | |||
| 2953 | Ga0373955_0010972 | |||
| 2954 | Ga0373955_0239824 | |||
| 2955 | Ga0373942_0012467 | |||
| 2956 | Ga0373961_0042255 | |||
| 2957 | Ga0373961_0049360 | |||
| 2958 | Ga0373961_0050034 | |||
| 2959 | Ga0373961_0081022 | |||
| 2960 | Ga0373962_0040324 | |||
| 2961 | Ga0373924_0046941 | |||
| 2962 | Ga0373931_0010909 | |||
| 2963 | Ga0373931_0848899 | |||
| 2964 | Ga0373935_0001207 | |||
| 2965 | Ga0373935_0160633 | |||
| 2966 | Ga0373935_0209603 | |||
| 2967 | Ga0373935_0293890 | |||
| 2968 | Ga0373935_0319523 | |||
| 2969 | Ga0373927_0012867 | |||
| 2970 | Ga0373927_0024739 | |||
| 2971 | Ga0373927_0133583 | |||
| 2972 | Ga0373927_0241346 | |||
| 2973 | Ga0373927_0295112 | |||
| 2974 | Ga0373933_0071250 | |||
| 2975 | Ga0373947_0000036 | |||
| 2976 | Ga0373937_0028903 | |||
| 2977 | Ga0373937_0030183 | |||
| 2978 | Ga0373937_0294252 | |||
| 2979 | Ga0373937_0349015 | |||
| 2980 | Ga0373937_1405769 | |||
| 2981 | Ga0373925_0002900 | |||
| 2982 | Ga0373925_0079107 | |||
| 2983 | Ga0395899_0024945 | |||
| 2984 | Ga0395899_0252138 | |||
| 2985 | Ga0395900_0018069 | |||
| 2986 | Ga0395898_0092700 | |||
| 2987 | Ga0395898_1325841 | |||
| 2988 | Ga0395905_0024022 | |||
| 2989 | Ga0395905_0518557 | |||
| 2990 | Ga0395905_1111444 | |||
| 2991 | Ga0436364_1341442 | |||
| 2992 | Ga0395901_0013649 | |||
| 2993 | Ga0395901_0433913 | |||
| 2994 | Ga0395901_0971620 | |||
| 2995 | Ga0436365_0453863 | |||
| 2996 | Ga0436365_0527755 | |||
| 2997 | Ga0436365_1474633 | |||
| 2998 | Ga0436363_1364797 | |||
| 2999 | Ga0439439_0048612 | |||
| 3000 | Ga0439439_0056597 | |||
| 3001 | Ga0439461_0106727 | |||
| 3002 | Ga0451849_0697007 | |||
| 3003 | Ga0439433_0045714 | |||
| 3004 | Ga0439448_0165838 | |||
| 3005 | Ga0439432_112596 | |||
| 3006 | Ga0439449_0137510 | |||
| 3007 | Ga0439457_077101 | |||
| 3008 | Ga0450914_038316 | |||
| 3009 | Ga0439434_0045677 | |||
| 3010 | Ga0439464_0014107 | |||
| 3011 | Ga0450918_048213 | |||
| 3012 | Ga0451577_0052812 | |||
| 3013 | Ga0451577_0061827 | |||
| 3014 | Ga0451577_0272209 | |||
| 3015 | Ga0453683_0422606 | |||
| 3016 | Ga0453683_1051357 | |||
| 3017 | Ga0466965_0367195 | |||
| 3018 | Ga0466966_0002321 | |||
| 3019 | Ga0466966_0405162 | |||
| 3020 | Ga0466961_0193427 | |||
| 3021 | Ga0466961_0252437 | |||
| 3022 | Ga0453684_0007935 | |||
| 3023 | Ga0453684_0680474 | |||
| 3024 | Ga0466959_0083014 | |||
| 3025 | Ga0466959_0102056 | |||
| 3026 | Ga0466959_0159260 | |||
| 3027 | Ga0451576_0055578 | |||
| 3028 | Ga0451576_0299384 | |||
| 3029 | Ga0451576_0394688 | |||
| 3030 | Ga0451576_0646029 | |||
| 3031 | Ga0466958_0320546 | |||
| 3032 | Ga0466967_0016772 | |||
| 3033 | Ga0466967_0197468 | |||
| 3034 | Ga0495592_0059098 | |||
| 3035 | Ga0495592_0090958 | |||
| 3036 | Ga0495603_0000774 | |||
| 3037 | Ga0495603_0061064 | |||
| 3038 | Ga0495603_0391216 | |||
| 3039 | Ga0495629_0025246 | |||
| 3040 | Ga0495629_0046147 | |||
| 3041 | Ga0495629_0051921 | |||
| 3042 | Ga0495629_0129738 | |||
| 3043 | Ga0495629_0135653 | |||
| 3044 | Ga0495651_0007272 | |||
| 3045 | Ga0495653_0026336 | |||
| 3046 | Ga0495653_0190493 | |||
| 3047 | Ga0495580_0000048 | |||
| 3048 | Ga0495580_0005246 | |||
| 3049 | Ga0495580_0251168 | |||
| 3050 | Ga0495580_0317252 | |||
| 3051 | Ga0495580_0603293 | |||
| 3052 | Ga0495582_0000179 | |||
| 3053 | Ga0495582_0089405 | |||
| 3054 | Ga0495582_0190051 | |||
| 3055 | Ga0495582_0190118 | |||
| 3056 | Ga0495639_0000917 | |||
| 3057 | Ga0495639_0025267 | |||
| 3058 | Ga0495639_0124255 | |||
| 3059 | Ga0495639_0128318 | |||
| 3060 | Ga0495639_0153678 | |||
| 3061 | Ga0495662_0045613 | |||
| 3062 | Ga0495662_0148930 | |||
| 3063 | Ga0495664_0052972 | |||
| 3064 | Ga0495664_0065508 | |||
| 3065 | Ga0495664_0119664 | |||
| 3066 | Ga0495664_0200678 | |||
| 3067 | Ga0495585_0484234 | |||
| 3068 | Ga0495594_0023704 | |||
| 3069 | Ga0495594_0050634 | |||
| 3070 | Ga0495594_0056042 | |||
| 3071 | Ga0495594_0082577 | |||
| 3072 | Ga0495594_0150217 | |||
| 3073 | Ga0495596_0059166 | |||
| 3074 | Ga0495608_0031708 | |||
| 3075 | Ga0495618_0288660 | |||
| 3076 | Ga0495620_0049369 | |||
| 3077 | Ga0495628_0101738 | |||
| 3078 | Ga0495628_0149404 | |||
| 3079 | Ga0495628_0180853 | |||
| 3080 | Ga0495628_0499176 | |||
| 3081 | Ga0495630_0004558 | |||
| 3082 | Ga0495630_0085911 | |||
| 3083 | Ga0495630_0188289 | |||
| 3084 | Ga0495631_0265938 | |||
| 3085 | Ga0495644_0121267 | |||
| 3086 | Ga0495666_0036458 | |||
| 3087 | Ga0495642_0091528 | |||
| 3088 | Ga0495642_0251978 | |||
| 3089 | Ga0495652_0075969 | |||
| 3090 | Ga0495652_0108848 | |||
| 3091 | Ga0495665_0000002 | |||
| 3092 | Ga0495665_0037940 | |||
| 3093 | Ga0495665_0044551 | |||
| 3094 | Ga0495665_0104079 | |||
| 3095 | Ga0495665_0195919 | |||
| 3096 | Ga0495665_0228634 | |||
| 3097 | Ga0495640_0045556 | |||
| 3098 | Ga0495640_0521255 | |||
| 3099 | Ga0495586_0075598 | |||
| 3100 | Ga0495586_0239426 | |||
| 3101 | Ga0495587_0009315 | |||
| 3102 | Ga0495587_0020967 | |||
| 3103 | Ga0495587_0071142 | |||
| 3104 | Ga0495587_0307965 | |||
| 3105 | Ga0495598_0188507 | |||
| 3106 | Ga0495621_0257239 | |||
| 3107 | Ga0495645_0004375 | |||
| 3108 | Ga0495645_0144276 | |||
| 3109 | Ga0495645_0182107 | |||
| 3110 | Ga0495622_0104163 | |||
| 3111 | Ga0495667_0012198 | |||
| 3112 | Ga0495667_0012237 | |||
| 3113 | Ga0495667_0096831 | |||
| 3114 | Ga0495667_0202194 | |||
| 3115 | Ga0495667_0476114 | |||
| 3116 | Ga0495634_0078582 | |||
| 3117 | Ga0495634_0085652 | |||
| 3118 | Ga0495634_0135824 | |||
| 3119 | Ga0495635_0073192 | |||
| 3120 | Ga0495635_0200298 | |||
| 3121 | Ga0495635_0238196 | |||
| 3122 | Ga0495659_0168281 | |||
| 3123 | Ga0495659_0337323 | |||
| 3124 | Ga0495588_0000464 | |||
| 3125 | Ga0495588_0200108 | |||
| 3126 | Ga0495588_0462174 | |||
| 3127 | Ga0495588_0660673 | |||
| 3128 | Ga0495657_0007724 | |||
| 3129 | Ga0495657_0353614 | |||
| 3130 | Ga0495599_0017331 | |||
| 3131 | Ga0495599_0022659 | |||
| 3132 | Ga0495599_0060889 | |||
| 3133 | Ga0495623_0009437 | |||
| 3134 | Ga0495623_0019422 | |||
| 3135 | Ga0495623_0116001 | |||
| 3136 | Ga0495658_0000017 | |||
| 3137 | Ga0495658_0034200 | |||
| 3138 | Ga0495658_0085320 | |||
| 3139 | Ga0495658_0088542 | |||
| 3140 | Ga0495669_0162868 | |||
| 3141 | Ga0495669_0295436 | |||
| 3142 | Ga0495613_0024110 | |||
| 3143 | Ga0495613_0095423 | |||
| 3144 | Ga0495613_0264410 | |||
| 3145 | Ga0495613_0272776 | |||
| 3146 | Ga0495670_0152555 | |||
| 3147 | Ga0495600_0030035 | |||
| 3148 | Ga0495600_0068897 | |||
| 3149 | Ga0495600_0373586 | |||
| 3150 | Ga0495581_0000312 | |||
| 3151 | Ga0495581_0015316 | |||
| 3152 | Ga0495581_0155211 | |||
| 3153 | Ga0495581_0426975 | |||
| 3154 | Ga0495604_0034670 | |||
| 3155 | Ga0495604_0169824 | |||
| 3156 | Ga0495604_0261367 | |||
| 3157 | Ga0495604_0379121 | |||
| 3158 | Ga0495636_0181890 | |||
| 3159 | Ga0495674_0024914 | |||
| 3160 | Ga0495674_0092120 | |||
| 3161 | Ga0495674_0174987 | |||
| 3162 | Ga0495672_0003004 | |||
| 3163 | Ga0495676_0120349 | |||
| 3164 | Ga0495680_0091173 | |||
| 3165 | Ga0495680_0197314 | |||
| 3166 | Ga0495680_0314323 | |||
| 3167 | Ga0495675_0026681 | |||
| 3168 | Ga0495675_0114593 | |||
| 3169 | Ga0495675_0173492 | |||
| 3170 | Ga0495675_0192174 | |||
| 3171 | Ga0495677_0054921 | |||
| 3172 | Ga0495677_0127135 | |||
| 3173 | Ga0495685_079177 | |||
| 3174 | Ga0495681_0169572 | |||
| 3175 | Ga0495684_0010619 | |||
| 3176 | Ga0495684_0051096 | |||
| 3177 | Ga0495684_0170599 | |||
| 3178 | Ga0495593_0000009 | |||
| 3179 | Ga0495593_0225905 | |||
| 3180 | Ga0495593_0253689 | |||
| 3181 | Ga0495602_0139637 | |||
| 3182 | Ga0495602_0391914 | |||
| 3183 | Ga0495614_0000005 | |||
| 3184 | Ga0495614_0080470 | |||
| 3185 | Ga0495614_0104335 | |||
| 3186 | Ga0495615_0004404 | |||
| 3187 | Ga0496100_0051928 | |||
| 3188 | Ga0496102_0045307 | |||
| 3189 | Ga0496102_0372073 | |||
| 3190 | Ga0496103_0063254 | |||
| 3191 | Ga0496104_0035477 | |||
| 3192 | Ga0496104_0188251 | |||
| 3193 | Ga0496105_0034848 | |||
| 3194 | Ga0496105_0481339 | |||
| 3195 | Ga0496106_0092000 | |||
| 3196 | Ga0496106_0098435 | |||
| 3197 | Ga0496107_0096470 | |||
| 3198 | Ga0496107_0638516 | |||
| 3199 | Ga0496108_0138948 | |||
| 3200 | Ga0496108_0515253 | |||
| 3201 | Ga0496109_0062007 | |||
| 3202 | Ga0496109_0213158 | |||
| 3203 | Ga0496110_0131572 | |||
| 3204 | Ga0496110_0331004 | |||
| 3205 | Ga0496110_0864425 | |||
| 3206 | Ga0496111_0588139 | |||
| 3207 | Ga0496112_0007357 | |||
| 3208 | Ga0496112_0011512 | |||
| 3209 | Ga0496112_0061746 | |||
| 3210 | Ga0496112_0125606 | |||
| 3211 | Ga0496112_0159113 | |||
| 3212 | Ga0496112_0198054 | |||
| 3213 | Ga0496112_0337636 | |||
| 3214 | Ga0496113_0034556 | |||
| 3215 | Ga0496113_0125789 | |||
| 3216 | Ga0496115_0303651 | |||
| 3217 | Ga0496115_0720737 | |||
| 3218 | Ga0501306_013293 | |||
| 3219 | Ga0501306_019523 | |||
| 3220 | Ga0501308_023243 | |||
| 3221 | Ga0501309_001393 | |||
| 3222 | Ga0501309_010333 | |||
| 3223 | Ga0501307_000980 | |||
| 3224 | Ga0501307_001114 | |||
| 3225 | Ga0501307_007862 | |||
| 3226 | Ga0501307_038351 | |||
| 3227 | Ga0501291_123184 | |||
| 3228 | Ga0501298_028587 | |||
| 3229 | Ga0501299_052756 | |||
| 3230 | Ga0501311_002476 | |||
| 3231 | Ga0501311_004538 | |||
| 3232 | Ga0501311_016925 | |||
| 3233 | Ga0501312_056549 | |||
| 3234 | Ga0501313_004470 | |||
| 3235 | Ga0501315_021987 | |||
| 3236 | Ga0501316_009249 | |||
| 3237 | Ga0501316_010847 | |||
| 3238 | Ga0501316_011289 | |||
| 3239 | Ga0501317_013796 | |||
| 3240 | Ga0501320_023190 | |||
| 3241 | Ga0501323_008090 | |||
| 3242 | Ga0501323_026219 | |||
| 3243 | Ga0501324_001625 | |||
| 3244 | Ga0501031_0074621 | |||
| 3245 | Ga0501031_0209344 | |||
| 3246 | Ga0501032_0033574 | |||
| 3247 | Ga0501033_0466893 | |||
| 3248 | Ga0501034_0556562 | |||
| 3249 | Ga0501034_0642092 | |||
| 3250 | Ga0501036_0127060 | |||
| 3251 | Ga0501037_0308337 | |||
| 3252 | Ga0501038_0513461 | |||
| 3253 | Ga0501038_0712879 | |||
| 3254 | Ga0501039_0375285 | |||
| 3255 | Ga0501040_0431791 | |||
| 3256 | Ga0501043_0055578 | |||
| 3257 | Ga0501043_0185422 | |||
| 3258 | Ga0501046_0129806 | |||
| 3259 | Ga0501047_0014779 | |||
| 3260 | Ga0501047_0196179 | |||
| 3261 | Ga0501067_0399161 | |||
| 3262 | Ga0501070_0061451 | |||
| 3263 | Ga0501070_0106773 | |||
| 3264 | Ga0501071_0079085 | |||
| 3265 | Ga0501071_0331773 | |||
| 3266 | Ga0501072_1237048 | |||
| 3267 | Ga0501073_0268094 | |||
| 3268 | Ga0501073_0393792 | |||
| 3269 | Ga0501074_0214188 | |||
| 3270 | Ga0501074_0553289 | |||
| 3271 | Ga0501075_0126690 | |||
| 3272 | Ga0501075_0180257 | |||
| 3273 | Ga0501076_0325659 | |||
| 3274 | Ga0501076_0984491 | |||
| 3275 | Ga0501198_083668 | |||
| 3276 | Ga0501202_164123 | |||
| 3277 | Ga0501206_056896 | |||
| 3278 | Ga0501207_069832 | |||
| 3279 | Ga0501217_024873 | |||
| 3280 | Ga0501224_007129 | |||
| 3281 | Ga0501227_032223 | |||
| 3282 | Ga0501227_164012 | |||
| 3283 | Ga0501233_032767 | |||
| 3284 | Ga0501235_001630 | |||
| 3285 | Ga0501248_016002 | |||
| 3286 | Ga0501249_002095 | |||
| 3287 | Ga0501250_022605 | |||
| 3288 | Ga0501257_071687 | |||
| 3289 | Ga0501257_104848 | |||
| 3290 | Ga0501259_034647 | |||
| 3291 | Ga0501261_023703 | |||
| 3292 | Ga0501219_006160 | |||
| 3293 | Ga0501225_0007423 | |||
| 3294 | Ga0501234_006534 | |||
| 3295 | Ga0501079_0110450 | |||
| 3296 | Ga0501079_0180034 | |||
| 3297 | Ga0501080_0053870 | |||
| 3298 | Ga0501080_0212868 | |||
| 3299 | Ga0501080_0641315 | |||
| 3300 | Ga0501080_0738704 | |||
| 3301 | Ga0501081_0086410 | |||
| 3302 | Ga0501083_0369517 | |||
| 3303 | Ga0501232_010651 | |||
| 3304 | Ga0501266_005651 | |||
| 3305 | Ga0501268_001269 | |||
| 3306 | Ga0501268_055351 | |||
| 3307 | Ga0501272_007479 | |||
| 3308 | Ga0501035_0046302 | |||
| 3309 | Ga0501035_0210590 | |||
| 3310 | Ga0501035_0324916 | |||
| 3311 | Ga0501045_0418500 | |||
| 3312 | Ga0501212_076168 | |||
| 3313 | nmdc:mga05p37_1266157_c1 | |||
| 3314 | nmdc:mga05p37_160485_c1 | |||
| 3315 | nmdc:mga05p37_19612_c1 | |||
| 3316 | nmdc:mga05p37_271519_c1 | |||
| 3317 | nmdc:mga05p37_3917_c1 | |||
| 3318 | nmdc:mga05p37_82274_c1 | |||
| 3319 | nmdc:mga09592_140785_c1 | |||
| 3320 | nmdc:mga09592_15413_c1 | |||
| 3321 | nmdc:mga09592_188306_c1 | |||
| 3322 | nmdc:mga09592_227605_c1 | |||
| 3323 | nmdc:mga09592_40739_c1 | |||
| 3324 | nmdc:mga09592_430636_c1 | |||
| 3325 | nmdc:mga09592_49688_c1 | |||
| 3326 | nmdc:mga0qj67_158748_c1 | |||
| 3327 | nmdc:mga0qj67_177890_c1 | |||
| 3328 | nmdc:mga0qj67_187451_c1 | |||
| 3329 | nmdc:mga0qj67_247879_c1 | |||
| 3330 | nmdc:mga0qj67_26425_c1 | |||
| 3331 | nmdc:mga0qj67_321506_c1 | |||
| 3332 | nmdc:mga0qj67_366205_c1 | |||
| 3333 | nmdc:mga0qj67_40140_c1 | |||
| 3334 | nmdc:mga0qj67_62146_c1 | |||
| 3335 | nmdc:mga06r32_11453_c1 | |||
| 3336 | nmdc:mga06r32_1194161_c1 | |||
| 3337 | nmdc:mga06r32_29589_c1 | |||
| 3338 | nmdc:mga06r32_355255_c1 | |||
| 3339 | nmdc:mga06r32_438043_c1 | |||
| 3340 | nmdc:mga06r32_455925_c1 | |||
| 3341 | nmdc:mga06r32_651335_c1 | |||
| 3342 | nmdc:mga06r32_88199_c1 | |||
| 3343 | nmdc:mga08y16_145790_c1 | |||
| 3344 | nmdc:mga08y16_146631_c1 | |||
| 3345 | nmdc:mga08y16_168077_c1 | |||
| 3346 | nmdc:mga08y16_27513_c1 | |||
| 3347 | nmdc:mga08y16_33336_c1 | |||
| 3348 | nmdc:mga08y16_84658_c1 | |||
| 3349 | nmdc:mga0n895_10875_c1 | |||
| 3350 | nmdc:mga0n895_14066_c1 | |||
| 3351 | nmdc:mga0n895_147262_c1 | |||
| 3352 | nmdc:mga0n895_235374_c1 | |||
| 3353 | nmdc:mga0n895_436895_c1 | |||
| 3354 | nmdc:mga0n895_69021_c1 | |||
| 3355 | nmdc:mga0n895_84154_c1 | |||
| 3356 | nmdc:mga0n895_90735_c1 | |||
| 3357 | nmdc:mga0rr50_1032596_c1 | |||
| 3358 | nmdc:mga0rr50_114549_c1 | |||
| 3359 | nmdc:mga0rr50_138710_c1 | |||
| 3360 | nmdc:mga0rr50_462521_c1 | |||
| 3361 | nmdc:mga0rr50_63406_c1 | |||
| 3362 | nmdc:mga0a205_196515_c1 | |||
| 3363 | nmdc:mga0a205_28550_c1 | |||
| 3364 | nmdc:mga0a205_294033_c1 | |||
| 3365 | nmdc:mga0a205_36134_c1 | |||
| 3366 | nmdc:mga0a205_6528_c1 | |||
| 3367 | Ga0495601_0155460 | |||
| 3368 | Ga0495601_0423665 | |||
| 3369 | Ga0495612_0132552 | |||
| 3370 | Ga0495612_0200960 | |||
| 3371 | Ga0495595_0137986 | |||
| 3372 | Ga0495595_0226027 | |||
| 3373 | Ga0501084_0106476 | |||
| 3374 | Ga0501084_0309154 | |||
| 3375 | Ga0590075_070669 | |||
| 3376 | Ga0590077_039989 | |||
| 3377 | Ga0590077_062781 | |||
| 3378 | Ga0587108_012874 | |||
| 3379 | Ga0587111_0045632 | |||
| 3380 | Ga0501082_0053239 | |||
| 3381 | Ga0501082_0204266 | |||
| 3382 | Ga0501082_0552852 | |||
| 3383 | Ga0466962_0175353 | |||
| 3384 | Ga0530510_0532243 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy