F495117
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1628 | 736 | 1384 | 264 |
Family's Representative Sequence
| Representative Sequence | 3300031691|Ga0316579_10026379|Ga0316579_100263792 |
| Length | 309 |
| Sequence | MKAPHVPGLPPHQPKPLTHNEARVLHKVEHRARLKEHELYKGEYPIVIEGLVNRFGTQVVHENLSLKVRRGEILGVVGGSGSGKSVLMRSIIGLQQPTEGKILVFGRSIEDHHEESEIDIRSRWGVLFQGGALFSTLTVGENVEVPLREFYPEIEDELRHEIARYKVRLSGLPEEATSKFPSQLSGGMVKRAALARALSLDPELLFLDEPTAGLDPIGAAAFDMLTRELTDILGLTVFLITHDLDTLHEICDRVAVIADRTIIAVGTIPELMASDHPWIQEYFNGPRGRAALASQELAKAMDSPEESLD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 3 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 4 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 5 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 6 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 7 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 8 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 9 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 10 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 11 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 12 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 13 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 14 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 15 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 16 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 17 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 18 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 19 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 20 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 21 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 22 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 23 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 24 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 25 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 26 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 27 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 28 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 29 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 30 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 31 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 32 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 33 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 34 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 35 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 36 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 37 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 38 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 39 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 40 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 41 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 42 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 43 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 44 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 45 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 46 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 47 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 48 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 49 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 50 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 51 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 52 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 53 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 54 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 55 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 56 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 57 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 58 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 59 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 60 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 61 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 62 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 63 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 64 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 65 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 66 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 67 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 68 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 69 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 70 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 71 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 72 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 73 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 74 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 75 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 76 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 77 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 78 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 79 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 80 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 81 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 82 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 83 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 84 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 85 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 86 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 87 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 88 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 89 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 90 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 91 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 92 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 93 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 94 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 95 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 96 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 97 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 98 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 99 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 100 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 101 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 102 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 103 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 104 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 105 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 106 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 107 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 108 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 109 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 110 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 111 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 112 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 113 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 114 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 115 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 116 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 117 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 118 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 119 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 120 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 121 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 122 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 123 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 124 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 125 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 126 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 127 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 128 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 129 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 130 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 131 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 132 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 133 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 134 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 135 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 136 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 137 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 138 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 139 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 140 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 141 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 142 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 143 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 144 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 145 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 146 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 147 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 148 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 149 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 150 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 151 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 152 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 153 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 154 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 155 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 156 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 157 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 158 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 159 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 160 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 161 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 162 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 163 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 164 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 165 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 166 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 167 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 168 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 169 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 170 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 171 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 172 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 173 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 174 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 175 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 176 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 177 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 178 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 179 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 180 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 181 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 182 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 183 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 184 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 185 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 186 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 187 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 188 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 189 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 190 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 191 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 192 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 193 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 194 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 195 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 196 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 197 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 198 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 199 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 200 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 201 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 202 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 203 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 204 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 205 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 206 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 207 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 208 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 209 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 210 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 211 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 212 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 213 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 214 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 215 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 216 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 217 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 218 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 219 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 220 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 221 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 222 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 223 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 224 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 225 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 226 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 227 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 228 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 229 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 230 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 231 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 232 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 233 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 234 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 235 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 236 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 237 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 238 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 239 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 240 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 241 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 242 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 243 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 244 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 245 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 246 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 247 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 248 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 249 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 250 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 251 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 252 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 253 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 254 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 255 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 256 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 257 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 258 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 259 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 260 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 261 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 262 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 263 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 264 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 265 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 266 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 267 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 268 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 269 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 270 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 271 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 272 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 273 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 274 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 275 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 276 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 277 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 278 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 279 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 280 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 281 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 282 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 283 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 284 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 285 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 286 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 287 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 288 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 289 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 290 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 291 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 292 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 293 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 294 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 295 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 296 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 297 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 298 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 299 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 300 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 301 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 302 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 303 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 304 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 305 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 306 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 308 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 309 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 310 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 311 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 312 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 313 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 314 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 315 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 317 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 318 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 319 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 320 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 321 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 322 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 324 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 325 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 327 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 328 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 329 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 330 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 331 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 332 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 333 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 334 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 335 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 336 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 337 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 338 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 339 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 340 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 341 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 342 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 343 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 344 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 345 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 346 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 347 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 348 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 349 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 350 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 351 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 352 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 353 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 354 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 355 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 356 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 357 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 358 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 359 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 360 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 361 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 362 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 363 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 364 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 365 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 366 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 367 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 368 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 369 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 370 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 371 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 372 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 373 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 374 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 375 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 376 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 377 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 378 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 379 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 380 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 381 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 382 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 383 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 384 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 385 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 418 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 419 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 420 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 421 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 422 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 423 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 424 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 425 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 426 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 427 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 428 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 429 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 430 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 431 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 432 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 433 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 434 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 435 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 436 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 437 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 438 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 439 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 440 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 441 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 442 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 443 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 444 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 445 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 446 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 447 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 448 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 449 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 450 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 451 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 452 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 453 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 454 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 455 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 456 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 457 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 458 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 459 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 460 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 461 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 462 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 463 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 464 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 465 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 466 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 467 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 468 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 469 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 470 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 471 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 472 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 473 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 474 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 475 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 476 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 477 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 478 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 479 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 480 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 481 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 482 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 483 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 484 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 485 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 486 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 487 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 488 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 489 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 490 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 491 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 492 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 493 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 494 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 495 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 496 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 497 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 498 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 499 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 500 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 501 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 502 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 503 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 504 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 505 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 506 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 507 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 508 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 509 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 510 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 511 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 512 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 513 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 514 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 515 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 516 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 517 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 518 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 519 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 520 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 521 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 522 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 523 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 524 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 525 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 526 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 527 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 528 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 529 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 530 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 531 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 532 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 533 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 534 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 535 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 536 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 537 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 538 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 539 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 540 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 541 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 542 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 543 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 544 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 545 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 546 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 547 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 548 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 549 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 550 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 626 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 627 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 628 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 629 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 630 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 631 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 632 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 633 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 634 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 635 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 636 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 637 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 638 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 639 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 640 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 641 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 642 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 643 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 644 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 645 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 646 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 647 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 648 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 649 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 650 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 651 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 652 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 653 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 654 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 655 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 656 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 657 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 658 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 659 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 660 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 661 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 662 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 663 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 664 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 665 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 666 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 667 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 668 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 669 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 670 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 671 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 672 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 673 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 674 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 675 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 676 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 677 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 678 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 679 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 680 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 681 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 682 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 683 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 684 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 685 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 686 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 687 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 688 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 689 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 690 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 691 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 692 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 693 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 694 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 695 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 696 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 697 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 698 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 699 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 700 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 701 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 702 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 703 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 704 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 705 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 706 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 707 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 708 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 709 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 710 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 711 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 712 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 713 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 714 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 715 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 716 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 717 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 718 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 719 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 720 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 721 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 722 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 723 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 724 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 725 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 726 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 727 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 728 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 729 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 730 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 731 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 732 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 733 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 734 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 735 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 736 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.77 |
| Metatranscriptomes | 0.25 |
| Isolates | 14.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0 |
| Endosphere | 8.23 |
| Nodule | 1.78 |
| Rhizoplane | 6.2 |
| Rhizosphere | 71.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_6771 | 2124908027 | Bacteria | 4731 |
| 2 | MRS2a_Contig_7961 | 2124908027 | Bacteria | 2332 |
| 3 | JGI24736J21556_1007395 | 3300001904 | Bacteria | 1846 |
| 4 | JGI25162J39368_1000459 | 3300002737 | Bacteria | 31876 |
| 5 | JGI25163J39215_1000407 | 3300002771 | Bacteria | 13526 |
| 6 | JGI25163J39215_1000589 | 3300002771 | Bacteria | 10199 |
| 7 | JGI25164J39214_1000297 | 3300002772 | Bacteria | 34174 |
| 8 | JGI25164J39214_1000314 | 3300002772 | Bacteria | 31880 |
| 9 | JGI25165J46597_1000175 | 3300003214 | Bacteria | 100117 |
| 10 | JGI25165J46597_1000193 | 3300003214 | Bacteria | 91069 |
| 11 | rootL2_10219289 | 3300003322 | Bacteria | 1981 |
| 12 | rootL2_10301675 | 3300003322 | Bacteria | 1954 |
| 13 | Ga0006562J51391_1013763 | 3300003578 | Bacteria | 3997 |
| 14 | Ga0006562J51391_1162000 | 3300003578 | Bacteria | 2511 |
| 15 | Ga0006562J51391_1162001 | 3300003578 | Bacteria | 2360 |
| 16 | Ga0055538_1000012 | 3300003751 | Bacteria | 353826 |
| 17 | Ga0055539_1000017 | 3300003752 | Bacteria | 353873 |
| 18 | Ga0055533_1000021 | 3300003756 | Bacteria | 353826 |
| 19 | Ga0055532_1000020 | 3300003758 | Bacteria | 270853 |
| 20 | Ga0055525_1000117 | 3300003759 | Bacteria | 120690 |
| 21 | Ga0055535_1012090 | 3300003761 | Bacteria | 1333 |
| 22 | Ga0055526_1000674 | 3300003771 | Bacteria | 26160 |
| 23 | Ga0055537_1002258 | 3300003773 | Bacteria | 6632 |
| 24 | Ga0055524_1000852 | 3300003775 | Bacteria | 20009 |
| 25 | Ga0055536_1000595 | 3300003781 | Bacteria | 24647 |
| 26 | Ga0055536_1000604 | 3300003781 | Bacteria | 24459 |
| 27 | Ga0055536_1003173 | 3300003781 | Bacteria | 8915 |
| 28 | Ga0055530_10000050 | 3300003791 | Bacteria | 105620 |
| 29 | Ga0055530_10000081 | 3300003791 | Bacteria | 82192 |
| 30 | Ga0055530_10000548 | 3300003791 | Bacteria | 32545 |
| 31 | Ga0055530_10000899 | 3300003791 | Bacteria | 24455 |
| 32 | Ga0055530_10002781 | 3300003791 | Bacteria | 10795 |
| 33 | Ga0055530_10004915 | 3300003791 | Bacteria | 6624 |
| 34 | Ga0055540_1000121 | 3300003792 | Bacteria | 82192 |
| 35 | Ga0055540_1000242 | 3300003792 | Bacteria | 49989 |
| 36 | Ga0055540_1001116 | 3300003792 | Bacteria | 16913 |
| 37 | Ga0055531_10000847 | 3300003794 | Bacteria | 25245 |
| 38 | Ga0055531_10001033 | 3300003794 | Bacteria | 22056 |
| 39 | Ga0055541_1000012 | 3300003841 | Bacteria | 353826 |
| 40 | Ga0058692_1008095 | 3300003856 | Bacteria | 2726 |
| 41 | Ga0065165_1000093 | 3300005262 | Bacteria | 146751 |
| 42 | Ga0065165_1037701 | 3300005262 | Bacteria | 1463 |
| 43 | Ga0065714_10002860 | 3300005288 | Bacteria | 11454 |
| 44 | Ga0065714_10004303 | 3300005288 | Bacteria | 7578 |
| 45 | Ga0065714_10008943 | 3300005288 | Bacteria | 2429 |
| 46 | Ga0065714_10064636 | 3300005288 | Bacteria | 26785 |
| 47 | Ga0065714_10064893 | 3300005288 | Bacteria | 15990 |
| 48 | Ga0065714_10066596 | 3300005288 | Bacteria | 6589 |
| 49 | Ga0065714_10091673 | 3300005288 | Bacteria | 1897 |
| 50 | Ga0065704_10001959 | 3300005289 | Bacteria | 9751 |
| 51 | Ga0065704_10008836 | 3300005289 | Bacteria | 3521 |
| 52 | Ga0065704_10071119 | 3300005289 | Bacteria | 13035 |
| 53 | Ga0065712_10068500 | 3300005290 | Bacteria | 10228 |
| 54 | Ga0065715_10215900 | 3300005293 | Bacteria | 1264 |
| 55 | Ga0065715_10341747 | 3300005293 | Bacteria | 966 |
| 56 | Ga0070683_100453071 | 3300005329 | Bacteria | 1224 |
| 57 | Ga0070690_100002162 | 3300005330 | Bacteria | 10498 |
| 58 | Ga0070690_100068633 | 3300005330 | Bacteria | 2300 |
| 59 | Ga0070670_100000050 | 3300005331 | Bacteria | 132470 |
| 60 | Ga0070670_100003035 | 3300005331 | Bacteria | 13890 |
| 61 | Ga0070670_100005339 | 3300005331 | Bacteria | 10835 |
| 62 | Ga0070670_100018343 | 3300005331 | Bacteria | 6004 |
| 63 | Ga0070670_100276858 | 3300005331 | Bacteria | 1465 |
| 64 | Ga0070670_100689905 | 3300005331 | Bacteria | 918 |
| 65 | Ga0068869_100002671 | 3300005334 | Bacteria | 10776 |
| 66 | Ga0070666_10020342 | 3300005335 | Bacteria | 4290 |
| 67 | Ga0070680_100005561 | 3300005336 | Bacteria | 9539 |
| 68 | Ga0070689_100003447 | 3300005340 | Bacteria | 10517 |
| 69 | Ga0070661_100000237 | 3300005344 | Bacteria | 45515 |
| 70 | Ga0070661_100022662 | 3300005344 | Bacteria | 4497 |
| 71 | Ga0070661_100274321 | 3300005344 | Bacteria | 1307 |
| 72 | Ga0070668_100001877 | 3300005347 | Bacteria | 15355 |
| 73 | Ga0070669_100000158 | 3300005353 | Bacteria | 61318 |
| 74 | Ga0070669_100000277 | 3300005353 | Bacteria | 41213 |
| 75 | Ga0070675_100001395 | 3300005354 | Bacteria | 17713 |
| 76 | Ga0070671_100045250 | 3300005355 | Bacteria | 3659 |
| 77 | Ga0070671_100070671 | 3300005355 | Bacteria | 2912 |
| 78 | Ga0070671_100284428 | 3300005355 | Bacteria | 1407 |
| 79 | Ga0070673_100000393 | 3300005364 | Bacteria | 23110 |
| 80 | Ga0070673_100013793 | 3300005364 | Bacteria | 5606 |
| 81 | Ga0070659_100000040 | 3300005366 | Bacteria | 104145 |
| 82 | Ga0070659_100008635 | 3300005366 | Bacteria | 7451 |
| 83 | Ga0070667_100000299 | 3300005367 | Bacteria | 55531 |
| 84 | Ga0070667_100028277 | 3300005367 | Bacteria | 4667 |
| 85 | Ga0070667_100203189 | 3300005367 | Bacteria | 1759 |
| 86 | Ga0070714_100018934 | 3300005435 | Bacteria | 5601 |
| 87 | Ga0070714_100425139 | 3300005435 | Bacteria | 1259 |
| 88 | Ga0070713_100000501 | 3300005436 | Bacteria | 25040 |
| 89 | Ga0070713_100000622 | 3300005436 | Bacteria | 22633 |
| 90 | Ga0070710_10003523 | 3300005437 | Bacteria | 7419 |
| 91 | Ga0070711_100001068 | 3300005439 | Bacteria | 14617 |
| 92 | Ga0070705_100016110 | 3300005440 | Bacteria | 3879 |
| 93 | Ga0070700_100174455 | 3300005441 | Bacteria | 1491 |
| 94 | Ga0070663_100026194 | 3300005455 | Bacteria | 3946 |
| 95 | Ga0070678_100147426 | 3300005456 | Bacteria | 1891 |
| 96 | Ga0070678_100289437 | 3300005456 | Bacteria | 1388 |
| 97 | Ga0070662_100000063 | 3300005457 | Bacteria | 57210 |
| 98 | Ga0070662_100172140 | 3300005457 | Bacteria | 1701 |
| 99 | Ga0070681_10030623 | 3300005458 | Bacteria | 5400 |
| 100 | Ga0068867_100093050 | 3300005459 | Bacteria | 2290 |
| 101 | Ga0068867_100100528 | 3300005459 | Bacteria | 2208 |
| 102 | Ga0070679_100071686 | 3300005530 | Bacteria | 3456 |
| 103 | Ga0070684_100002776 | 3300005535 | Bacteria | 12967 |
| 104 | Ga0068853_100000143 | 3300005539 | Bacteria | 48815 |
| 105 | Ga0068853_100047201 | 3300005539 | Bacteria | 3696 |
| 106 | Ga0068853_100079848 | 3300005539 | Bacteria | 2861 |
| 107 | Ga0068853_100302093 | 3300005539 | Bacteria | 1480 |
| 108 | Ga0070672_100022058 | 3300005543 | Bacteria | 4670 |
| 109 | Ga0070686_100007969 | 3300005544 | Bacteria | 5922 |
| 110 | Ga0070696_100208435 | 3300005546 | Bacteria | 1462 |
| 111 | Ga0070693_100342933 | 3300005547 | Bacteria | 1020 |
| 112 | Ga0070665_100000248 | 3300005548 | Bacteria | 89239 |
| 113 | Ga0070665_100001434 | 3300005548 | Bacteria | 27937 |
| 114 | Ga0070665_100010596 | 3300005548 | Bacteria | 9333 |
| 115 | Ga0070665_100020273 | 3300005548 | Bacteria | 6676 |
| 116 | Ga0070665_100047335 | 3300005548 | Bacteria | 4317 |
| 117 | Ga0070665_100057771 | 3300005548 | Bacteria | 3889 |
| 118 | Ga0070665_100224775 | 3300005548 | Bacteria | 1877 |
| 119 | Ga0070704_100061290 | 3300005549 | Bacteria | 2692 |
| 120 | Ga0068855_100011064 | 3300005563 | Bacteria | 10886 |
| 121 | Ga0068855_100159449 | 3300005563 | Bacteria | 2562 |
| 122 | Ga0068855_100240141 | 3300005563 | Bacteria | 2025 |
| 123 | Ga0070664_100000407 | 3300005564 | Bacteria | 32028 |
| 124 | Ga0070664_100000940 | 3300005564 | Bacteria | 22757 |
| 125 | Ga0070664_100008436 | 3300005564 | Bacteria | 8333 |
| 126 | Ga0070664_100055150 | 3300005564 | Bacteria | 3373 |
| 127 | Ga0070664_100577189 | 3300005564 | Bacteria | 1041 |
| 128 | Ga0068857_100059056 | 3300005577 | Bacteria | 3406 |
| 129 | Ga0068854_100004725 | 3300005578 | Bacteria | 8585 |
| 130 | Ga0068856_100025594 | 3300005614 | Bacteria | 5754 |
| 131 | Ga0068856_100135583 | 3300005614 | Bacteria | 2467 |
| 132 | Ga0070702_100006771 | 3300005615 | Bacteria | 5447 |
| 133 | Ga0068859_100001376 | 3300005617 | Bacteria | 24747 |
| 134 | Ga0068859_100237560 | 3300005617 | Bacteria | 1911 |
| 135 | Ga0068864_100000238 | 3300005618 | Bacteria | 49284 |
| 136 | Ga0068864_100022488 | 3300005618 | Bacteria | 5287 |
| 137 | Ga0068864_100033400 | 3300005618 | Bacteria | 4374 |
| 138 | Ga0068866_10176277 | 3300005718 | Bacteria | 1259 |
| 139 | Ga0068861_100051537 | 3300005719 | Bacteria | 3124 |
| 140 | Ga0068851_10000018 | 3300005834 | Bacteria | 137425 |
| 141 | Ga0068870_10020900 | 3300005840 | Bacteria | 3195 |
| 142 | Ga0068863_100000531 | 3300005841 | Bacteria | 38939 |
| 143 | Ga0068863_100000673 | 3300005841 | Bacteria | 34509 |
| 144 | Ga0068863_100005001 | 3300005841 | Bacteria | 13072 |
| 145 | Ga0068863_100338951 | 3300005841 | Bacteria | 1463 |
| 146 | Ga0068858_100003909 | 3300005842 | Bacteria | 14720 |
| 147 | Ga0068858_100004783 | 3300005842 | Bacteria | 13259 |
| 148 | Ga0068858_100007943 | 3300005842 | Bacteria | 10225 |
| 149 | Ga0068858_100376935 | 3300005842 | Bacteria | 1361 |
| 150 | Ga0068860_100015972 | 3300005843 | Bacteria | 7328 |
| 151 | Ga0068862_100000786 | 3300005844 | Bacteria | 31460 |
| 152 | Ga0068862_100001925 | 3300005844 | Bacteria | 18852 |
| 153 | Ga0068862_100015372 | 3300005844 | Bacteria | 6358 |
| 154 | Ga0068862_100158322 | 3300005844 | Bacteria | 2020 |
| 155 | Ga0075365_10041469 | 3300006038 | Bacteria | 3007 |
| 156 | Ga0075363_100009303 | 3300006048 | Bacteria | 4616 |
| 157 | Ga0075364_10000109 | 3300006051 | Bacteria | 33870 |
| 158 | Ga0075364_10034624 | 3300006051 | Bacteria | 3260 |
| 159 | Ga0075364_10054778 | 3300006051 | Bacteria | 2609 |
| 160 | Ga0075364_10078438 | 3300006051 | Bacteria | 2182 |
| 161 | Ga0075364_10110261 | 3300006051 | Bacteria | 1836 |
| 162 | Ga0075364_10131569 | 3300006051 | Bacteria | 1679 |
| 163 | Ga0075432_10004705 | 3300006058 | Bacteria | 4647 |
| 164 | Ga0075432_10007143 | 3300006058 | Bacteria | 3803 |
| 165 | Ga0075432_10021580 | 3300006058 | Bacteria | 2201 |
| 166 | Ga0075432_10064995 | 3300006058 | Bacteria | 1303 |
| 167 | Ga0070715_10000137 | 3300006163 | Bacteria | 17172 |
| 168 | Ga0070715_10130230 | 3300006163 | Bacteria | 1210 |
| 169 | Ga0070716_100000250 | 3300006173 | Bacteria | 21487 |
| 170 | Ga0070716_100009265 | 3300006173 | Bacteria | 4906 |
| 171 | Ga0070712_100000944 | 3300006175 | Bacteria | 17506 |
| 172 | Ga0070712_100069855 | 3300006175 | Bacteria | 2507 |
| 173 | Ga0075362_10000018 | 3300006177 | Bacteria | 75123 |
| 174 | Ga0075362_10003263 | 3300006177 | Bacteria | 5637 |
| 175 | Ga0075369_10002686 | 3300006186 | Bacteria | 6376 |
| 176 | Ga0075369_10013967 | 3300006186 | Bacteria | 3199 |
| 177 | Ga0075366_10003020 | 3300006195 | Bacteria | 8779 |
| 178 | Ga0097621_100002763 | 3300006237 | Bacteria | 12003 |
| 179 | Ga0097621_100042100 | 3300006237 | Bacteria | 3678 |
| 180 | Ga0075370_10000065 | 3300006353 | Bacteria | 31858 |
| 181 | Ga0068871_100007873 | 3300006358 | Bacteria | 7638 |
| 182 | Ga0068871_100094024 | 3300006358 | Bacteria | 2502 |
| 183 | Ga0075428_100000169 | 3300006844 | Bacteria | 60729 |
| 184 | Ga0075428_100003164 | 3300006844 | Bacteria | 17986 |
| 185 | Ga0075428_100032925 | 3300006844 | Bacteria | 5724 |
| 186 | Ga0075428_100627006 | 3300006844 | Bacteria | 1147 |
| 187 | Ga0075430_100001922 | 3300006846 | Bacteria | 17042 |
| 188 | Ga0075430_100043515 | 3300006846 | Bacteria | 3795 |
| 189 | Ga0075431_100000027 | 3300006847 | Bacteria | 74360 |
| 190 | Ga0075431_100001984 | 3300006847 | Bacteria | 19531 |
| 191 | Ga0075431_100019179 | 3300006847 | Bacteria | 6971 |
| 192 | Ga0075431_100288039 | 3300006847 | Bacteria | 1662 |
| 193 | Ga0075429_100000416 | 3300006880 | Bacteria | 31687 |
| 194 | Ga0075429_100023537 | 3300006880 | Bacteria | 5346 |
| 195 | Ga0068865_100002003 | 3300006881 | Bacteria | 12025 |
| 196 | Ga0068865_100004806 | 3300006881 | Bacteria | 8166 |
| 197 | Ga0075436_100170932 | 3300006914 | Bacteria | 1535 |
| 198 | Ga0075436_100413037 | 3300006914 | Bacteria | 979 |
| 199 | Ga0097620_100001375 | 3300006931 | Bacteria | 24747 |
| 200 | Ga0097620_100237587 | 3300006931 | Bacteria | 1911 |
| 201 | Ga0099823_1002256 | 3300006944 | Bacteria | 17218 |
| 202 | Ga0079104_1000291 | 3300006946 | Bacteria | 63569 |
| 203 | Ga0079104_1003204 | 3300006946 | Bacteria | 7891 |
| 204 | Ga0079104_1020394 | 3300006946 | Bacteria | 1827 |
| 205 | Ga0105251_10000033 | 3300009011 | Bacteria | 118905 |
| 206 | Ga0105251_10000068 | 3300009011 | Bacteria | 98955 |
| 207 | Ga0105251_10000881 | 3300009011 | Bacteria | 26861 |
| 208 | Ga0105251_10000985 | 3300009011 | Bacteria | 25069 |
| 209 | Ga0105251_10002062 | 3300009011 | Bacteria | 16229 |
| 210 | Ga0105251_10003716 | 3300009011 | Bacteria | 10935 |
| 211 | Ga0105251_10004230 | 3300009011 | Bacteria | 9916 |
| 212 | Ga0105251_10004706 | 3300009011 | Bacteria | 9169 |
| 213 | Ga0105251_10007970 | 3300009011 | Bacteria | 6430 |
| 214 | Ga0105251_10012227 | 3300009011 | Bacteria | 4866 |
| 215 | Ga0105251_10039793 | 3300009011 | Bacteria | 2294 |
| 216 | Ga0105251_10043483 | 3300009011 | Bacteria | 2175 |
| 217 | Ga0105251_10047642 | 3300009011 | Bacteria | 2059 |
| 218 | Ga0105251_10051112 | 3300009011 | Bacteria | 1972 |
| 219 | Ga0105251_10051586 | 3300009011 | Bacteria | 1961 |
| 220 | Ga0105251_10162101 | 3300009011 | Bacteria | 1008 |
| 221 | Ga0105251_10186259 | 3300009011 | Bacteria | 935 |
| 222 | Ga0105244_10000726 | 3300009036 | Bacteria | 28455 |
| 223 | Ga0105244_10001870 | 3300009036 | Bacteria | 16359 |
| 224 | Ga0105244_10002402 | 3300009036 | Bacteria | 14157 |
| 225 | Ga0105244_10005309 | 3300009036 | Bacteria | 8578 |
| 226 | Ga0105244_10006394 | 3300009036 | Bacteria | 7644 |
| 227 | Ga0105244_10010227 | 3300009036 | Bacteria | 5700 |
| 228 | Ga0105244_10017810 | 3300009036 | Bacteria | 4003 |
| 229 | Ga0105244_10096083 | 3300009036 | Bacteria | 1454 |
| 230 | Ga0105244_10096207 | 3300009036 | Bacteria | 1453 |
| 231 | Ga0105244_10101682 | 3300009036 | Bacteria | 1405 |
| 232 | Ga0105244_10109387 | 3300009036 | Bacteria | 1346 |
| 233 | Ga0105244_10156809 | 3300009036 | Bacteria | 1089 |
| 234 | Ga0105244_10161267 | 3300009036 | Bacteria | 1071 |
| 235 | Ga0105250_10000825 | 3300009092 | Bacteria | 18449 |
| 236 | Ga0105250_10001995 | 3300009092 | Bacteria | 10569 |
| 237 | Ga0105250_10007162 | 3300009092 | Bacteria | 4812 |
| 238 | Ga0105250_10016832 | 3300009092 | Bacteria | 2975 |
| 239 | Ga0105250_10027515 | 3300009092 | Bacteria | 2292 |
| 240 | Ga0105250_10065871 | 3300009092 | Bacteria | 1460 |
| 241 | Ga0105250_10065931 | 3300009092 | Bacteria | 1460 |
| 242 | Ga0105250_10089394 | 3300009092 | Bacteria | 1251 |
| 243 | Ga0105250_10173047 | 3300009092 | Bacteria | 904 |
| 244 | Ga0105240_10000522 | 3300009093 | Bacteria | 70833 |
| 245 | Ga0105240_10008495 | 3300009093 | Bacteria | 14686 |
| 246 | Ga0105240_10073487 | 3300009093 | Bacteria | 4222 |
| 247 | Ga0111539_10000211 | 3300009094 | Bacteria | 69441 |
| 248 | Ga0111539_10040297 | 3300009094 | Bacteria | 5625 |
| 249 | Ga0111539_10076787 | 3300009094 | Bacteria | 3933 |
| 250 | Ga0105245_10008015 | 3300009098 | Bacteria | 9237 |
| 251 | Ga0105247_10012887 | 3300009101 | Bacteria | 5017 |
| 252 | Ga0114129_10001827 | 3300009147 | Bacteria | 28986 |
| 253 | Ga0114129_10005882 | 3300009147 | Bacteria | 17371 |
| 254 | Ga0114129_10526183 | 3300009147 | Bacteria | 1541 |
| 255 | Ga0105243_10000075 | 3300009148 | Bacteria | 112098 |
| 256 | Ga0105243_10000867 | 3300009148 | Bacteria | 28621 |
| 257 | Ga0105243_10001447 | 3300009148 | Bacteria | 20865 |
| 258 | Ga0105243_10075069 | 3300009148 | Bacteria | 2744 |
| 259 | Ga0105243_10098657 | 3300009148 | Bacteria | 2420 |
| 260 | Ga0105243_10118152 | 3300009148 | Bacteria | 2230 |
| 261 | Ga0105243_10135072 | 3300009148 | Bacteria | 2098 |
| 262 | Ga0105241_10039582 | 3300009174 | Bacteria | 3556 |
| 263 | Ga0105242_10000358 | 3300009176 | Bacteria | 36515 |
| 264 | Ga0105242_10003944 | 3300009176 | Bacteria | 11524 |
| 265 | Ga0105242_10016716 | 3300009176 | Bacteria | 5707 |
| 266 | Ga0105248_10002192 | 3300009177 | Bacteria | 21611 |
| 267 | Ga0105248_10028267 | 3300009177 | Bacteria | 6246 |
| 268 | Ga0105248_10172510 | 3300009177 | Bacteria | 2438 |
| 269 | Ga0105248_10180194 | 3300009177 | Bacteria | 2381 |
| 270 | Ga0105237_10002504 | 3300009545 | Bacteria | 22765 |
| 271 | Ga0105237_10058234 | 3300009545 | Bacteria | 3867 |
| 272 | Ga0105238_10016707 | 3300009551 | Bacteria | 7436 |
| 273 | Ga0105238_10091911 | 3300009551 | Bacteria | 3022 |
| 274 | Ga0105238_10165976 | 3300009551 | Bacteria | 2184 |
| 275 | Ga0105238_10504063 | 3300009551 | Bacteria | 1212 |
| 276 | Ga0105249_10000356 | 3300009553 | Bacteria | 45856 |
| 277 | Ga0105249_10007976 | 3300009553 | Bacteria | 9231 |
| 278 | Ga0105239_10179083 | 3300010375 | Bacteria | 2371 |
| 279 | Ga0105239_10219964 | 3300010375 | Bacteria | 2130 |
| 280 | Ga0105239_10611688 | 3300010375 | Bacteria | 1243 |
| 281 | Ga0105239_11075055 | 3300010375 | Bacteria | 926 |
| 282 | Ga0105246_10000436 | 3300011119 | Bacteria | 22273 |
| 283 | Ga0105246_10000504 | 3300011119 | Bacteria | 21247 |
| 284 | Ga0105246_10010430 | 3300011119 | Bacteria | 5750 |
| 285 | Ga0105246_10023186 | 3300011119 | Bacteria | 4014 |
| 286 | Ga0105246_10047287 | 3300011119 | Bacteria | 2938 |
| 287 | Ga0157345_1000163 | 3300012498 | Bacteria | 11194 |
| 288 | Ga0157373_10000586 | 3300013100 | Bacteria | 28347 |
| 289 | Ga0157373_10003492 | 3300013100 | Bacteria | 11888 |
| 290 | Ga0157373_10003814 | 3300013100 | Bacteria | 11399 |
| 291 | Ga0157373_10006402 | 3300013100 | Bacteria | 8795 |
| 292 | Ga0157373_10016680 | 3300013100 | Bacteria | 5352 |
| 293 | Ga0157373_10031150 | 3300013100 | Bacteria | 3838 |
| 294 | Ga0157373_10061092 | 3300013100 | Bacteria | 2669 |
| 295 | Ga0157373_10390036 | 3300013100 | Bacteria | 997 |
| 296 | Ga0157371_10000935 | 3300013102 | Bacteria | 32661 |
| 297 | Ga0157371_10001391 | 3300013102 | Bacteria | 25247 |
| 298 | Ga0157371_10004419 | 3300013102 | Bacteria | 12282 |
| 299 | Ga0157371_10058580 | 3300013102 | Bacteria | 2732 |
| 300 | Ga0157371_10223794 | 3300013102 | Bacteria | 1351 |
| 301 | Ga0157370_10000495 | 3300013104 | Bacteria | 48993 |
| 302 | Ga0157370_10008450 | 3300013104 | Bacteria | 11105 |
| 303 | Ga0157370_10010774 | 3300013104 | Bacteria | 9612 |
| 304 | Ga0157370_10029824 | 3300013104 | Bacteria | 5347 |
| 305 | Ga0157370_10054054 | 3300013104 | Bacteria | 3828 |
| 306 | Ga0157370_10073948 | 3300013104 | Bacteria | 3215 |
| 307 | Ga0157370_10177270 | 3300013104 | Bacteria | 1981 |
| 308 | Ga0157370_10469478 | 3300013104 | Bacteria | 1156 |
| 309 | Ga0157369_10000464 | 3300013105 | Bacteria | 53767 |
| 310 | Ga0157369_10009283 | 3300013105 | Bacteria | 11250 |
| 311 | Ga0157369_10017873 | 3300013105 | Bacteria | 7960 |
| 312 | Ga0157369_10022731 | 3300013105 | Bacteria | 6993 |
| 313 | Ga0157369_10194966 | 3300013105 | Bacteria | 2127 |
| 314 | Ga0157369_10229424 | 3300013105 | Bacteria | 1941 |
| 315 | Ga0157369_10898889 | 3300013105 | Bacteria | 908 |
| 316 | Ga0157374_10095689 | 3300013296 | Bacteria | 2840 |
| 317 | Ga0157378_10003437 | 3300013297 | Bacteria | 14049 |
| 318 | Ga0163162_10001225 | 3300013306 | Bacteria | 23961 |
| 319 | Ga0163162_10014604 | 3300013306 | Bacteria | 7673 |
| 320 | Ga0163162_10037697 | 3300013306 | Bacteria | 4825 |
| 321 | Ga0163162_10082355 | 3300013306 | Bacteria | 3290 |
| 322 | Ga0157375_10005374 | 3300013308 | Bacteria | 11127 |
| 323 | Ga0157375_10008547 | 3300013308 | Bacteria | 8964 |
| 324 | Ga0157375_10009695 | 3300013308 | Bacteria | 8467 |
| 325 | Ga0157375_10049656 | 3300013308 | Bacteria | 4112 |
| 326 | Ga0157375_10062273 | 3300013308 | Bacteria | 3706 |
| 327 | Ga0163163_10122601 | 3300014325 | Bacteria | 2634 |
| 328 | Ga0163163_10190075 | 3300014325 | Bacteria | 2102 |
| 329 | Ga0163163_10489375 | 3300014325 | Bacteria | 1292 |
| 330 | Ga0182008_10001337 | 3300014497 | Bacteria | 16791 |
| 331 | Ga0182008_10003405 | 3300014497 | Bacteria | 9609 |
| 332 | Ga0182008_10005486 | 3300014497 | Bacteria | 7221 |
| 333 | Ga0182008_10009133 | 3300014497 | Bacteria | 5367 |
| 334 | Ga0182008_10010188 | 3300014497 | Bacteria | 5038 |
| 335 | Ga0157377_10037112 | 3300014745 | Bacteria | 2684 |
| 336 | Ga0157379_10001501 | 3300014968 | Bacteria | 19208 |
| 337 | Ga0157379_10022262 | 3300014968 | Bacteria | 5614 |
| 338 | Ga0157376_10160193 | 3300014969 | Bacteria | 2039 |
| 339 | Ga0157376_10199497 | 3300014969 | Bacteria | 1840 |
| 340 | Ga0157376_10224360 | 3300014969 | Bacteria | 1742 |
| 341 | Ga0182006_1001380 | 3300015261 | Bacteria | 14787 |
| 342 | Ga0182006_1001917 | 3300015261 | Bacteria | 11851 |
| 343 | Ga0182006_1002154 | 3300015261 | Bacteria | 10922 |
| 344 | Ga0182006_1003725 | 3300015261 | Bacteria | 7705 |
| 345 | Ga0182006_1060908 | 3300015261 | Bacteria | 1424 |
| 346 | Ga0182007_10000228 | 3300015262 | Bacteria | 37784 |
| 347 | Ga0182007_10054590 | 3300015262 | Bacteria | 1314 |
| 348 | Ga0182005_1000375 | 3300015265 | Bacteria | 24704 |
| 349 | Ga0182005_1004691 | 3300015265 | Bacteria | 4368 |
| 350 | Ga0182005_1015515 | 3300015265 | Bacteria | 2123 |
| 351 | Ga0182005_1022296 | 3300015265 | Bacteria | 1735 |
| 352 | Ga0182005_1028587 | 3300015265 | Bacteria | 1520 |
| 353 | Ga0182005_1073370 | 3300015265 | Bacteria | 941 |
| 354 | Ga0163161_10003439 | 3300017792 | Bacteria | 11094 |
| 355 | Ga0163161_10025857 | 3300017792 | Bacteria | 4156 |
| 356 | Ga0163161_10026043 | 3300017792 | Bacteria | 4143 |
| 357 | Ga0163161_10030292 | 3300017792 | Bacteria | 3849 |
| 358 | Ga0163161_10062624 | 3300017792 | Bacteria | 2710 |
| 359 | Ga0163161_10196908 | 3300017792 | Bacteria | 1551 |
| 360 | Ga0213873_10005190 | 3300021358 | Bacteria | 2482 |
| 361 | Ga0213872_10019359 | 3300021361 | Bacteria | 3136 |
| 362 | Ga0213874_10002493 | 3300021377 | Bacteria | 3970 |
| 363 | Ga0213876_10000183 | 3300021384 | Bacteria | 64845 |
| 364 | Ga0213876_10002636 | 3300021384 | Bacteria | 10480 |
| 365 | Ga0213876_10002883 | 3300021384 | Bacteria | 9985 |
| 366 | Ga0213876_10063026 | 3300021384 | Bacteria | 1957 |
| 367 | Ga0213876_10076158 | 3300021384 | Bacteria | 1772 |
| 368 | Ga0213875_10001986 | 3300021388 | Bacteria | 12652 |
| 369 | Ga0213875_10036093 | 3300021388 | Bacteria | 2331 |
| 370 | Ga0213875_10064935 | 3300021388 | Bacteria | 1706 |
| 371 | Ga0213871_10019712 | 3300021441 | Bacteria | 1663 |
| 372 | Ga0209435_100424 | 3300025206 | Bacteria | 8905 |
| 373 | Ga0209760_100082 | 3300025207 | Bacteria | 76168 |
| 374 | Ga0209760_100230 | 3300025207 | Bacteria | 23968 |
| 375 | Ga0209784_100007 | 3300025224 | Bacteria | 747715 |
| 376 | Ga0209566_100009 | 3300025225 | Bacteria | 554018 |
| 377 | Ga0209674_100021 | 3300025226 | Bacteria | 629811 |
| 378 | Ga0209147_100009 | 3300025229 | Bacteria | 747409 |
| 379 | Ga0209563_100018 | 3300025230 | Bacteria | 747850 |
| 380 | Ga0207427_100005 | 3300025231 | Bacteria | 797999 |
| 381 | Ga0207427_100006 | 3300025231 | Bacteria | 785415 |
| 382 | Ga0209437_100013 | 3300025233 | Bacteria | 785457 |
| 383 | Ga0209437_100018 | 3300025233 | Bacteria | 694400 |
| 384 | Ga0209258_100237 | 3300025242 | Bacteria | 102220 |
| 385 | Ga0209646_1000277 | 3300025246 | Bacteria | 45368 |
| 386 | Ga0209677_100012 | 3300025253 | Bacteria | 554018 |
| 387 | Ga0209759_1006965 | 3300025256 | Bacteria | 3713 |
| 388 | Ga0209759_1017087 | 3300025256 | Bacteria | 1801 |
| 389 | Ga0209129_1001075 | 3300025258 | Bacteria | 16097 |
| 390 | Ga0209129_1014853 | 3300025258 | Unclassified | 1635 |
| 391 | Ga0209233_1000021 | 3300025261 | Bacteria | 798078 |
| 392 | Ga0209233_1000022 | 3300025261 | Bacteria | 785415 |
| 393 | Ga0209565_1000846 | 3300025263 | Bacteria | 17296 |
| 394 | Ga0209130_1025652 | 3300025284 | Bacteria | 1274 |
| 395 | Ga0209675_1000481 | 3300025291 | Bacteria | 30301 |
| 396 | Ga0209676_1000015 | 3300025292 | Bacteria | 784458 |
| 397 | Ga0209676_1000157 | 3300025292 | Bacteria | 163094 |
| 398 | Ga0209676_1000222 | 3300025292 | Bacteria | 124695 |
| 399 | Ga0209676_1000242 | 3300025292 | Bacteria | 117224 |
| 400 | Ga0209676_1000243 | 3300025292 | Bacteria | 117113 |
| 401 | Ga0209676_1000311 | 3300025292 | Bacteria | 95478 |
| 402 | Ga0209676_1000583 | 3300025292 | Bacteria | 54696 |
| 403 | Ga0209676_1002476 | 3300025292 | Bacteria | 13015 |
| 404 | Ga0209564_1000219 | 3300025295 | Bacteria | 129725 |
| 405 | Ga0209758_1004180 | 3300025297 | Bacteria | 12268 |
| 406 | Ga0209050_1000030 | 3300025298 | Bacteria | 463381 |
| 407 | Ga0209050_1000058 | 3300025298 | Bacteria | 325558 |
| 408 | Ga0209050_1000061 | 3300025298 | Bacteria | 321435 |
| 409 | Ga0209050_1000244 | 3300025298 | Bacteria | 117105 |
| 410 | Ga0209050_1000296 | 3300025298 | Bacteria | 104732 |
| 411 | Ga0209050_1000375 | 3300025298 | Bacteria | 84503 |
| 412 | Ga0209050_1001114 | 3300025298 | Bacteria | 32494 |
| 413 | Ga0209050_1059597 | 3300025298 | Bacteria | 910 |
| 414 | Ga0209256_1001588 | 3300025299 | Bacteria | 22236 |
| 415 | Ga0209256_1017602 | 3300025299 | Bacteria | 2364 |
| 416 | Ga0207426_1024894 | 3300025302 | Bacteria | 2024 |
| 417 | Ga0209051_1000088 | 3300025303 | Bacteria | 180480 |
| 418 | Ga0209051_1000143 | 3300025303 | Bacteria | 135182 |
| 419 | Ga0209051_1000295 | 3300025303 | Bacteria | 79621 |
| 420 | Ga0209051_1003593 | 3300025303 | Bacteria | 10081 |
| 421 | Ga0209051_1009993 | 3300025303 | Bacteria | 4833 |
| 422 | Ga0209257_1000140 | 3300025304 | Bacteria | 201515 |
| 423 | Ga0209257_1000422 | 3300025304 | Bacteria | 81630 |
| 424 | Ga0209257_1004459 | 3300025304 | Bacteria | 10837 |
| 425 | Ga0209257_1009479 | 3300025304 | Bacteria | 5195 |
| 426 | Ga0207656_10000009 | 3300025321 | Bacteria | 245637 |
| 427 | Ga0207696_1000055 | 3300025711 | Bacteria | 258289 |
| 428 | Ga0207696_1000127 | 3300025711 | Bacteria | 135531 |
| 429 | Ga0207696_1000151 | 3300025711 | Bacteria | 120171 |
| 430 | Ga0207696_1000165 | 3300025711 | Bacteria | 104683 |
| 431 | Ga0207696_1001704 | 3300025711 | Bacteria | 11399 |
| 432 | Ga0207696_1003033 | 3300025711 | Bacteria | 7843 |
| 433 | Ga0207696_1003607 | 3300025711 | Bacteria | 6986 |
| 434 | Ga0207696_1006652 | 3300025711 | Bacteria | 4624 |
| 435 | Ga0207696_1015269 | 3300025711 | Bacteria | 2608 |
| 436 | Ga0207696_1076906 | 3300025711 | Bacteria | 924 |
| 437 | Ga0207655_1000135 | 3300025728 | Bacteria | 143597 |
| 438 | Ga0207655_1000548 | 3300025728 | Bacteria | 47302 |
| 439 | Ga0207655_1000667 | 3300025728 | Bacteria | 40487 |
| 440 | Ga0207655_1000754 | 3300025728 | Bacteria | 36294 |
| 441 | Ga0207655_1001254 | 3300025728 | Bacteria | 24214 |
| 442 | Ga0207655_1001422 | 3300025728 | Bacteria | 22200 |
| 443 | Ga0207655_1001733 | 3300025728 | Bacteria | 19145 |
| 444 | Ga0207655_1002247 | 3300025728 | Bacteria | 15981 |
| 445 | Ga0207655_1004181 | 3300025728 | Bacteria | 10359 |
| 446 | Ga0207655_1006660 | 3300025728 | Bacteria | 7613 |
| 447 | Ga0207655_1009133 | 3300025728 | Bacteria | 6196 |
| 448 | Ga0207655_1011018 | 3300025728 | Bacteria | 5425 |
| 449 | Ga0207655_1017979 | 3300025728 | Bacteria | 3781 |
| 450 | Ga0207655_1028896 | 3300025728 | Bacteria | 2606 |
| 451 | Ga0207655_1065329 | 3300025728 | Bacteria | 1381 |
| 452 | Ga0207655_1066905 | 3300025728 | Bacteria | 1355 |
| 453 | Ga0207655_1081641 | 3300025728 | Bacteria | 1164 |
| 454 | Ga0207655_1113523 | 3300025728 | Bacteria | 911 |
| 455 | Ga0207713_1000012 | 3300025735 | Bacteria | 501860 |
| 456 | Ga0207713_1000103 | 3300025735 | Bacteria | 138415 |
| 457 | Ga0207713_1000126 | 3300025735 | Bacteria | 118913 |
| 458 | Ga0207713_1000297 | 3300025735 | Bacteria | 57038 |
| 459 | Ga0207713_1000325 | 3300025735 | Bacteria | 53895 |
| 460 | Ga0207713_1000984 | 3300025735 | Bacteria | 25052 |
| 461 | Ga0207713_1002461 | 3300025735 | Bacteria | 13461 |
| 462 | Ga0207713_1003599 | 3300025735 | Bacteria | 10444 |
| 463 | Ga0207713_1004264 | 3300025735 | Bacteria | 9335 |
| 464 | Ga0207713_1004634 | 3300025735 | Bacteria | 8877 |
| 465 | Ga0207713_1004661 | 3300025735 | Bacteria | 8849 |
| 466 | Ga0207713_1005396 | 3300025735 | Bacteria | 8014 |
| 467 | Ga0207713_1005829 | 3300025735 | Bacteria | 7620 |
| 468 | Ga0207713_1008163 | 3300025735 | Bacteria | 6061 |
| 469 | Ga0207713_1016738 | 3300025735 | Bacteria | 3711 |
| 470 | Ga0207713_1017509 | 3300025735 | Bacteria | 3588 |
| 471 | Ga0207713_1025443 | 3300025735 | Bacteria | 2733 |
| 472 | Ga0207713_1046805 | 3300025735 | Bacteria | 1756 |
| 473 | Ga0207713_1088689 | 3300025735 | Bacteria | 1092 |
| 474 | Ga0207713_1098176 | 3300025735 | Bacteria | 1016 |
| 475 | Ga0207692_10015378 | 3300025898 | Bacteria | 3366 |
| 476 | Ga0207710_10038644 | 3300025900 | Bacteria | 2111 |
| 477 | Ga0207680_10085489 | 3300025903 | Bacteria | 1993 |
| 478 | Ga0207647_10000010 | 3300025904 | Bacteria | 174219 |
| 479 | Ga0207685_10011922 | 3300025905 | Bacteria | 2635 |
| 480 | Ga0207643_10017888 | 3300025908 | Bacteria | 3881 |
| 481 | Ga0207705_10002329 | 3300025909 | Bacteria | 14696 |
| 482 | Ga0207707_10080846 | 3300025912 | Bacteria | 2837 |
| 483 | Ga0207695_10001134 | 3300025913 | Bacteria | 46205 |
| 484 | Ga0207695_10001421 | 3300025913 | Bacteria | 40289 |
| 485 | Ga0207695_10028456 | 3300025913 | Bacteria | 6197 |
| 486 | Ga0207671_10000876 | 3300025914 | Bacteria | 38121 |
| 487 | Ga0207671_10334774 | 3300025914 | Bacteria | 1199 |
| 488 | Ga0207693_10000021 | 3300025915 | Bacteria | 128800 |
| 489 | Ga0207663_10056513 | 3300025916 | Bacteria | 2468 |
| 490 | Ga0207660_10003341 | 3300025917 | Bacteria | 10470 |
| 491 | Ga0207660_10133325 | 3300025917 | Bacteria | 1893 |
| 492 | Ga0207662_10002043 | 3300025918 | Bacteria | 9992 |
| 493 | Ga0207657_10007945 | 3300025919 | Bacteria | 10817 |
| 494 | Ga0207649_10000007 | 3300025920 | Bacteria | 334217 |
| 495 | Ga0207652_10054611 | 3300025921 | Bacteria | 3434 |
| 496 | Ga0207681_10000291 | 3300025923 | Bacteria | 37201 |
| 497 | Ga0207681_10001357 | 3300025923 | Bacteria | 15813 |
| 498 | Ga0207681_10213847 | 3300025923 | Bacteria | 1488 |
| 499 | Ga0207681_10414592 | 3300025923 | Bacteria | 1090 |
| 500 | Ga0207694_10060428 | 3300025924 | Bacteria | 2949 |
| 501 | Ga0207650_10000133 | 3300025925 | Bacteria | 90953 |
| 502 | Ga0207650_10000308 | 3300025925 | Bacteria | 48275 |
| 503 | Ga0207650_10000407 | 3300025925 | Bacteria | 38580 |
| 504 | Ga0207650_10014558 | 3300025925 | Bacteria | 5465 |
| 505 | Ga0207650_10492621 | 3300025925 | Bacteria | 1024 |
| 506 | Ga0207659_10035819 | 3300025926 | Bacteria | 3433 |
| 507 | Ga0207700_10000241 | 3300025928 | Bacteria | 32753 |
| 508 | Ga0207700_10054000 | 3300025928 | Bacteria | 3013 |
| 509 | Ga0207664_10015239 | 3300025929 | Bacteria | 5573 |
| 510 | Ga0207644_10082031 | 3300025931 | Bacteria | 2384 |
| 511 | Ga0207690_10000134 | 3300025932 | Bacteria | 60374 |
| 512 | Ga0207690_10019025 | 3300025932 | Bacteria | 4218 |
| 513 | Ga0207690_10059032 | 3300025932 | Bacteria | 2598 |
| 514 | Ga0207706_10000050 | 3300025933 | Bacteria | 116811 |
| 515 | Ga0207686_10001345 | 3300025934 | Bacteria | 13988 |
| 516 | Ga0207686_10007359 | 3300025934 | Bacteria | 5925 |
| 517 | Ga0207686_10067563 | 3300025934 | Bacteria | 2287 |
| 518 | Ga0207709_10000107 | 3300025935 | Bacteria | 129240 |
| 519 | Ga0207709_10000368 | 3300025935 | Bacteria | 45426 |
| 520 | Ga0207709_10001047 | 3300025935 | Bacteria | 20429 |
| 521 | Ga0207709_10044529 | 3300025935 | Bacteria | 2682 |
| 522 | Ga0207670_10005327 | 3300025936 | Bacteria | 7050 |
| 523 | Ga0207669_10047123 | 3300025937 | Bacteria | 2551 |
| 524 | Ga0207704_10039182 | 3300025938 | Bacteria | 2756 |
| 525 | Ga0207704_10055805 | 3300025938 | Bacteria | 2416 |
| 526 | Ga0207665_10000465 | 3300025939 | Bacteria | 27775 |
| 527 | Ga0207691_10133426 | 3300025940 | Bacteria | 2192 |
| 528 | Ga0207711_10005329 | 3300025941 | Bacteria | 10907 |
| 529 | Ga0207711_10046495 | 3300025941 | Bacteria | 3709 |
| 530 | Ga0207711_10442639 | 3300025941 | Bacteria | 1209 |
| 531 | Ga0207689_10020551 | 3300025942 | Bacteria | 5555 |
| 532 | Ga0207679_10000013 | 3300025945 | Bacteria | 334197 |
| 533 | Ga0207679_10016582 | 3300025945 | Bacteria | 4895 |
| 534 | Ga0207679_10039343 | 3300025945 | Bacteria | 3376 |
| 535 | Ga0207667_10096443 | 3300025949 | Bacteria | 3052 |
| 536 | Ga0207667_10109685 | 3300025949 | Bacteria | 2846 |
| 537 | Ga0207667_10176225 | 3300025949 | Bacteria | 2197 |
| 538 | Ga0207651_10033951 | 3300025960 | Bacteria | 3297 |
| 539 | Ga0207651_10201252 | 3300025960 | Bacteria | 1596 |
| 540 | Ga0207712_10000790 | 3300025961 | Bacteria | 23489 |
| 541 | Ga0207668_10000718 | 3300025972 | Bacteria | 20265 |
| 542 | Ga0207640_10080376 | 3300025981 | Bacteria | 2225 |
| 543 | Ga0207658_10000931 | 3300025986 | Bacteria | 24185 |
| 544 | Ga0207658_10085271 | 3300025986 | Bacteria | 2432 |
| 545 | Ga0207677_10096803 | 3300026023 | Bacteria | 2160 |
| 546 | Ga0207703_10002235 | 3300026035 | Bacteria | 16933 |
| 547 | Ga0207703_10499048 | 3300026035 | Bacteria | 1142 |
| 548 | Ga0207639_10000079 | 3300026041 | Bacteria | 83859 |
| 549 | Ga0207639_10157496 | 3300026041 | Bacteria | 1910 |
| 550 | Ga0207678_10012003 | 3300026067 | Bacteria | 7609 |
| 551 | Ga0207678_10184033 | 3300026067 | Bacteria | 1784 |
| 552 | Ga0207708_10058009 | 3300026075 | Bacteria | 2954 |
| 553 | Ga0207702_10099548 | 3300026078 | Bacteria | 2563 |
| 554 | Ga0207702_10130565 | 3300026078 | Bacteria | 2260 |
| 555 | Ga0207641_10011031 | 3300026088 | Bacteria | 7410 |
| 556 | Ga0207641_10024917 | 3300026088 | Bacteria | 4932 |
| 557 | Ga0207641_10164515 | 3300026088 | Bacteria | 2019 |
| 558 | Ga0207641_10172025 | 3300026088 | Bacteria | 1978 |
| 559 | Ga0207648_10007368 | 3300026089 | Bacteria | 10835 |
| 560 | Ga0207648_10070388 | 3300026089 | Bacteria | 3050 |
| 561 | Ga0207676_10000109 | 3300026095 | Bacteria | 74080 |
| 562 | Ga0207676_10005349 | 3300026095 | Bacteria | 9092 |
| 563 | Ga0207674_10025731 | 3300026116 | Bacteria | 6267 |
| 564 | Ga0207683_10000599 | 3300026121 | Bacteria | 33250 |
| 565 | Ga0209281_1000237 | 3300027111 | Bacteria | 112688 |
| 566 | Ga0209281_1002242 | 3300027111 | Bacteria | 8247 |
| 567 | Ga0209281_1003265 | 3300027111 | Bacteria | 5497 |
| 568 | Ga0209389_1000065 | 3300027296 | Bacteria | 102064 |
| 569 | Ga0209389_1041832 | 3300027296 | Bacteria | 3489 |
| 570 | Ga0209371_1000087 | 3300027312 | Bacteria | 175021 |
| 571 | Ga0209371_1000176 | 3300027312 | Bacteria | 95739 |
| 572 | Ga0209371_1000735 | 3300027312 | Bacteria | 27499 |
| 573 | Ga0209371_1010326 | 3300027312 | Bacteria | 2885 |
| 574 | Ga0209999_1001854 | 3300027543 | Bacteria | 3677 |
| 575 | Ga0209983_1026486 | 3300027665 | Bacteria | 1227 |
| 576 | Ga0207428_10006022 | 3300027907 | Bacteria | 11219 |
| 577 | Ga0207428_10039216 | 3300027907 | Bacteria | 3845 |
| 578 | Ga0207428_10039688 | 3300027907 | Bacteria | 3823 |
| 579 | Ga0207428_10043963 | 3300027907 | Bacteria | 3605 |
| 580 | Ga0207428_10078153 | 3300027907 | Bacteria | 2590 |
| 581 | Ga0207428_10079559 | 3300027907 | Bacteria | 2563 |
| 582 | Ga0207428_10233560 | 3300027907 | Bacteria | 1376 |
| 583 | Ga0268266_10000005 | 3300028379 | Bacteria | 1448194 |
| 584 | Ga0268266_10002063 | 3300028379 | Bacteria | 22264 |
| 585 | Ga0268266_10002796 | 3300028379 | Bacteria | 18197 |
| 586 | Ga0268266_10065003 | 3300028379 | Bacteria | 3153 |
| 587 | Ga0268266_10074778 | 3300028379 | Bacteria | 2942 |
| 588 | Ga0268266_10099303 | 3300028379 | Bacteria | 2562 |
| 589 | Ga0268266_10116472 | 3300028379 | Bacteria | 2373 |
| 590 | Ga0268265_10002972 | 3300028380 | Bacteria | 12401 |
| 591 | Ga0268265_10005179 | 3300028380 | Bacteria | 8933 |
| 592 | Ga0268265_10193008 | 3300028380 | Bacteria | 1760 |
| 593 | Ga0268265_10814574 | 3300028380 | Bacteria | 911 |
| 594 | Ga0268264_10209512 | 3300028381 | Bacteria | 1788 |
| 595 | Ga0307517_10003720 | 3300028786 | Bacteria | 23706 |
| 596 | Ga0307517_10032178 | 3300028786 | Bacteria | 6072 |
| 597 | Ga0307515_10021855 | 3300028794 | Bacteria | 11317 |
| 598 | Ga0307515_10027521 | 3300028794 | Bacteria | 9715 |
| 599 | Ga0265338_10011798 | 3300028800 | Bacteria | 10044 |
| 600 | Ga0265338_10071753 | 3300028800 | Bacteria | 2960 |
| 601 | Ga0265338_10189119 | 3300028800 | Bacteria | 1562 |
| 602 | Ga0268256_1000101 | 3300030500 | Bacteria | 130956 |
| 603 | Ga0268256_1000146 | 3300030500 | Bacteria | 95753 |
| 604 | Ga0268256_1000625 | 3300030500 | Bacteria | 27486 |
| 605 | Ga0268256_1011074 | 3300030500 | Bacteria | 2885 |
| 606 | Ga0307511_10008829 | 3300030521 | Bacteria | 10062 |
| 607 | Ga0314311_1262089 | 3300030733 | Bacteria | 7107 |
| 608 | Ga0316178_1036683 | 3300030735 | Bacteria | 48421 |
| 609 | Ga0316183_1050417 | 3300030742 | Bacteria | 3627 |
| 610 | Ga0265760_10026665 | 3300031090 | Bacteria | 1691 |
| 611 | Ga0265329_10016433 | 3300031242 | Bacteria | 2563 |
| 612 | Ga0265331_10026729 | 3300031250 | Unclassified | 2898 |
| 613 | Ga0265327_10000394 | 3300031251 | Bacteria | 81965 |
| 614 | Ga0265327_10000764 | 3300031251 | Bacteria | 49808 |
| 615 | Ga0265327_10000933 | 3300031251 | Bacteria | 42834 |
| 616 | Ga0265327_10001245 | 3300031251 | Bacteria | 33996 |
| 617 | Ga0265327_10005511 | 3300031251 | Bacteria | 10525 |
| 618 | Ga0265316_10000395 | 3300031344 | Bacteria | 49755 |
| 619 | Ga0307513_10021039 | 3300031456 | Bacteria | 7710 |
| 620 | Ga0307513_10053499 | 3300031456 | Bacteria | 4338 |
| 621 | Ga0307509_10114426 | 3300031507 | Bacteria | 2692 |
| 622 | Ga0307408_100000002 | 3300031548 | Bacteria | 827227 |
| 623 | Ga0307408_100002301 | 3300031548 | Bacteria | 13596 |
| 624 | Ga0307408_100045292 | 3300031548 | Bacteria | 3141 |
| 625 | Ga0307408_100162575 | 3300031548 | Bacteria | 1774 |
| 626 | Ga0316575_10000476 | 3300031665 | Bacteria | 11561 |
| 627 | Ga0316579_10026379 | 3300031691 | Bacteria | 2631 |
| 628 | Ga0316578_10008639 | 3300031728 | Bacteria | 5194 |
| 629 | Ga0316577_10000611 | 3300031733 | Bacteria | 14754 |
| 630 | Ga0307413_10135376 | 3300031824 | Bacteria | 1693 |
| 631 | Ga0307406_10497533 | 3300031901 | Bacteria | 988 |
| 632 | Ga0307407_10348269 | 3300031903 | Bacteria | 1048 |
| 633 | Ga0307412_10115149 | 3300031911 | Bacteria | 1926 |
| 634 | Ga0307409_100045637 | 3300031995 | Bacteria | 3310 |
| 635 | Ga0307409_100105426 | 3300031995 | Bacteria | 2350 |
| 636 | Ga0307416_100106393 | 3300032002 | Bacteria | 2459 |
| 637 | Ga0307416_100181428 | 3300032002 | Bacteria | 1974 |
| 638 | Ga0307416_100426991 | 3300032002 | Bacteria | 1371 |
| 639 | Ga0307414_10133798 | 3300032004 | Bacteria | 1929 |
| 640 | Ga0307414_10698186 | 3300032004 | Bacteria | 918 |
| 641 | Ga0307411_10010751 | 3300032005 | Bacteria | 4897 |
| 642 | Ga0307411_10122994 | 3300032005 | Bacteria | 1881 |
| 643 | Ga0307411_10125159 | 3300032005 | Bacteria | 1868 |
| 644 | Ga0307411_10171378 | 3300032005 | Bacteria | 1637 |
| 645 | Ga0307415_100176251 | 3300032126 | Bacteria | 1673 |
| 646 | Ga0307415_100463762 | 3300032126 | Bacteria | 1098 |
| 647 | Ga0316583_10001101 | 3300032133 | Bacteria | 8783 |
| 648 | Ga0316583_10002300 | 3300032133 | Bacteria | 6588 |
| 649 | Ga0316583_10015720 | 3300032133 | Bacteria | 2725 |
| 650 | Ga0316585_10002081 | 3300032137 | Bacteria | 5369 |
| 651 | Ga0316580_10005072 | 3300032139 | Bacteria | 3829 |
| 652 | Ga0307510_10010168 | 3300033180 | Bacteria | 11188 |
| 653 | Ga0307510_10046095 | 3300033180 | Bacteria | 4694 |
| 654 | Ga0316214_1014381 | 3300033545 | Bacteria | 1089 |
| 655 | Ga0373929_0062312 | 3300035085 | Bacteria | 876 |
| 656 | Ga0373934_0000039 | 3300035086 | Bacteria | 43197 |
| 657 | Ga0373923_0270195 | 3300035111 | Bacteria | 799 |
| 658 | Ga0373953_0195503 | 3300035117 | Bacteria | 874 |
| 659 | Ga0373956_0000165 | 3300035119 | Bacteria | 24697 |
| 660 | Ga0373956_0177561 | 3300035119 | Bacteria | 1006 |
| 661 | Ga0373957_0000698 | 3300035120 | Bacteria | 8694 |
| 662 | Ga0373943_0056693 | 3300035170 | Bacteria | 1945 |
| 663 | Ga0373946_0007070 | 3300035171 | Bacteria | 4096 |
| 664 | Ga0373955_0004254 | 3300035172 | Bacteria | 6322 |
| 665 | Ga0316574_0155392 | 3300035398 | Bacteria | 1474 |
| 666 | Ga0373935_0098345 | 3300035692 | Bacteria | 1926 |
| 667 | Ga0373927_0000130 | 3300035695 | Bacteria | 57890 |
| 668 | Ga0373927_0079455 | 3300035695 | Bacteria | 2125 |
| 669 | Ga0373933_0008171 | 3300035724 | Bacteria | 5711 |
| 670 | Ga0373947_0145709 | 3300035725 | Bacteria | 1522 |
| 671 | Ga0373937_0015350 | 3300036401 | Bacteria | 6774 |
| 672 | Ga0373937_0026675 | 3300036401 | Bacteria | 5220 |
| 673 | Ga0373937_0259061 | 3300036401 | Bacteria | 1640 |
| 674 | Ga0316582_0000534 | 3300036647 | Bacteria | 14508 |
| 675 | Ga0316582_0015883 | 3300036647 | Bacteria | 4318 |
| 676 | Ga0316582_0350552 | 3300036647 | Bacteria | 1015 |
| 677 | Ga0316584_0135592 | 3300036712 | Bacteria | 1837 |
| 678 | Ga0316584_0184876 | 3300036712 | Bacteria | 1542 |
| 679 | Ga0373925_0036513 | 3300037068 | Bacteria | 3626 |
| 680 | Ga0395899_0016645 | 3300037312 | Bacteria | 5607 |
| 681 | Ga0395900_0000010 | 3300037418 | Bacteria | 461364 |
| 682 | Ga0395898_0034425 | 3300037466 | Bacteria | 5048 |
| 683 | Ga0395898_0123153 | 3300037466 | Bacteria | 2484 |
| 684 | Ga0395905_0001301 | 3300037471 | Bacteria | 30685 |
| 685 | Ga0316581_0014022 | 3300037588 | Bacteria | 2279 |
| 686 | Ga0436364_0959921 | 3300037853 | Bacteria | 2357 |
| 687 | Ga0436364_1061319 | 3300037853 | Bacteria | 1945 |
| 688 | Ga0436364_1109728 | 3300037853 | Bacteria | 2074 |
| 689 | Ga0436364_1346974 | 3300037853 | Bacteria | 3423 |
| 690 | Ga0395901_0000007 | 3300038443 | Bacteria | 497408 |
| 691 | Ga0400484_04287 | 3300038725 | Bacteria | 14642 |
| 692 | Ga0400484_11728 | 3300038725 | Bacteria | 7352 |
| 693 | Ga0400484_44564 | 3300038725 | Bacteria | 1791 |
| 694 | Ga0400490_06422 | 3300038726 | Bacteria | 2206 |
| 695 | Ga0400490_18130 | 3300038726 | Bacteria | 3068 |
| 696 | Ga0400491_04024 | 3300038727 | Bacteria | 1329 |
| 697 | Ga0436365_0156475 | 3300039437 | Bacteria | 37868 |
| 698 | Ga0436365_0356842 | 3300039437 | Bacteria | 18396 |
| 699 | Ga0436365_0638922 | 3300039437 | Bacteria | 1466 |
| 700 | Ga0436365_0640791 | 3300039437 | Bacteria | 50242 |
| 701 | Ga0436365_1846384 | 3300039437 | Bacteria | 2081 |
| 702 | Ga0436360_0428272 | 3300039438 | Bacteria | 6302 |
| 703 | Ga0436361_0129444 | 3300039447 | Bacteria | 9167 |
| 704 | Ga0436363_0538450 | 3300039450 | Bacteria | 22269 |
| 705 | Ga0436363_1520052 | 3300039450 | Bacteria | 6158 |
| 706 | Ga0436362_0582461 | 3300039453 | Bacteria | 7924 |
| 707 | Ga0439436_0000652 | 3300041404 | Bacteria | 9230 |
| 708 | Ga0439438_000437 | 3300041405 | Bacteria | 18952 |
| 709 | Ga0439438_001281 | 3300041405 | Bacteria | 11122 |
| 710 | Ga0439438_002577 | 3300041405 | Bacteria | 7683 |
| 711 | Ga0439438_005287 | 3300041405 | Bacteria | 4778 |
| 712 | Ga0439438_005461 | 3300041405 | Bacteria | 4670 |
| 713 | Ga0439438_007479 | 3300041405 | Bacteria | 3729 |
| 714 | Ga0439438_007560 | 3300041405 | Bacteria | 3700 |
| 715 | Ga0439447_000128 | 3300041407 | Bacteria | 25836 |
| 716 | Ga0439447_000462 | 3300041407 | Bacteria | 15142 |
| 717 | Ga0439447_004152 | 3300041407 | Bacteria | 5032 |
| 718 | Ga0439466_0000343 | 3300041411 | Bacteria | 17888 |
| 719 | Ga0439466_0001334 | 3300041411 | Bacteria | 9623 |
| 720 | Ga0439466_0004277 | 3300041411 | Bacteria | 5514 |
| 721 | Ga0439466_0006839 | 3300041411 | Bacteria | 4324 |
| 722 | Ga0439466_0022672 | 3300041411 | Bacteria | 2213 |
| 723 | Ga0439466_0036944 | 3300041411 | Bacteria | 1647 |
| 724 | Ga0439466_0072946 | 3300041411 | Bacteria | 1091 |
| 725 | Ga0439465_0002085 | 3300041413 | Bacteria | 6568 |
| 726 | Ga0439432_001014 | 3300042006 | Bacteria | 10614 |
| 727 | Ga0439432_003214 | 3300042006 | Bacteria | 6079 |
| 728 | Ga0439432_003970 | 3300042006 | Bacteria | 5437 |
| 729 | Ga0439432_008308 | 3300042006 | Bacteria | 3648 |
| 730 | Ga0439432_037651 | 3300042006 | Bacteria | 1543 |
| 731 | Ga0439451_003180 | 3300042009 | Bacteria | 3333 |
| 732 | Ga0439452_000190 | 3300042010 | Bacteria | 45505 |
| 733 | Ga0439452_000443 | 3300042010 | Bacteria | 23463 |
| 734 | Ga0439452_001195 | 3300042010 | Bacteria | 11155 |
| 735 | Ga0439452_002167 | 3300042010 | Bacteria | 7428 |
| 736 | Ga0439452_002256 | 3300042010 | Bacteria | 7225 |
| 737 | Ga0439452_032955 | 3300042010 | Bacteria | 1261 |
| 738 | Ga0439456_000036 | 3300042013 | Bacteria | 49413 |
| 739 | Ga0439456_001085 | 3300042013 | Bacteria | 5413 |
| 740 | Ga0439456_004035 | 3300042013 | Bacteria | 2980 |
| 741 | Ga0439463_000120 | 3300042016 | Bacteria | 19571 |
| 742 | Ga0439463_000491 | 3300042016 | Bacteria | 11038 |
| 743 | Ga0439463_003161 | 3300042016 | Bacteria | 4180 |
| 744 | Ga0439463_005639 | 3300042016 | Bacteria | 3109 |
| 745 | Ga0450911_000509 | 3300042115 | Bacteria | 12334 |
| 746 | Ga0450911_000543 | 3300042115 | Bacteria | 11754 |
| 747 | Ga0450911_001948 | 3300042115 | Bacteria | 4320 |
| 748 | Ga0450919_000957 | 3300042121 | Bacteria | 3741 |
| 749 | Ga0450920_002368 | 3300042122 | Bacteria | 3201 |
| 750 | Ga0450922_000657 | 3300042124 | Bacteria | 3607 |
| 751 | Ga0450923_001543 | 3300042125 | Bacteria | 3092 |
| 752 | Ga0450890_000131 | 3300042127 | Bacteria | 11737 |
| 753 | Ga0450900_000084 | 3300042136 | Bacteria | 4887 |
| 754 | Ga0450903_005080 | 3300042138 | Bacteria | 2215 |
| 755 | Ga0450903_008578 | 3300042138 | Bacteria | 1671 |
| 756 | Ga0450905_000122 | 3300042142 | Bacteria | 7925 |
| 757 | Ga0450905_004899 | 3300042142 | Bacteria | 1788 |
| 758 | Ga0450907_000110 | 3300042146 | Bacteria | 31083 |
| 759 | Ga0450907_001935 | 3300042146 | Bacteria | 4182 |
| 760 | Ga0450910_002464 | 3300042147 | Bacteria | 2430 |
| 761 | Ga0450910_024120 | 3300042147 | Bacteria | 932 |
| 762 | Ga0439446_0002401 | 3300042156 | Bacteria | 4489 |
| 763 | Ga0439446_0002959 | 3300042156 | Bacteria | 4155 |
| 764 | Ga0450908_000050 | 3300042184 | Bacteria | 23798 |
| 765 | Ga0450909_000363 | 3300042185 | Bacteria | 5765 |
| 766 | Ga0450909_001941 | 3300042185 | Bacteria | 2921 |
| 767 | Ga0439434_0000092 | 3300042435 | Bacteria | 22644 |
| 768 | Ga0439464_0000277 | 3300042439 | Bacteria | 9613 |
| 769 | Ga0439464_0006232 | 3300042439 | Bacteria | 3104 |
| 770 | Ga0439464_0012378 | 3300042439 | Bacteria | 2273 |
| 771 | Ga0439460_0003102 | 3300042461 | Bacteria | 4018 |
| 772 | Ga0439460_0008742 | 3300042461 | Bacteria | 2560 |
| 773 | Ga0450901_000475 | 3300042533 | Bacteria | 4768 |
| 774 | Ga0451577_0003511 | 3300042876 | Bacteria | 17381 |
| 775 | Ga0451577_0125705 | 3300042876 | Bacteria | 2298 |
| 776 | Ga0451577_0156363 | 3300042876 | Bacteria | 2052 |
| 777 | Ga0439440_0000808 | 3300042993 | Bacteria | 5423 |
| 778 | Ga0466965_0059528 | 3300044683 | Bacteria | 1907 |
| 779 | Ga0466968_0032261 | 3300044735 | Bacteria | 2178 |
| 780 | Ga0495617_000386 | 3300046452 | Bacteria | 24346 |
| 781 | Ga0495617_004591 | 3300046452 | Bacteria | 5001 |
| 782 | Ga0495617_084803 | 3300046452 | Bacteria | 1036 |
| 783 | Ga0495627_000095 | 3300046453 | Bacteria | 108094 |
| 784 | Ga0495627_000646 | 3300046453 | Bacteria | 27194 |
| 785 | Ga0495627_001581 | 3300046453 | Bacteria | 12884 |
| 786 | Ga0495627_004712 | 3300046453 | Bacteria | 5637 |
| 787 | Ga0495603_0001944 | 3300046455 | Bacteria | 12181 |
| 788 | Ga0495590_0000388 | 3300046457 | Bacteria | 22311 |
| 789 | Ga0495590_0000460 | 3300046457 | Bacteria | 20084 |
| 790 | Ga0495590_0001474 | 3300046457 | Bacteria | 10144 |
| 791 | Ga0495590_0007082 | 3300046457 | Bacteria | 4340 |
| 792 | Ga0495590_0025857 | 3300046457 | Bacteria | 2062 |
| 793 | Ga0495591_000334 | 3300046458 | Bacteria | 42109 |
| 794 | Ga0495591_000628 | 3300046458 | Bacteria | 26285 |
| 795 | Ga0495591_000923 | 3300046458 | Bacteria | 20257 |
| 796 | Ga0495591_001427 | 3300046458 | Bacteria | 14881 |
| 797 | Ga0495591_002016 | 3300046458 | Bacteria | 11817 |
| 798 | Ga0495591_002140 | 3300046458 | Bacteria | 11330 |
| 799 | Ga0495591_002379 | 3300046458 | Bacteria | 10553 |
| 800 | Ga0495591_004970 | 3300046458 | Bacteria | 6292 |
| 801 | Ga0495591_005398 | 3300046458 | Bacteria | 5930 |
| 802 | Ga0495591_007620 | 3300046458 | Bacteria | 4569 |
| 803 | Ga0495591_016596 | 3300046458 | Bacteria | 2557 |
| 804 | Ga0495591_018027 | 3300046458 | Bacteria | 2405 |
| 805 | Ga0495638_0000326 | 3300046460 | Bacteria | 60360 |
| 806 | Ga0495638_0004508 | 3300046460 | Bacteria | 10549 |
| 807 | Ga0495638_0034918 | 3300046460 | Bacteria | 3208 |
| 808 | Ga0495638_0045219 | 3300046460 | Bacteria | 2770 |
| 809 | Ga0495638_0065440 | 3300046460 | Bacteria | 2237 |
| 810 | Ga0495638_0225126 | 3300046460 | Bacteria | 1046 |
| 811 | Ga0495638_0288369 | 3300046460 | Bacteria | 889 |
| 812 | Ga0495651_0005051 | 3300046462 | Bacteria | 10075 |
| 813 | Ga0495653_0007203 | 3300046463 | Bacteria | 9113 |
| 814 | Ga0495653_0012336 | 3300046463 | Bacteria | 6972 |
| 815 | Ga0495650_0001617 | 3300046471 | Bacteria | 21024 |
| 816 | Ga0495650_0001916 | 3300046471 | Bacteria | 18422 |
| 817 | Ga0495650_0007358 | 3300046471 | Bacteria | 6633 |
| 818 | Ga0495650_0009773 | 3300046471 | Bacteria | 5424 |
| 819 | Ga0495650_0017685 | 3300046471 | Bacteria | 3566 |
| 820 | Ga0495650_0024217 | 3300046471 | Bacteria | 2869 |
| 821 | Ga0495650_0054220 | 3300046471 | Bacteria | 1637 |
| 822 | Ga0495582_0000456 | 3300046473 | Bacteria | 22343 |
| 823 | Ga0495605_0000019 | 3300046474 | Bacteria | 270010 |
| 824 | Ga0495605_0000376 | 3300046474 | Bacteria | 42124 |
| 825 | Ga0495605_0000384 | 3300046474 | Bacteria | 40989 |
| 826 | Ga0495605_0002242 | 3300046474 | Bacteria | 12068 |
| 827 | Ga0495605_0004010 | 3300046474 | Bacteria | 8696 |
| 828 | Ga0495605_0004235 | 3300046474 | Bacteria | 8450 |
| 829 | Ga0495605_0004852 | 3300046474 | Bacteria | 7866 |
| 830 | Ga0495605_0006168 | 3300046474 | Bacteria | 6913 |
| 831 | Ga0495605_0009596 | 3300046474 | Bacteria | 5435 |
| 832 | Ga0495605_0011143 | 3300046474 | Bacteria | 5024 |
| 833 | Ga0495605_0020125 | 3300046474 | Bacteria | 3549 |
| 834 | Ga0495605_0033602 | 3300046474 | Bacteria | 2602 |
| 835 | Ga0495605_0080499 | 3300046474 | Bacteria | 1524 |
| 836 | Ga0495639_0000295 | 3300046475 | Bacteria | 24407 |
| 837 | Ga0495662_0146533 | 3300046476 | Bacteria | 1163 |
| 838 | Ga0495584_0000408 | 3300046491 | Bacteria | 29754 |
| 839 | Ga0495584_0002140 | 3300046491 | Bacteria | 11289 |
| 840 | Ga0495584_0002646 | 3300046491 | Bacteria | 10080 |
| 841 | Ga0495584_0003319 | 3300046491 | Bacteria | 8901 |
| 842 | Ga0495584_0006064 | 3300046491 | Bacteria | 6363 |
| 843 | Ga0495584_0006289 | 3300046491 | Bacteria | 6223 |
| 844 | Ga0495584_0033007 | 3300046491 | Bacteria | 2618 |
| 845 | Ga0495584_0043001 | 3300046491 | Bacteria | 2280 |
| 846 | Ga0495584_0249412 | 3300046491 | Bacteria | 902 |
| 847 | Ga0495585_0000895 | 3300046492 | Bacteria | 25250 |
| 848 | Ga0495585_0011646 | 3300046492 | Bacteria | 5202 |
| 849 | Ga0495585_0012147 | 3300046492 | Bacteria | 5079 |
| 850 | Ga0495585_0014639 | 3300046492 | Bacteria | 4564 |
| 851 | Ga0495585_0017769 | 3300046492 | Bacteria | 4105 |
| 852 | Ga0495585_0034670 | 3300046492 | Bacteria | 2853 |
| 853 | Ga0495594_0005851 | 3300046499 | Bacteria | 6317 |
| 854 | Ga0495596_0000175 | 3300046500 | Bacteria | 44764 |
| 855 | Ga0495596_0012956 | 3300046500 | Bacteria | 3551 |
| 856 | Ga0495607_0000024 | 3300046501 | Bacteria | 159904 |
| 857 | Ga0495607_0000531 | 3300046501 | Bacteria | 37437 |
| 858 | Ga0495607_0000751 | 3300046501 | Bacteria | 31037 |
| 859 | Ga0495607_0001123 | 3300046501 | Bacteria | 24276 |
| 860 | Ga0495607_0003423 | 3300046501 | Bacteria | 12155 |
| 861 | Ga0495607_0003609 | 3300046501 | Bacteria | 11756 |
| 862 | Ga0495607_0012855 | 3300046501 | Bacteria | 5506 |
| 863 | Ga0495607_0017733 | 3300046501 | Bacteria | 4559 |
| 864 | Ga0495607_0030789 | 3300046501 | Bacteria | 3290 |
| 865 | Ga0495607_0052787 | 3300046501 | Bacteria | 2352 |
| 866 | Ga0495607_0113048 | 3300046501 | Bacteria | 1436 |
| 867 | Ga0495607_0139380 | 3300046501 | Bacteria | 1252 |
| 868 | Ga0495607_0189960 | 3300046501 | Bacteria | 1024 |
| 869 | Ga0495583_0000146 | 3300046506 | Bacteria | 119793 |
| 870 | Ga0495583_0000452 | 3300046506 | Bacteria | 61394 |
| 871 | Ga0495583_0001254 | 3300046506 | Bacteria | 26768 |
| 872 | Ga0495583_0001293 | 3300046506 | Bacteria | 26098 |
| 873 | Ga0495583_0004428 | 3300046506 | Bacteria | 10053 |
| 874 | Ga0495583_0005244 | 3300046506 | Bacteria | 8889 |
| 875 | Ga0495583_0007005 | 3300046506 | Bacteria | 7216 |
| 876 | Ga0495583_0008331 | 3300046506 | Bacteria | 6353 |
| 877 | Ga0495606_0000115 | 3300046507 | Bacteria | 135589 |
| 878 | Ga0495606_0001164 | 3300046507 | Bacteria | 37202 |
| 879 | Ga0495606_0002670 | 3300046507 | Bacteria | 20254 |
| 880 | Ga0495606_0007824 | 3300046507 | Bacteria | 9438 |
| 881 | Ga0495606_0008572 | 3300046507 | Bacteria | 8847 |
| 882 | Ga0495606_0017468 | 3300046507 | Bacteria | 5422 |
| 883 | Ga0495606_0021308 | 3300046507 | Bacteria | 4748 |
| 884 | Ga0495610_0003687 | 3300046512 | Bacteria | 11763 |
| 885 | Ga0495610_0004027 | 3300046512 | Bacteria | 11082 |
| 886 | Ga0495610_0004226 | 3300046512 | Bacteria | 10697 |
| 887 | Ga0495610_0007330 | 3300046512 | Bacteria | 7374 |
| 888 | Ga0495610_0007573 | 3300046512 | Bacteria | 7191 |
| 889 | Ga0495610_0008416 | 3300046512 | Bacteria | 6687 |
| 890 | Ga0495610_0011490 | 3300046512 | Bacteria | 5412 |
| 891 | Ga0495610_0014586 | 3300046512 | Bacteria | 4609 |
| 892 | Ga0495610_0015654 | 3300046512 | Bacteria | 4397 |
| 893 | Ga0495610_0022458 | 3300046512 | Bacteria | 3450 |
| 894 | Ga0495610_0023562 | 3300046512 | Bacteria | 3342 |
| 895 | Ga0495610_0032725 | 3300046512 | Bacteria | 2697 |
| 896 | Ga0495616_0038638 | 3300046513 | Bacteria | 2450 |
| 897 | Ga0495616_0044969 | 3300046513 | Bacteria | 2237 |
| 898 | Ga0495616_0050447 | 3300046513 | Bacteria | 2080 |
| 899 | Ga0495616_0064360 | 3300046513 | Bacteria | 1789 |
| 900 | Ga0495616_0120987 | 3300046513 | Bacteria | 1208 |
| 901 | Ga0495620_0000023 | 3300046515 | Bacteria | 131512 |
| 902 | Ga0495620_0000108 | 3300046515 | Bacteria | 66218 |
| 903 | Ga0495620_0001719 | 3300046515 | Bacteria | 12933 |
| 904 | Ga0495620_0002090 | 3300046515 | Bacteria | 11609 |
| 905 | Ga0495620_0009332 | 3300046515 | Bacteria | 5223 |
| 906 | Ga0495620_0014190 | 3300046515 | Bacteria | 4056 |
| 907 | Ga0495620_0048260 | 3300046515 | Bacteria | 1828 |
| 908 | Ga0495620_0052870 | 3300046515 | Bacteria | 1722 |
| 909 | Ga0495630_0107281 | 3300046517 | Bacteria | 2115 |
| 910 | Ga0495631_0001318 | 3300046518 | Bacteria | 15202 |
| 911 | Ga0495631_0002233 | 3300046518 | Bacteria | 11131 |
| 912 | Ga0495631_0002655 | 3300046518 | Bacteria | 9972 |
| 913 | Ga0495631_0005054 | 3300046518 | Bacteria | 6949 |
| 914 | Ga0495631_0006347 | 3300046518 | Bacteria | 6113 |
| 915 | Ga0495631_0026439 | 3300046518 | Bacteria | 2665 |
| 916 | Ga0495631_0045974 | 3300046518 | Bacteria | 1921 |
| 917 | Ga0495631_0049399 | 3300046518 | Bacteria | 1841 |
| 918 | Ga0495632_0001083 | 3300046519 | Bacteria | 23346 |
| 919 | Ga0495632_0001735 | 3300046519 | Bacteria | 17682 |
| 920 | Ga0495632_0001795 | 3300046519 | Bacteria | 17318 |
| 921 | Ga0495632_0002669 | 3300046519 | Bacteria | 13373 |
| 922 | Ga0495632_0004841 | 3300046519 | Bacteria | 9042 |
| 923 | Ga0495632_0004928 | 3300046519 | Bacteria | 8951 |
| 924 | Ga0495632_0055660 | 3300046519 | Bacteria | 1935 |
| 925 | Ga0495632_0215176 | 3300046519 | Bacteria | 870 |
| 926 | Ga0495637_0000054 | 3300046520 | Bacteria | 99531 |
| 927 | Ga0495637_0000194 | 3300046520 | Bacteria | 47572 |
| 928 | Ga0495637_0000269 | 3300046520 | Bacteria | 41036 |
| 929 | Ga0495637_0000466 | 3300046520 | Bacteria | 29566 |
| 930 | Ga0495637_0002490 | 3300046520 | Bacteria | 10165 |
| 931 | Ga0495637_0003116 | 3300046520 | Bacteria | 8852 |
| 932 | Ga0495637_0004382 | 3300046520 | Bacteria | 7320 |
| 933 | Ga0495637_0005192 | 3300046520 | Bacteria | 6669 |
| 934 | Ga0495637_0011746 | 3300046520 | Bacteria | 4199 |
| 935 | Ga0495637_0019417 | 3300046520 | Bacteria | 3142 |
| 936 | Ga0495637_0057374 | 3300046520 | Bacteria | 1608 |
| 937 | Ga0495643_0000730 | 3300046522 | Bacteria | 37461 |
| 938 | Ga0495643_0001170 | 3300046522 | Bacteria | 25602 |
| 939 | Ga0495643_0015823 | 3300046522 | Bacteria | 4445 |
| 940 | Ga0495643_0018489 | 3300046522 | Bacteria | 4048 |
| 941 | Ga0495643_0052789 | 3300046522 | Bacteria | 2181 |
| 942 | Ga0495643_0075803 | 3300046522 | Bacteria | 1759 |
| 943 | Ga0495644_0001554 | 3300046523 | Bacteria | 9358 |
| 944 | Ga0495644_0003019 | 3300046523 | Bacteria | 6662 |
| 945 | Ga0495644_0003034 | 3300046523 | Bacteria | 6645 |
| 946 | Ga0495644_0003287 | 3300046523 | Bacteria | 6390 |
| 947 | Ga0495648_0000165 | 3300046524 | Bacteria | 78462 |
| 948 | Ga0495648_0000783 | 3300046524 | Bacteria | 33886 |
| 949 | Ga0495648_0001858 | 3300046524 | Bacteria | 20225 |
| 950 | Ga0495648_0002460 | 3300046524 | Bacteria | 17056 |
| 951 | Ga0495648_0002748 | 3300046524 | Bacteria | 15885 |
| 952 | Ga0495648_0004730 | 3300046524 | Bacteria | 11529 |
| 953 | Ga0495648_0005172 | 3300046524 | Bacteria | 10916 |
| 954 | Ga0495648_0007923 | 3300046524 | Bacteria | 8427 |
| 955 | Ga0495648_0008056 | 3300046524 | Bacteria | 8336 |
| 956 | Ga0495648_0012578 | 3300046524 | Bacteria | 6301 |
| 957 | Ga0495648_0043672 | 3300046524 | Bacteria | 2806 |
| 958 | Ga0495648_0113046 | 3300046524 | Bacteria | 1473 |
| 959 | Ga0495648_0146522 | 3300046524 | Bacteria | 1236 |
| 960 | Ga0495666_0001604 | 3300046526 | Bacteria | 11127 |
| 961 | Ga0495666_0008958 | 3300046526 | Bacteria | 5007 |
| 962 | Ga0495666_0036593 | 3300046526 | Bacteria | 2390 |
| 963 | Ga0495642_0000536 | 3300046528 | Bacteria | 19246 |
| 964 | Ga0495642_0000555 | 3300046528 | Bacteria | 18832 |
| 965 | Ga0495642_0001444 | 3300046528 | Bacteria | 10638 |
| 966 | Ga0495654_0000404 | 3300046530 | Bacteria | 36985 |
| 967 | Ga0495654_0001010 | 3300046530 | Bacteria | 20620 |
| 968 | Ga0495654_0001692 | 3300046530 | Bacteria | 14844 |
| 969 | Ga0495654_0002438 | 3300046530 | Bacteria | 11969 |
| 970 | Ga0495654_0005580 | 3300046530 | Bacteria | 7283 |
| 971 | Ga0495654_0006844 | 3300046530 | Bacteria | 6432 |
| 972 | Ga0495654_0007375 | 3300046530 | Bacteria | 6144 |
| 973 | Ga0495654_0007795 | 3300046530 | Bacteria | 5953 |
| 974 | Ga0495654_0031295 | 3300046530 | Bacteria | 2701 |
| 975 | Ga0495654_0032061 | 3300046530 | Bacteria | 2664 |
| 976 | Ga0495654_0032647 | 3300046530 | Bacteria | 2638 |
| 977 | Ga0495665_0190299 | 3300046531 | Bacteria | 1065 |
| 978 | Ga0495586_0005132 | 3300046535 | Bacteria | 7010 |
| 979 | Ga0495587_0003520 | 3300046536 | Bacteria | 10428 |
| 980 | Ga0495609_0000061 | 3300046538 | Bacteria | 139848 |
| 981 | Ga0495609_0000101 | 3300046538 | Bacteria | 100818 |
| 982 | Ga0495609_0000696 | 3300046538 | Bacteria | 25895 |
| 983 | Ga0495609_0004755 | 3300046538 | Bacteria | 7342 |
| 984 | Ga0495609_0005878 | 3300046538 | Bacteria | 6355 |
| 985 | Ga0495609_0009579 | 3300046538 | Bacteria | 4683 |
| 986 | Ga0495609_0062227 | 3300046538 | Bacteria | 1648 |
| 987 | Ga0495597_0009099 | 3300046542 | Bacteria | 4931 |
| 988 | Ga0495597_0011291 | 3300046542 | Bacteria | 4335 |
| 989 | Ga0495597_0030031 | 3300046542 | Bacteria | 2478 |
| 990 | Ga0495597_0059307 | 3300046542 | Bacteria | 1671 |
| 991 | Ga0495597_0070344 | 3300046542 | Bacteria | 1509 |
| 992 | Ga0495645_0005791 | 3300046543 | Bacteria | 8525 |
| 993 | Ga0495622_0001089 | 3300046557 | Bacteria | 14195 |
| 994 | Ga0495622_0001805 | 3300046557 | Bacteria | 10548 |
| 995 | Ga0495622_0009631 | 3300046557 | Bacteria | 4466 |
| 996 | Ga0495622_0010425 | 3300046557 | Bacteria | 4292 |
| 997 | Ga0495622_0060819 | 3300046557 | Bacteria | 1749 |
| 998 | Ga0495633_0000129 | 3300046558 | Bacteria | 100833 |
| 999 | Ga0495633_0003624 | 3300046558 | Bacteria | 10211 |
| 1000 | Ga0495668_0000456 | 3300046616 | Bacteria | 52300 |
| 1001 | Ga0495668_0003520 | 3300046616 | Bacteria | 11662 |
| 1002 | Ga0495668_0005068 | 3300046616 | Bacteria | 9068 |
| 1003 | Ga0495668_0008651 | 3300046616 | Bacteria | 6328 |
| 1004 | Ga0495668_0017023 | 3300046616 | Bacteria | 4221 |
| 1005 | Ga0495668_0024129 | 3300046616 | Bacteria | 3460 |
| 1006 | Ga0495668_0058681 | 3300046616 | Bacteria | 2123 |
| 1007 | Ga0495668_0078486 | 3300046616 | Bacteria | 1813 |
| 1008 | Ga0495668_0087826 | 3300046616 | Bacteria | 1705 |
| 1009 | Ga0495634_0005870 | 3300046642 | Bacteria | 9381 |
| 1010 | Ga0495634_0181392 | 3300046642 | Bacteria | 1318 |
| 1011 | Ga0495611_0000525 | 3300046648 | Bacteria | 22782 |
| 1012 | Ga0495611_0000571 | 3300046648 | Bacteria | 21238 |
| 1013 | Ga0495611_0001821 | 3300046648 | Bacteria | 10218 |
| 1014 | Ga0495611_0012098 | 3300046648 | Bacteria | 3667 |
| 1015 | Ga0495611_0013014 | 3300046648 | Bacteria | 3538 |
| 1016 | Ga0495611_0027813 | 3300046648 | Bacteria | 2475 |
| 1017 | Ga0495625_0000147 | 3300046660 | Bacteria | 107983 |
| 1018 | Ga0495625_0010589 | 3300046660 | Bacteria | 7612 |
| 1019 | Ga0495625_0022435 | 3300046660 | Bacteria | 4840 |
| 1020 | Ga0495625_0023226 | 3300046660 | Bacteria | 4739 |
| 1021 | Ga0495625_0097020 | 3300046660 | Bacteria | 2029 |
| 1022 | Ga0495635_0000583 | 3300046663 | Bacteria | 23456 |
| 1023 | Ga0495635_0012360 | 3300046663 | Bacteria | 5983 |
| 1024 | Ga0495659_0000380 | 3300046664 | Bacteria | 17135 |
| 1025 | Ga0495661_0000153 | 3300046665 | Bacteria | 81096 |
| 1026 | Ga0495661_0000196 | 3300046665 | Bacteria | 69840 |
| 1027 | Ga0495661_0000484 | 3300046665 | Bacteria | 41967 |
| 1028 | Ga0495661_0001282 | 3300046665 | Bacteria | 21506 |
| 1029 | Ga0495661_0001727 | 3300046665 | Bacteria | 17684 |
| 1030 | Ga0495661_0023738 | 3300046665 | Bacteria | 3975 |
| 1031 | Ga0495661_0042494 | 3300046665 | Bacteria | 2801 |
| 1032 | Ga0495661_0137531 | 3300046665 | Bacteria | 1332 |
| 1033 | Ga0495588_0045613 | 3300046674 | Bacteria | 2247 |
| 1034 | Ga0495657_0054974 | 3300046675 | Bacteria | 2657 |
| 1035 | Ga0495623_0017742 | 3300046679 | Bacteria | 4597 |
| 1036 | Ga0495646_0000923 | 3300046680 | Bacteria | 16700 |
| 1037 | Ga0495646_0039662 | 3300046680 | Bacteria | 2902 |
| 1038 | Ga0495658_0043062 | 3300046683 | Bacteria | 2523 |
| 1039 | Ga0495669_0014877 | 3300046684 | Bacteria | 3328 |
| 1040 | Ga0495624_0003816 | 3300046690 | Bacteria | 11140 |
| 1041 | Ga0495670_0000388 | 3300046691 | Bacteria | 21005 |
| 1042 | Ga0495670_0001561 | 3300046691 | Bacteria | 11194 |
| 1043 | Ga0495670_0003729 | 3300046691 | Bacteria | 7496 |
| 1044 | Ga0495670_0013134 | 3300046691 | Bacteria | 4071 |
| 1045 | Ga0495670_0033110 | 3300046691 | Bacteria | 2571 |
| 1046 | Ga0495670_0180903 | 3300046691 | Bacteria | 1113 |
| 1047 | Ga0495671_0000471 | 3300046692 | Bacteria | 31523 |
| 1048 | Ga0495671_0001900 | 3300046692 | Bacteria | 13409 |
| 1049 | Ga0495671_0003438 | 3300046692 | Bacteria | 9728 |
| 1050 | Ga0495671_0007329 | 3300046692 | Bacteria | 6297 |
| 1051 | Ga0495671_0009812 | 3300046692 | Bacteria | 5332 |
| 1052 | Ga0495671_0010835 | 3300046692 | Bacteria | 5039 |
| 1053 | Ga0495671_0026950 | 3300046692 | Bacteria | 2973 |
| 1054 | Ga0495671_0034401 | 3300046692 | Bacteria | 2576 |
| 1055 | Ga0495671_0135720 | 3300046692 | Bacteria | 1199 |
| 1056 | Ga0495649_0000968 | 3300046694 | Bacteria | 22667 |
| 1057 | Ga0495649_0001584 | 3300046694 | Bacteria | 17031 |
| 1058 | Ga0495649_0007483 | 3300046694 | Bacteria | 6650 |
| 1059 | Ga0495649_0027028 | 3300046694 | Bacteria | 3185 |
| 1060 | Ga0495649_0031798 | 3300046694 | Bacteria | 2909 |
| 1061 | Ga0495649_0036976 | 3300046694 | Bacteria | 2681 |
| 1062 | Ga0495649_0053755 | 3300046694 | Bacteria | 2179 |
| 1063 | Ga0495589_0000668 | 3300046794 | Bacteria | 22510 |
| 1064 | Ga0495589_0002719 | 3300046794 | Bacteria | 9775 |
| 1065 | Ga0495589_0011005 | 3300046794 | Bacteria | 4696 |
| 1066 | Ga0495589_0034990 | 3300046794 | Bacteria | 2519 |
| 1067 | Ga0495589_0039482 | 3300046794 | Bacteria | 2358 |
| 1068 | Ga0495600_0038322 | 3300046809 | Bacteria | 3118 |
| 1069 | Ga0495660_0000431 | 3300046810 | Bacteria | 35256 |
| 1070 | Ga0495660_0002451 | 3300046810 | Bacteria | 11842 |
| 1071 | Ga0495660_0005838 | 3300046810 | Bacteria | 7344 |
| 1072 | Ga0495660_0007185 | 3300046810 | Bacteria | 6558 |
| 1073 | Ga0495660_0009508 | 3300046810 | Bacteria | 5667 |
| 1074 | Ga0495660_0010383 | 3300046810 | Bacteria | 5417 |
| 1075 | Ga0495660_0070127 | 3300046810 | Bacteria | 1861 |
| 1076 | Ga0495660_0139177 | 3300046810 | Bacteria | 1209 |
| 1077 | Ga0495660_0166390 | 3300046810 | Bacteria | 1077 |
| 1078 | Ga0495604_0010664 | 3300047317 | Bacteria | 7289 |
| 1079 | Ga0495604_0033515 | 3300047317 | Bacteria | 4065 |
| 1080 | Ga0495636_0013676 | 3300047318 | Bacteria | 3221 |
| 1081 | Ga0495636_0116008 | 3300047318 | Bacteria | 1181 |
| 1082 | Ga0495674_0091398 | 3300047319 | Bacteria | 2600 |
| 1083 | Ga0495672_0003447 | 3300047320 | Bacteria | 13529 |
| 1084 | Ga0495672_0004295 | 3300047320 | Bacteria | 11749 |
| 1085 | Ga0495672_0004628 | 3300047320 | Bacteria | 11168 |
| 1086 | Ga0495672_0005323 | 3300047320 | Bacteria | 10239 |
| 1087 | Ga0495672_0005353 | 3300047320 | Bacteria | 10210 |
| 1088 | Ga0495672_0007677 | 3300047320 | Bacteria | 8085 |
| 1089 | Ga0495672_0008665 | 3300047320 | Bacteria | 7470 |
| 1090 | Ga0495672_0009332 | 3300047320 | Bacteria | 7121 |
| 1091 | Ga0495672_0009374 | 3300047320 | Bacteria | 7100 |
| 1092 | Ga0495672_0012649 | 3300047320 | Bacteria | 5873 |
| 1093 | Ga0495672_0013767 | 3300047320 | Bacteria | 5565 |
| 1094 | Ga0495672_0015335 | 3300047320 | Bacteria | 5206 |
| 1095 | Ga0495672_0027993 | 3300047320 | Bacteria | 3573 |
| 1096 | Ga0495672_0053772 | 3300047320 | Bacteria | 2357 |
| 1097 | Ga0495676_0000027 | 3300047321 | Bacteria | 141955 |
| 1098 | Ga0495676_0017673 | 3300047321 | Bacteria | 6297 |
| 1099 | Ga0495680_0005758 | 3300047322 | Bacteria | 11601 |
| 1100 | Ga0495680_0033959 | 3300047322 | Bacteria | 4126 |
| 1101 | Ga0495683_0000075 | 3300047323 | Bacteria | 100715 |
| 1102 | Ga0495683_0001303 | 3300047323 | Bacteria | 16785 |
| 1103 | Ga0495683_0001374 | 3300047323 | Bacteria | 16151 |
| 1104 | Ga0495683_0030110 | 3300047323 | Bacteria | 2770 |
| 1105 | Ga0495683_0033942 | 3300047323 | Bacteria | 2595 |
| 1106 | Ga0495683_0146379 | 3300047323 | Bacteria | 1103 |
| 1107 | Ga0495687_004754 | 3300047443 | Bacteria | 8978 |
| 1108 | Ga0495687_027947 | 3300047443 | Bacteria | 2631 |
| 1109 | Ga0495687_028807 | 3300047443 | Bacteria | 2578 |
| 1110 | Ga0495675_0025096 | 3300047444 | Bacteria | 3801 |
| 1111 | Ga0495679_000237 | 3300047446 | Bacteria | 45847 |
| 1112 | Ga0495679_000792 | 3300047446 | Bacteria | 20055 |
| 1113 | Ga0495679_028365 | 3300047446 | Bacteria | 1837 |
| 1114 | Ga0495673_0000344 | 3300047469 | Bacteria | 58803 |
| 1115 | Ga0495673_0000389 | 3300047469 | Bacteria | 51664 |
| 1116 | Ga0495673_0001628 | 3300047469 | Bacteria | 17374 |
| 1117 | Ga0495673_0001807 | 3300047469 | Bacteria | 16191 |
| 1118 | Ga0495673_0003384 | 3300047469 | Bacteria | 10535 |
| 1119 | Ga0495673_0003463 | 3300047469 | Bacteria | 10384 |
| 1120 | Ga0495673_0003817 | 3300047469 | Bacteria | 9735 |
| 1121 | Ga0495673_0005394 | 3300047469 | Bacteria | 7744 |
| 1122 | Ga0495673_0006066 | 3300047469 | Bacteria | 7177 |
| 1123 | Ga0495673_0007335 | 3300047469 | Bacteria | 6359 |
| 1124 | Ga0495673_0020644 | 3300047469 | Bacteria | 3276 |
| 1125 | Ga0495673_0022022 | 3300047469 | Bacteria | 3131 |
| 1126 | Ga0495673_0066546 | 3300047469 | Bacteria | 1527 |
| 1127 | Ga0495681_0003081 | 3300047470 | Bacteria | 11691 |
| 1128 | Ga0495681_0003215 | 3300047470 | Bacteria | 11403 |
| 1129 | Ga0495681_0004733 | 3300047470 | Bacteria | 9222 |
| 1130 | Ga0495681_0004777 | 3300047470 | Bacteria | 9177 |
| 1131 | Ga0495681_0006728 | 3300047470 | Bacteria | 7498 |
| 1132 | Ga0495681_0009405 | 3300047470 | Bacteria | 6026 |
| 1133 | Ga0495681_0009407 | 3300047470 | Bacteria | 6025 |
| 1134 | Ga0495681_0014453 | 3300047470 | Bacteria | 4523 |
| 1135 | Ga0495681_0031089 | 3300047470 | Bacteria | 2708 |
| 1136 | Ga0495681_0033287 | 3300047470 | Bacteria | 2584 |
| 1137 | Ga0495681_0116910 | 3300047470 | Bacteria | 1148 |
| 1138 | Ga0495686_0000939 | 3300047472 | Bacteria | 36166 |
| 1139 | Ga0495686_0005925 | 3300047472 | Bacteria | 9518 |
| 1140 | Ga0495686_0026529 | 3300047472 | Bacteria | 3789 |
| 1141 | Ga0495686_0034167 | 3300047472 | Bacteria | 3277 |
| 1142 | Ga0495626_0000067 | 3300048091 | Bacteria | 139969 |
| 1143 | Ga0495626_0000507 | 3300048091 | Bacteria | 38997 |
| 1144 | Ga0495626_0000684 | 3300048091 | Bacteria | 32479 |
| 1145 | Ga0495626_0000996 | 3300048091 | Bacteria | 24344 |
| 1146 | Ga0495626_0001171 | 3300048091 | Bacteria | 21808 |
| 1147 | Ga0495626_0001627 | 3300048091 | Bacteria | 17443 |
| 1148 | Ga0495626_0008526 | 3300048091 | Bacteria | 5609 |
| 1149 | Ga0495626_0018825 | 3300048091 | Bacteria | 3459 |
| 1150 | Ga0495626_0059201 | 3300048091 | Bacteria | 1748 |
| 1151 | Ga0495626_0123277 | 3300048091 | Bacteria | 1112 |
| 1152 | Ga0496100_0103302 | 3300048903 | Bacteria | 1967 |
| 1153 | Ga0496101_0074515 | 3300048904 | Bacteria | 2496 |
| 1154 | Ga0496101_0141962 | 3300048904 | Bacteria | 1831 |
| 1155 | Ga0496102_0001259 | 3300048905 | Bacteria | 22840 |
| 1156 | Ga0496102_0006816 | 3300048905 | Bacteria | 9749 |
| 1157 | Ga0496102_0043521 | 3300048905 | Bacteria | 4072 |
| 1158 | Ga0496102_0067249 | 3300048905 | Bacteria | 3286 |
| 1159 | Ga0496102_0125466 | 3300048905 | Bacteria | 2399 |
| 1160 | Ga0496102_0284314 | 3300048905 | Bacteria | 1559 |
| 1161 | Ga0496103_0005569 | 3300048906 | Bacteria | 7531 |
| 1162 | Ga0496104_0011028 | 3300048907 | Bacteria | 8086 |
| 1163 | Ga0496105_0002288 | 3300048908 | Bacteria | 13889 |
| 1164 | Ga0496105_0141507 | 3300048908 | Bacteria | 1980 |
| 1165 | Ga0496105_0402718 | 3300048908 | Bacteria | 1086 |
| 1166 | Ga0496106_0006654 | 3300048909 | Bacteria | 8556 |
| 1167 | Ga0496106_0029466 | 3300048909 | Bacteria | 4091 |
| 1168 | Ga0496106_0141442 | 3300048909 | Bacteria | 1893 |
| 1169 | Ga0496107_0016644 | 3300048910 | Bacteria | 5166 |
| 1170 | Ga0496108_0021493 | 3300048911 | Bacteria | 5303 |
| 1171 | Ga0496109_0037045 | 3300048912 | Bacteria | 4406 |
| 1172 | Ga0496109_0053159 | 3300048912 | Bacteria | 3693 |
| 1173 | Ga0496110_0073220 | 3300048913 | Bacteria | 3040 |
| 1174 | Ga0496110_0096563 | 3300048913 | Bacteria | 2648 |
| 1175 | Ga0496111_0070257 | 3300048914 | Bacteria | 2546 |
| 1176 | Ga0496112_0054241 | 3300048915 | Bacteria | 3938 |
| 1177 | Ga0496112_0240683 | 3300048915 | Bacteria | 1762 |
| 1178 | Ga0496112_0597880 | 3300048915 | Bacteria | 1035 |
| 1179 | Ga0496113_0033499 | 3300048916 | Bacteria | 3741 |
| 1180 | Ga0496114_0005634 | 3300048917 | Bacteria | 9821 |
| 1181 | Ga0496114_0023930 | 3300048917 | Bacteria | 4984 |
| 1182 | Ga0496114_0024009 | 3300048917 | Bacteria | 4975 |
| 1183 | Ga0496114_0380253 | 3300048917 | Bacteria | 1250 |
| 1184 | Ga0496115_0001599 | 3300048918 | Bacteria | 16277 |
| 1185 | Ga0496115_0001643 | 3300048918 | Bacteria | 16076 |
| 1186 | Ga0496115_0012609 | 3300048918 | Bacteria | 6367 |
| 1187 | Ga0496116_0000242 | 3300048919 | Bacteria | 99455 |
| 1188 | Ga0496116_0000275 | 3300048919 | Bacteria | 89714 |
| 1189 | Ga0496116_0001670 | 3300048919 | Bacteria | 24375 |
| 1190 | Ga0496116_0002076 | 3300048919 | Bacteria | 21440 |
| 1191 | Ga0496116_0007060 | 3300048919 | Bacteria | 10060 |
| 1192 | Ga0496116_0033922 | 3300048919 | Bacteria | 3612 |
| 1193 | Ga0496117_0000270 | 3300048920 | Bacteria | 97077 |
| 1194 | Ga0496117_0000932 | 3300048920 | Bacteria | 44792 |
| 1195 | Ga0496117_0002067 | 3300048920 | Bacteria | 26545 |
| 1196 | Ga0496117_0007272 | 3300048920 | Bacteria | 10879 |
| 1197 | Ga0496117_0007848 | 3300048920 | Bacteria | 10266 |
| 1198 | Ga0496117_0018282 | 3300048920 | Bacteria | 5815 |
| 1199 | Ga0496117_0026880 | 3300048920 | Bacteria | 4494 |
| 1200 | Ga0496117_0061121 | 3300048920 | Bacteria | 2592 |
| 1201 | Ga0496117_0081529 | 3300048920 | Bacteria | 2122 |
| 1202 | Ga0496117_0105827 | 3300048920 | Bacteria | 1767 |
| 1203 | Ga0496118_0001862 | 3300048921 | Bacteria | 30191 |
| 1204 | Ga0496118_0001894 | 3300048921 | Bacteria | 29838 |
| 1205 | Ga0496118_0007945 | 3300048921 | Bacteria | 11099 |
| 1206 | Ga0496118_0010933 | 3300048921 | Bacteria | 8924 |
| 1207 | Ga0496118_0018613 | 3300048921 | Bacteria | 6251 |
| 1208 | Ga0496118_0018851 | 3300048921 | Bacteria | 6194 |
| 1209 | Ga0496118_0061091 | 3300048921 | Bacteria | 2792 |
| 1210 | Ga0496118_0081215 | 3300048921 | Bacteria | 2277 |
| 1211 | Ga0496118_0082230 | 3300048921 | Bacteria | 2257 |
| 1212 | Ga0496118_0158863 | 3300048921 | Bacteria | 1401 |
| 1213 | Ga0496119_0000230 | 3300048922 | Bacteria | 78527 |
| 1214 | Ga0496119_0012199 | 3300048922 | Bacteria | 7011 |
| 1215 | Ga0496120_0000324 | 3300048923 | Bacteria | 79261 |
| 1216 | Ga0496120_0004336 | 3300048923 | Bacteria | 11991 |
| 1217 | Ga0496120_0016350 | 3300048923 | Bacteria | 4851 |
| 1218 | Ga0496121_0000071 | 3300048924 | Bacteria | 247039 |
| 1219 | Ga0496121_0000318 | 3300048924 | Bacteria | 100833 |
| 1220 | Ga0496121_0010903 | 3300048924 | Bacteria | 10158 |
| 1221 | Ga0496121_0029160 | 3300048924 | Bacteria | 5113 |
| 1222 | Ga0496121_0041549 | 3300048924 | Bacteria | 4016 |
| 1223 | Ga0496121_0047928 | 3300048924 | Bacteria | 3640 |
| 1224 | Ga0496121_0080949 | 3300048924 | Bacteria | 2572 |
| 1225 | Ga0496122_0000517 | 3300048925 | Bacteria | 79890 |
| 1226 | Ga0496122_0002629 | 3300048925 | Bacteria | 25113 |
| 1227 | Ga0496122_0007631 | 3300048925 | Bacteria | 11947 |
| 1228 | Ga0496122_0010252 | 3300048925 | Bacteria | 9701 |
| 1229 | Ga0496122_0018736 | 3300048925 | Bacteria | 6370 |
| 1230 | Ga0496122_0019577 | 3300048925 | Bacteria | 6173 |
| 1231 | Ga0496122_0028914 | 3300048925 | Bacteria | 4688 |
| 1232 | Ga0496122_0116564 | 3300048925 | Bacteria | 1736 |
| 1233 | Ga0496122_0180560 | 3300048925 | Bacteria | 1259 |
| 1234 | Ga0496122_0205757 | 3300048925 | Bacteria | 1145 |
| 1235 | Ga0496123_0000243 | 3300048926 | Bacteria | 109767 |
| 1236 | Ga0496123_0007055 | 3300048926 | Bacteria | 10690 |
| 1237 | Ga0496123_0016801 | 3300048926 | Bacteria | 5918 |
| 1238 | Ga0496123_0049415 | 3300048926 | Bacteria | 2820 |
| 1239 | Ga0496123_0049421 | 3300048926 | Bacteria | 2820 |
| 1240 | Ga0496123_0049567 | 3300048926 | Bacteria | 2814 |
| 1241 | Ga0496123_0075778 | 3300048926 | Bacteria | 2074 |
| 1242 | Ga0496124_0000511 | 3300048927 | Bacteria | 66830 |
| 1243 | Ga0496124_0001467 | 3300048927 | Bacteria | 34796 |
| 1244 | Ga0496124_0001534 | 3300048927 | Bacteria | 33561 |
| 1245 | Ga0496124_0002260 | 3300048927 | Bacteria | 25562 |
| 1246 | Ga0496124_0002328 | 3300048927 | Bacteria | 25081 |
| 1247 | Ga0496124_0007063 | 3300048927 | Bacteria | 12030 |
| 1248 | Ga0496124_0026136 | 3300048927 | Bacteria | 5270 |
| 1249 | Ga0496124_0044157 | 3300048927 | Bacteria | 3826 |
| 1250 | Ga0496124_0060578 | 3300048927 | Bacteria | 3175 |
| 1251 | Ga0496124_0083275 | 3300048927 | Bacteria | 2624 |
| 1252 | Ga0496124_0177417 | 3300048927 | Bacteria | 1643 |
| 1253 | Ga0496124_0204528 | 3300048927 | Bacteria | 1499 |
| 1254 | Ga0496125_0000971 | 3300048928 | Bacteria | 44877 |
| 1255 | Ga0496125_0002177 | 3300048928 | Bacteria | 26150 |
| 1256 | Ga0496125_0005751 | 3300048928 | Bacteria | 13638 |
| 1257 | Ga0496125_0006705 | 3300048928 | Bacteria | 12379 |
| 1258 | Ga0496125_0024125 | 3300048928 | Bacteria | 5600 |
| 1259 | Ga0496125_0027152 | 3300048928 | Bacteria | 5197 |
| 1260 | Ga0496125_0097616 | 3300048928 | Bacteria | 2176 |
| 1261 | Ga0496125_0136412 | 3300048928 | Bacteria | 1715 |
| 1262 | Ga0496125_0146754 | 3300048928 | Bacteria | 1629 |
| 1263 | Ga0496126_0018224 | 3300048929 | Bacteria | 6967 |
| 1264 | Ga0496126_0032825 | 3300048929 | Bacteria | 4887 |
| 1265 | Ga0496126_0036273 | 3300048929 | Bacteria | 4610 |
| 1266 | Ga0496126_0053094 | 3300048929 | Bacteria | 3679 |
| 1267 | Ga0496126_0079339 | 3300048929 | Bacteria | 2906 |
| 1268 | Ga0496126_0234714 | 3300048929 | Bacteria | 1535 |
| 1269 | Ga0495678_000106 | 3300049459 | Bacteria | 100780 |
| 1270 | Ga0495678_000499 | 3300049459 | Bacteria | 38715 |
| 1271 | Ga0495678_000648 | 3300049459 | Bacteria | 32019 |
| 1272 | Ga0495678_000694 | 3300049459 | Bacteria | 30590 |
| 1273 | Ga0495678_003175 | 3300049459 | Bacteria | 10355 |
| 1274 | Ga0495678_003193 | 3300049459 | Bacteria | 10317 |
| 1275 | Ga0495678_005483 | 3300049459 | Bacteria | 6992 |
| 1276 | Ga0495678_010464 | 3300049459 | Bacteria | 4510 |
| 1277 | Ga0495678_051038 | 3300049459 | Bacteria | 1600 |
| 1278 | Ga0495682_0000069 | 3300049460 | Bacteria | 94250 |
| 1279 | Ga0495682_0000804 | 3300049460 | Bacteria | 19829 |
| 1280 | Ga0495682_0004192 | 3300049460 | Bacteria | 6241 |
| 1281 | Ga0495682_0012679 | 3300049460 | Bacteria | 3226 |
| 1282 | Ga0495682_0019649 | 3300049460 | Bacteria | 2539 |
| 1283 | Ga0501032_0003622 | 3300049569 | Bacteria | 11760 |
| 1284 | Ga0501032_0144361 | 3300049569 | Bacteria | 1567 |
| 1285 | Ga0501033_0000863 | 3300049570 | Bacteria | 27736 |
| 1286 | Ga0501033_0129227 | 3300049570 | Bacteria | 1831 |
| 1287 | Ga0501034_0000164 | 3300049571 | Bacteria | 125152 |
| 1288 | Ga0501034_0047534 | 3300049571 | Bacteria | 4333 |
| 1289 | Ga0501034_0179869 | 3300049571 | Bacteria | 2080 |
| 1290 | Ga0501034_0199285 | 3300049571 | Bacteria | 1961 |
| 1291 | Ga0501034_0307313 | 3300049571 | Bacteria | 1521 |
| 1292 | Ga0501034_0410791 | 3300049571 | Bacteria | 1276 |
| 1293 | Ga0501036_0001148 | 3300049572 | Bacteria | 20168 |
| 1294 | Ga0501036_0059760 | 3300049572 | Bacteria | 3230 |
| 1295 | Ga0501036_0174913 | 3300049572 | Bacteria | 1808 |
| 1296 | Ga0501037_0039003 | 3300049573 | Bacteria | 3498 |
| 1297 | Ga0501037_0105525 | 3300049573 | Bacteria | 2031 |
| 1298 | Ga0501037_0106816 | 3300049573 | Bacteria | 2017 |
| 1299 | Ga0501038_0004502 | 3300049574 | Bacteria | 12962 |
| 1300 | Ga0501039_0106853 | 3300049575 | Bacteria | 2186 |
| 1301 | Ga0501039_0193977 | 3300049575 | Bacteria | 1597 |
| 1302 | Ga0501041_0016608 | 3300049577 | Bacteria | 4379 |
| 1303 | Ga0501042_0065532 | 3300049578 | Bacteria | 2596 |
| 1304 | Ga0501042_0320016 | 3300049578 | Bacteria | 1121 |
| 1305 | Ga0501043_0076739 | 3300049579 | Bacteria | 2625 |
| 1306 | Ga0501046_0006429 | 3300049580 | Bacteria | 10414 |
| 1307 | Ga0501046_0256311 | 3300049580 | Bacteria | 1286 |
| 1308 | Ga0501047_0004231 | 3300049581 | Bacteria | 13513 |
| 1309 | Ga0501047_0016564 | 3300049581 | Bacteria | 7038 |
| 1310 | Ga0501047_0079481 | 3300049581 | Bacteria | 3153 |
| 1311 | Ga0501047_0159992 | 3300049581 | Bacteria | 2124 |
| 1312 | Ga0501047_0417017 | 3300049581 | Bacteria | 1174 |
| 1313 | Ga0501069_0110950 | 3300049585 | Bacteria | 1562 |
| 1314 | Ga0501069_0317886 | 3300049585 | Bacteria | 914 |
| 1315 | Ga0501070_0062258 | 3300049586 | Bacteria | 3091 |
| 1316 | Ga0501070_0210962 | 3300049586 | Bacteria | 1594 |
| 1317 | Ga0501072_0102593 | 3300049588 | Bacteria | 2274 |
| 1318 | Ga0501073_0044538 | 3300049589 | Bacteria | 3127 |
| 1319 | Ga0501074_0198666 | 3300049590 | Bacteria | 1429 |
| 1320 | Ga0501241_000367 | 3300049758 | Bacteria | 9932 |
| 1321 | Ga0501035_0094792 | 3300049822 | Bacteria | 2624 |
| 1322 | Ga0501035_0360481 | 3300049822 | Bacteria | 1215 |
| 1323 | Ga0501035_0535248 | 3300049822 | Bacteria | 961 |
| 1324 | Ga0501044_0000068 | 3300049823 | Bacteria | 126642 |
| 1325 | Ga0501044_0009147 | 3300049823 | Bacteria | 10819 |
| 1326 | Ga0501044_0115290 | 3300049823 | Bacteria | 2692 |
| 1327 | Ga0501044_0153126 | 3300049823 | Bacteria | 2287 |
| 1328 | Ga0501045_0081398 | 3300049824 | Bacteria | 2388 |
| 1329 | Ga0501045_0144216 | 3300049824 | Bacteria | 1771 |
| 1330 | nmdc:mga03683_8_c1 | 3300050489 | Bacteria | 138266 |
| 1331 | nmdc:mga03n38_5812_c1 | 3300050490 | Bacteria | 4236 |
| 1332 | nmdc:mga00v17_281_c1 | 3300050491 | Bacteria | 30104 |
| 1333 | nmdc:mga0k408_212_c1 | 3300050493 | Bacteria | 31209 |
| 1334 | nmdc:mga0k408_58194_c1 | 3300050493 | Bacteria | 2244 |
| 1335 | nmdc:mga05p37_32052_c1 | 3300050507 | Bacteria | 6426 |
| 1336 | nmdc:mga05p37_536868_c1 | 3300050507 | Bacteria | 1334 |
| 1337 | nmdc:mga05p37_80086_c1 | 3300050507 | Bacteria | 4023 |
| 1338 | nmdc:mga09592_1245_c2 | 3300050508 | Bacteria | 19929 |
| 1339 | nmdc:mga09592_1735_c1 | 3300050508 | Bacteria | 17549 |
| 1340 | nmdc:mga0qj67_6255_c1 | 3300050509 | Bacteria | 8736 |
| 1341 | nmdc:mga0qj67_6308_c1 | 3300050509 | Bacteria | 8704 |
| 1342 | nmdc:mga06r32_100768_c1 | 3300050510 | Bacteria | 2834 |
| 1343 | nmdc:mga06r32_2068_c1 | 3300050510 | Bacteria | 17962 |
| 1344 | nmdc:mga06r32_453135_c1 | 3300050510 | Bacteria | 1262 |
| 1345 | nmdc:mga06r32_48_c1 | 3300050510 | Bacteria | 73903 |
| 1346 | nmdc:mga08y16_435052_c1 | 3300050511 | Bacteria | 1340 |
| 1347 | nmdc:mga08y16_67_c1 | 3300050511 | Bacteria | 46512 |
| 1348 | nmdc:mga08x19_218914_c1 | 3300050514 | Bacteria | 1308 |
| 1349 | nmdc:mga08x19_487811_c1 | 3300050514 | Bacteria | 869 |
| 1350 | nmdc:mga0sz30_48_c1 | 3300050516 | Bacteria | 19397 |
| 1351 | Ga0495619_0303429 | 3300053085 | Bacteria | 1106 |
| 1352 | Ga0500578_0000056 | 3300053086 | Bacteria | 120189 |
| 1353 | Ga0500643_000236 | 3300053087 | Bacteria | 51341 |
| 1354 | Ga0500644_0000089 | 3300053088 | Bacteria | 56897 |
| 1355 | Ga0500641_0007930 | 3300053096 | Bacteria | 3786 |
| 1356 | Ga0500556_0001246 | 3300053104 | Bacteria | 11763 |
| 1357 | Ga0500557_051774 | 3300053105 | Bacteria | 1318 |
| 1358 | Ga0500562_000623 | 3300053108 | Bacteria | 8548 |
| 1359 | Ga0500562_001952 | 3300053108 | Bacteria | 5170 |
| 1360 | Ga0500562_002160 | 3300053108 | Bacteria | 4912 |
| 1361 | Ga0500562_022909 | 3300053108 | Bacteria | 1628 |
| 1362 | Ga0500572_002298 | 3300053111 | Bacteria | 4624 |
| 1363 | Ga0500594_0000069 | 3300053118 | Bacteria | 32465 |
| 1364 | Ga0500595_038862 | 3300053119 | Bacteria | 1544 |
| 1365 | Ga0500608_000207 | 3300053122 | Bacteria | 23415 |
| 1366 | Ga0500618_000754 | 3300053125 | Bacteria | 18308 |
| 1367 | Ga0500658_0016538 | 3300053134 | Bacteria | 2749 |
| 1368 | Ga0500659_0002369 | 3300053135 | Bacteria | 11369 |
| 1369 | Ga0500559_0003257 | 3300053136 | Bacteria | 8060 |
| 1370 | Ga0500568_0003211 | 3300053139 | Bacteria | 9282 |
| 1371 | Ga0500573_0048452 | 3300053140 | Bacteria | 2446 |
| 1372 | Ga0500604_0061682 | 3300053151 | Bacteria | 1179 |
| 1373 | Ga0500616_0006850 | 3300053153 | Bacteria | 7365 |
| 1374 | Ga0500616_0022720 | 3300053153 | Bacteria | 3499 |
| 1375 | Ga0500622_0001390 | 3300053156 | Bacteria | 19494 |
| 1376 | Ga0500622_0001762 | 3300053156 | Bacteria | 16622 |
| 1377 | Ga0500622_0004080 | 3300053156 | Bacteria | 9364 |
| 1378 | Ga0500622_0014917 | 3300053156 | Bacteria | 4165 |
| 1379 | Ga0500622_0014955 | 3300053156 | Bacteria | 4160 |
| 1380 | Ga0500622_0020348 | 3300053156 | Bacteria | 3524 |
| 1381 | Ga0500645_000790 | 3300053730 | Bacteria | 19008 |
| 1382 | Ga0500645_001349 | 3300053730 | Bacteria | 12693 |
| 1383 | Ga0501084_0403429 | 3300054114 | Bacteria | 1155 |
| 1384 | Ga0501082_0000514 | 3300060353 | Bacteria | 34391 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037588 | Ga0316581_0014022 | Ga0316581_0014022_1578_2261 | 226 |
| 2 | 3300046642 | Ga0495634_0181392 | Ga0495634_0181392_612_1307 | 230 |
| 3 | 3300046471 | Ga0495650_0024217 | Ga0495650_0024217_1030_1725 | 231 |
| 4 | 2124908027 | MRS2a_Contig_7961 | MRS2a_00799810 | 236 |
| 5 | 3300050514 | nmdc:mga08x19_487811_c1 | nmdc:mga08x19_487811_c1_12_725 | 236 |
| 6 | 3300021388 | Ga0213875_10064935 | Ga0213875_100649351 | 238 |
| 7 | 3300037853 | Ga0436364_1061319 | Ga0436364_1061319_88_1017 | 238 |
| 8 | 3300003773 | Ga0055537_1002258 | Ga0055537_10022585 | 240 |
| 9 | 3300041405 | Ga0439438_005461 | Ga0439438_005461_2201_2926 | 241 |
| 10 | 3300042013 | Ga0439456_004035 | Ga0439456_004035_761_1486 | 241 |
| 11 | 3300046458 | Ga0495591_000923 | Ga0495591_000923_4148_4873 | 241 |
| 12 | 3300046460 | Ga0495638_0034918 | Ga0495638_0034918_40_765 | 241 |
| 13 | 3300046474 | Ga0495605_0011143 | Ga0495605_0011143_2044_2769 | 241 |
| 14 | 3300046530 | Ga0495654_0002438 | Ga0495654_0002438_7392_8117 | 241 |
| 15 | 3300046535 | Ga0495586_0005132 | Ga0495586_0005132_1940_2665 | 241 |
| 16 | 3300046665 | Ga0495661_0001282 | Ga0495661_0001282_5392_6117 | 241 |
| 17 | 3300046680 | Ga0495646_0000923 | Ga0495646_0000923_14002_14727 | 241 |
| 18 | 3300046691 | Ga0495670_0180903 | Ga0495670_0180903_347_1072 | 241 |
| 19 | 3300047470 | Ga0495681_0014453 | Ga0495681_0014453_1556_2281 | 241 |
| 20 | 3300048922 | Ga0496119_0012199 | Ga0496119_0012199_2334_3194 | 241 |
| 21 | 3300048925 | Ga0496122_0205757 | Ga0496122_0205757_60_920 | 241 |
| 22 | 3300048926 | Ga0496123_0049415 | Ga0496123_0049415_978_1838 | 241 |
| 23 | 3300021361 | Ga0213872_10019359 | Ga0213872_100193592 | 242 |
| 24 | 3300039447 | Ga0436361_0129444 | Ga0436361_0129444_3831_4646 | 242 |
| 25 | 3300049573 | Ga0501037_0106816 | Ga0501037_0106816_125_853 | 242 |
| 26 | 3300037312 | Ga0395899_0016645 | Ga0395899_0016645_3392_4210 | 243 |
| 27 | 3300037418 | Ga0395900_0000010 | Ga0395900_0000010_357356_358174 | 243 |
| 28 | 3300037466 | Ga0395898_0034425 | Ga0395898_0034425_2833_3651 | 243 |
| 29 | 3300037471 | Ga0395905_0001301 | Ga0395905_0001301_28146_28964 | 243 |
| 30 | 3300038443 | Ga0395901_0000007 | Ga0395901_0000007_441720_442538 | 243 |
| 31 | 3300049822 | Ga0501035_0535248 | Ga0501035_0535248_66_842 | 243 |
| 32 | 3300039437 | Ga0436365_0638922 | Ga0436365_0638922_359_1123 | 245 |
| 33 | 3300046512 | Ga0495610_0004226 | Ga0495610_0004226_6305_7042 | 245 |
| 34 | 3300049571 | Ga0501034_0307313 | Ga0501034_0307313_227_1015 | 245 |
| 35 | 3300049571 | Ga0501034_0410791 | Ga0501034_0410791_229_1011 | 245 |
| 36 | 3300049578 | Ga0501042_0320016 | Ga0501042_0320016_110_880 | 245 |
| 37 | 3300049585 | Ga0501069_0317886 | Ga0501069_0317886_97_885 | 245 |
| 38 | 3300049586 | Ga0501070_0062258 | Ga0501070_0062258_246_1034 | 245 |
| 39 | 3300049588 | Ga0501072_0102593 | Ga0501072_0102593_571_1338 | 245 |
| 40 | 3300049590 | Ga0501074_0198666 | Ga0501074_0198666_283_1071 | 245 |
| 41 | 3300049823 | Ga0501044_0115290 | Ga0501044_0115290_259_1047 | 245 |
| 42 | 3300049824 | Ga0501045_0081398 | Ga0501045_0081398_566_1333 | 245 |
| 43 | 3300009551 | Ga0105238_10016707 | Ga0105238_100167073 | 246 |
| 44 | 3300025914 | Ga0207671_10334774 | Ga0207671_103347742 | 246 |
| 45 | 3300025949 | Ga0207667_10096443 | Ga0207667_100964432 | 246 |
| 46 | 3300031242 | Ga0265329_10016433 | Ga0265329_100164333 | 246 |
| 47 | 3300031251 | Ga0265327_10000764 | Ga0265327_1000076415 | 246 |
| 48 | 3300031251 | Ga0265327_10001245 | Ga0265327_1000124523 | 246 |
| 49 | 3300031344 | Ga0265316_10000395 | Ga0265316_1000039538 | 246 |
| 50 | 3300031824 | Ga0307413_10135376 | Ga0307413_101353762 | 247 |
| 51 | 3300031995 | Ga0307409_100045637 | Ga0307409_1000456374 | 247 |
| 52 | 3300032005 | Ga0307411_10122994 | Ga0307411_101229942 | 247 |
| 53 | 3300032126 | Ga0307415_100463762 | Ga0307415_1004637621 | 247 |
| 54 | iso_pu_bacteria | 2894232714 | 2894233462 | 247 |
| 55 | 3300005344 | Ga0070661_100274321 | Ga0070661_1002743211 | 248 |
| 56 | 3300005455 | Ga0070663_100026194 | Ga0070663_1000261943 | 248 |
| 57 | 3300005456 | Ga0070678_100289437 | Ga0070678_1002894372 | 248 |
| 58 | 3300005548 | Ga0070665_100224775 | Ga0070665_1002247752 | 248 |
| 59 | 3300026067 | Ga0207678_10012003 | Ga0207678_100120032 | 248 |
| 60 | 3300044683 | Ga0466965_0059528 | Ga0466965_0059528_549_1322 | 248 |
| 61 | 3300049580 | Ga0501046_0006429 | Ga0501046_0006429_2331_3134 | 248 |
| 62 | 3300049585 | Ga0501069_0110950 | Ga0501069_0110950_608_1411 | 248 |
| 63 | 3300049586 | Ga0501070_0210962 | Ga0501070_0210962_554_1357 | 248 |
| 64 | 3300049589 | Ga0501073_0044538 | Ga0501073_0044538_2267_3070 | 248 |
| 65 | 3300054114 | Ga0501084_0403429 | Ga0501084_0403429_47_850 | 248 |
| 66 | 3300060353 | Ga0501082_0000514 | Ga0501082_0000514_27867_28670 | 248 |
| 67 | 3300031665 | Ga0316575_10000476 | Ga0316575_100004763 | 249 |
| 68 | 3300031728 | Ga0316578_10008639 | Ga0316578_100086392 | 249 |
| 69 | 3300031733 | Ga0316577_10000611 | Ga0316577_100006115 | 249 |
| 70 | 3300032005 | Ga0307411_10125159 | Ga0307411_101251593 | 249 |
| 71 | 3300032133 | Ga0316583_10001101 | Ga0316583_100011019 | 249 |
| 72 | 3300032137 | Ga0316585_10002081 | Ga0316585_100020814 | 249 |
| 73 | 3300032139 | Ga0316580_10005072 | Ga0316580_100050722 | 249 |
| 74 | 3300035398 | Ga0316574_0155392 | Ga0316574_0155392_59_826 | 249 |
| 75 | 3300036647 | Ga0316582_0000534 | Ga0316582_0000534_4387_5154 | 249 |
| 76 | 3300036712 | Ga0316584_0135592 | Ga0316584_0135592_323_1090 | 249 |
| 77 | 3300049570 | Ga0501033_0000863 | Ga0501033_0000863_14891_15655 | 249 |
| 78 | 3300049574 | Ga0501038_0004502 | Ga0501038_0004502_709_1473 | 249 |
| 79 | 3300049575 | Ga0501039_0193977 | Ga0501039_0193977_276_1040 | 249 |
| 80 | 3300049580 | Ga0501046_0256311 | Ga0501046_0256311_499_1263 | 249 |
| 81 | 3300049581 | Ga0501047_0159992 | Ga0501047_0159992_1328_2092 | 249 |
| 82 | 3300053139 | Ga0500568_0003211 | Ga0500568_0003211_4860_5663 | 249 |
| 83 | 3300003322 | rootL2_10219289 | rootL2_102192893 | 250 |
| 84 | 3300003771 | Ga0055526_1000674 | Ga0055526_100067412 | 250 |
| 85 | 3300003775 | Ga0055524_1000852 | Ga0055524_10008526 | 250 |
| 86 | 3300003791 | Ga0055530_10000050 | Ga0055530_1000005089 | 250 |
| 87 | 3300005262 | Ga0065165_1037701 | Ga0065165_10377011 | 250 |
| 88 | 3300005435 | Ga0070714_100018934 | Ga0070714_1000189345 | 250 |
| 89 | 3300005530 | Ga0070679_100071686 | Ga0070679_1000716862 | 250 |
| 90 | 3300006163 | Ga0070715_10130230 | Ga0070715_101302302 | 250 |
| 91 | 3300006237 | Ga0097621_100042100 | Ga0097621_1000421003 | 250 |
| 92 | 3300006844 | Ga0075428_100003164 | Ga0075428_1000031649 | 250 |
| 93 | 3300006844 | Ga0075428_100032925 | Ga0075428_1000329252 | 250 |
| 94 | 3300006846 | Ga0075430_100001922 | Ga0075430_1000019223 | 250 |
| 95 | 3300006846 | Ga0075430_100043515 | Ga0075430_1000435153 | 250 |
| 96 | 3300006847 | Ga0075431_100001984 | Ga0075431_10000198420 | 250 |
| 97 | 3300006847 | Ga0075431_100019179 | Ga0075431_1000191792 | 250 |
| 98 | 3300006880 | Ga0075429_100000416 | Ga0075429_10000041632 | 250 |
| 99 | 3300009094 | Ga0111539_10076787 | Ga0111539_100767875 | 250 |
| 100 | 3300009147 | Ga0114129_10001827 | Ga0114129_100018272 | 250 |
| 101 | 3300013104 | Ga0157370_10029824 | Ga0157370_100298242 | 250 |
| 102 | 3300014969 | Ga0157376_10199497 | Ga0157376_101994972 | 250 |
| 103 | 3300014969 | Ga0157376_10224360 | Ga0157376_102243602 | 250 |
| 104 | 3300025258 | Ga0209129_1014853 | Ga0209129_10148532 | 250 |
| 105 | 3300025263 | Ga0209565_1000846 | Ga0209565_100084623 | 250 |
| 106 | 3300025291 | Ga0209675_1000481 | Ga0209675_100048114 | 250 |
| 107 | 3300025295 | Ga0209564_1000219 | Ga0209564_100021912 | 250 |
| 108 | 3300025298 | Ga0209050_1000058 | Ga0209050_100005886 | 250 |
| 109 | 3300025299 | Ga0209256_1001588 | Ga0209256_10015887 | 250 |
| 110 | 3300025921 | Ga0207652_10054611 | Ga0207652_100546113 | 250 |
| 111 | 3300025929 | Ga0207664_10015239 | Ga0207664_100152394 | 250 |
| 112 | 3300027907 | Ga0207428_10039216 | Ga0207428_100392166 | 250 |
| 113 | 3300032002 | Ga0307416_100426991 | Ga0307416_1004269912 | 250 |
| 114 | 3300033545 | Ga0316214_1014381 | Ga0316214_10143812 | 250 |
| 115 | 3300042876 | Ga0451577_0003511 | Ga0451577_0003511_5287_6099 | 250 |
| 116 | 3300042876 | Ga0451577_0156363 | Ga0451577_0156363_561_1373 | 250 |
| 117 | 3300046457 | Ga0495590_0001474 | Ga0495590_0001474_3176_3928 | 250 |
| 118 | 3300046474 | Ga0495605_0009596 | Ga0495605_0009596_1472_2224 | 250 |
| 119 | 3300046512 | Ga0495610_0022458 | Ga0495610_0022458_1811_2563 | 250 |
| 120 | 3300046528 | Ga0495642_0000555 | Ga0495642_0000555_7831_8583 | 250 |
| 121 | 3300046530 | Ga0495654_0032647 | Ga0495654_0032647_1852_2604 | 250 |
| 122 | 3300046616 | Ga0495668_0003520 | Ga0495668_0003520_7639_8391 | 250 |
| 123 | 3300046692 | Ga0495671_0026950 | Ga0495671_0026950_2111_2863 | 250 |
| 124 | 3300046694 | Ga0495649_0036976 | Ga0495649_0036976_1907_2659 | 250 |
| 125 | 3300047320 | Ga0495672_0004295 | Ga0495672_0004295_7697_8449 | 250 |
| 126 | 3300048905 | Ga0496102_0284314 | Ga0496102_0284314_70_870 | 250 |
| 127 | 3300048915 | Ga0496112_0054241 | Ga0496112_0054241_1005_1847 | 250 |
| 128 | 3300048917 | Ga0496114_0380253 | Ga0496114_0380253_175_957 | 250 |
| 129 | 3300049569 | Ga0501032_0144361 | Ga0501032_0144361_193_975 | 250 |
| 130 | 3300049572 | Ga0501036_0001148 | Ga0501036_0001148_14225_15007 | 250 |
| 131 | 3300049579 | Ga0501043_0076739 | Ga0501043_0076739_1511_2293 | 250 |
| 132 | 3300049823 | Ga0501044_0000068 | Ga0501044_0000068_14154_14936 | 250 |
| 133 | 3300050507 | nmdc:mga05p37_80086_c1 | nmdc:mga05p37_80086_c1_1534_2319 | 250 |
| 134 | 3300050508 | nmdc:mga09592_1245_c2 | nmdc:mga09592_1245_c2_9836_10621 | 250 |
| 135 | 3300050509 | nmdc:mga0qj67_6255_c1 | nmdc:mga0qj67_6255_c1_3645_4430 | 250 |
| 136 | 3300050509 | nmdc:mga0qj67_6308_c1 | nmdc:mga0qj67_6308_c1_6696_7493 | 250 |
| 137 | 3300050510 | nmdc:mga06r32_100768_c1 | nmdc:mga06r32_100768_c1_944_1741 | 250 |
| 138 | 3300050510 | nmdc:mga06r32_2068_c1 | nmdc:mga06r32_2068_c1_4307_5092 | 250 |
| 139 | 3300050511 | nmdc:mga08y16_435052_c1 | nmdc:mga08y16_435052_c1_394_1176 | 250 |
| 140 | iso_pu_bacteria | 2643221554 | 2643791656 | 250 |
| 141 | iso_pu_bacteria | 2739367756 | 2739790269 | 250 |
| 142 | 3300005293 | Ga0065715_10215900 | Ga0065715_102159002 | 251 |
| 143 | 3300005330 | Ga0070690_100068633 | Ga0070690_1000686332 | 251 |
| 144 | 3300005355 | Ga0070671_100070671 | Ga0070671_1000706712 | 251 |
| 145 | 3300005364 | Ga0070673_100013793 | Ga0070673_1000137932 | 251 |
| 146 | 3300005367 | Ga0070667_100028277 | Ga0070667_1000282772 | 251 |
| 147 | 3300005435 | Ga0070714_100425139 | Ga0070714_1004251392 | 251 |
| 148 | 3300005436 | Ga0070713_100000501 | Ga0070713_10000050119 | 251 |
| 149 | 3300005437 | Ga0070710_10003523 | Ga0070710_100035236 | 251 |
| 150 | 3300005439 | Ga0070711_100001068 | Ga0070711_10000106815 | 251 |
| 151 | 3300005456 | Ga0070678_100147426 | Ga0070678_1001474262 | 251 |
| 152 | 3300005459 | Ga0068867_100100528 | Ga0068867_1001005282 | 251 |
| 153 | 3300005546 | Ga0070696_100208435 | Ga0070696_1002084352 | 251 |
| 154 | 3300005548 | Ga0070665_100010596 | Ga0070665_1000105963 | 251 |
| 155 | 3300005549 | Ga0070704_100061290 | Ga0070704_1000612902 | 251 |
| 156 | 3300005563 | Ga0068855_100240141 | Ga0068855_1002401411 | 251 |
| 157 | 3300005564 | Ga0070664_100577189 | Ga0070664_1005771892 | 251 |
| 158 | 3300005614 | Ga0068856_100025594 | Ga0068856_1000255942 | 251 |
| 159 | 3300005617 | Ga0068859_100237560 | Ga0068859_1002375602 | 251 |
| 160 | 3300005618 | Ga0068864_100022488 | Ga0068864_1000224886 | 251 |
| 161 | 3300005718 | Ga0068866_10176277 | Ga0068866_101762772 | 251 |
| 162 | 3300005841 | Ga0068863_100005001 | Ga0068863_1000050019 | 251 |
| 163 | 3300005842 | Ga0068858_100003909 | Ga0068858_1000039095 | 251 |
| 164 | 3300006163 | Ga0070715_10000137 | Ga0070715_1000013711 | 251 |
| 165 | 3300006173 | Ga0070716_100000250 | Ga0070716_1000002506 | 251 |
| 166 | 3300006175 | Ga0070712_100000944 | Ga0070712_1000009443 | 251 |
| 167 | 3300006237 | Ga0097621_100002763 | Ga0097621_1000027632 | 251 |
| 168 | 3300006358 | Ga0068871_100007873 | Ga0068871_1000078735 | 251 |
| 169 | 3300006847 | Ga0075431_100288039 | Ga0075431_1002880393 | 251 |
| 170 | 3300006914 | Ga0075436_100413037 | Ga0075436_1004130372 | 251 |
| 171 | 3300006931 | Ga0097620_100237587 | Ga0097620_1002375872 | 251 |
| 172 | 3300009098 | Ga0105245_10008015 | Ga0105245_100080156 | 251 |
| 173 | 3300009101 | Ga0105247_10012887 | Ga0105247_100128875 | 251 |
| 174 | 3300009174 | Ga0105241_10039582 | Ga0105241_100395823 | 251 |
| 175 | 3300009176 | Ga0105242_10003944 | Ga0105242_100039443 | 251 |
| 176 | 3300009177 | Ga0105248_10028267 | Ga0105248_100282675 | 251 |
| 177 | 3300009545 | Ga0105237_10058234 | Ga0105237_100582344 | 251 |
| 178 | 3300010375 | Ga0105239_10179083 | Ga0105239_101790833 | 251 |
| 179 | 3300013296 | Ga0157374_10095689 | Ga0157374_100956892 | 251 |
| 180 | 3300013297 | Ga0157378_10003437 | Ga0157378_100034379 | 251 |
| 181 | 3300013306 | Ga0163162_10014604 | Ga0163162_100146046 | 251 |
| 182 | 3300013308 | Ga0157375_10062273 | Ga0157375_100622733 | 251 |
| 183 | 3300014968 | Ga0157379_10022262 | Ga0157379_100222622 | 251 |
| 184 | 3300021441 | Ga0213871_10019712 | Ga0213871_100197121 | 251 |
| 185 | 3300025898 | Ga0207692_10015378 | Ga0207692_100153783 | 251 |
| 186 | 3300025903 | Ga0207680_10085489 | Ga0207680_100854892 | 251 |
| 187 | 3300025905 | Ga0207685_10011922 | Ga0207685_100119222 | 251 |
| 188 | 3300025915 | Ga0207693_10000021 | Ga0207693_1000002145 | 251 |
| 189 | 3300025916 | Ga0207663_10056513 | Ga0207663_100565132 | 251 |
| 190 | 3300025925 | Ga0207650_10014558 | Ga0207650_100145587 | 251 |
| 191 | 3300025928 | Ga0207700_10054000 | Ga0207700_100540003 | 251 |
| 192 | 3300025931 | Ga0207644_10082031 | Ga0207644_100820312 | 251 |
| 193 | 3300025934 | Ga0207686_10067563 | Ga0207686_100675632 | 251 |
| 194 | 3300025938 | Ga0207704_10039182 | Ga0207704_100391822 | 251 |
| 195 | 3300025939 | Ga0207665_10000465 | Ga0207665_1000046515 | 251 |
| 196 | 3300025941 | Ga0207711_10046495 | Ga0207711_100464953 | 251 |
| 197 | 3300025960 | Ga0207651_10201252 | Ga0207651_102012522 | 251 |
| 198 | 3300025986 | Ga0207658_10085271 | Ga0207658_100852712 | 251 |
| 199 | 3300026023 | Ga0207677_10096803 | Ga0207677_100968032 | 251 |
| 200 | 3300026078 | Ga0207702_10130565 | Ga0207702_101305652 | 251 |
| 201 | 3300026088 | Ga0207641_10164515 | Ga0207641_101645151 | 251 |
| 202 | 3300026089 | Ga0207648_10070388 | Ga0207648_100703883 | 251 |
| 203 | 3300026121 | Ga0207683_10000599 | Ga0207683_100005993 | 251 |
| 204 | 3300028379 | Ga0268266_10099303 | Ga0268266_100993033 | 251 |
| 205 | 3300035111 | Ga0373923_0270195 | Ga0373923_0270195_15_782 | 251 |
| 206 | 3300035119 | Ga0373956_0177561 | Ga0373956_0177561_199_966 | 251 |
| 207 | 3300035170 | Ga0373943_0056693 | Ga0373943_0056693_892_1659 | 251 |
| 208 | 3300035692 | Ga0373935_0098345 | Ga0373935_0098345_241_1062 | 251 |
| 209 | 3300035695 | Ga0373927_0079455 | Ga0373927_0079455_863_1630 | 251 |
| 210 | 3300035725 | Ga0373947_0145709 | Ga0373947_0145709_78_845 | 251 |
| 211 | 3300036401 | Ga0373937_0026675 | Ga0373937_0026675_558_1325 | 251 |
| 212 | 3300037466 | Ga0395898_0123153 | Ga0395898_0123153_1096_1917 | 251 |
| 213 | 3300039438 | Ga0436360_0428272 | Ga0436360_0428272_42_863 | 251 |
| 214 | 3300046476 | Ga0495662_0146533 | Ga0495662_0146533_97_864 | 251 |
| 215 | 3300046531 | Ga0495665_0190299 | Ga0495665_0190299_198_965 | 251 |
| 216 | 3300046683 | Ga0495658_0043062 | Ga0495658_0043062_749_1516 | 251 |
| 217 | 3300047319 | Ga0495674_0091398 | Ga0495674_0091398_1445_2212 | 251 |
| 218 | 3300047472 | Ga0495686_0034167 | Ga0495686_0034167_799_1596 | 251 |
| 219 | 3300048903 | Ga0496100_0103302 | Ga0496100_0103302_405_1172 | 251 |
| 220 | 3300048904 | Ga0496101_0074515 | Ga0496101_0074515_491_1258 | 251 |
| 221 | 3300048905 | Ga0496102_0006816 | Ga0496102_0006816_5032_5799 | 251 |
| 222 | 3300048905 | Ga0496102_0043521 | Ga0496102_0043521_1847_2614 | 251 |
| 223 | 3300048908 | Ga0496105_0002288 | Ga0496105_0002288_7216_7983 | 251 |
| 224 | 3300048909 | Ga0496106_0006654 | Ga0496106_0006654_504_1271 | 251 |
| 225 | 3300048910 | Ga0496107_0016644 | Ga0496107_0016644_1567_2334 | 251 |
| 226 | 3300048911 | Ga0496108_0021493 | Ga0496108_0021493_936_1703 | 251 |
| 227 | 3300048912 | Ga0496109_0037045 | Ga0496109_0037045_734_1501 | 251 |
| 228 | 3300048913 | Ga0496110_0073220 | Ga0496110_0073220_854_1621 | 251 |
| 229 | 3300048914 | Ga0496111_0070257 | Ga0496111_0070257_734_1501 | 251 |
| 230 | 3300048915 | Ga0496112_0240683 | Ga0496112_0240683_631_1398 | 251 |
| 231 | 3300048916 | Ga0496113_0033499 | Ga0496113_0033499_256_1023 | 251 |
| 232 | 3300048917 | Ga0496114_0005634 | Ga0496114_0005634_5522_6289 | 251 |
| 233 | 3300048918 | Ga0496115_0012609 | Ga0496115_0012609_4883_5650 | 251 |
| 234 | 3300048921 | Ga0496118_0158863 | Ga0496118_0158863_78_845 | 251 |
| 235 | 3300048928 | Ga0496125_0146754 | Ga0496125_0146754_473_1294 | 251 |
| 236 | 3300048929 | Ga0496126_0018224 | Ga0496126_0018224_3020_3841 | 251 |
| 237 | 3300050510 | nmdc:mga06r32_453135_c1 | nmdc:mga06r32_453135_c1_439_1197 | 251 |
| 238 | iso_pu_bacteria | 2857504554 | 2857504819 | 251 |
| 239 | 3300005844 | Ga0068862_100158322 | Ga0068862_1001583222 | 252 |
| 240 | 3300006038 | Ga0075365_10041469 | Ga0075365_100414692 | 252 |
| 241 | 3300006175 | Ga0070712_100069855 | Ga0070712_1000698552 | 252 |
| 242 | 3300006881 | Ga0068865_100002003 | Ga0068865_1000020037 | 252 |
| 243 | 3300009094 | Ga0111539_10040297 | Ga0111539_100402973 | 252 |
| 244 | 3300009147 | Ga0114129_10526183 | Ga0114129_105261832 | 252 |
| 245 | 3300014325 | Ga0163163_10489375 | Ga0163163_104893752 | 252 |
| 246 | 3300021358 | Ga0213873_10005190 | Ga0213873_100051902 | 252 |
| 247 | 3300021377 | Ga0213874_10002493 | Ga0213874_100024933 | 252 |
| 248 | 3300021384 | Ga0213876_10002636 | Ga0213876_100026368 | 252 |
| 249 | 3300021384 | Ga0213876_10002883 | Ga0213876_100028834 | 252 |
| 250 | 3300021388 | Ga0213875_10001986 | Ga0213875_100019863 | 252 |
| 251 | 3300028380 | Ga0268265_10814574 | Ga0268265_108145742 | 252 |
| 252 | 3300028794 | Ga0307515_10021855 | Ga0307515_100218555 | 252 |
| 253 | 3300031090 | Ga0265760_10026665 | Ga0265760_100266652 | 252 |
| 254 | 3300031691 | Ga0316579_10026379 | Ga0316579_100263792 | 252 |
| 255 | 3300032133 | Ga0316583_10002300 | Ga0316583_100023005 | 252 |
| 256 | 3300036647 | Ga0316582_0015883 | Ga0316582_0015883_3050_3979 | 252 |
| 257 | 3300036647 | Ga0316582_0350552 | Ga0316582_0350552_54_983 | 252 |
| 258 | 3300036712 | Ga0316584_0184876 | Ga0316584_0184876_96_1025 | 252 |
| 259 | 3300037853 | Ga0436364_1346974 | Ga0436364_1346974_902_1786 | 252 |
| 260 | 3300039437 | Ga0436365_0156475 | Ga0436365_0156475_2521_3405 | 252 |
| 261 | 3300039437 | Ga0436365_0356842 | Ga0436365_0356842_12220_13104 | 252 |
| 262 | 3300039450 | Ga0436363_0538450 | Ga0436363_0538450_8385_9269 | 252 |
| 263 | 3300039453 | Ga0436362_0582461 | Ga0436362_0582461_2560_3444 | 252 |
| 264 | 3300042439 | Ga0439464_0012378 | Ga0439464_0012378_1403_2188 | 252 |
| 265 | 3300046457 | Ga0495590_0000388 | Ga0495590_0000388_331_1161 | 252 |
| 266 | 3300046518 | Ga0495631_0005054 | Ga0495631_0005054_4817_5647 | 252 |
| 267 | 3300046523 | Ga0495644_0003034 | Ga0495644_0003034_1957_2715 | 252 |
| 268 | 3300046524 | Ga0495648_0000165 | Ga0495648_0000165_31474_32346 | 252 |
| 269 | 3300046542 | Ga0495597_0070344 | Ga0495597_0070344_335_1165 | 252 |
| 270 | 3300046616 | Ga0495668_0005068 | Ga0495668_0005068_2250_3080 | 252 |
| 271 | 3300047469 | Ga0495673_0000344 | Ga0495673_0000344_29602_30477 | 252 |
| 272 | 3300047472 | Ga0495686_0000939 | Ga0495686_0000939_7332_8162 | 252 |
| 273 | 3300048919 | Ga0496116_0000275 | Ga0496116_0000275_58325_59215 | 252 |
| 274 | 3300048925 | Ga0496122_0028914 | Ga0496122_0028914_3191_4024 | 252 |
| 275 | 3300049459 | Ga0495678_000648 | Ga0495678_000648_2849_3679 | 252 |
| 276 | 3300050507 | nmdc:mga05p37_536868_c1 | nmdc:mga05p37_536868_c1_198_983 | 252 |
| 277 | 3300053086 | Ga0500578_0000056 | Ga0500578_0000056_90878_91708 | 252 |
| 278 | 3300053088 | Ga0500644_0000089 | Ga0500644_0000089_28291_29166 | 252 |
| 279 | 3300053108 | Ga0500562_002160 | Ga0500562_002160_2397_3227 | 252 |
| 280 | 3300053111 | Ga0500572_002298 | Ga0500572_002298_2235_3098 | 252 |
| 281 | 3300053118 | Ga0500594_0000069 | Ga0500594_0000069_28330_29160 | 252 |
| 282 | 3300053134 | Ga0500658_0016538 | Ga0500658_0016538_59_844 | 252 |
| 283 | 3300053156 | Ga0500622_0001762 | Ga0500622_0001762_1229_2059 | 252 |
| 284 | iso_pu_bacteria | 8054460903 | 8054462585 | 252 |
| 285 | 3300003781 | Ga0055536_1000595 | Ga0055536_100059519 | 253 |
| 286 | 3300003781 | Ga0055536_1000604 | Ga0055536_100060418 | 253 |
| 287 | 3300003791 | Ga0055530_10000899 | Ga0055530_1000089918 | 253 |
| 288 | 3300003791 | Ga0055530_10002781 | Ga0055530_100027819 | 253 |
| 289 | 3300003794 | Ga0055531_10000847 | Ga0055531_1000084719 | 253 |
| 290 | 3300005331 | Ga0070670_100000050 | Ga0070670_100000050110 | 253 |
| 291 | 3300005347 | Ga0070668_100001877 | Ga0070668_10000187713 | 253 |
| 292 | 3300005367 | Ga0070667_100000299 | Ga0070667_10000029933 | 253 |
| 293 | 3300005436 | Ga0070713_100000622 | Ga0070713_10000062222 | 253 |
| 294 | 3300005548 | Ga0070665_100001434 | Ga0070665_10000143417 | 253 |
| 295 | 3300005614 | Ga0068856_100135583 | Ga0068856_1001355832 | 253 |
| 296 | 3300005618 | Ga0068864_100000238 | Ga0068864_10000023825 | 253 |
| 297 | 3300005841 | Ga0068863_100000531 | Ga0068863_1000005314 | 253 |
| 298 | 3300005842 | Ga0068858_100007943 | Ga0068858_1000079432 | 253 |
| 299 | 3300005844 | Ga0068862_100000786 | Ga0068862_10000078610 | 253 |
| 300 | 3300006048 | Ga0075363_100009303 | Ga0075363_1000093034 | 253 |
| 301 | 3300006051 | Ga0075364_10034624 | Ga0075364_100346243 | 253 |
| 302 | 3300006177 | Ga0075362_10000018 | Ga0075362_1000001843 | 253 |
| 303 | 3300006186 | Ga0075369_10002686 | Ga0075369_100026863 | 253 |
| 304 | 3300006186 | Ga0075369_10013967 | Ga0075369_100139674 | 253 |
| 305 | 3300006195 | Ga0075366_10003020 | Ga0075366_100030206 | 253 |
| 306 | 3300006353 | Ga0075370_10000065 | Ga0075370_100000656 | 253 |
| 307 | 3300009093 | Ga0105240_10000522 | Ga0105240_1000052215 | 253 |
| 308 | 3300009093 | Ga0105240_10073487 | Ga0105240_100734874 | 253 |
| 309 | 3300009553 | Ga0105249_10000356 | Ga0105249_1000035623 | 253 |
| 310 | 3300013104 | Ga0157370_10177270 | Ga0157370_101772701 | 253 |
| 311 | 3300013105 | Ga0157369_10194966 | Ga0157369_101949662 | 253 |
| 312 | 3300013306 | Ga0163162_10082355 | Ga0163162_100823554 | 253 |
| 313 | 3300013308 | Ga0157375_10049656 | Ga0157375_100496563 | 253 |
| 314 | 3300014325 | Ga0163163_10190075 | Ga0163163_101900752 | 253 |
| 315 | 3300014968 | Ga0157379_10001501 | Ga0157379_1000150112 | 253 |
| 316 | 3300014969 | Ga0157376_10160193 | Ga0157376_101601932 | 253 |
| 317 | 3300021384 | Ga0213876_10063026 | Ga0213876_100630262 | 253 |
| 318 | 3300025292 | Ga0209676_1000243 | Ga0209676_100024367 | 253 |
| 319 | 3300025292 | Ga0209676_1000311 | Ga0209676_100031118 | 253 |
| 320 | 3300025298 | Ga0209050_1000244 | Ga0209050_100024467 | 253 |
| 321 | 3300025298 | Ga0209050_1000375 | Ga0209050_100037518 | 253 |
| 322 | 3300025299 | Ga0209256_1017602 | Ga0209256_10176022 | 253 |
| 323 | 3300025303 | Ga0209051_1003593 | Ga0209051_10035932 | 253 |
| 324 | 3300025304 | Ga0209257_1000140 | Ga0209257_100014057 | 253 |
| 325 | 3300025304 | Ga0209257_1004459 | Ga0209257_100445910 | 253 |
| 326 | 3300025900 | Ga0207710_10038644 | Ga0207710_100386442 | 253 |
| 327 | 3300025913 | Ga0207695_10001134 | Ga0207695_1000113415 | 253 |
| 328 | 3300025913 | Ga0207695_10028456 | Ga0207695_100284564 | 253 |
| 329 | 3300025917 | Ga0207660_10133325 | Ga0207660_101333252 | 253 |
| 330 | 3300025923 | Ga0207681_10213847 | Ga0207681_102138472 | 253 |
| 331 | 3300025925 | Ga0207650_10000133 | Ga0207650_1000013367 | 253 |
| 332 | 3300025928 | Ga0207700_10000241 | Ga0207700_1000024111 | 253 |
| 333 | 3300025961 | Ga0207712_10000790 | Ga0207712_100007905 | 253 |
| 334 | 3300025972 | Ga0207668_10000718 | Ga0207668_100007184 | 253 |
| 335 | 3300025986 | Ga0207658_10000931 | Ga0207658_1000093125 | 253 |
| 336 | 3300026035 | Ga0207703_10002235 | Ga0207703_100022352 | 253 |
| 337 | 3300026078 | Ga0207702_10099548 | Ga0207702_100995482 | 253 |
| 338 | 3300026088 | Ga0207641_10011031 | Ga0207641_100110312 | 253 |
| 339 | 3300026095 | Ga0207676_10000109 | Ga0207676_1000010925 | 253 |
| 340 | 3300028379 | Ga0268266_10002063 | Ga0268266_1000206315 | 253 |
| 341 | 3300028380 | Ga0268265_10005179 | Ga0268265_100051791 | 253 |
| 342 | 3300028800 | Ga0265338_10011798 | Ga0265338_100117983 | 253 |
| 343 | 3300031250 | Ga0265331_10026729 | Ga0265331_100267293 | 253 |
| 344 | 3300031901 | Ga0307406_10497533 | Ga0307406_104975331 | 253 |
| 345 | 3300032002 | Ga0307416_100181428 | Ga0307416_1001814282 | 253 |
| 346 | 3300032126 | Ga0307415_100176251 | Ga0307415_1001762512 | 253 |
| 347 | 3300032133 | Ga0316583_10015720 | Ga0316583_100157202 | 253 |
| 348 | 3300035086 | Ga0373934_0000039 | Ga0373934_0000039_34449_35240 | 253 |
| 349 | 3300035117 | Ga0373953_0195503 | Ga0373953_0195503_36_827 | 253 |
| 350 | 3300035119 | Ga0373956_0000165 | Ga0373956_0000165_2916_3707 | 253 |
| 351 | 3300035120 | Ga0373957_0000698 | Ga0373957_0000698_903_1694 | 253 |
| 352 | 3300035172 | Ga0373955_0004254 | Ga0373955_0004254_4065_4856 | 253 |
| 353 | 3300035724 | Ga0373933_0008171 | Ga0373933_0008171_2900_3691 | 253 |
| 354 | 3300036401 | Ga0373937_0015350 | Ga0373937_0015350_3529_4320 | 253 |
| 355 | 3300036401 | Ga0373937_0259061 | Ga0373937_0259061_629_1429 | 253 |
| 356 | 3300037853 | Ga0436364_1109728 | Ga0436364_1109728_888_1685 | 253 |
| 357 | 3300039437 | Ga0436365_1846384 | Ga0436365_1846384_590_1414 | 253 |
| 358 | 3300042876 | Ga0451577_0125705 | Ga0451577_0125705_198_989 | 253 |
| 359 | 3300044735 | Ga0466968_0032261 | Ga0466968_0032261_1247_2044 | 253 |
| 360 | 3300046458 | Ga0495591_000628 | Ga0495591_000628_3464_4228 | 253 |
| 361 | 3300046462 | Ga0495651_0005051 | Ga0495651_0005051_6865_7656 | 253 |
| 362 | 3300046501 | Ga0495607_0000531 | Ga0495607_0000531_14942_15706 | 253 |
| 363 | 3300046616 | Ga0495668_0000456 | Ga0495668_0000456_27672_28508 | 253 |
| 364 | 3300046675 | Ga0495657_0054974 | Ga0495657_0054974_274_1065 | 253 |
| 365 | 3300048905 | Ga0496102_0125466 | Ga0496102_0125466_531_1355 | 253 |
| 366 | 3300048918 | Ga0496115_0001599 | Ga0496115_0001599_3621_4460 | 253 |
| 367 | 3300048927 | Ga0496124_0177417 | Ga0496124_0177417_577_1416 | 253 |
| 368 | 3300049570 | Ga0501033_0129227 | Ga0501033_0129227_540_1316 | 253 |
| 369 | 3300049577 | Ga0501041_0016608 | Ga0501041_0016608_3194_3970 | 253 |
| 370 | 3300049578 | Ga0501042_0065532 | Ga0501042_0065532_214_990 | 253 |
| 371 | 3300049581 | Ga0501047_0079481 | Ga0501047_0079481_550_1380 | 253 |
| 372 | 3300049824 | Ga0501045_0144216 | Ga0501045_0144216_835_1611 | 253 |
| 373 | 3300050489 | nmdc:mga03683_8_c1 | nmdc:mga03683_8_c1_24721_25560 | 253 |
| 374 | 3300050490 | nmdc:mga03n38_5812_c1 | nmdc:mga03n38_5812_c1_1851_2690 | 253 |
| 375 | 3300050493 | nmdc:mga0k408_212_c1 | nmdc:mga0k408_212_c1_6250_7089 | 253 |
| 376 | 3300050493 | nmdc:mga0k408_58194_c1 | nmdc:mga0k408_58194_c1_588_1421 | 253 |
| 377 | 3300050516 | nmdc:mga0sz30_48_c1 | nmdc:mga0sz30_48_c1_3463_4302 | 253 |
| 378 | 3300053085 | Ga0495619_0303429 | Ga0495619_0303429_45_836 | 253 |
| 379 | 3300053122 | Ga0500608_000207 | Ga0500608_000207_13980_14816 | 253 |
| 380 | 3300053136 | Ga0500559_0003257 | Ga0500559_0003257_3067_3903 | 253 |
| 381 | 3300053156 | Ga0500622_0001390 | Ga0500622_0001390_13669_14457 | 253 |
| 382 | 3300053156 | Ga0500622_0004080 | Ga0500622_0004080_2254_3042 | 253 |
| 383 | 3300053156 | Ga0500622_0014955 | Ga0500622_0014955_1306_2142 | 253 |
| 384 | iso_pu_bacteria | 2585428106 | 2587918025 | 253 |
| 385 | iso_pu_bacteria | 2643221640 | 2644224559 | 253 |
| 386 | iso_pu_bacteria | 2643221642 | 2644234506 | 253 |
| 387 | iso_pu_bacteria | 2884960567 | 2884965366 | 253 |
| 388 | iso_pu_bacteria | 2928531327 | 2928532866 | 253 |
| 389 | iso_pu_bacteria | 2990196909 | 2990197903 | 253 |
| 390 | 3300003578 | Ga0006562J51391_1013763 | Ga0006562J51391_10137633 | 254 |
| 391 | 3300005331 | Ga0070670_100689905 | Ga0070670_1006899051 | 254 |
| 392 | 3300005355 | Ga0070671_100284428 | Ga0070671_1002844282 | 254 |
| 393 | 3300005548 | Ga0070665_100047335 | Ga0070665_1000473354 | 254 |
| 394 | 3300006844 | Ga0075428_100000169 | Ga0075428_10000016951 | 254 |
| 395 | 3300006844 | Ga0075428_100627006 | Ga0075428_1006270062 | 254 |
| 396 | 3300006847 | Ga0075431_100000027 | Ga0075431_10000002761 | 254 |
| 397 | 3300006880 | Ga0075429_100023537 | Ga0075429_1000235374 | 254 |
| 398 | 3300009094 | Ga0111539_10000211 | Ga0111539_100002119 | 254 |
| 399 | 3300009147 | Ga0114129_10005882 | Ga0114129_100058823 | 254 |
| 400 | 3300009551 | Ga0105238_10504063 | Ga0105238_105040632 | 254 |
| 401 | 3300013100 | Ga0157373_10061092 | Ga0157373_100610922 | 254 |
| 402 | 3300013102 | Ga0157371_10058580 | Ga0157371_100585804 | 254 |
| 403 | 3300021388 | Ga0213875_10036093 | Ga0213875_100360931 | 254 |
| 404 | 3300027312 | Ga0209371_1000087 | Ga0209371_100008773 | 254 |
| 405 | 3300027907 | Ga0207428_10006022 | Ga0207428_1000602210 | 254 |
| 406 | 3300028379 | Ga0268266_10074778 | Ga0268266_100747782 | 254 |
| 407 | 3300028786 | Ga0307517_10003720 | Ga0307517_1000372018 | 254 |
| 408 | 3300028794 | Ga0307515_10027521 | Ga0307515_100275219 | 254 |
| 409 | 3300028800 | Ga0265338_10189119 | Ga0265338_101891192 | 254 |
| 410 | 3300030500 | Ga0268256_1000101 | Ga0268256_100010173 | 254 |
| 411 | 3300031456 | Ga0307513_10053499 | Ga0307513_100534995 | 254 |
| 412 | 3300032002 | Ga0307416_100106393 | Ga0307416_1001063932 | 254 |
| 413 | 3300037853 | Ga0436364_0959921 | Ga0436364_0959921_63_881 | 254 |
| 414 | 3300039450 | Ga0436363_1520052 | Ga0436363_1520052_2740_3804 | 254 |
| 415 | 3300041411 | Ga0439466_0072946 | Ga0439466_0072946_91_870 | 254 |
| 416 | 3300042006 | Ga0439432_037651 | Ga0439432_037651_49_828 | 254 |
| 417 | 3300042010 | Ga0439452_032955 | Ga0439452_032955_65_844 | 254 |
| 418 | 3300042439 | Ga0439464_0000277 | Ga0439464_0000277_7632_8411 | 254 |
| 419 | 3300046460 | Ga0495638_0000326 | Ga0495638_0000326_58466_59311 | 254 |
| 420 | 3300046512 | Ga0495610_0007573 | Ga0495610_0007573_2101_2946 | 254 |
| 421 | 3300046513 | Ga0495616_0038638 | Ga0495616_0038638_1394_2239 | 254 |
| 422 | 3300046616 | Ga0495668_0087826 | Ga0495668_0087826_555_1346 | 254 |
| 423 | 3300046648 | Ga0495611_0027813 | Ga0495611_0027813_1288_2112 | 254 |
| 424 | 3300049571 | Ga0501034_0199285 | Ga0501034_0199285_545_1327 | 254 |
| 425 | 3300049581 | Ga0501047_0016564 | Ga0501047_0016564_296_1123 | 254 |
| 426 | 3300049581 | Ga0501047_0417017 | Ga0501047_0417017_11_817 | 254 |
| 427 | 3300050507 | nmdc:mga05p37_32052_c1 | nmdc:mga05p37_32052_c1_3975_4769 | 254 |
| 428 | 3300050508 | nmdc:mga09592_1735_c1 | nmdc:mga09592_1735_c1_10347_11141 | 254 |
| 429 | 3300050510 | nmdc:mga06r32_48_c1 | nmdc:mga06r32_48_c1_22698_23492 | 254 |
| 430 | 3300050511 | nmdc:mga08y16_67_c1 | nmdc:mga08y16_67_c1_38280_39074 | 254 |
| 431 | 3300053087 | Ga0500643_000236 | Ga0500643_000236_29395_30240 | 254 |
| 432 | 3300053096 | Ga0500641_0007930 | Ga0500641_0007930_1537_2382 | 254 |
| 433 | 3300053104 | Ga0500556_0001246 | Ga0500556_0001246_2799_3644 | 254 |
| 434 | 3300053105 | Ga0500557_051774 | Ga0500557_051774_260_1105 | 254 |
| 435 | 3300053108 | Ga0500562_001952 | Ga0500562_001952_2803_3648 | 254 |
| 436 | 3300053108 | Ga0500562_022909 | Ga0500562_022909_385_1230 | 254 |
| 437 | 3300053151 | Ga0500604_0061682 | Ga0500604_0061682_185_976 | 254 |
| 438 | 3300053153 | Ga0500616_0006850 | Ga0500616_0006850_1600_2445 | 254 |
| 439 | 3300053153 | Ga0500616_0022720 | Ga0500616_0022720_552_1397 | 254 |
| 440 | 3300053156 | Ga0500622_0014917 | Ga0500622_0014917_1777_2622 | 254 |
| 441 | 3300053156 | Ga0500622_0020348 | Ga0500622_0020348_1337_2182 | 254 |
| 442 | 3300053730 | Ga0500645_000790 | Ga0500645_000790_14212_15057 | 254 |
| 443 | 3300053730 | Ga0500645_001349 | Ga0500645_001349_1442_2287 | 254 |
| 444 | iso_pu_bacteria | 2854911287 | 2854912013 | 254 |
| 445 | iso_pu_bacteria | 3007252601 | 3007254297 | 254 |
| 446 | iso_pu_bacteria | 3007315729 | 3007316906 | 254 |
| 447 | 3300001904 | JGI24736J21556_1007395 | JGI24736J21556_10073952 | 255 |
| 448 | 3300003322 | rootL2_10301675 | rootL2_103016753 | 255 |
| 449 | 3300003578 | Ga0006562J51391_1162000 | Ga0006562J51391_11620001 | 255 |
| 450 | 3300003578 | Ga0006562J51391_1162001 | Ga0006562J51391_11620013 | 255 |
| 451 | 3300005262 | Ga0065165_1000093 | Ga0065165_100009389 | 255 |
| 452 | 3300005288 | Ga0065714_10091673 | Ga0065714_100916732 | 255 |
| 453 | 3300005293 | Ga0065715_10341747 | Ga0065715_103417471 | 255 |
| 454 | 3300005329 | Ga0070683_100453071 | Ga0070683_1004530711 | 255 |
| 455 | 3300005330 | Ga0070690_100002162 | Ga0070690_10000216210 | 255 |
| 456 | 3300005331 | Ga0070670_100018343 | Ga0070670_1000183436 | 255 |
| 457 | 3300005331 | Ga0070670_100276858 | Ga0070670_1002768582 | 255 |
| 458 | 3300005334 | Ga0068869_100002671 | Ga0068869_1000026719 | 255 |
| 459 | 3300005335 | Ga0070666_10020342 | Ga0070666_100203425 | 255 |
| 460 | 3300005336 | Ga0070680_100005561 | Ga0070680_1000055612 | 255 |
| 461 | 3300005340 | Ga0070689_100003447 | Ga0070689_1000034473 | 255 |
| 462 | 3300005344 | Ga0070661_100022662 | Ga0070661_1000226623 | 255 |
| 463 | 3300005354 | Ga0070675_100001395 | Ga0070675_1000013951 | 255 |
| 464 | 3300005355 | Ga0070671_100045250 | Ga0070671_1000452503 | 255 |
| 465 | 3300005364 | Ga0070673_100000393 | Ga0070673_1000003936 | 255 |
| 466 | 3300005366 | Ga0070659_100000040 | Ga0070659_10000004088 | 255 |
| 467 | 3300005366 | Ga0070659_100008635 | Ga0070659_1000086356 | 255 |
| 468 | 3300005440 | Ga0070705_100016110 | Ga0070705_1000161103 | 255 |
| 469 | 3300005441 | Ga0070700_100174455 | Ga0070700_1001744551 | 255 |
| 470 | 3300005457 | Ga0070662_100172140 | Ga0070662_1001721401 | 255 |
| 471 | 3300005458 | Ga0070681_10030623 | Ga0070681_100306235 | 255 |
| 472 | 3300005459 | Ga0068867_100093050 | Ga0068867_1000930502 | 255 |
| 473 | 3300005535 | Ga0070684_100002776 | Ga0070684_1000027766 | 255 |
| 474 | 3300005539 | Ga0068853_100079848 | Ga0068853_1000798482 | 255 |
| 475 | 3300005543 | Ga0070672_100022058 | Ga0070672_1000220582 | 255 |
| 476 | 3300005544 | Ga0070686_100007969 | Ga0070686_1000079694 | 255 |
| 477 | 3300005547 | Ga0070693_100342933 | Ga0070693_1003429331 | 255 |
| 478 | 3300005548 | Ga0070665_100000248 | Ga0070665_10000024868 | 255 |
| 479 | 3300005548 | Ga0070665_100020273 | Ga0070665_1000202734 | 255 |
| 480 | 3300005563 | Ga0068855_100011064 | Ga0068855_1000110648 | 255 |
| 481 | 3300005563 | Ga0068855_100159449 | Ga0068855_1001594492 | 255 |
| 482 | 3300005564 | Ga0070664_100000407 | Ga0070664_10000040735 | 255 |
| 483 | 3300005577 | Ga0068857_100059056 | Ga0068857_1000590563 | 255 |
| 484 | 3300005615 | Ga0070702_100006771 | Ga0070702_1000067715 | 255 |
| 485 | 3300005617 | Ga0068859_100001376 | Ga0068859_10000137614 | 255 |
| 486 | 3300005618 | Ga0068864_100033400 | Ga0068864_1000334002 | 255 |
| 487 | 3300005719 | Ga0068861_100051537 | Ga0068861_1000515372 | 255 |
| 488 | 3300005840 | Ga0068870_10020900 | Ga0068870_100209003 | 255 |
| 489 | 3300005841 | Ga0068863_100000673 | Ga0068863_1000006738 | 255 |
| 490 | 3300005842 | Ga0068858_100004783 | Ga0068858_1000047834 | 255 |
| 491 | 3300005842 | Ga0068858_100376935 | Ga0068858_1003769352 | 255 |
| 492 | 3300005843 | Ga0068860_100015972 | Ga0068860_1000159722 | 255 |
| 493 | 3300005844 | Ga0068862_100001925 | Ga0068862_10000192514 | 255 |
| 494 | 3300006173 | Ga0070716_100009265 | Ga0070716_1000092652 | 255 |
| 495 | 3300006358 | Ga0068871_100094024 | Ga0068871_1000940242 | 255 |
| 496 | 3300006881 | Ga0068865_100004806 | Ga0068865_1000048069 | 255 |
| 497 | 3300006931 | Ga0097620_100001375 | Ga0097620_10000137514 | 255 |
| 498 | 3300009093 | Ga0105240_10008495 | Ga0105240_100084952 | 255 |
| 499 | 3300009148 | Ga0105243_10098657 | Ga0105243_100986572 | 255 |
| 500 | 3300009177 | Ga0105248_10002192 | Ga0105248_1000219210 | 255 |
| 501 | 3300009551 | Ga0105238_10091911 | Ga0105238_100919113 | 255 |
| 502 | 3300009551 | Ga0105238_10165976 | Ga0105238_101659762 | 255 |
| 503 | 3300009553 | Ga0105249_10007976 | Ga0105249_100079762 | 255 |
| 504 | 3300010375 | Ga0105239_10219964 | Ga0105239_102199642 | 255 |
| 505 | 3300010375 | Ga0105239_11075055 | Ga0105239_110750551 | 255 |
| 506 | 3300013104 | Ga0157370_10000495 | Ga0157370_1000049542 | 255 |
| 507 | 3300013105 | Ga0157369_10000464 | Ga0157369_1000046442 | 255 |
| 508 | 3300013306 | Ga0163162_10037697 | Ga0163162_100376975 | 255 |
| 509 | 3300013308 | Ga0157375_10008547 | Ga0157375_100085478 | 255 |
| 510 | 3300014325 | Ga0163163_10122601 | Ga0163163_101226012 | 255 |
| 511 | 3300014745 | Ga0157377_10037112 | Ga0157377_100371122 | 255 |
| 512 | 3300015265 | Ga0182005_1073370 | Ga0182005_10733701 | 255 |
| 513 | 3300021384 | Ga0213876_10000183 | Ga0213876_1000018331 | 255 |
| 514 | 3300025258 | Ga0209129_1001075 | Ga0209129_10010755 | 255 |
| 515 | 3300025297 | Ga0209758_1004180 | Ga0209758_10041806 | 255 |
| 516 | 3300025302 | Ga0207426_1024894 | Ga0207426_10248943 | 255 |
| 517 | 3300025904 | Ga0207647_10000010 | Ga0207647_10000010143 | 255 |
| 518 | 3300025908 | Ga0207643_10017888 | Ga0207643_100178883 | 255 |
| 519 | 3300025909 | Ga0207705_10002329 | Ga0207705_100023298 | 255 |
| 520 | 3300025912 | Ga0207707_10080846 | Ga0207707_100808462 | 255 |
| 521 | 3300025913 | Ga0207695_10001421 | Ga0207695_100014213 | 255 |
| 522 | 3300025917 | Ga0207660_10003341 | Ga0207660_100033412 | 255 |
| 523 | 3300025918 | Ga0207662_10002043 | Ga0207662_100020436 | 255 |
| 524 | 3300025919 | Ga0207657_10007945 | Ga0207657_100079458 | 255 |
| 525 | 3300025924 | Ga0207694_10060428 | Ga0207694_100604282 | 255 |
| 526 | 3300025925 | Ga0207650_10492621 | Ga0207650_104926212 | 255 |
| 527 | 3300025926 | Ga0207659_10035819 | Ga0207659_100358193 | 255 |
| 528 | 3300025932 | Ga0207690_10000134 | Ga0207690_1000013415 | 255 |
| 529 | 3300025932 | Ga0207690_10019025 | Ga0207690_100190254 | 255 |
| 530 | 3300025936 | Ga0207670_10005327 | Ga0207670_100053276 | 255 |
| 531 | 3300025937 | Ga0207669_10047123 | Ga0207669_100471232 | 255 |
| 532 | 3300025938 | Ga0207704_10055805 | Ga0207704_100558053 | 255 |
| 533 | 3300025940 | Ga0207691_10133426 | Ga0207691_101334262 | 255 |
| 534 | 3300025941 | Ga0207711_10005329 | Ga0207711_1000532911 | 255 |
| 535 | 3300025942 | Ga0207689_10020551 | Ga0207689_100205514 | 255 |
| 536 | 3300025945 | Ga0207679_10016582 | Ga0207679_100165824 | 255 |
| 537 | 3300025949 | Ga0207667_10109685 | Ga0207667_101096853 | 255 |
| 538 | 3300025949 | Ga0207667_10176225 | Ga0207667_101762253 | 255 |
| 539 | 3300025960 | Ga0207651_10033951 | Ga0207651_100339513 | 255 |
| 540 | 3300026035 | Ga0207703_10499048 | Ga0207703_104990481 | 255 |
| 541 | 3300026075 | Ga0207708_10058009 | Ga0207708_100580092 | 255 |
| 542 | 3300026088 | Ga0207641_10024917 | Ga0207641_100249174 | 255 |
| 543 | 3300026088 | Ga0207641_10172025 | Ga0207641_101720252 | 255 |
| 544 | 3300026089 | Ga0207648_10007368 | Ga0207648_100073689 | 255 |
| 545 | 3300026095 | Ga0207676_10005349 | Ga0207676_100053499 | 255 |
| 546 | 3300026116 | Ga0207674_10025731 | Ga0207674_100257317 | 255 |
| 547 | 3300027543 | Ga0209999_1001854 | Ga0209999_10018544 | 255 |
| 548 | 3300028379 | Ga0268266_10000005 | Ga0268266_100000051138 | 255 |
| 549 | 3300028379 | Ga0268266_10065003 | Ga0268266_100650032 | 255 |
| 550 | 3300028379 | Ga0268266_10116472 | Ga0268266_101164722 | 255 |
| 551 | 3300028380 | Ga0268265_10193008 | Ga0268265_101930082 | 255 |
| 552 | 3300028381 | Ga0268264_10209512 | Ga0268264_102095122 | 255 |
| 553 | 3300031251 | Ga0265327_10000394 | Ga0265327_1000039468 | 255 |
| 554 | 3300031251 | Ga0265327_10000933 | Ga0265327_1000093325 | 255 |
| 555 | 3300031456 | Ga0307513_10021039 | Ga0307513_100210397 | 255 |
| 556 | 3300031548 | Ga0307408_100045292 | Ga0307408_1000452922 | 255 |
| 557 | 3300032005 | Ga0307411_10171378 | Ga0307411_101713781 | 255 |
| 558 | 3300035085 | Ga0373929_0062312 | Ga0373929_0062312_36_833 | 255 |
| 559 | 3300035171 | Ga0373946_0007070 | Ga0373946_0007070_2082_2918 | 255 |
| 560 | 3300035695 | Ga0373927_0000130 | Ga0373927_0000130_392_1228 | 255 |
| 561 | 3300037068 | Ga0373925_0036513 | Ga0373925_0036513_1037_1873 | 255 |
| 562 | 3300038725 | Ga0400484_04287 | Ga0400484_04287_13177_14001 | 255 |
| 563 | 3300038725 | Ga0400484_11728 | Ga0400484_11728_4630_5454 | 255 |
| 564 | 3300038725 | Ga0400484_44564 | Ga0400484_44564_361_1185 | 255 |
| 565 | 3300038726 | Ga0400490_06422 | Ga0400490_06422_458_1381 | 255 |
| 566 | 3300038726 | Ga0400490_18130 | Ga0400490_18130_1687_2511 | 255 |
| 567 | 3300038727 | Ga0400491_04024 | Ga0400491_04024_332_1156 | 255 |
| 568 | 3300039437 | Ga0436365_0640791 | Ga0436365_0640791_33479_34300 | 255 |
| 569 | 3300042184 | Ga0450908_000050 | Ga0450908_000050_8925_9740 | 255 |
| 570 | 3300046453 | Ga0495627_000095 | Ga0495627_000095_97362_98162 | 255 |
| 571 | 3300046474 | Ga0495605_0004235 | Ga0495605_0004235_3505_4302 | 255 |
| 572 | 3300046474 | Ga0495605_0004852 | Ga0495605_0004852_1036_1833 | 255 |
| 573 | 3300046501 | Ga0495607_0000024 | Ga0495607_0000024_144413_145210 | 255 |
| 574 | 3300046543 | Ga0495645_0005791 | Ga0495645_0005791_423_1265 | 255 |
| 575 | 3300046616 | Ga0495668_0058681 | Ga0495668_0058681_125_922 | 255 |
| 576 | 3300046616 | Ga0495668_0078486 | Ga0495668_0078486_384_1208 | 255 |
| 577 | 3300046660 | Ga0495625_0097020 | Ga0495625_0097020_345_1169 | 255 |
| 578 | 3300046810 | Ga0495660_0000431 | Ga0495660_0000431_14728_15516 | 255 |
| 579 | 3300047320 | Ga0495672_0009332 | Ga0495672_0009332_1961_2758 | 255 |
| 580 | 3300047320 | Ga0495672_0015335 | Ga0495672_0015335_2639_3427 | 255 |
| 581 | 3300047320 | Ga0495672_0053772 | Ga0495672_0053772_1092_1910 | 255 |
| 582 | 3300047469 | Ga0495673_0000389 | Ga0495673_0000389_12968_13756 | 255 |
| 583 | 3300048091 | Ga0495626_0123277 | Ga0495626_0123277_175_963 | 255 |
| 584 | 3300048909 | Ga0496106_0029466 | Ga0496106_0029466_194_991 | 255 |
| 585 | 3300048912 | Ga0496109_0053159 | Ga0496109_0053159_1318_2115 | 255 |
| 586 | 3300048913 | Ga0496110_0096563 | Ga0496110_0096563_1585_2382 | 255 |
| 587 | 3300048918 | Ga0496115_0001643 | Ga0496115_0001643_15182_16027 | 255 |
| 588 | 3300048920 | Ga0496117_0026880 | Ga0496117_0026880_2096_2878 | 255 |
| 589 | 3300048921 | Ga0496118_0001894 | Ga0496118_0001894_1630_2412 | 255 |
| 590 | 3300048924 | Ga0496121_0000071 | Ga0496121_0000071_189912_190694 | 255 |
| 591 | 3300048925 | Ga0496122_0180560 | Ga0496122_0180560_354_1136 | 255 |
| 592 | 3300048926 | Ga0496123_0049567 | Ga0496123_0049567_480_1262 | 255 |
| 593 | 3300048926 | Ga0496123_0075778 | Ga0496123_0075778_1124_1906 | 255 |
| 594 | 3300048927 | Ga0496124_0060578 | Ga0496124_0060578_1941_2726 | 255 |
| 595 | 3300048928 | Ga0496125_0027152 | Ga0496125_0027152_3977_4759 | 255 |
| 596 | 3300048929 | Ga0496126_0079339 | Ga0496126_0079339_836_1618 | 255 |
| 597 | 3300049572 | Ga0501036_0174913 | Ga0501036_0174913_768_1601 | 255 |
| 598 | 3300049581 | Ga0501047_0004231 | Ga0501047_0004231_12607_13440 | 255 |
| 599 | 3300049822 | Ga0501035_0094792 | Ga0501035_0094792_1598_2431 | 255 |
| 600 | 3300049823 | Ga0501044_0009147 | Ga0501044_0009147_9315_10148 | 255 |
| 601 | 3300053108 | Ga0500562_000623 | Ga0500562_000623_2336_3181 | 255 |
| 602 | 3300053119 | Ga0500595_038862 | Ga0500595_038862_377_1207 | 255 |
| 603 | 3300053125 | Ga0500618_000754 | Ga0500618_000754_12872_13711 | 255 |
| 604 | 3300053140 | Ga0500573_0048452 | Ga0500573_0048452_674_1474 | 255 |
| 605 | iso_pu_bacteria | 2582581279 | 2585147152 | 255 |
| 606 | iso_pu_bacteria | 2842914999 | 2842918295 | 255 |
| 607 | iso_pu_bacteria | 2919404418 | 2919406585 | 255 |
| 608 | 2124908027 | MRS2a_Contig_6771 | MRS2a_00628600 | 256 |
| 609 | 3300002737 | JGI25162J39368_1000459 | JGI25162J39368_100045917 | 256 |
| 610 | 3300002771 | JGI25163J39215_1000407 | JGI25163J39215_10004077 | 256 |
| 611 | 3300002771 | JGI25163J39215_1000589 | JGI25163J39215_10005893 | 256 |
| 612 | 3300002772 | JGI25164J39214_1000297 | JGI25164J39214_100029717 | 256 |
| 613 | 3300002772 | JGI25164J39214_1000314 | JGI25164J39214_100031417 | 256 |
| 614 | 3300003214 | JGI25165J46597_1000175 | JGI25165J46597_100017517 | 256 |
| 615 | 3300003214 | JGI25165J46597_1000193 | JGI25165J46597_100019315 | 256 |
| 616 | 3300003751 | Ga0055538_1000012 | Ga0055538_100001219 | 256 |
| 617 | 3300003752 | Ga0055539_1000017 | Ga0055539_100001719 | 256 |
| 618 | 3300003756 | Ga0055533_1000021 | Ga0055533_100002119 | 256 |
| 619 | 3300003758 | Ga0055532_1000020 | Ga0055532_1000020223 | 256 |
| 620 | 3300003759 | Ga0055525_1000117 | Ga0055525_100011797 | 256 |
| 621 | 3300003761 | Ga0055535_1012090 | Ga0055535_10120902 | 256 |
| 622 | 3300003781 | Ga0055536_1003173 | Ga0055536_10031734 | 256 |
| 623 | 3300003791 | Ga0055530_10000081 | Ga0055530_1000008156 | 256 |
| 624 | 3300003791 | Ga0055530_10000548 | Ga0055530_1000054816 | 256 |
| 625 | 3300003791 | Ga0055530_10004915 | Ga0055530_100049152 | 256 |
| 626 | 3300003792 | Ga0055540_1000121 | Ga0055540_100012156 | 256 |
| 627 | 3300003792 | Ga0055540_1000242 | Ga0055540_100024219 | 256 |
| 628 | 3300003792 | Ga0055540_1001116 | Ga0055540_10011163 | 256 |
| 629 | 3300003794 | Ga0055531_10001033 | Ga0055531_1000103317 | 256 |
| 630 | 3300003841 | Ga0055541_1000012 | Ga0055541_100001219 | 256 |
| 631 | 3300003856 | Ga0058692_1008095 | Ga0058692_10080953 | 256 |
| 632 | 3300005288 | Ga0065714_10002860 | Ga0065714_100028604 | 256 |
| 633 | 3300005288 | Ga0065714_10004303 | Ga0065714_100043036 | 256 |
| 634 | 3300005288 | Ga0065714_10008943 | Ga0065714_100089432 | 256 |
| 635 | 3300005288 | Ga0065714_10064636 | Ga0065714_100646368 | 256 |
| 636 | 3300005288 | Ga0065714_10064893 | Ga0065714_100648932 | 256 |
| 637 | 3300005288 | Ga0065714_10066596 | Ga0065714_100665961 | 256 |
| 638 | 3300005289 | Ga0065704_10001959 | Ga0065704_100019597 | 256 |
| 639 | 3300005289 | Ga0065704_10008836 | Ga0065704_100088363 | 256 |
| 640 | 3300005289 | Ga0065704_10071119 | Ga0065704_1007111910 | 256 |
| 641 | 3300005290 | Ga0065712_10068500 | Ga0065712_100685007 | 256 |
| 642 | 3300005331 | Ga0070670_100003035 | Ga0070670_1000030356 | 256 |
| 643 | 3300005331 | Ga0070670_100005339 | Ga0070670_1000053395 | 256 |
| 644 | 3300005344 | Ga0070661_100000237 | Ga0070661_10000023724 | 256 |
| 645 | 3300005353 | Ga0070669_100000158 | Ga0070669_10000015825 | 256 |
| 646 | 3300005353 | Ga0070669_100000277 | Ga0070669_10000027720 | 256 |
| 647 | 3300005367 | Ga0070667_100203189 | Ga0070667_1002031891 | 256 |
| 648 | 3300005457 | Ga0070662_100000063 | Ga0070662_10000006317 | 256 |
| 649 | 3300005539 | Ga0068853_100000143 | Ga0068853_10000014327 | 256 |
| 650 | 3300005539 | Ga0068853_100047201 | Ga0068853_1000472012 | 256 |
| 651 | 3300005539 | Ga0068853_100302093 | Ga0068853_1003020932 | 256 |
| 652 | 3300005548 | Ga0070665_100057771 | Ga0070665_1000577712 | 256 |
| 653 | 3300005564 | Ga0070664_100000940 | Ga0070664_10000094018 | 256 |
| 654 | 3300005564 | Ga0070664_100008436 | Ga0070664_1000084365 | 256 |
| 655 | 3300005564 | Ga0070664_100055150 | Ga0070664_1000551504 | 256 |
| 656 | 3300005578 | Ga0068854_100004725 | Ga0068854_1000047257 | 256 |
| 657 | 3300005834 | Ga0068851_10000018 | Ga0068851_1000001820 | 256 |
| 658 | 3300005841 | Ga0068863_100338951 | Ga0068863_1003389512 | 256 |
| 659 | 3300005844 | Ga0068862_100015372 | Ga0068862_1000153721 | 256 |
| 660 | 3300006051 | Ga0075364_10000109 | Ga0075364_1000010918 | 256 |
| 661 | 3300006051 | Ga0075364_10054778 | Ga0075364_100547782 | 256 |
| 662 | 3300006051 | Ga0075364_10078438 | Ga0075364_100784382 | 256 |
| 663 | 3300006051 | Ga0075364_10110261 | Ga0075364_101102612 | 256 |
| 664 | 3300006051 | Ga0075364_10131569 | Ga0075364_101315692 | 256 |
| 665 | 3300006058 | Ga0075432_10004705 | Ga0075432_100047054 | 256 |
| 666 | 3300006058 | Ga0075432_10007143 | Ga0075432_100071432 | 256 |
| 667 | 3300006058 | Ga0075432_10021580 | Ga0075432_100215802 | 256 |
| 668 | 3300006058 | Ga0075432_10064995 | Ga0075432_100649952 | 256 |
| 669 | 3300006177 | Ga0075362_10003263 | Ga0075362_100032635 | 256 |
| 670 | 3300006914 | Ga0075436_100170932 | Ga0075436_1001709322 | 256 |
| 671 | 3300006944 | Ga0099823_1002256 | Ga0099823_100225614 | 256 |
| 672 | 3300006946 | Ga0079104_1000291 | Ga0079104_100029138 | 256 |
| 673 | 3300006946 | Ga0079104_1003204 | Ga0079104_10032043 | 256 |
| 674 | 3300006946 | Ga0079104_1020394 | Ga0079104_10203942 | 256 |
| 675 | 3300009011 | Ga0105251_10000033 | Ga0105251_10000033101 | 256 |
| 676 | 3300009011 | Ga0105251_10000068 | Ga0105251_1000006879 | 256 |
| 677 | 3300009011 | Ga0105251_10000881 | Ga0105251_1000088118 | 256 |
| 678 | 3300009011 | Ga0105251_10000985 | Ga0105251_100009856 | 256 |
| 679 | 3300009011 | Ga0105251_10002062 | Ga0105251_1000206213 | 256 |
| 680 | 3300009011 | Ga0105251_10003716 | Ga0105251_100037165 | 256 |
| 681 | 3300009011 | Ga0105251_10004230 | Ga0105251_100042306 | 256 |
| 682 | 3300009011 | Ga0105251_10004706 | Ga0105251_100047065 | 256 |
| 683 | 3300009011 | Ga0105251_10007970 | Ga0105251_100079707 | 256 |
| 684 | 3300009011 | Ga0105251_10012227 | Ga0105251_100122273 | 256 |
| 685 | 3300009011 | Ga0105251_10039793 | Ga0105251_100397932 | 256 |
| 686 | 3300009011 | Ga0105251_10043483 | Ga0105251_100434832 | 256 |
| 687 | 3300009011 | Ga0105251_10047642 | Ga0105251_100476423 | 256 |
| 688 | 3300009011 | Ga0105251_10051112 | Ga0105251_100511122 | 256 |
| 689 | 3300009011 | Ga0105251_10051586 | Ga0105251_100515862 | 256 |
| 690 | 3300009011 | Ga0105251_10162101 | Ga0105251_101621012 | 256 |
| 691 | 3300009011 | Ga0105251_10186259 | Ga0105251_101862592 | 256 |
| 692 | 3300009036 | Ga0105244_10000726 | Ga0105244_1000072616 | 256 |
| 693 | 3300009036 | Ga0105244_10001870 | Ga0105244_1000187012 | 256 |
| 694 | 3300009036 | Ga0105244_10002402 | Ga0105244_100024026 | 256 |
| 695 | 3300009036 | Ga0105244_10005309 | Ga0105244_100053097 | 256 |
| 696 | 3300009036 | Ga0105244_10006394 | Ga0105244_100063944 | 256 |
| 697 | 3300009036 | Ga0105244_10010227 | Ga0105244_100102275 | 256 |
| 698 | 3300009036 | Ga0105244_10017810 | Ga0105244_100178104 | 256 |
| 699 | 3300009036 | Ga0105244_10096083 | Ga0105244_100960832 | 256 |
| 700 | 3300009036 | Ga0105244_10096207 | Ga0105244_100962072 | 256 |
| 701 | 3300009036 | Ga0105244_10101682 | Ga0105244_101016821 | 256 |
| 702 | 3300009036 | Ga0105244_10109387 | Ga0105244_101093872 | 256 |
| 703 | 3300009036 | Ga0105244_10156809 | Ga0105244_101568092 | 256 |
| 704 | 3300009036 | Ga0105244_10161267 | Ga0105244_101612672 | 256 |
| 705 | 3300009092 | Ga0105250_10000825 | Ga0105250_100008257 | 256 |
| 706 | 3300009092 | Ga0105250_10001995 | Ga0105250_100019955 | 256 |
| 707 | 3300009092 | Ga0105250_10007162 | Ga0105250_100071625 | 256 |
| 708 | 3300009092 | Ga0105250_10016832 | Ga0105250_100168323 | 256 |
| 709 | 3300009092 | Ga0105250_10027515 | Ga0105250_100275152 | 256 |
| 710 | 3300009092 | Ga0105250_10065871 | Ga0105250_100658711 | 256 |
| 711 | 3300009092 | Ga0105250_10065931 | Ga0105250_100659312 | 256 |
| 712 | 3300009092 | Ga0105250_10089394 | Ga0105250_100893942 | 256 |
| 713 | 3300009092 | Ga0105250_10173047 | Ga0105250_101730471 | 256 |
| 714 | 3300009148 | Ga0105243_10000075 | Ga0105243_10000075100 | 256 |
| 715 | 3300009148 | Ga0105243_10000867 | Ga0105243_100008679 | 256 |
| 716 | 3300009148 | Ga0105243_10001447 | Ga0105243_1000144716 | 256 |
| 717 | 3300009148 | Ga0105243_10075069 | Ga0105243_100750692 | 256 |
| 718 | 3300009148 | Ga0105243_10118152 | Ga0105243_101181522 | 256 |
| 719 | 3300009148 | Ga0105243_10135072 | Ga0105243_101350722 | 256 |
| 720 | 3300009176 | Ga0105242_10000358 | Ga0105242_1000035816 | 256 |
| 721 | 3300009176 | Ga0105242_10016716 | Ga0105242_100167162 | 256 |
| 722 | 3300009177 | Ga0105248_10172510 | Ga0105248_101725102 | 256 |
| 723 | 3300009177 | Ga0105248_10180194 | Ga0105248_101801943 | 256 |
| 724 | 3300009545 | Ga0105237_10002504 | Ga0105237_100025046 | 256 |
| 725 | 3300010375 | Ga0105239_10611688 | Ga0105239_106116882 | 256 |
| 726 | 3300011119 | Ga0105246_10000436 | Ga0105246_100004366 | 256 |
| 727 | 3300011119 | Ga0105246_10000504 | Ga0105246_1000050410 | 256 |
| 728 | 3300011119 | Ga0105246_10010430 | Ga0105246_100104303 | 256 |
| 729 | 3300011119 | Ga0105246_10023186 | Ga0105246_100231865 | 256 |
| 730 | 3300011119 | Ga0105246_10047287 | Ga0105246_100472873 | 256 |
| 731 | 3300012498 | Ga0157345_1000163 | Ga0157345_10001636 | 256 |
| 732 | 3300013100 | Ga0157373_10000586 | Ga0157373_1000058610 | 256 |
| 733 | 3300013100 | Ga0157373_10003492 | Ga0157373_1000349210 | 256 |
| 734 | 3300013100 | Ga0157373_10003814 | Ga0157373_100038145 | 256 |
| 735 | 3300013100 | Ga0157373_10006402 | Ga0157373_100064024 | 256 |
| 736 | 3300013100 | Ga0157373_10016680 | Ga0157373_100166802 | 256 |
| 737 | 3300013100 | Ga0157373_10031150 | Ga0157373_100311502 | 256 |
| 738 | 3300013100 | Ga0157373_10390036 | Ga0157373_103900361 | 256 |
| 739 | 3300013102 | Ga0157371_10000935 | Ga0157371_1000093516 | 256 |
| 740 | 3300013102 | Ga0157371_10001391 | Ga0157371_1000139116 | 256 |
| 741 | 3300013102 | Ga0157371_10004419 | Ga0157371_100044198 | 256 |
| 742 | 3300013102 | Ga0157371_10223794 | Ga0157371_102237942 | 256 |
| 743 | 3300013104 | Ga0157370_10008450 | Ga0157370_100084505 | 256 |
| 744 | 3300013104 | Ga0157370_10010774 | Ga0157370_100107745 | 256 |
| 745 | 3300013104 | Ga0157370_10054054 | Ga0157370_100540544 | 256 |
| 746 | 3300013104 | Ga0157370_10073948 | Ga0157370_100739483 | 256 |
| 747 | 3300013104 | Ga0157370_10469478 | Ga0157370_104694781 | 256 |
| 748 | 3300013105 | Ga0157369_10009283 | Ga0157369_100092836 | 256 |
| 749 | 3300013105 | Ga0157369_10017873 | Ga0157369_100178735 | 256 |
| 750 | 3300013105 | Ga0157369_10022731 | Ga0157369_100227315 | 256 |
| 751 | 3300013105 | Ga0157369_10229424 | Ga0157369_102294242 | 256 |
| 752 | 3300013105 | Ga0157369_10898889 | Ga0157369_108988891 | 256 |
| 753 | 3300013306 | Ga0163162_10001225 | Ga0163162_100012255 | 256 |
| 754 | 3300013308 | Ga0157375_10005374 | Ga0157375_100053746 | 256 |
| 755 | 3300013308 | Ga0157375_10009695 | Ga0157375_100096955 | 256 |
| 756 | 3300014497 | Ga0182008_10001337 | Ga0182008_100013375 | 256 |
| 757 | 3300014497 | Ga0182008_10003405 | Ga0182008_100034057 | 256 |
| 758 | 3300014497 | Ga0182008_10005486 | Ga0182008_100054863 | 256 |
| 759 | 3300014497 | Ga0182008_10009133 | Ga0182008_100091334 | 256 |
| 760 | 3300014497 | Ga0182008_10010188 | Ga0182008_100101884 | 256 |
| 761 | 3300015261 | Ga0182006_1001380 | Ga0182006_10013805 | 256 |
| 762 | 3300015261 | Ga0182006_1001917 | Ga0182006_10019175 | 256 |
| 763 | 3300015261 | Ga0182006_1002154 | Ga0182006_10021545 | 256 |
| 764 | 3300015261 | Ga0182006_1003725 | Ga0182006_10037255 | 256 |
| 765 | 3300015261 | Ga0182006_1060908 | Ga0182006_10609082 | 256 |
| 766 | 3300015262 | Ga0182007_10000228 | Ga0182007_1000022820 | 256 |
| 767 | 3300015262 | Ga0182007_10054590 | Ga0182007_100545902 | 256 |
| 768 | 3300015265 | Ga0182005_1000375 | Ga0182005_100037520 | 256 |
| 769 | 3300015265 | Ga0182005_1004691 | Ga0182005_10046913 | 256 |
| 770 | 3300015265 | Ga0182005_1015515 | Ga0182005_10155152 | 256 |
| 771 | 3300015265 | Ga0182005_1022296 | Ga0182005_10222962 | 256 |
| 772 | 3300015265 | Ga0182005_1028587 | Ga0182005_10285872 | 256 |
| 773 | 3300017792 | Ga0163161_10003439 | Ga0163161_100034395 | 256 |
| 774 | 3300017792 | Ga0163161_10025857 | Ga0163161_100258574 | 256 |
| 775 | 3300017792 | Ga0163161_10026043 | Ga0163161_100260433 | 256 |
| 776 | 3300017792 | Ga0163161_10030292 | Ga0163161_100302924 | 256 |
| 777 | 3300017792 | Ga0163161_10062624 | Ga0163161_100626242 | 256 |
| 778 | 3300017792 | Ga0163161_10196908 | Ga0163161_101969082 | 256 |
| 779 | 3300021384 | Ga0213876_10076158 | Ga0213876_100761582 | 256 |
| 780 | 3300025206 | Ga0209435_100424 | Ga0209435_1004249 | 256 |
| 781 | 3300025207 | Ga0209760_100082 | Ga0209760_10008267 | 256 |
| 782 | 3300025207 | Ga0209760_100230 | Ga0209760_1002303 | 256 |
| 783 | 3300025224 | Ga0209784_100007 | Ga0209784_10000719 | 256 |
| 784 | 3300025225 | Ga0209566_100009 | Ga0209566_10000919 | 256 |
| 785 | 3300025226 | Ga0209674_100021 | Ga0209674_10002119 | 256 |
| 786 | 3300025229 | Ga0209147_100009 | Ga0209147_10000919 | 256 |
| 787 | 3300025230 | Ga0209563_100018 | Ga0209563_10001819 | 256 |
| 788 | 3300025231 | Ga0207427_100005 | Ga0207427_100005732 | 256 |
| 789 | 3300025231 | Ga0207427_100006 | Ga0207427_10000620 | 256 |
| 790 | 3300025233 | Ga0209437_100013 | Ga0209437_10001320 | 256 |
| 791 | 3300025233 | Ga0209437_100018 | Ga0209437_100018642 | 256 |
| 792 | 3300025242 | Ga0209258_100237 | Ga0209258_10023719 | 256 |
| 793 | 3300025246 | Ga0209646_1000277 | Ga0209646_100027720 | 256 |
| 794 | 3300025253 | Ga0209677_100012 | Ga0209677_10001219 | 256 |
| 795 | 3300025256 | Ga0209759_1006965 | Ga0209759_10069653 | 256 |
| 796 | 3300025256 | Ga0209759_1017087 | Ga0209759_10170872 | 256 |
| 797 | 3300025261 | Ga0209233_1000021 | Ga0209233_1000021732 | 256 |
| 798 | 3300025261 | Ga0209233_1000022 | Ga0209233_100002220 | 256 |
| 799 | 3300025284 | Ga0209130_1025652 | Ga0209130_10256522 | 256 |
| 800 | 3300025292 | Ga0209676_1000015 | Ga0209676_100001579 | 256 |
| 801 | 3300025292 | Ga0209676_1000157 | Ga0209676_100015780 | 256 |
| 802 | 3300025292 | Ga0209676_1000222 | Ga0209676_100022222 | 256 |
| 803 | 3300025292 | Ga0209676_1000242 | Ga0209676_1000242112 | 256 |
| 804 | 3300025292 | Ga0209676_1000583 | Ga0209676_100058338 | 256 |
| 805 | 3300025292 | Ga0209676_1002476 | Ga0209676_10024762 | 256 |
| 806 | 3300025298 | Ga0209050_1000030 | Ga0209050_1000030359 | 256 |
| 807 | 3300025298 | Ga0209050_1000061 | Ga0209050_1000061137 | 256 |
| 808 | 3300025298 | Ga0209050_1000296 | Ga0209050_100029622 | 256 |
| 809 | 3300025298 | Ga0209050_1001114 | Ga0209050_100111414 | 256 |
| 810 | 3300025298 | Ga0209050_1059597 | Ga0209050_10595972 | 256 |
| 811 | 3300025303 | Ga0209051_1000088 | Ga0209051_100008891 | 256 |
| 812 | 3300025303 | Ga0209051_1000143 | Ga0209051_100014380 | 256 |
| 813 | 3300025303 | Ga0209051_1000295 | Ga0209051_100029558 | 256 |
| 814 | 3300025303 | Ga0209051_1009993 | Ga0209051_10099934 | 256 |
| 815 | 3300025304 | Ga0209257_1000422 | Ga0209257_100042279 | 256 |
| 816 | 3300025304 | Ga0209257_1009479 | Ga0209257_10094795 | 256 |
| 817 | 3300025321 | Ga0207656_10000009 | Ga0207656_1000000920 | 256 |
| 818 | 3300025711 | Ga0207696_1000055 | Ga0207696_1000055235 | 256 |
| 819 | 3300025711 | Ga0207696_1000127 | Ga0207696_100012720 | 256 |
| 820 | 3300025711 | Ga0207696_1000151 | Ga0207696_100015140 | 256 |
| 821 | 3300025711 | Ga0207696_1000165 | Ga0207696_100016520 | 256 |
| 822 | 3300025711 | Ga0207696_1001704 | Ga0207696_10017045 | 256 |
| 823 | 3300025711 | Ga0207696_1003033 | Ga0207696_10030336 | 256 |
| 824 | 3300025711 | Ga0207696_1003607 | Ga0207696_10036075 | 256 |
| 825 | 3300025711 | Ga0207696_1006652 | Ga0207696_10066522 | 256 |
| 826 | 3300025711 | Ga0207696_1015269 | Ga0207696_10152692 | 256 |
| 827 | 3300025711 | Ga0207696_1076906 | Ga0207696_10769061 | 256 |
| 828 | 3300025728 | Ga0207655_1000135 | Ga0207655_1000135119 | 256 |
| 829 | 3300025728 | Ga0207655_1000548 | Ga0207655_100054821 | 256 |
| 830 | 3300025728 | Ga0207655_1000667 | Ga0207655_100066721 | 256 |
| 831 | 3300025728 | Ga0207655_1000754 | Ga0207655_100075420 | 256 |
| 832 | 3300025728 | Ga0207655_1001254 | Ga0207655_10012547 | 256 |
| 833 | 3300025728 | Ga0207655_1001422 | Ga0207655_10014224 | 256 |
| 834 | 3300025728 | Ga0207655_1001733 | Ga0207655_10017335 | 256 |
| 835 | 3300025728 | Ga0207655_1002247 | Ga0207655_10022472 | 256 |
| 836 | 3300025728 | Ga0207655_1004181 | Ga0207655_10041814 | 256 |
| 837 | 3300025728 | Ga0207655_1006660 | Ga0207655_10066605 | 256 |
| 838 | 3300025728 | Ga0207655_1009133 | Ga0207655_10091334 | 256 |
| 839 | 3300025728 | Ga0207655_1011018 | Ga0207655_10110181 | 256 |
| 840 | 3300025728 | Ga0207655_1017979 | Ga0207655_10179792 | 256 |
| 841 | 3300025728 | Ga0207655_1028896 | Ga0207655_10288962 | 256 |
| 842 | 3300025728 | Ga0207655_1065329 | Ga0207655_10653292 | 256 |
| 843 | 3300025728 | Ga0207655_1066905 | Ga0207655_10669052 | 256 |
| 844 | 3300025728 | Ga0207655_1081641 | Ga0207655_10816412 | 256 |
| 845 | 3300025728 | Ga0207655_1113523 | Ga0207655_11135231 | 256 |
| 846 | 3300025735 | Ga0207713_1000012 | Ga0207713_1000012282 | 256 |
| 847 | 3300025735 | Ga0207713_1000103 | Ga0207713_1000103111 | 256 |
| 848 | 3300025735 | Ga0207713_1000126 | Ga0207713_100012618 | 256 |
| 849 | 3300025735 | Ga0207713_1000297 | Ga0207713_10002976 | 256 |
| 850 | 3300025735 | Ga0207713_1000325 | Ga0207713_100032534 | 256 |
| 851 | 3300025735 | Ga0207713_1000984 | Ga0207713_10009846 | 256 |
| 852 | 3300025735 | Ga0207713_1002461 | Ga0207713_10024619 | 256 |
| 853 | 3300025735 | Ga0207713_1003599 | Ga0207713_10035997 | 256 |
| 854 | 3300025735 | Ga0207713_1004264 | Ga0207713_10042644 | 256 |
| 855 | 3300025735 | Ga0207713_1004634 | Ga0207713_10046344 | 256 |
| 856 | 3300025735 | Ga0207713_1004661 | Ga0207713_10046615 | 256 |
| 857 | 3300025735 | Ga0207713_1005396 | Ga0207713_10053965 | 256 |
| 858 | 3300025735 | Ga0207713_1005829 | Ga0207713_10058292 | 256 |
| 859 | 3300025735 | Ga0207713_1008163 | Ga0207713_10081634 | 256 |
| 860 | 3300025735 | Ga0207713_1016738 | Ga0207713_10167382 | 256 |
| 861 | 3300025735 | Ga0207713_1017509 | Ga0207713_10175092 | 256 |
| 862 | 3300025735 | Ga0207713_1025443 | Ga0207713_10254432 | 256 |
| 863 | 3300025735 | Ga0207713_1046805 | Ga0207713_10468052 | 256 |
| 864 | 3300025735 | Ga0207713_1088689 | Ga0207713_10886892 | 256 |
| 865 | 3300025735 | Ga0207713_1098176 | Ga0207713_10981762 | 256 |
| 866 | 3300025914 | Ga0207671_10000876 | Ga0207671_1000087620 | 256 |
| 867 | 3300025920 | Ga0207649_10000007 | Ga0207649_10000007284 | 256 |
| 868 | 3300025923 | Ga0207681_10000291 | Ga0207681_1000029120 | 256 |
| 869 | 3300025923 | Ga0207681_10001357 | Ga0207681_1000135714 | 256 |
| 870 | 3300025923 | Ga0207681_10414592 | Ga0207681_104145922 | 256 |
| 871 | 3300025925 | Ga0207650_10000308 | Ga0207650_1000030819 | 256 |
| 872 | 3300025925 | Ga0207650_10000407 | Ga0207650_1000040717 | 256 |
| 873 | 3300025932 | Ga0207690_10059032 | Ga0207690_100590322 | 256 |
| 874 | 3300025933 | Ga0207706_10000050 | Ga0207706_1000005020 | 256 |
| 875 | 3300025934 | Ga0207686_10001345 | Ga0207686_1000134511 | 256 |
| 876 | 3300025934 | Ga0207686_10007359 | Ga0207686_100073595 | 256 |
| 877 | 3300025935 | Ga0207709_10000107 | Ga0207709_1000010748 | 256 |
| 878 | 3300025935 | Ga0207709_10000368 | Ga0207709_100003685 | 256 |
| 879 | 3300025935 | Ga0207709_10001047 | Ga0207709_1000104711 | 256 |
| 880 | 3300025935 | Ga0207709_10044529 | Ga0207709_100445292 | 256 |
| 881 | 3300025941 | Ga0207711_10442639 | Ga0207711_104426392 | 256 |
| 882 | 3300025945 | Ga0207679_10000013 | Ga0207679_1000001320 | 256 |
| 883 | 3300025945 | Ga0207679_10039343 | Ga0207679_100393434 | 256 |
| 884 | 3300025981 | Ga0207640_10080376 | Ga0207640_100803762 | 256 |
| 885 | 3300026041 | Ga0207639_10000079 | Ga0207639_1000007920 | 256 |
| 886 | 3300026041 | Ga0207639_10157496 | Ga0207639_101574962 | 256 |
| 887 | 3300026067 | Ga0207678_10184033 | Ga0207678_101840332 | 256 |
| 888 | 3300027111 | Ga0209281_1000237 | Ga0209281_100023743 | 256 |
| 889 | 3300027111 | Ga0209281_1002242 | Ga0209281_10022423 | 256 |
| 890 | 3300027111 | Ga0209281_1003265 | Ga0209281_10032654 | 256 |
| 891 | 3300027296 | Ga0209389_1000065 | Ga0209389_100006584 | 256 |
| 892 | 3300027296 | Ga0209389_1041832 | Ga0209389_10418322 | 256 |
| 893 | 3300027312 | Ga0209371_1000176 | Ga0209371_100017627 | 256 |
| 894 | 3300027312 | Ga0209371_1000735 | Ga0209371_100073521 | 256 |
| 895 | 3300027312 | Ga0209371_1010326 | Ga0209371_10103262 | 256 |
| 896 | 3300027665 | Ga0209983_1026486 | Ga0209983_10264862 | 256 |
| 897 | 3300027907 | Ga0207428_10039688 | Ga0207428_100396882 | 256 |
| 898 | 3300027907 | Ga0207428_10043963 | Ga0207428_100439633 | 256 |
| 899 | 3300027907 | Ga0207428_10078153 | Ga0207428_100781532 | 256 |
| 900 | 3300027907 | Ga0207428_10079559 | Ga0207428_100795592 | 256 |
| 901 | 3300027907 | Ga0207428_10233560 | Ga0207428_102335602 | 256 |
| 902 | 3300028379 | Ga0268266_10002796 | Ga0268266_100027965 | 256 |
| 903 | 3300028380 | Ga0268265_10002972 | Ga0268265_100029729 | 256 |
| 904 | 3300028786 | Ga0307517_10032178 | Ga0307517_100321783 | 256 |
| 905 | 3300028800 | Ga0265338_10071753 | Ga0265338_100717532 | 256 |
| 906 | 3300030500 | Ga0268256_1000146 | Ga0268256_100014673 | 256 |
| 907 | 3300030500 | Ga0268256_1000625 | Ga0268256_10006256 | 256 |
| 908 | 3300030500 | Ga0268256_1011074 | Ga0268256_10110744 | 256 |
| 909 | 3300030521 | Ga0307511_10008829 | Ga0307511_100088297 | 256 |
| 910 | 3300030733 | Ga0314311_1262089 | Ga0314311_12620898 | 256 |
| 911 | 3300030735 | Ga0316178_1036683 | Ga0316178_103668310 | 256 |
| 912 | 3300030742 | Ga0316183_1050417 | Ga0316183_10504173 | 256 |
| 913 | 3300031251 | Ga0265327_10005511 | Ga0265327_100055112 | 256 |
| 914 | 3300031507 | Ga0307509_10114426 | Ga0307509_101144262 | 256 |
| 915 | 3300031548 | Ga0307408_100000002 | Ga0307408_100000002373 | 256 |
| 916 | 3300031548 | Ga0307408_100002301 | Ga0307408_10000230110 | 256 |
| 917 | 3300031548 | Ga0307408_100162575 | Ga0307408_1001625752 | 256 |
| 918 | 3300031903 | Ga0307407_10348269 | Ga0307407_103482691 | 256 |
| 919 | 3300031911 | Ga0307412_10115149 | Ga0307412_101151491 | 256 |
| 920 | 3300031995 | Ga0307409_100105426 | Ga0307409_1001054262 | 256 |
| 921 | 3300032004 | Ga0307414_10133798 | Ga0307414_101337982 | 256 |
| 922 | 3300032004 | Ga0307414_10698186 | Ga0307414_106981862 | 256 |
| 923 | 3300032005 | Ga0307411_10010751 | Ga0307411_100107513 | 256 |
| 924 | 3300033180 | Ga0307510_10010168 | Ga0307510_100101686 | 256 |
| 925 | 3300033180 | Ga0307510_10046095 | Ga0307510_100460953 | 256 |
| 926 | 3300041404 | Ga0439436_0000652 | Ga0439436_0000652_5193_5981 | 256 |
| 927 | 3300041405 | Ga0439438_000437 | Ga0439438_000437_16359_17129 | 256 |
| 928 | 3300041405 | Ga0439438_001281 | Ga0439438_001281_5259_6047 | 256 |
| 929 | 3300041405 | Ga0439438_002577 | Ga0439438_002577_3300_4070 | 256 |
| 930 | 3300041405 | Ga0439438_005287 | Ga0439438_005287_2818_3588 | 256 |
| 931 | 3300041405 | Ga0439438_007479 | Ga0439438_007479_1378_2181 | 256 |
| 932 | 3300041405 | Ga0439438_007560 | Ga0439438_007560_2494_3264 | 256 |
| 933 | 3300041407 | Ga0439447_000128 | Ga0439447_000128_3482_4270 | 256 |
| 934 | 3300041407 | Ga0439447_000462 | Ga0439447_000462_10542_11312 | 256 |
| 935 | 3300041407 | Ga0439447_004152 | Ga0439447_004152_747_1517 | 256 |
| 936 | 3300041411 | Ga0439466_0000343 | Ga0439466_0000343_2711_3481 | 256 |
| 937 | 3300041411 | Ga0439466_0001334 | Ga0439466_0001334_270_1040 | 256 |
| 938 | 3300041411 | Ga0439466_0004277 | Ga0439466_0004277_4375_5163 | 256 |
| 939 | 3300041411 | Ga0439466_0006839 | Ga0439466_0006839_865_1635 | 256 |
| 940 | 3300041411 | Ga0439466_0022672 | Ga0439466_0022672_60_830 | 256 |
| 941 | 3300041411 | Ga0439466_0036944 | Ga0439466_0036944_110_880 | 256 |
| 942 | 3300041413 | Ga0439465_0002085 | Ga0439465_0002085_2273_3043 | 256 |
| 943 | 3300042006 | Ga0439432_001014 | Ga0439432_001014_6160_6951 | 256 |
| 944 | 3300042006 | Ga0439432_003214 | Ga0439432_003214_3024_3794 | 256 |
| 945 | 3300042006 | Ga0439432_003970 | Ga0439432_003970_2778_3566 | 256 |
| 946 | 3300042006 | Ga0439432_008308 | Ga0439432_008308_2531_3301 | 256 |
| 947 | 3300042009 | Ga0439451_003180 | Ga0439451_003180_1303_2073 | 256 |
| 948 | 3300042010 | Ga0439452_000190 | Ga0439452_000190_27655_28425 | 256 |
| 949 | 3300042010 | Ga0439452_000443 | Ga0439452_000443_1191_1961 | 256 |
| 950 | 3300042010 | Ga0439452_001195 | Ga0439452_001195_3922_4692 | 256 |
| 951 | 3300042010 | Ga0439452_002167 | Ga0439452_002167_1309_2097 | 256 |
| 952 | 3300042010 | Ga0439452_002256 | Ga0439452_002256_4312_5082 | 256 |
| 953 | 3300042013 | Ga0439456_000036 | Ga0439456_000036_21016_21819 | 256 |
| 954 | 3300042013 | Ga0439456_001085 | Ga0439456_001085_2034_2804 | 256 |
| 955 | 3300042016 | Ga0439463_000120 | Ga0439463_000120_15080_15853 | 256 |
| 956 | 3300042016 | Ga0439463_000491 | Ga0439463_000491_7159_7950 | 256 |
| 957 | 3300042016 | Ga0439463_003161 | Ga0439463_003161_3332_4135 | 256 |
| 958 | 3300042016 | Ga0439463_005639 | Ga0439463_005639_271_1041 | 256 |
| 959 | 3300042115 | Ga0450911_000509 | Ga0450911_000509_7695_8465 | 256 |
| 960 | 3300042115 | Ga0450911_000543 | Ga0450911_000543_8916_9686 | 256 |
| 961 | 3300042115 | Ga0450911_001948 | Ga0450911_001948_3324_4109 | 256 |
| 962 | 3300042121 | Ga0450919_000957 | Ga0450919_000957_1464_2234 | 256 |
| 963 | 3300042122 | Ga0450920_002368 | Ga0450920_002368_1438_2208 | 256 |
| 964 | 3300042124 | Ga0450922_000657 | Ga0450922_000657_1862_2632 | 256 |
| 965 | 3300042125 | Ga0450923_001543 | Ga0450923_001543_1507_2295 | 256 |
| 966 | 3300042127 | Ga0450890_000131 | Ga0450890_000131_7653_8423 | 256 |
| 967 | 3300042136 | Ga0450900_000084 | Ga0450900_000084_2394_3167 | 256 |
| 968 | 3300042138 | Ga0450903_005080 | Ga0450903_005080_1375_2145 | 256 |
| 969 | 3300042138 | Ga0450903_008578 | Ga0450903_008578_639_1409 | 256 |
| 970 | 3300042142 | Ga0450905_000122 | Ga0450905_000122_3475_4266 | 256 |
| 971 | 3300042142 | Ga0450905_004899 | Ga0450905_004899_69_842 | 256 |
| 972 | 3300042146 | Ga0450907_000110 | Ga0450907_000110_2868_3638 | 256 |
| 973 | 3300042146 | Ga0450907_001935 | Ga0450907_001935_2840_3610 | 256 |
| 974 | 3300042147 | Ga0450910_002464 | Ga0450910_002464_1023_1793 | 256 |
| 975 | 3300042147 | Ga0450910_024120 | Ga0450910_024120_132_902 | 256 |
| 976 | 3300042156 | Ga0439446_0002401 | Ga0439446_0002401_10_798 | 256 |
| 977 | 3300042156 | Ga0439446_0002959 | Ga0439446_0002959_1909_2679 | 256 |
| 978 | 3300042185 | Ga0450909_000363 | Ga0450909_000363_1151_1921 | 256 |
| 979 | 3300042185 | Ga0450909_001941 | Ga0450909_001941_307_1077 | 256 |
| 980 | 3300042435 | Ga0439434_0000092 | Ga0439434_0000092_21430_22200 | 256 |
| 981 | 3300042439 | Ga0439464_0006232 | Ga0439464_0006232_1810_2601 | 256 |
| 982 | 3300042461 | Ga0439460_0003102 | Ga0439460_0003102_1959_2729 | 256 |
| 983 | 3300042461 | Ga0439460_0008742 | Ga0439460_0008742_1119_1889 | 256 |
| 984 | 3300042533 | Ga0450901_000475 | Ga0450901_000475_1587_2360 | 256 |
| 985 | 3300042993 | Ga0439440_0000808 | Ga0439440_0000808_1129_1899 | 256 |
| 986 | 3300046452 | Ga0495617_000386 | Ga0495617_000386_7331_8101 | 256 |
| 987 | 3300046452 | Ga0495617_004591 | Ga0495617_004591_1778_2548 | 256 |
| 988 | 3300046452 | Ga0495617_084803 | Ga0495617_084803_236_1006 | 256 |
| 989 | 3300046453 | Ga0495627_000646 | Ga0495627_000646_3820_4590 | 256 |
| 990 | 3300046453 | Ga0495627_001581 | Ga0495627_001581_263_1033 | 256 |
| 991 | 3300046453 | Ga0495627_004712 | Ga0495627_004712_2924_3730 | 256 |
| 992 | 3300046455 | Ga0495603_0001944 | Ga0495603_0001944_10849_11619 | 256 |
| 993 | 3300046457 | Ga0495590_0000460 | Ga0495590_0000460_16188_16958 | 256 |
| 994 | 3300046457 | Ga0495590_0007082 | Ga0495590_0007082_35_805 | 256 |
| 995 | 3300046457 | Ga0495590_0025857 | Ga0495590_0025857_1113_1904 | 256 |
| 996 | 3300046458 | Ga0495591_000334 | Ga0495591_000334_22030_22821 | 256 |
| 997 | 3300046458 | Ga0495591_001427 | Ga0495591_001427_11099_11890 | 256 |
| 998 | 3300046458 | Ga0495591_002016 | Ga0495591_002016_4417_5187 | 256 |
| 999 | 3300046458 | Ga0495591_002140 | Ga0495591_002140_3886_4656 | 256 |
| 1000 | 3300046458 | Ga0495591_002379 | Ga0495591_002379_6277_7068 | 256 |
| 1001 | 3300046458 | Ga0495591_004970 | Ga0495591_004970_1696_2466 | 256 |
| 1002 | 3300046458 | Ga0495591_005398 | Ga0495591_005398_3013_3783 | 256 |
| 1003 | 3300046458 | Ga0495591_007620 | Ga0495591_007620_565_1371 | 256 |
| 1004 | 3300046458 | Ga0495591_016596 | Ga0495591_016596_1708_2478 | 256 |
| 1005 | 3300046458 | Ga0495591_018027 | Ga0495591_018027_1178_1948 | 256 |
| 1006 | 3300046460 | Ga0495638_0004508 | Ga0495638_0004508_8746_9516 | 256 |
| 1007 | 3300046460 | Ga0495638_0045219 | Ga0495638_0045219_1928_2698 | 256 |
| 1008 | 3300046460 | Ga0495638_0065440 | Ga0495638_0065440_586_1356 | 256 |
| 1009 | 3300046460 | Ga0495638_0225126 | Ga0495638_0225126_32_805 | 256 |
| 1010 | 3300046460 | Ga0495638_0288369 | Ga0495638_0288369_38_808 | 256 |
| 1011 | 3300046463 | Ga0495653_0007203 | Ga0495653_0007203_3868_4671 | 256 |
| 1012 | 3300046463 | Ga0495653_0012336 | Ga0495653_0012336_3413_4183 | 256 |
| 1013 | 3300046471 | Ga0495650_0001617 | Ga0495650_0001617_5571_6362 | 256 |
| 1014 | 3300046471 | Ga0495650_0001916 | Ga0495650_0001916_15173_15976 | 256 |
| 1015 | 3300046471 | Ga0495650_0007358 | Ga0495650_0007358_1257_2027 | 256 |
| 1016 | 3300046471 | Ga0495650_0009773 | Ga0495650_0009773_2890_3660 | 256 |
| 1017 | 3300046471 | Ga0495650_0017685 | Ga0495650_0017685_56_862 | 256 |
| 1018 | 3300046471 | Ga0495650_0054220 | Ga0495650_0054220_799_1599 | 256 |
| 1019 | 3300046473 | Ga0495582_0000456 | Ga0495582_0000456_14040_14810 | 256 |
| 1020 | 3300046474 | Ga0495605_0000019 | Ga0495605_0000019_235560_236366 | 256 |
| 1021 | 3300046474 | Ga0495605_0000376 | Ga0495605_0000376_22243_23034 | 256 |
| 1022 | 3300046474 | Ga0495605_0000384 | Ga0495605_0000384_5937_6740 | 256 |
| 1023 | 3300046474 | Ga0495605_0002242 | Ga0495605_0002242_9813_10583 | 256 |
| 1024 | 3300046474 | Ga0495605_0004010 | Ga0495605_0004010_1833_2603 | 256 |
| 1025 | 3300046474 | Ga0495605_0006168 | Ga0495605_0006168_6065_6838 | 256 |
| 1026 | 3300046474 | Ga0495605_0020125 | Ga0495605_0020125_1921_2691 | 256 |
| 1027 | 3300046474 | Ga0495605_0033602 | Ga0495605_0033602_1084_1887 | 256 |
| 1028 | 3300046474 | Ga0495605_0080499 | Ga0495605_0080499_692_1483 | 256 |
| 1029 | 3300046475 | Ga0495639_0000295 | Ga0495639_0000295_7355_8125 | 256 |
| 1030 | 3300046491 | Ga0495584_0000408 | Ga0495584_0000408_15484_16254 | 256 |
| 1031 | 3300046491 | Ga0495584_0002140 | Ga0495584_0002140_10506_11276 | 256 |
| 1032 | 3300046491 | Ga0495584_0002646 | Ga0495584_0002646_3422_4192 | 256 |
| 1033 | 3300046491 | Ga0495584_0003319 | Ga0495584_0003319_6359_7129 | 256 |
| 1034 | 3300046491 | Ga0495584_0006064 | Ga0495584_0006064_3585_4355 | 256 |
| 1035 | 3300046491 | Ga0495584_0006289 | Ga0495584_0006289_1454_2257 | 256 |
| 1036 | 3300046491 | Ga0495584_0033007 | Ga0495584_0033007_41_811 | 256 |
| 1037 | 3300046491 | Ga0495584_0043001 | Ga0495584_0043001_265_1056 | 256 |
| 1038 | 3300046491 | Ga0495584_0249412 | Ga0495584_0249412_39_809 | 256 |
| 1039 | 3300046492 | Ga0495585_0000895 | Ga0495585_0000895_16748_17518 | 256 |
| 1040 | 3300046492 | Ga0495585_0011646 | Ga0495585_0011646_1563_2333 | 256 |
| 1041 | 3300046492 | Ga0495585_0012147 | Ga0495585_0012147_1937_2743 | 256 |
| 1042 | 3300046492 | Ga0495585_0014639 | Ga0495585_0014639_3330_4121 | 256 |
| 1043 | 3300046492 | Ga0495585_0017769 | Ga0495585_0017769_10_780 | 256 |
| 1044 | 3300046492 | Ga0495585_0034670 | Ga0495585_0034670_1363_2133 | 256 |
| 1045 | 3300046499 | Ga0495594_0005851 | Ga0495594_0005851_3035_3841 | 256 |
| 1046 | 3300046500 | Ga0495596_0000175 | Ga0495596_0000175_27334_28104 | 256 |
| 1047 | 3300046500 | Ga0495596_0012956 | Ga0495596_0012956_2284_3075 | 256 |
| 1048 | 3300046501 | Ga0495607_0000751 | Ga0495607_0000751_22359_23150 | 256 |
| 1049 | 3300046501 | Ga0495607_0001123 | Ga0495607_0001123_1833_2603 | 256 |
| 1050 | 3300046501 | Ga0495607_0003423 | Ga0495607_0003423_9661_10452 | 256 |
| 1051 | 3300046501 | Ga0495607_0003609 | Ga0495607_0003609_7164_7934 | 256 |
| 1052 | 3300046501 | Ga0495607_0012855 | Ga0495607_0012855_3777_4550 | 256 |
| 1053 | 3300046501 | Ga0495607_0017733 | Ga0495607_0017733_3248_4021 | 256 |
| 1054 | 3300046501 | Ga0495607_0030789 | Ga0495607_0030789_1740_2510 | 256 |
| 1055 | 3300046501 | Ga0495607_0052787 | Ga0495607_0052787_325_1095 | 256 |
| 1056 | 3300046501 | Ga0495607_0113048 | Ga0495607_0113048_514_1305 | 256 |
| 1057 | 3300046501 | Ga0495607_0139380 | Ga0495607_0139380_440_1210 | 256 |
| 1058 | 3300046501 | Ga0495607_0189960 | Ga0495607_0189960_34_840 | 256 |
| 1059 | 3300046506 | Ga0495583_0000146 | Ga0495583_0000146_33645_34451 | 256 |
| 1060 | 3300046506 | Ga0495583_0000452 | Ga0495583_0000452_19421_20191 | 256 |
| 1061 | 3300046506 | Ga0495583_0001254 | Ga0495583_0001254_18586_19377 | 256 |
| 1062 | 3300046506 | Ga0495583_0001293 | Ga0495583_0001293_18574_19365 | 256 |
| 1063 | 3300046506 | Ga0495583_0004428 | Ga0495583_0004428_3033_3824 | 256 |
| 1064 | 3300046506 | Ga0495583_0005244 | Ga0495583_0005244_3218_4021 | 256 |
| 1065 | 3300046506 | Ga0495583_0007005 | Ga0495583_0007005_3926_4696 | 256 |
| 1066 | 3300046506 | Ga0495583_0008331 | Ga0495583_0008331_2096_2866 | 256 |
| 1067 | 3300046507 | Ga0495606_0000115 | Ga0495606_0000115_17548_18339 | 256 |
| 1068 | 3300046507 | Ga0495606_0001164 | Ga0495606_0001164_15987_16778 | 256 |
| 1069 | 3300046507 | Ga0495606_0002670 | Ga0495606_0002670_3389_4159 | 256 |
| 1070 | 3300046507 | Ga0495606_0007824 | Ga0495606_0007824_1078_1848 | 256 |
| 1071 | 3300046507 | Ga0495606_0008572 | Ga0495606_0008572_5742_6515 | 256 |
| 1072 | 3300046507 | Ga0495606_0017468 | Ga0495606_0017468_3150_3920 | 256 |
| 1073 | 3300046507 | Ga0495606_0021308 | Ga0495606_0021308_2272_3042 | 256 |
| 1074 | 3300046512 | Ga0495610_0003687 | Ga0495610_0003687_3899_4669 | 256 |
| 1075 | 3300046512 | Ga0495610_0004027 | Ga0495610_0004027_3608_4378 | 256 |
| 1076 | 3300046512 | Ga0495610_0007330 | Ga0495610_0007330_6036_6806 | 256 |
| 1077 | 3300046512 | Ga0495610_0008416 | Ga0495610_0008416_2682_3485 | 256 |
| 1078 | 3300046512 | Ga0495610_0011490 | Ga0495610_0011490_3310_4116 | 256 |
| 1079 | 3300046512 | Ga0495610_0014586 | Ga0495610_0014586_2123_2893 | 256 |
| 1080 | 3300046512 | Ga0495610_0015654 | Ga0495610_0015654_3539_4330 | 256 |
| 1081 | 3300046512 | Ga0495610_0023562 | Ga0495610_0023562_778_1548 | 256 |
| 1082 | 3300046512 | Ga0495610_0032725 | Ga0495610_0032725_1855_2625 | 256 |
| 1083 | 3300046513 | Ga0495616_0044969 | Ga0495616_0044969_1026_1796 | 256 |
| 1084 | 3300046513 | Ga0495616_0050447 | Ga0495616_0050447_493_1284 | 256 |
| 1085 | 3300046513 | Ga0495616_0064360 | Ga0495616_0064360_67_837 | 256 |
| 1086 | 3300046513 | Ga0495616_0120987 | Ga0495616_0120987_382_1152 | 256 |
| 1087 | 3300046515 | Ga0495620_0000023 | Ga0495620_0000023_21147_21938 | 256 |
| 1088 | 3300046515 | Ga0495620_0000108 | Ga0495620_0000108_33669_34475 | 256 |
| 1089 | 3300046515 | Ga0495620_0001719 | Ga0495620_0001719_8205_8975 | 256 |
| 1090 | 3300046515 | Ga0495620_0002090 | Ga0495620_0002090_3036_3827 | 256 |
| 1091 | 3300046515 | Ga0495620_0009332 | Ga0495620_0009332_3234_4004 | 256 |
| 1092 | 3300046515 | Ga0495620_0014190 | Ga0495620_0014190_3050_3841 | 256 |
| 1093 | 3300046515 | Ga0495620_0048260 | Ga0495620_0048260_495_1265 | 256 |
| 1094 | 3300046515 | Ga0495620_0052870 | Ga0495620_0052870_857_1648 | 256 |
| 1095 | 3300046517 | Ga0495630_0107281 | Ga0495630_0107281_947_1750 | 256 |
| 1096 | 3300046518 | Ga0495631_0001318 | Ga0495631_0001318_3582_4352 | 256 |
| 1097 | 3300046518 | Ga0495631_0002233 | Ga0495631_0002233_6568_7338 | 256 |
| 1098 | 3300046518 | Ga0495631_0002655 | Ga0495631_0002655_3320_4126 | 256 |
| 1099 | 3300046518 | Ga0495631_0006347 | Ga0495631_0006347_1819_2610 | 256 |
| 1100 | 3300046518 | Ga0495631_0026439 | Ga0495631_0026439_513_1283 | 256 |
| 1101 | 3300046518 | Ga0495631_0045974 | Ga0495631_0045974_1105_1875 | 256 |
| 1102 | 3300046518 | Ga0495631_0049399 | Ga0495631_0049399_353_1144 | 256 |
| 1103 | 3300046519 | Ga0495632_0001083 | Ga0495632_0001083_6498_7268 | 256 |
| 1104 | 3300046519 | Ga0495632_0001735 | Ga0495632_0001735_12913_13704 | 256 |
| 1105 | 3300046519 | Ga0495632_0001795 | Ga0495632_0001795_1993_2784 | 256 |
| 1106 | 3300046519 | Ga0495632_0002669 | Ga0495632_0002669_6410_7180 | 256 |
| 1107 | 3300046519 | Ga0495632_0004841 | Ga0495632_0004841_2739_3530 | 256 |
| 1108 | 3300046519 | Ga0495632_0004928 | Ga0495632_0004928_3619_4389 | 256 |
| 1109 | 3300046519 | Ga0495632_0055660 | Ga0495632_0055660_586_1356 | 256 |
| 1110 | 3300046519 | Ga0495632_0215176 | Ga0495632_0215176_69_839 | 256 |
| 1111 | 3300046520 | Ga0495637_0000054 | Ga0495637_0000054_77283_78074 | 256 |
| 1112 | 3300046520 | Ga0495637_0000194 | Ga0495637_0000194_19320_20090 | 256 |
| 1113 | 3300046520 | Ga0495637_0000269 | Ga0495637_0000269_21471_22262 | 256 |
| 1114 | 3300046520 | Ga0495637_0000466 | Ga0495637_0000466_19172_19942 | 256 |
| 1115 | 3300046520 | Ga0495637_0002490 | Ga0495637_0002490_3646_4416 | 256 |
| 1116 | 3300046520 | Ga0495637_0003116 | Ga0495637_0003116_4746_5516 | 256 |
| 1117 | 3300046520 | Ga0495637_0004382 | Ga0495637_0004382_3334_4140 | 256 |
| 1118 | 3300046520 | Ga0495637_0005192 | Ga0495637_0005192_2955_3725 | 256 |
| 1119 | 3300046520 | Ga0495637_0011746 | Ga0495637_0011746_1635_2405 | 256 |
| 1120 | 3300046520 | Ga0495637_0019417 | Ga0495637_0019417_1409_2179 | 256 |
| 1121 | 3300046520 | Ga0495637_0057374 | Ga0495637_0057374_765_1535 | 256 |
| 1122 | 3300046522 | Ga0495643_0000730 | Ga0495643_0000730_17382_18173 | 256 |
| 1123 | 3300046522 | Ga0495643_0001170 | Ga0495643_0001170_3489_4280 | 256 |
| 1124 | 3300046522 | Ga0495643_0015823 | Ga0495643_0015823_2995_3786 | 256 |
| 1125 | 3300046522 | Ga0495643_0018489 | Ga0495643_0018489_129_899 | 256 |
| 1126 | 3300046522 | Ga0495643_0052789 | Ga0495643_0052789_1191_1961 | 256 |
| 1127 | 3300046522 | Ga0495643_0075803 | Ga0495643_0075803_922_1692 | 256 |
| 1128 | 3300046523 | Ga0495644_0001554 | Ga0495644_0001554_6230_7021 | 256 |
| 1129 | 3300046523 | Ga0495644_0003019 | Ga0495644_0003019_4082_4852 | 256 |
| 1130 | 3300046523 | Ga0495644_0003287 | Ga0495644_0003287_3847_4617 | 256 |
| 1131 | 3300046524 | Ga0495648_0000783 | Ga0495648_0000783_23251_24042 | 256 |
| 1132 | 3300046524 | Ga0495648_0001858 | Ga0495648_0001858_15729_16499 | 256 |
| 1133 | 3300046524 | Ga0495648_0002460 | Ga0495648_0002460_3244_4035 | 256 |
| 1134 | 3300046524 | Ga0495648_0002748 | Ga0495648_0002748_12976_13782 | 256 |
| 1135 | 3300046524 | Ga0495648_0004730 | Ga0495648_0004730_1833_2603 | 256 |
| 1136 | 3300046524 | Ga0495648_0005172 | Ga0495648_0005172_5546_6337 | 256 |
| 1137 | 3300046524 | Ga0495648_0007923 | Ga0495648_0007923_3471_4241 | 256 |
| 1138 | 3300046524 | Ga0495648_0008056 | Ga0495648_0008056_3691_4461 | 256 |
| 1139 | 3300046524 | Ga0495648_0012578 | Ga0495648_0012578_2029_2835 | 256 |
| 1140 | 3300046524 | Ga0495648_0043672 | Ga0495648_0043672_946_1716 | 256 |
| 1141 | 3300046524 | Ga0495648_0113046 | Ga0495648_0113046_453_1223 | 256 |
| 1142 | 3300046524 | Ga0495648_0146522 | Ga0495648_0146522_418_1188 | 256 |
| 1143 | 3300046526 | Ga0495666_0001604 | Ga0495666_0001604_5392_6162 | 256 |
| 1144 | 3300046526 | Ga0495666_0008958 | Ga0495666_0008958_1997_2800 | 256 |
| 1145 | 3300046526 | Ga0495666_0036593 | Ga0495666_0036593_84_854 | 256 |
| 1146 | 3300046528 | Ga0495642_0000536 | Ga0495642_0000536_3857_4627 | 256 |
| 1147 | 3300046528 | Ga0495642_0001444 | Ga0495642_0001444_3346_4116 | 256 |
| 1148 | 3300046530 | Ga0495654_0000404 | Ga0495654_0000404_32816_33607 | 256 |
| 1149 | 3300046530 | Ga0495654_0001010 | Ga0495654_0001010_1297_2103 | 256 |
| 1150 | 3300046530 | Ga0495654_0001692 | Ga0495654_0001692_2791_3561 | 256 |
| 1151 | 3300046530 | Ga0495654_0005580 | Ga0495654_0005580_570_1340 | 256 |
| 1152 | 3300046530 | Ga0495654_0006844 | Ga0495654_0006844_1714_2484 | 256 |
| 1153 | 3300046530 | Ga0495654_0007375 | Ga0495654_0007375_3800_4570 | 256 |
| 1154 | 3300046530 | Ga0495654_0007795 | Ga0495654_0007795_1701_2471 | 256 |
| 1155 | 3300046530 | Ga0495654_0031295 | Ga0495654_0031295_1873_2643 | 256 |
| 1156 | 3300046530 | Ga0495654_0032061 | Ga0495654_0032061_1860_2630 | 256 |
| 1157 | 3300046536 | Ga0495587_0003520 | Ga0495587_0003520_2357_3127 | 256 |
| 1158 | 3300046538 | Ga0495609_0000061 | Ga0495609_0000061_21455_22246 | 256 |
| 1159 | 3300046538 | Ga0495609_0000101 | Ga0495609_0000101_33646_34452 | 256 |
| 1160 | 3300046538 | Ga0495609_0000696 | Ga0495609_0000696_3299_4069 | 256 |
| 1161 | 3300046538 | Ga0495609_0004755 | Ga0495609_0004755_920_1690 | 256 |
| 1162 | 3300046538 | Ga0495609_0005878 | Ga0495609_0005878_1191_1961 | 256 |
| 1163 | 3300046538 | Ga0495609_0009579 | Ga0495609_0009579_3843_4613 | 256 |
| 1164 | 3300046538 | Ga0495609_0062227 | Ga0495609_0062227_670_1476 | 256 |
| 1165 | 3300046542 | Ga0495597_0009099 | Ga0495597_0009099_2354_3124 | 256 |
| 1166 | 3300046542 | Ga0495597_0011291 | Ga0495597_0011291_1477_2247 | 256 |
| 1167 | 3300046542 | Ga0495597_0030031 | Ga0495597_0030031_570_1340 | 256 |
| 1168 | 3300046542 | Ga0495597_0059307 | Ga0495597_0059307_739_1530 | 256 |
| 1169 | 3300046557 | Ga0495622_0001089 | Ga0495622_0001089_9143_9913 | 256 |
| 1170 | 3300046557 | Ga0495622_0001805 | Ga0495622_0001805_6622_7392 | 256 |
| 1171 | 3300046557 | Ga0495622_0009631 | Ga0495622_0009631_3255_4025 | 256 |
| 1172 | 3300046557 | Ga0495622_0010425 | Ga0495622_0010425_1630_2400 | 256 |
| 1173 | 3300046557 | Ga0495622_0060819 | Ga0495622_0060819_163_954 | 256 |
| 1174 | 3300046558 | Ga0495633_0000129 | Ga0495633_0000129_66317_67123 | 256 |
| 1175 | 3300046558 | Ga0495633_0003624 | Ga0495633_0003624_7425_8195 | 256 |
| 1176 | 3300046616 | Ga0495668_0008651 | Ga0495668_0008651_4420_5190 | 256 |
| 1177 | 3300046616 | Ga0495668_0017023 | Ga0495668_0017023_2392_3183 | 256 |
| 1178 | 3300046616 | Ga0495668_0024129 | Ga0495668_0024129_2620_3411 | 256 |
| 1179 | 3300046642 | Ga0495634_0005870 | Ga0495634_0005870_3898_4701 | 256 |
| 1180 | 3300046648 | Ga0495611_0000525 | Ga0495611_0000525_19140_19931 | 256 |
| 1181 | 3300046648 | Ga0495611_0000571 | Ga0495611_0000571_3731_4501 | 256 |
| 1182 | 3300046648 | Ga0495611_0001821 | Ga0495611_0001821_280_1086 | 256 |
| 1183 | 3300046648 | Ga0495611_0012098 | Ga0495611_0012098_1764_2555 | 256 |
| 1184 | 3300046648 | Ga0495611_0013014 | Ga0495611_0013014_282_1052 | 256 |
| 1185 | 3300046660 | Ga0495625_0000147 | Ga0495625_0000147_21597_22388 | 256 |
| 1186 | 3300046660 | Ga0495625_0010589 | Ga0495625_0010589_756_1526 | 256 |
| 1187 | 3300046660 | Ga0495625_0022435 | Ga0495625_0022435_3509_4279 | 256 |
| 1188 | 3300046660 | Ga0495625_0023226 | Ga0495625_0023226_2041_2811 | 256 |
| 1189 | 3300046663 | Ga0495635_0000583 | Ga0495635_0000583_15358_16128 | 256 |
| 1190 | 3300046663 | Ga0495635_0012360 | Ga0495635_0012360_3776_4579 | 256 |
| 1191 | 3300046664 | Ga0495659_0000380 | Ga0495659_0000380_16271_17041 | 256 |
| 1192 | 3300046665 | Ga0495661_0000153 | Ga0495661_0000153_21612_22403 | 256 |
| 1193 | 3300046665 | Ga0495661_0000196 | Ga0495661_0000196_33703_34509 | 256 |
| 1194 | 3300046665 | Ga0495661_0000484 | Ga0495661_0000484_19138_19908 | 256 |
| 1195 | 3300046665 | Ga0495661_0001727 | Ga0495661_0001727_9555_10346 | 256 |
| 1196 | 3300046665 | Ga0495661_0023738 | Ga0495661_0023738_1021_1791 | 256 |
| 1197 | 3300046665 | Ga0495661_0042494 | Ga0495661_0042494_49_819 | 256 |
| 1198 | 3300046665 | Ga0495661_0137531 | Ga0495661_0137531_441_1211 | 256 |
| 1199 | 3300046674 | Ga0495588_0045613 | Ga0495588_0045613_1034_1804 | 256 |
| 1200 | 3300046679 | Ga0495623_0017742 | Ga0495623_0017742_72_875 | 256 |
| 1201 | 3300046680 | Ga0495646_0039662 | Ga0495646_0039662_801_1604 | 256 |
| 1202 | 3300046684 | Ga0495669_0014877 | Ga0495669_0014877_67_837 | 256 |
| 1203 | 3300046690 | Ga0495624_0003816 | Ga0495624_0003816_3716_4486 | 256 |
| 1204 | 3300046691 | Ga0495670_0000388 | Ga0495670_0000388_3656_4426 | 256 |
| 1205 | 3300046691 | Ga0495670_0001561 | Ga0495670_0001561_4173_4943 | 256 |
| 1206 | 3300046691 | Ga0495670_0003729 | Ga0495670_0003729_5078_5848 | 256 |
| 1207 | 3300046691 | Ga0495670_0013134 | Ga0495670_0013134_12_782 | 256 |
| 1208 | 3300046691 | Ga0495670_0033110 | Ga0495670_0033110_1775_2545 | 256 |
| 1209 | 3300046692 | Ga0495671_0000471 | Ga0495671_0000471_25273_26043 | 256 |
| 1210 | 3300046692 | Ga0495671_0001900 | Ga0495671_0001900_945_1751 | 256 |
| 1211 | 3300046692 | Ga0495671_0003438 | Ga0495671_0003438_6159_6965 | 256 |
| 1212 | 3300046692 | Ga0495671_0007329 | Ga0495671_0007329_5219_6010 | 256 |
| 1213 | 3300046692 | Ga0495671_0009812 | Ga0495671_0009812_384_1154 | 256 |
| 1214 | 3300046692 | Ga0495671_0010835 | Ga0495671_0010835_2914_3684 | 256 |
| 1215 | 3300046692 | Ga0495671_0034401 | Ga0495671_0034401_119_889 | 256 |
| 1216 | 3300046692 | Ga0495671_0135720 | Ga0495671_0135720_401_1171 | 256 |
| 1217 | 3300046694 | Ga0495649_0000968 | Ga0495649_0000968_385_1155 | 256 |
| 1218 | 3300046694 | Ga0495649_0001584 | Ga0495649_0001584_11460_12230 | 256 |
| 1219 | 3300046694 | Ga0495649_0007483 | Ga0495649_0007483_3826_4617 | 256 |
| 1220 | 3300046694 | Ga0495649_0027028 | Ga0495649_0027028_1346_2116 | 256 |
| 1221 | 3300046694 | Ga0495649_0031798 | Ga0495649_0031798_1922_2692 | 256 |
| 1222 | 3300046694 | Ga0495649_0053755 | Ga0495649_0053755_1073_1843 | 256 |
| 1223 | 3300046794 | Ga0495589_0000668 | Ga0495589_0000668_5638_6408 | 256 |
| 1224 | 3300046794 | Ga0495589_0002719 | Ga0495589_0002719_1667_2473 | 256 |
| 1225 | 3300046794 | Ga0495589_0011005 | Ga0495589_0011005_3533_4336 | 256 |
| 1226 | 3300046794 | Ga0495589_0034990 | Ga0495589_0034990_1727_2497 | 256 |
| 1227 | 3300046794 | Ga0495589_0039482 | Ga0495589_0039482_431_1201 | 256 |
| 1228 | 3300046809 | Ga0495600_0038322 | Ga0495600_0038322_945_1715 | 256 |
| 1229 | 3300046810 | Ga0495660_0002451 | Ga0495660_0002451_3199_4005 | 256 |
| 1230 | 3300046810 | Ga0495660_0005838 | Ga0495660_0005838_3752_4543 | 256 |
| 1231 | 3300046810 | Ga0495660_0007185 | Ga0495660_0007185_2825_3595 | 256 |
| 1232 | 3300046810 | Ga0495660_0009508 | Ga0495660_0009508_1712_2503 | 256 |
| 1233 | 3300046810 | Ga0495660_0010383 | Ga0495660_0010383_4634_5404 | 256 |
| 1234 | 3300046810 | Ga0495660_0070127 | Ga0495660_0070127_596_1366 | 256 |
| 1235 | 3300046810 | Ga0495660_0139177 | Ga0495660_0139177_125_895 | 256 |
| 1236 | 3300046810 | Ga0495660_0166390 | Ga0495660_0166390_247_1017 | 256 |
| 1237 | 3300047317 | Ga0495604_0010664 | Ga0495604_0010664_4999_5769 | 256 |
| 1238 | 3300047317 | Ga0495604_0033515 | Ga0495604_0033515_352_1155 | 256 |
| 1239 | 3300047318 | Ga0495636_0013676 | Ga0495636_0013676_2067_2837 | 256 |
| 1240 | 3300047318 | Ga0495636_0116008 | Ga0495636_0116008_185_955 | 256 |
| 1241 | 3300047320 | Ga0495672_0003447 | Ga0495672_0003447_3266_4036 | 256 |
| 1242 | 3300047320 | Ga0495672_0004628 | Ga0495672_0004628_6639_7409 | 256 |
| 1243 | 3300047320 | Ga0495672_0005323 | Ga0495672_0005323_3688_4491 | 256 |
| 1244 | 3300047320 | Ga0495672_0005353 | Ga0495672_0005353_6082_6873 | 256 |
| 1245 | 3300047320 | Ga0495672_0007677 | Ga0495672_0007677_3627_4397 | 256 |
| 1246 | 3300047320 | Ga0495672_0008665 | Ga0495672_0008665_874_1644 | 256 |
| 1247 | 3300047320 | Ga0495672_0009374 | Ga0495672_0009374_2086_2889 | 256 |
| 1248 | 3300047320 | Ga0495672_0012649 | Ga0495672_0012649_3855_4625 | 256 |
| 1249 | 3300047320 | Ga0495672_0013767 | Ga0495672_0013767_3816_4586 | 256 |
| 1250 | 3300047320 | Ga0495672_0027993 | Ga0495672_0027993_935_1741 | 256 |
| 1251 | 3300047321 | Ga0495676_0000027 | Ga0495676_0000027_119415_120206 | 256 |
| 1252 | 3300047321 | Ga0495676_0017673 | Ga0495676_0017673_1657_2427 | 256 |
| 1253 | 3300047322 | Ga0495680_0005758 | Ga0495680_0005758_10600_11370 | 256 |
| 1254 | 3300047322 | Ga0495680_0033959 | Ga0495680_0033959_1648_2451 | 256 |
| 1255 | 3300047323 | Ga0495683_0000075 | Ga0495683_0000075_33578_34384 | 256 |
| 1256 | 3300047323 | Ga0495683_0001303 | Ga0495683_0001303_3267_4037 | 256 |
| 1257 | 3300047323 | Ga0495683_0001374 | Ga0495683_0001374_10772_11542 | 256 |
| 1258 | 3300047323 | Ga0495683_0030110 | Ga0495683_0030110_426_1196 | 256 |
| 1259 | 3300047323 | Ga0495683_0033942 | Ga0495683_0033942_711_1481 | 256 |
| 1260 | 3300047323 | Ga0495683_0146379 | Ga0495683_0146379_305_1075 | 256 |
| 1261 | 3300047443 | Ga0495687_004754 | Ga0495687_004754_7506_8276 | 256 |
| 1262 | 3300047443 | Ga0495687_027947 | Ga0495687_027947_1286_2056 | 256 |
| 1263 | 3300047443 | Ga0495687_028807 | Ga0495687_028807_1698_2468 | 256 |
| 1264 | 3300047444 | Ga0495675_0025096 | Ga0495675_0025096_1500_2270 | 256 |
| 1265 | 3300047446 | Ga0495679_000237 | Ga0495679_000237_21603_22394 | 256 |
| 1266 | 3300047446 | Ga0495679_000792 | Ga0495679_000792_13412_14218 | 256 |
| 1267 | 3300047446 | Ga0495679_028365 | Ga0495679_028365_417_1217 | 256 |
| 1268 | 3300047469 | Ga0495673_0001628 | Ga0495673_0001628_15246_16016 | 256 |
| 1269 | 3300047469 | Ga0495673_0001807 | Ga0495673_0001807_3211_4002 | 256 |
| 1270 | 3300047469 | Ga0495673_0003384 | Ga0495673_0003384_3147_3938 | 256 |
| 1271 | 3300047469 | Ga0495673_0003463 | Ga0495673_0003463_3959_4729 | 256 |
| 1272 | 3300047469 | Ga0495673_0003817 | Ga0495673_0003817_4442_5212 | 256 |
| 1273 | 3300047469 | Ga0495673_0005394 | Ga0495673_0005394_6879_7670 | 256 |
| 1274 | 3300047469 | Ga0495673_0006066 | Ga0495673_0006066_5888_6658 | 256 |
| 1275 | 3300047469 | Ga0495673_0007335 | Ga0495673_0007335_1692_2483 | 256 |
| 1276 | 3300047469 | Ga0495673_0020644 | Ga0495673_0020644_1553_2323 | 256 |
| 1277 | 3300047469 | Ga0495673_0022022 | Ga0495673_0022022_1185_1991 | 256 |
| 1278 | 3300047469 | Ga0495673_0066546 | Ga0495673_0066546_75_845 | 256 |
| 1279 | 3300047470 | Ga0495681_0003081 | Ga0495681_0003081_3350_4120 | 256 |
| 1280 | 3300047470 | Ga0495681_0003215 | Ga0495681_0003215_7228_8019 | 256 |
| 1281 | 3300047470 | Ga0495681_0004733 | Ga0495681_0004733_2825_3595 | 256 |
| 1282 | 3300047470 | Ga0495681_0004777 | Ga0495681_0004777_561_1331 | 256 |
| 1283 | 3300047470 | Ga0495681_0006728 | Ga0495681_0006728_23_793 | 256 |
| 1284 | 3300047470 | Ga0495681_0009405 | Ga0495681_0009405_3548_4318 | 256 |
| 1285 | 3300047470 | Ga0495681_0009407 | Ga0495681_0009407_2989_3759 | 256 |
| 1286 | 3300047470 | Ga0495681_0031089 | Ga0495681_0031089_1615_2385 | 256 |
| 1287 | 3300047470 | Ga0495681_0033287 | Ga0495681_0033287_569_1339 | 256 |
| 1288 | 3300047470 | Ga0495681_0116910 | Ga0495681_0116910_161_931 | 256 |
| 1289 | 3300047472 | Ga0495686_0005925 | Ga0495686_0005925_6391_7194 | 256 |
| 1290 | 3300047472 | Ga0495686_0026529 | Ga0495686_0026529_836_1606 | 256 |
| 1291 | 3300048091 | Ga0495626_0000067 | Ga0495626_0000067_117706_118497 | 256 |
| 1292 | 3300048091 | Ga0495626_0000507 | Ga0495626_0000507_26961_27731 | 256 |
| 1293 | 3300048091 | Ga0495626_0000684 | Ga0495626_0000684_27293_28063 | 256 |
| 1294 | 3300048091 | Ga0495626_0000996 | Ga0495626_0000996_16301_17071 | 256 |
| 1295 | 3300048091 | Ga0495626_0001171 | Ga0495626_0001171_17007_17777 | 256 |
| 1296 | 3300048091 | Ga0495626_0001627 | Ga0495626_0001627_16115_16885 | 256 |
| 1297 | 3300048091 | Ga0495626_0008526 | Ga0495626_0008526_2189_2959 | 256 |
| 1298 | 3300048091 | Ga0495626_0018825 | Ga0495626_0018825_801_1571 | 256 |
| 1299 | 3300048091 | Ga0495626_0059201 | Ga0495626_0059201_496_1266 | 256 |
| 1300 | 3300048904 | Ga0496101_0141962 | Ga0496101_0141962_323_1216 | 256 |
| 1301 | 3300048905 | Ga0496102_0001259 | Ga0496102_0001259_16847_17650 | 256 |
| 1302 | 3300048905 | Ga0496102_0067249 | Ga0496102_0067249_2124_2915 | 256 |
| 1303 | 3300048906 | Ga0496103_0005569 | Ga0496103_0005569_4597_5400 | 256 |
| 1304 | 3300048907 | Ga0496104_0011028 | Ga0496104_0011028_2557_3357 | 256 |
| 1305 | 3300048908 | Ga0496105_0141507 | Ga0496105_0141507_97_897 | 256 |
| 1306 | 3300048908 | Ga0496105_0402718 | Ga0496105_0402718_287_1057 | 256 |
| 1307 | 3300048909 | Ga0496106_0141442 | Ga0496106_0141442_257_1150 | 256 |
| 1308 | 3300048915 | Ga0496112_0597880 | Ga0496112_0597880_148_918 | 256 |
| 1309 | 3300048917 | Ga0496114_0023930 | Ga0496114_0023930_1905_2699 | 256 |
| 1310 | 3300048917 | Ga0496114_0024009 | Ga0496114_0024009_2443_3234 | 256 |
| 1311 | 3300048919 | Ga0496116_0000242 | Ga0496116_0000242_16342_17145 | 256 |
| 1312 | 3300048919 | Ga0496116_0001670 | Ga0496116_0001670_16318_17088 | 256 |
| 1313 | 3300048919 | Ga0496116_0002076 | Ga0496116_0002076_16718_17488 | 256 |
| 1314 | 3300048919 | Ga0496116_0007060 | Ga0496116_0007060_2861_3652 | 256 |
| 1315 | 3300048919 | Ga0496116_0033922 | Ga0496116_0033922_1535_2338 | 256 |
| 1316 | 3300048920 | Ga0496117_0000270 | Ga0496117_0000270_16347_17150 | 256 |
| 1317 | 3300048920 | Ga0496117_0000932 | Ga0496117_0000932_7686_8489 | 256 |
| 1318 | 3300048920 | Ga0496117_0002067 | Ga0496117_0002067_7872_8663 | 256 |
| 1319 | 3300048920 | Ga0496117_0007272 | Ga0496117_0007272_6161_6955 | 256 |
| 1320 | 3300048920 | Ga0496117_0007848 | Ga0496117_0007848_3381_4172 | 256 |
| 1321 | 3300048920 | Ga0496117_0018282 | Ga0496117_0018282_3735_4535 | 256 |
| 1322 | 3300048920 | Ga0496117_0061121 | Ga0496117_0061121_120_890 | 256 |
| 1323 | 3300048920 | Ga0496117_0081529 | Ga0496117_0081529_14_817 | 256 |
| 1324 | 3300048920 | Ga0496117_0105827 | Ga0496117_0105827_786_1577 | 256 |
| 1325 | 3300048921 | Ga0496118_0001862 | Ga0496118_0001862_24448_25248 | 256 |
| 1326 | 3300048921 | Ga0496118_0007945 | Ga0496118_0007945_6384_7178 | 256 |
| 1327 | 3300048921 | Ga0496118_0010933 | Ga0496118_0010933_2006_2797 | 256 |
| 1328 | 3300048921 | Ga0496118_0018613 | Ga0496118_0018613_2514_3305 | 256 |
| 1329 | 3300048921 | Ga0496118_0018851 | Ga0496118_0018851_1537_2340 | 256 |
| 1330 | 3300048921 | Ga0496118_0061091 | Ga0496118_0061091_1972_2742 | 256 |
| 1331 | 3300048921 | Ga0496118_0081215 | Ga0496118_0081215_1470_2240 | 256 |
| 1332 | 3300048921 | Ga0496118_0082230 | Ga0496118_0082230_546_1349 | 256 |
| 1333 | 3300048922 | Ga0496119_0000230 | Ga0496119_0000230_35006_35806 | 256 |
| 1334 | 3300048923 | Ga0496120_0000324 | Ga0496120_0000324_38173_38973 | 256 |
| 1335 | 3300048923 | Ga0496120_0004336 | Ga0496120_0004336_7626_8429 | 256 |
| 1336 | 3300048923 | Ga0496120_0016350 | Ga0496120_0016350_749_1519 | 256 |
| 1337 | 3300048924 | Ga0496121_0000318 | Ga0496121_0000318_83681_84484 | 256 |
| 1338 | 3300048924 | Ga0496121_0010903 | Ga0496121_0010903_1839_2630 | 256 |
| 1339 | 3300048924 | Ga0496121_0029160 | Ga0496121_0029160_1547_2338 | 256 |
| 1340 | 3300048924 | Ga0496121_0041549 | Ga0496121_0041549_2085_2855 | 256 |
| 1341 | 3300048924 | Ga0496121_0047928 | Ga0496121_0047928_2829_3599 | 256 |
| 1342 | 3300048924 | Ga0496121_0080949 | Ga0496121_0080949_857_1648 | 256 |
| 1343 | 3300048925 | Ga0496122_0000517 | Ga0496122_0000517_57231_58022 | 256 |
| 1344 | 3300048925 | Ga0496122_0002629 | Ga0496122_0002629_2847_3641 | 256 |
| 1345 | 3300048925 | Ga0496122_0007631 | Ga0496122_0007631_7318_8088 | 256 |
| 1346 | 3300048925 | Ga0496122_0010252 | Ga0496122_0010252_4925_5731 | 256 |
| 1347 | 3300048925 | Ga0496122_0018736 | Ga0496122_0018736_2094_2864 | 256 |
| 1348 | 3300048925 | Ga0496122_0019577 | Ga0496122_0019577_2322_3113 | 256 |
| 1349 | 3300048925 | Ga0496122_0116564 | Ga0496122_0116564_177_968 | 256 |
| 1350 | 3300048926 | Ga0496123_0000243 | Ga0496123_0000243_21869_22660 | 256 |
| 1351 | 3300048926 | Ga0496123_0007055 | Ga0496123_0007055_7897_8691 | 256 |
| 1352 | 3300048926 | Ga0496123_0016801 | Ga0496123_0016801_1814_2605 | 256 |
| 1353 | 3300048926 | Ga0496123_0049421 | Ga0496123_0049421_1216_2016 | 256 |
| 1354 | 3300048927 | Ga0496124_0000511 | Ga0496124_0000511_21504_22310 | 256 |
| 1355 | 3300048927 | Ga0496124_0001467 | Ga0496124_0001467_26250_27041 | 256 |
| 1356 | 3300048927 | Ga0496124_0001534 | Ga0496124_0001534_29310_30104 | 256 |
| 1357 | 3300048927 | Ga0496124_0002260 | Ga0496124_0002260_16341_17111 | 256 |
| 1358 | 3300048927 | Ga0496124_0002328 | Ga0496124_0002328_6674_7465 | 256 |
| 1359 | 3300048927 | Ga0496124_0007063 | Ga0496124_0007063_7654_8457 | 256 |
| 1360 | 3300048927 | Ga0496124_0026136 | Ga0496124_0026136_2184_2969 | 256 |
| 1361 | 3300048927 | Ga0496124_0044157 | Ga0496124_0044157_1270_2061 | 256 |
| 1362 | 3300048927 | Ga0496124_0083275 | Ga0496124_0083275_204_995 | 256 |
| 1363 | 3300048927 | Ga0496124_0204528 | Ga0496124_0204528_10_780 | 256 |
| 1364 | 3300048928 | Ga0496125_0000971 | Ga0496125_0000971_36300_37103 | 256 |
| 1365 | 3300048928 | Ga0496125_0002177 | Ga0496125_0002177_21604_22395 | 256 |
| 1366 | 3300048928 | Ga0496125_0005751 | Ga0496125_0005751_9359_10129 | 256 |
| 1367 | 3300048928 | Ga0496125_0006705 | Ga0496125_0006705_7447_8217 | 256 |
| 1368 | 3300048928 | Ga0496125_0024125 | Ga0496125_0024125_2312_3103 | 256 |
| 1369 | 3300048928 | Ga0496125_0097616 | Ga0496125_0097616_474_1244 | 256 |
| 1370 | 3300048928 | Ga0496125_0136412 | Ga0496125_0136412_343_1137 | 256 |
| 1371 | 3300048929 | Ga0496126_0032825 | Ga0496126_0032825_3093_3884 | 256 |
| 1372 | 3300048929 | Ga0496126_0036273 | Ga0496126_0036273_2487_3290 | 256 |
| 1373 | 3300048929 | Ga0496126_0053094 | Ga0496126_0053094_1313_2116 | 256 |
| 1374 | 3300048929 | Ga0496126_0234714 | Ga0496126_0234714_711_1511 | 256 |
| 1375 | 3300049459 | Ga0495678_000106 | Ga0495678_000106_33622_34428 | 256 |
| 1376 | 3300049459 | Ga0495678_000499 | Ga0495678_000499_21471_22262 | 256 |
| 1377 | 3300049459 | Ga0495678_000694 | Ga0495678_000694_14559_15329 | 256 |
| 1378 | 3300049459 | Ga0495678_003175 | Ga0495678_003175_3912_4682 | 256 |
| 1379 | 3300049459 | Ga0495678_003193 | Ga0495678_003193_3678_4448 | 256 |
| 1380 | 3300049459 | Ga0495678_005483 | Ga0495678_005483_1806_2576 | 256 |
| 1381 | 3300049459 | Ga0495678_010464 | Ga0495678_010464_2125_2895 | 256 |
| 1382 | 3300049459 | Ga0495678_051038 | Ga0495678_051038_337_1107 | 256 |
| 1383 | 3300049460 | Ga0495682_0000069 | Ga0495682_0000069_72461_73264 | 256 |
| 1384 | 3300049460 | Ga0495682_0000804 | Ga0495682_0000804_15451_16242 | 256 |
| 1385 | 3300049460 | Ga0495682_0004192 | Ga0495682_0004192_3850_4620 | 256 |
| 1386 | 3300049460 | Ga0495682_0012679 | Ga0495682_0012679_786_1592 | 256 |
| 1387 | 3300049460 | Ga0495682_0019649 | Ga0495682_0019649_340_1110 | 256 |
| 1388 | 3300049569 | Ga0501032_0003622 | Ga0501032_0003622_7952_8740 | 256 |
| 1389 | 3300049571 | Ga0501034_0000164 | Ga0501034_0000164_102983_103774 | 256 |
| 1390 | 3300049571 | Ga0501034_0047534 | Ga0501034_0047534_3398_4186 | 256 |
| 1391 | 3300049571 | Ga0501034_0179869 | Ga0501034_0179869_803_1690 | 256 |
| 1392 | 3300049572 | Ga0501036_0059760 | Ga0501036_0059760_2006_2893 | 256 |
| 1393 | 3300049573 | Ga0501037_0039003 | Ga0501037_0039003_1504_2391 | 256 |
| 1394 | 3300049573 | Ga0501037_0105525 | Ga0501037_0105525_797_1585 | 256 |
| 1395 | 3300049575 | Ga0501039_0106853 | Ga0501039_0106853_509_1297 | 256 |
| 1396 | 3300049758 | Ga0501241_000367 | Ga0501241_000367_41_844 | 256 |
| 1397 | 3300049822 | Ga0501035_0360481 | Ga0501035_0360481_331_1122 | 256 |
| 1398 | 3300049823 | Ga0501044_0153126 | Ga0501044_0153126_692_1579 | 256 |
| 1399 | 3300050491 | nmdc:mga00v17_281_c1 | nmdc:mga00v17_281_c1_20594_21394 | 256 |
| 1400 | 3300050514 | nmdc:mga08x19_218914_c1 | nmdc:mga08x19_218914_c1_516_1286 | 256 |
| 1401 | 3300053135 | Ga0500659_0002369 | Ga0500659_0002369_7458_8249 | 256 |
| 1402 | iso_pu_bacteria | 2511231006 | 2511264707 | 256 |
| 1403 | iso_pu_bacteria | 2511231007 | 2511274358 | 256 |
| 1404 | iso_pu_bacteria | 2511231008 | 2511279877 | 256 |
| 1405 | iso_pu_bacteria | 2511231010 | 2511289676 | 256 |
| 1406 | iso_pu_bacteria | 2511231011 | 2511294619 | 256 |
| 1407 | iso_pu_bacteria | 2511231012 | 2511298914 | 256 |
| 1408 | iso_pu_bacteria | 2511231014 | 2511316653 | 256 |
| 1409 | iso_pu_bacteria | 2511231015 | 2511322229 | 256 |
| 1410 | iso_pu_bacteria | 2511231016 | 2511325259 | 256 |
| 1411 | iso_pu_bacteria | 2511231017 | 2511332243 | 256 |
| 1412 | iso_pu_bacteria | 2511231018 | 2511337679 | 256 |
| 1413 | iso_pu_bacteria | 2511231019 | 2511347423 | 256 |
| 1414 | iso_pu_bacteria | 2511231020 | 2511348017 | 256 |
| 1415 | iso_pu_bacteria | 2511231021 | 2511359161 | 256 |
| 1416 | iso_pu_bacteria | 2511231022 | 2511366119 | 256 |
| 1417 | iso_pu_bacteria | 2511231023 | 2511370485 | 256 |
| 1418 | iso_pu_bacteria | 2511231024 | 2511374111 | 256 |
| 1419 | iso_pu_bacteria | 2511231031 | 2511412436 | 256 |
| 1420 | iso_pu_bacteria | 2511231156 | 2511822028 | 256 |
| 1421 | iso_pu_bacteria | 2512047018 | 2512325220 | 256 |
| 1422 | iso_pu_bacteria | 2554235231 | 2555245324 | 256 |
| 1423 | iso_pu_bacteria | 2554235341 | 2555667039 | 256 |
| 1424 | iso_pu_bacteria | 2582580891 | 2583795318 | 256 |
| 1425 | iso_pu_bacteria | 2597489887 | 2597855290 | 256 |
| 1426 | iso_pu_bacteria | 2597489888 | 2597861291 | 256 |
| 1427 | iso_pu_bacteria | 2597489889 | 2597867038 | 256 |
| 1428 | iso_pu_bacteria | 2599185160 | 2599355552 | 256 |
| 1429 | iso_pu_bacteria | 2599185161 | 2599363045 | 256 |
| 1430 | iso_pu_bacteria | 2599185162 | 2599368649 | 256 |
| 1431 | iso_pu_bacteria | 2599185163 | 2599376154 | 256 |
| 1432 | iso_pu_bacteria | 2599185164 | 2599380658 | 256 |
| 1433 | iso_pu_bacteria | 2599185165 | 2599387826 | 256 |
| 1434 | iso_pu_bacteria | 2599185166 | 2599395012 | 256 |
| 1435 | iso_pu_bacteria | 2599185167 | 2599401178 | 256 |
| 1436 | iso_pu_bacteria | 2599185168 | 2599406777 | 256 |
| 1437 | iso_pu_bacteria | 2599185179 | 2599449489 | 256 |
| 1438 | iso_pu_bacteria | 2599185181 | 2599462386 | 256 |
| 1439 | iso_pu_bacteria | 2599185182 | 2599468191 | 256 |
| 1440 | iso_pu_bacteria | 2599185185 | 2599487416 | 256 |
| 1441 | iso_pu_bacteria | 2599185186 | 2599491403 | 256 |
| 1442 | iso_pu_bacteria | 2599185188 | 2599503809 | 256 |
| 1443 | iso_pu_bacteria | 2599185189 | 2599506117 | 256 |
| 1444 | iso_pu_bacteria | 2599185190 | 2599511561 | 256 |
| 1445 | iso_pu_bacteria | 2599185191 | 2599516535 | 256 |
| 1446 | iso_pu_bacteria | 2599185212 | 2599612602 | 256 |
| 1447 | iso_pu_bacteria | 2599185248 | 2599767796 | 256 |
| 1448 | iso_pu_bacteria | 2599185257 | 2599804228 | 256 |
| 1449 | iso_pu_bacteria | 2599185288 | 2599879412 | 256 |
| 1450 | iso_pu_bacteria | 2599185289 | 2599887887 | 256 |
| 1451 | iso_pu_bacteria | 2599185290 | 2599893064 | 256 |
| 1452 | iso_pu_bacteria | 2599185291 | 2599899422 | 256 |
| 1453 | iso_pu_bacteria | 2599185300 | 2599933242 | 256 |
| 1454 | iso_pu_bacteria | 2599185302 | 2599942009 | 256 |
| 1455 | iso_pu_bacteria | 2599185303 | 2599948642 | 256 |
| 1456 | iso_pu_bacteria | 2599185304 | 2599954990 | 256 |
| 1457 | iso_pu_bacteria | 2599185305 | 2599963555 | 256 |
| 1458 | iso_pu_bacteria | 2599185306 | 2599966418 | 256 |
| 1459 | iso_pu_bacteria | 2599185307 | 2599975260 | 256 |
| 1460 | iso_pu_bacteria | 2599185308 | 2599977267 | 256 |
| 1461 | iso_pu_bacteria | 2599185309 | 2599986297 | 256 |
| 1462 | iso_pu_bacteria | 2599185310 | 2599991350 | 256 |
| 1463 | iso_pu_bacteria | 2599185311 | 2599995157 | 256 |
| 1464 | iso_pu_bacteria | 2599185312 | 2600000821 | 256 |
| 1465 | iso_pu_bacteria | 2599185313 | 2600007479 | 256 |
| 1466 | iso_pu_bacteria | 2599185314 | 2600011300 | 256 |
| 1467 | iso_pu_bacteria | 2599185315 | 2600020220 | 256 |
| 1468 | iso_pu_bacteria | 2599185316 | 2600026583 | 256 |
| 1469 | iso_pu_bacteria | 2599185317 | 2600029535 | 256 |
| 1470 | iso_pu_bacteria | 2599185318 | 2600037613 | 256 |
| 1471 | iso_pu_bacteria | 2599185319 | 2600044259 | 256 |
| 1472 | iso_pu_bacteria | 2599185320 | 2600050041 | 256 |
| 1473 | iso_pu_bacteria | 2599185321 | 2600054711 | 256 |
| 1474 | iso_pu_bacteria | 2599185322 | 2600059884 | 256 |
| 1475 | iso_pu_bacteria | 2599185323 | 2600065313 | 256 |
| 1476 | iso_pu_bacteria | 2599185324 | 2600073254 | 256 |
| 1477 | iso_pu_bacteria | 2599185325 | 2600078975 | 256 |
| 1478 | iso_pu_bacteria | 2599185356 | 2600215008 | 256 |
| 1479 | iso_pu_bacteria | 2600254930 | 2600358781 | 256 |
| 1480 | iso_pu_bacteria | 2600254931 | 2600363099 | 256 |
| 1481 | iso_pu_bacteria | 2600254954 | 2600444059 | 256 |
| 1482 | iso_pu_bacteria | 2600255283 | 2601627776 | 256 |
| 1483 | iso_pu_bacteria | 2600255296 | 2601693365 | 256 |
| 1484 | iso_pu_bacteria | 2600255313 | 2601775174 | 256 |
| 1485 | iso_pu_bacteria | 2600255318 | 2601798179 | 256 |
| 1486 | iso_pu_bacteria | 2600255389 | 2602008456 | 256 |
| 1487 | iso_pu_bacteria | 2603880185 | 2606077067 | 256 |
| 1488 | iso_pu_bacteria | 2603880199 | 2606129687 | 256 |
| 1489 | iso_pu_bacteria | 2619619299 | 2621296454 | 256 |
| 1490 | iso_pu_bacteria | 2623620443 | 2624477816 | 256 |
| 1491 | iso_pu_bacteria | 2623620446 | 2624489394 | 256 |
| 1492 | iso_pu_bacteria | 2636415599 | 2637222601 | 256 |
| 1493 | iso_pu_bacteria | 2643221565 | 2643843160 | 256 |
| 1494 | iso_pu_bacteria | 2643221571 | 2643873580 | 256 |
| 1495 | iso_pu_bacteria | 2643221589 | 2643956028 | 256 |
| 1496 | iso_pu_bacteria | 2643221602 | 2644020150 | 256 |
| 1497 | iso_pu_bacteria | 2643221633 | 2644184160 | 256 |
| 1498 | iso_pu_bacteria | 2643221650 | 2644282868 | 256 |
| 1499 | iso_pu_bacteria | 2643221713 | 2644619829 | 256 |
| 1500 | iso_pu_bacteria | 2643221713 | 2644624403 | 256 |
| 1501 | iso_pu_bacteria | 2667528170 | 2671091926 | 256 |
| 1502 | iso_pu_bacteria | 2667528171 | 2671099686 | 256 |
| 1503 | iso_pu_bacteria | 2667528176 | 2671129630 | 256 |
| 1504 | iso_pu_bacteria | 2671180172 | 2671771237 | 256 |
| 1505 | iso_pu_bacteria | 2675903420 | 2677900378 | 256 |
| 1506 | iso_pu_bacteria | 2713897148 | 2715749498 | 256 |
| 1507 | iso_pu_bacteria | 2713897149 | 2715754501 | 256 |
| 1508 | iso_pu_bacteria | 2721755607 | 2723246194 | 256 |
| 1509 | iso_pu_bacteria | 2738541265 | 2738673400 | 256 |
| 1510 | iso_pu_bacteria | 2738541271 | 2738690667 | 256 |
| 1511 | iso_pu_bacteria | 2738541282 | 2738751793 | 256 |
| 1512 | iso_pu_bacteria | 2738541294 | 2738807636 | 256 |
| 1513 | iso_pu_bacteria | 2738541303 | 2738860834 | 256 |
| 1514 | iso_pu_bacteria | 2738541309 | 2738894996 | 256 |
| 1515 | iso_pu_bacteria | 2738543004 | 2739200947 | 256 |
| 1516 | iso_pu_bacteria | 2738543015 | 2739261783 | 256 |
| 1517 | iso_pu_bacteria | 2738543016 | 2739266441 | 256 |
| 1518 | iso_pu_bacteria | 2740892503 | 2743740859 | 256 |
| 1519 | iso_pu_bacteria | 2765235841 | 2765581304 | 256 |
| 1520 | iso_pu_bacteria | 2773857670 | 2774118028 | 256 |
| 1521 | iso_pu_bacteria | 2773857673 | 2774136542 | 256 |
| 1522 | iso_pu_bacteria | 2775507074 | 2777024532 | 256 |
| 1523 | iso_pu_bacteria | 2784132063 | 2784261468 | 256 |
| 1524 | iso_pu_bacteria | 2784132072 | 2784316515 | 256 |
| 1525 | iso_pu_bacteria | 2791355520 | 2794593599 | 256 |
| 1526 | iso_pu_bacteria | 2806310737 | 2807405887 | 256 |
| 1527 | iso_pu_bacteria | 2806310745 | 2807454222 | 256 |
| 1528 | iso_pu_bacteria | 2808606377 | 2808928106 | 256 |
| 1529 | iso_pu_bacteria | 2808606381 | 2808950712 | 256 |
| 1530 | iso_pu_bacteria | 2808606382 | 2808960679 | 256 |
| 1531 | iso_pu_bacteria | 2808606385 | 2808980054 | 256 |
| 1532 | iso_pu_bacteria | 2808606386 | 2808984878 | 256 |
| 1533 | iso_pu_bacteria | 2808606388 | 2808995774 | 256 |
| 1534 | iso_pu_bacteria | 2808606415 | 2809128782 | 256 |
| 1535 | iso_pu_bacteria | 2808606419 | 2809148403 | 256 |
| 1536 | iso_pu_bacteria | 2808606445 | 2809217567 | 256 |
| 1537 | iso_pu_bacteria | 2816332298 | 2817488067 | 256 |
| 1538 | iso_pu_bacteria | 2818991456 | 2819655471 | 256 |
| 1539 | iso_pu_bacteria | 2818991464 | 2819704833 | 256 |
| 1540 | iso_pu_bacteria | 2825651385 | 2825654711 | 256 |
| 1541 | iso_pu_bacteria | 2834028612 | 2834031325 | 256 |
| 1542 | iso_pu_bacteria | 2842826826 | 2842832029 | 256 |
| 1543 | iso_pu_bacteria | 2842832357 | 2842833792 | 256 |
| 1544 | iso_pu_bacteria | 2842837860 | 2842838300 | 256 |
| 1545 | iso_pu_bacteria | 2842843487 | 2842846019 | 256 |
| 1546 | iso_pu_bacteria | 2844665904 | 2844667526 | 256 |
| 1547 | iso_pu_bacteria | 2852103415 | 2852104452 | 256 |
| 1548 | iso_pu_bacteria | 2852612431 | 2852616722 | 256 |
| 1549 | iso_pu_bacteria | 2852618963 | 2852620169 | 256 |
| 1550 | iso_pu_bacteria | 2852657418 | 2852662618 | 256 |
| 1551 | iso_pu_bacteria | 2852667396 | 2852671690 | 256 |
| 1552 | iso_pu_bacteria | 2860339153 | 2860345255 | 256 |
| 1553 | iso_pu_bacteria | 2860867994 | 2860868091 | 256 |
| 1554 | iso_pu_bacteria | 2878029506 | 2878029759 | 256 |
| 1555 | iso_pu_bacteria | 2880230671 | 2880230709 | 256 |
| 1556 | iso_pu_bacteria | 2881927736 | 2881930383 | 256 |
| 1557 | iso_pu_bacteria | 2895511927 | 2895516146 | 256 |
| 1558 | iso_pu_bacteria | 2904518522 | 2904518601 | 256 |
| 1559 | iso_pu_bacteria | 2904550169 | 2904553445 | 256 |
| 1560 | iso_pu_bacteria | 2908446538 | 2908446680 | 256 |
| 1561 | iso_pu_bacteria | 2912963787 | 2912963878 | 256 |
| 1562 | iso_pu_bacteria | 2913036834 | 2913036889 | 256 |
| 1563 | iso_pu_bacteria | 2917070673 | 2917070776 | 256 |
| 1564 | iso_pu_bacteria | 2919063839 | 2919067984 | 256 |
| 1565 | iso_pu_bacteria | 2919385768 | 2919388831 | 256 |
| 1566 | iso_pu_bacteria | 2919456309 | 2919457910 | 256 |
| 1567 | iso_pu_bacteria | 2919481497 | 2919487008 | 256 |
| 1568 | iso_pu_bacteria | 2919487758 | 2919487788 | 256 |
| 1569 | iso_pu_bacteria | 2919501602 | 2919502431 | 256 |
| 1570 | iso_pu_bacteria | 2919697872 | 2919702401 | 256 |
| 1571 | iso_pu_bacteria | 2923153595 | 2923153691 | 256 |
| 1572 | iso_pu_bacteria | 2923586266 | 2923589319 | 256 |
| 1573 | iso_pu_bacteria | 2926063275 | 2926064104 | 256 |
| 1574 | iso_pu_bacteria | 2929189879 | 2929189974 | 256 |
| 1575 | iso_pu_bacteria | 2931369376 | 2931372314 | 256 |
| 1576 | iso_pu_bacteria | 2931390751 | 2931391035 | 256 |
| 1577 | iso_pu_bacteria | 2931396565 | 2931398454 | 256 |
| 1578 | iso_pu_bacteria | 2932406140 | 2932408908 | 256 |
| 1579 | iso_pu_bacteria | 2935353572 | 2935357889 | 256 |
| 1580 | iso_pu_bacteria | 2939577877 | 2939582040 | 256 |
| 1581 | iso_pu_bacteria | 2939636861 | 2939640518 | 256 |
| 1582 | iso_pu_bacteria | 2939651529 | 2939654481 | 256 |
| 1583 | iso_pu_bacteria | 2945928738 | 2945930508 | 256 |
| 1584 | iso_pu_bacteria | 2946006987 | 2946012854 | 256 |
| 1585 | iso_pu_bacteria | 2946027586 | 2946028283 | 256 |
| 1586 | iso_pu_bacteria | 2947233263 | 2947234800 | 256 |
| 1587 | iso_pu_bacteria | 2969304461 | 2969304515 | 256 |
| 1588 | iso_pu_bacteria | 2974289157 | 2974293729 | 256 |
| 1589 | iso_pu_bacteria | 2984286254 | 2984292422 | 256 |
| 1590 | iso_pu_bacteria | 2984559226 | 2984559295 | 256 |
| 1591 | iso_pu_bacteria | 2984595703 | 2984595822 | 256 |
| 1592 | iso_pu_bacteria | 2998139840 | 2998140079 | 256 |
| 1593 | iso_pu_bacteria | 3007395558 | 3007398984 | 256 |
| 1594 | iso_pu_bacteria | 3007419365 | 3007419676 | 256 |
| 1595 | iso_pu_bacteria | 3007511990 | 3007517497 | 256 |
| 1596 | iso_pu_bacteria | 3007614139 | 3007617039 | 256 |
| 1597 | iso_pu_bacteria | 3007619802 | 3007623822 | 256 |
| 1598 | iso_pu_bacteria | 3007718800 | 3007722069 | 256 |
| 1599 | iso_pu_bacteria | 3007803356 | 3007804067 | 256 |
| 1600 | iso_pu_bacteria | 3007855910 | 3007859528 | 256 |
| 1601 | iso_pu_bacteria | 3007861166 | 3007864739 | 256 |
| 1602 | iso_pu_bacteria | 3007872151 | 3007874926 | 256 |
| 1603 | iso_pu_bacteria | 637000220 | 637317442 | 256 |
| 1604 | iso_pu_bacteria | 8015687852 | 8015687954 | 256 |
| 1605 | iso_pu_bacteria | 8019769354 | 8019769379 | 256 |
| 1606 | iso_pu_bacteria | 8019775933 | 8019779624 | 256 |
| 1607 | iso_pu_bacteria | 8029995093 | 8029995171 | 256 |
| 1608 | iso_pu_bacteria | 8052494512 | 8052494532 | 256 |
| 1609 | iso_pu_bacteria | 8054285046 | 8054287164 | 256 |
| 1610 | iso_pu_bacteria | 8054347763 | 8054349217 | 256 |
| 1611 | iso_pu_bacteria | 8054503363 | 8054503641 | 256 |
| 1612 | iso_pu_bacteria | 8054929484 | 8054930026 | 256 |
| 1613 | iso_pu_bacteria | 8055770955 | 8055771052 | 256 |
| 1614 | iso_pu_bacteria | 8055817908 | 8055818004 | 256 |
| 1615 | iso_pu_bacteria | 8055878733 | 8055881566 | 256 |
| 1616 | iso_pu_bacteria | 8056115690 | 8056116229 | 256 |
| 1617 | iso_pu_bacteria | 8056120720 | 8056120816 | 256 |
| 1618 | iso_pu_bacteria | 8056125926 | 8056126098 | 256 |
| 1619 | iso_pu_bacteria | 8056131705 | 8056131973 | 256 |
| 1620 | iso_pu_bacteria | 8056137416 | 8056137510 | 256 |
| 1621 | iso_pu_bacteria | 8056148874 | 8056151129 | 256 |
| 1622 | iso_pu_bacteria | 8056155041 | 8056160076 | 256 |
| 1623 | iso_pu_bacteria | 8056161164 | 8056164002 | 256 |
| 1624 | iso_pu_bacteria | 8056166840 | 8056170968 | 256 |
| 1625 | iso_pu_bacteria | 8056172158 | 8056177101 | 256 |
| 1626 | iso_pu_bacteria | 8056177738 | 8056182192 | 256 |
| 1627 | iso_pu_bacteria | 8056569372 | 8056570810 | 256 |
| 1628 | iso_pu_bacteria | 8057798959 | 8057802334 | 256 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ch8-assembly1.cif.gz_J | cryo-em structure of p.aeruginosa mlafebd with adp-v | 0.9709 | 2 | 240 |
| 7ch8-assembly1.cif.gz_I | cryo-em structure of p.aeruginosa mlafebd with adp-v | 0.9692 | 2 | 240 |
| 7cha-assembly1.cif.gz_J | cryo-em structure of p.aeruginosa mlafebd with amppnp | 0.9556 | 2 | 240 |
| 8fee-assembly1.cif.gz_H | structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) | 0.9541 | 2 | 240 |
| 7d06-assembly1.cif.gz_B | cryo em structure of the nucleotide free acinetobacter mlafedb complex | 0.9536 | 2 | 240 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6Q2V7_231_304_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9594 | 2 | 64 | 3.40.50.300 |
| af_P63386_5_251_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9556 | 2 | 241 | 3.40.50.300 |
| af_Q2G1F8_275_530_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9536 | 1 | 240 | 3.40.50.300 |
| af_I6Y482_280_547_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9471 | 1 | 243 | 3.40.50.300 |
| af_P37313_10_333_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9462 | 2 | 240 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4P6FWW7-F1-model_v4 | ABC transporter ATP-binding protein | 1.001 | 1 | 256 |
GO:0005524
GO:0016887 |
| AF-A0A846V1C7-F1-model_v4 | Phospholipid/cholesterol/gamma-HCH transport system ATP-binding protein | 0.9986 | 1 | 255 |
GO:0005524
GO:0016887 |
| AF-A0A4P6FWW7-F1-model_v4 | ABC transporter ATP-binding protein | 0.9972 | 1 | 256 |
GO:0005524
GO:0016887 |
| AF-A0A1Q3LL68-F1-model_v4 | ABC transporter ATP-binding protein | 0.9918 | 2 | 247 |
GO:0005524
GO:0016887 |
| AF-A0A846V1C7-F1-model_v4 | Phospholipid/cholesterol/gamma-HCH transport system ATP-binding protein | 0.9908 | 1 | 255 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar