F495117

General Info

Members Datasets Scaffolds Average Seq Length
1628 736 1384 264

Family's Representative Sequence

Representative Sequence 3300031691|Ga0316579_10026379|Ga0316579_100263792
Length 309
Sequence MKAPHVPGLPPHQPKPLTHNEARVLHKVEHRARLKEHELYKGEYPIVIEGLVNRFGTQVVHENLSLKVRRGEILGVVGGSGSGKSVLMRSIIGLQQPTEGKILVFGRSIEDHHEESEIDIRSRWGVLFQGGALFSTLTVGENVEVPLREFYPEIEDELRHEIARYKVRLSGLPEEATSKFPSQLSGGMVKRAALARALSLDPELLFLDEPTAGLDPIGAAAFDMLTRELTDILGLTVFLITHDLDTLHEICDRVAVIADRTIIAVGTIPELMASDHPWIQEYFNGPRGRAALASQELAKAMDSPEESLD

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2511231006 Pseudomonas sp. GM17 Isolate Nodule
3 2511231007 Pseudomonas sp. GM18 Isolate Nodule
4 2511231008 Pseudomonas sp. GM21 Isolate Nodule
5 2511231010 Pseudomonas sp. GM25 Isolate Nodule
6 2511231011 Pseudomonas sp. GM30 Isolate Nodule
7 2511231012 Pseudomonas sp. GM33 Isolate Nodule
8 2511231014 Pseudomonas sp. GM48 Isolate Nodule
9 2511231015 Pseudomonas sp. GM49 Isolate Nodule
10 2511231016 Pseudomonas sp. GM50 Isolate Nodule
11 2511231017 Pseudomonas sp. GM55 Isolate Nodule
12 2511231018 Pseudomonas sp. GM60 Isolate Nodule
13 2511231019 Pseudomonas sp. GM67 Isolate Nodule
14 2511231020 Pseudomonas sp. GM74 Isolate Nodule
15 2511231021 Pseudomonas sp. GM78 Isolate Nodule
16 2511231022 Pseudomonas sp. GM79 Isolate Nodule
17 2511231023 Pseudomonas sp. GM80 Isolate Nodule
18 2511231024 Pseudomonas sp. GM84 Isolate Nodule
19 2511231031 Pseudomonas sp. GM16 Isolate Nodule
20 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
21 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
22 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
23 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
24 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
25 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
26 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
27 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
28 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
29 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
30 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
31 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
32 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
33 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
34 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
35 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
36 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
37 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
38 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
39 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
40 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
41 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
42 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
43 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
44 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
45 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
46 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
47 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
48 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
49 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
50 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
51 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
52 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
53 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
54 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
55 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
56 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
57 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
58 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
59 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
60 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
61 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
62 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
63 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
64 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
65 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
66 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
67 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
68 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
69 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
70 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
71 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
72 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
73 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
74 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
75 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
76 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
77 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
78 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
79 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
80 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
81 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
82 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
83 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
84 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
85 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
86 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
87 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
88 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
89 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
90 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
91 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
92 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
93 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
94 2636415599 Klebsiella variicola DX120E Isolate Unclassified
95 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
96 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
97 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
98 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
99 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
100 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
101 2643221640 Caulobacter sp. Root342 Isolate Unclassified
102 2643221642 Caulobacter sp. Root343 Isolate Unclassified
103 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
104 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
105 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
106 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
107 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
108 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
109 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
110 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
111 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
112 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
113 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
114 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
115 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
116 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
117 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
118 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
119 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
120 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
121 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
122 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
123 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
124 2765235841 Pseudomonas putida AA7 Isolate Unclassified
125 2773857670 Pseudomonas sp. 478 Isolate Unclassified
126 2773857673 Pseudomonas sp. 443 Isolate Unclassified
127 2775507074 Klebsiella sp. D5A Isolate Unclassified
128 2784132063 Pseudomonas sp. 424 Isolate Unclassified
129 2784132072 Pseudomonas sp. 460 Isolate Unclassified
130 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
131 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
132 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
133 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
134 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
135 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
136 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
137 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
138 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
139 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
140 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
141 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
142 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
143 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
144 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
145 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
146 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
147 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
148 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
149 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
150 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
151 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
152 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
153 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
154 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
155 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
156 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
157 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
158 2854911287 Brucella lupini LUP21 Isolate Unclassified
159 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
160 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
161 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
162 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
163 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
164 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
165 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
166 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
167 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
168 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
169 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
170 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
171 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
172 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
173 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
174 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
175 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
176 2919404418 Luteibacter sp. 3190 Isolate Unclassified
177 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
178 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
179 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
180 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
181 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
182 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
183 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
184 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
185 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
186 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
187 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
188 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
189 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
190 2932406140 Serratia sp. 2723 Isolate Rhizosphere
191 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
192 2939577877 Serratia sp. 509 Isolate Rhizosphere
193 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
194 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
195 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
196 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
197 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
198 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
199 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
200 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
201 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
202 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
203 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
204 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
205 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
206 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
207 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
208 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
209 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
210 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
211 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
212 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
213 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
214 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
215 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
216 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
217 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
218 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
219 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
220 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
221 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
222 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
223 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
224 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
225 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
226 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
227 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
228 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
229 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
230 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
231 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
232 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
233 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
234 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
235 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
236 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
237 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
238 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
239 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
240 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
241 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
242 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
243 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
244 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
245 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
246 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
247 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
248 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
249 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
250 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
251 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
252 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
253 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
254 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
255 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
256 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
257 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
258 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
259 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
260 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
261 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
262 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
263 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
264 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
265 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
266 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
267 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
268 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
269 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
270 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
271 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
272 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
273 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
274 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
275 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
276 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
277 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
278 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
279 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
280 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
281 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
282 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
283 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
284 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
285 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
286 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
287 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
288 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
289 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
290 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
291 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
292 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
293 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
294 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
295 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
296 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
297 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
298 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
299 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
300 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
301 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
302 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
303 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
304 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
305 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
306 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
307 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
308 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
309 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
310 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
311 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
312 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
313 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
314 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
315 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
316 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
317 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
318 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
319 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
320 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
321 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
322 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
323 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
324 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
325 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
326 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
327 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
328 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
329 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
330 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
331 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
332 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
333 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
334 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
335 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
336 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
337 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
338 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
339 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
340 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
341 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
342 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
343 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
344 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
345 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
346 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
347 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
348 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
349 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
350 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
351 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
352 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
353 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
354 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
355 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
356 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
357 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
358 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
359 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
360 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
361 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
362 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
363 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
364 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
365 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
366 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
367 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
368 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
369 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
370 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
371 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
372 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
373 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
374 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
375 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
376 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
377 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
378 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
379 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
380 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
381 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
382 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
383 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
384 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
385 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
432 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
433 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
434 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
436 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
437 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
438 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
439 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
440 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
441 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
443 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
444 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
445 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
446 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
447 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
448 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
450 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
451 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
452 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
453 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
454 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
455 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
456 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
457 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
458 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
459 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
461 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
462 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
463 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
464 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
465 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
466 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
467 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
468 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
469 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
470 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
471 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
472 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
473 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
474 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
475 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
476 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
477 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
478 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
479 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
480 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
481 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
482 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
483 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
484 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
485 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
486 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
487 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
488 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
489 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
490 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
491 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
492 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
493 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
494 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
495 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
496 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
497 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
498 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
499 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
500 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
501 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
502 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
503 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
504 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
505 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
506 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
507 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
508 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
509 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
510 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
511 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
512 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
513 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
514 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
515 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
516 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
517 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
518 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
519 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
520 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
521 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
522 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
523 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
524 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
525 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
526 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
527 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
528 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
529 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
530 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
531 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
532 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
533 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
534 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
535 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
536 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
537 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
538 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
539 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
540 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
541 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
542 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
543 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
544 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
545 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
546 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
547 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
548 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
549 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
550 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
551 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
552 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
553 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
554 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
555 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
556 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
557 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
558 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
559 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
560 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
561 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
562 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
563 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
564 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
565 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
566 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
567 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
568 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
569 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
570 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
571 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
572 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
573 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
574 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
575 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
576 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
577 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
578 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
579 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
580 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
581 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
582 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
583 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
584 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
585 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
586 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
587 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
588 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
589 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
590 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
591 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
592 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
593 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
594 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
595 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
596 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
597 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
598 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
599 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
600 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
601 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
602 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
603 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
604 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
605 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
606 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
607 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
608 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
609 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
610 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
611 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
612 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
613 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
614 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
615 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
616 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
617 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
618 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
619 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
620 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
621 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
622 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
623 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
624 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
625 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
626 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
627 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
628 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
629 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
630 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
631 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
632 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
633 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
634 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
635 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
636 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
637 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
638 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
639 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
640 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
641 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
642 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
643 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
644 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
645 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
646 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
647 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
648 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
649 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
650 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
651 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
652 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
653 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
654 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
655 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
656 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
657 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
658 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
659 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
660 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
661 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
662 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
663 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
664 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
665 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
666 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
667 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
668 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
669 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
670 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
671 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
672 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
673 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
674 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
675 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
676 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
677 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
678 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
679 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
680 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
681 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
682 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
683 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
684 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
685 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
686 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
687 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
688 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
689 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
690 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
691 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
692 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
693 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
694 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
695 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
696 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
697 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
698 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
699 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
700 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
701 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
702 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
703 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
704 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
705 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
706 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
707 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
708 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
709 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
710 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
711 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
712 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
713 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
714 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
715 8052494512 Pseudomonas putida LD6 Isolate Unclassified
716 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
717 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
718 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
719 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
720 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
721 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
722 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
723 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
724 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
725 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
726 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
727 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
728 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
729 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
730 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
731 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
732 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
733 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
734 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
735 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
736 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.77
Metatranscriptomes 0.25
Isolates 14.99

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 8.23
Nodule 1.78
Rhizoplane 6.2
Rhizosphere 71.5
Stem 0
Stem Tuber 0
Unclassified 12.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_6771 2124908027 Bacteria 4731
2 MRS2a_Contig_7961 2124908027 Bacteria 2332
3 JGI24736J21556_1007395 3300001904 Bacteria 1846
4 JGI25162J39368_1000459 3300002737 Bacteria 31876
5 JGI25163J39215_1000407 3300002771 Bacteria 13526
6 JGI25163J39215_1000589 3300002771 Bacteria 10199
7 JGI25164J39214_1000297 3300002772 Bacteria 34174
8 JGI25164J39214_1000314 3300002772 Bacteria 31880
9 JGI25165J46597_1000175 3300003214 Bacteria 100117
10 JGI25165J46597_1000193 3300003214 Bacteria 91069
11 rootL2_10219289 3300003322 Bacteria 1981
12 rootL2_10301675 3300003322 Bacteria 1954
13 Ga0006562J51391_1013763 3300003578 Bacteria 3997
14 Ga0006562J51391_1162000 3300003578 Bacteria 2511
15 Ga0006562J51391_1162001 3300003578 Bacteria 2360
16 Ga0055538_1000012 3300003751 Bacteria 353826
17 Ga0055539_1000017 3300003752 Bacteria 353873
18 Ga0055533_1000021 3300003756 Bacteria 353826
19 Ga0055532_1000020 3300003758 Bacteria 270853
20 Ga0055525_1000117 3300003759 Bacteria 120690
21 Ga0055535_1012090 3300003761 Bacteria 1333
22 Ga0055526_1000674 3300003771 Bacteria 26160
23 Ga0055537_1002258 3300003773 Bacteria 6632
24 Ga0055524_1000852 3300003775 Bacteria 20009
25 Ga0055536_1000595 3300003781 Bacteria 24647
26 Ga0055536_1000604 3300003781 Bacteria 24459
27 Ga0055536_1003173 3300003781 Bacteria 8915
28 Ga0055530_10000050 3300003791 Bacteria 105620
29 Ga0055530_10000081 3300003791 Bacteria 82192
30 Ga0055530_10000548 3300003791 Bacteria 32545
31 Ga0055530_10000899 3300003791 Bacteria 24455
32 Ga0055530_10002781 3300003791 Bacteria 10795
33 Ga0055530_10004915 3300003791 Bacteria 6624
34 Ga0055540_1000121 3300003792 Bacteria 82192
35 Ga0055540_1000242 3300003792 Bacteria 49989
36 Ga0055540_1001116 3300003792 Bacteria 16913
37 Ga0055531_10000847 3300003794 Bacteria 25245
38 Ga0055531_10001033 3300003794 Bacteria 22056
39 Ga0055541_1000012 3300003841 Bacteria 353826
40 Ga0058692_1008095 3300003856 Bacteria 2726
41 Ga0065165_1000093 3300005262 Bacteria 146751
42 Ga0065165_1037701 3300005262 Bacteria 1463
43 Ga0065714_10002860 3300005288 Bacteria 11454
44 Ga0065714_10004303 3300005288 Bacteria 7578
45 Ga0065714_10008943 3300005288 Bacteria 2429
46 Ga0065714_10064636 3300005288 Bacteria 26785
47 Ga0065714_10064893 3300005288 Bacteria 15990
48 Ga0065714_10066596 3300005288 Bacteria 6589
49 Ga0065714_10091673 3300005288 Bacteria 1897
50 Ga0065704_10001959 3300005289 Bacteria 9751
51 Ga0065704_10008836 3300005289 Bacteria 3521
52 Ga0065704_10071119 3300005289 Bacteria 13035
53 Ga0065712_10068500 3300005290 Bacteria 10228
54 Ga0065715_10215900 3300005293 Bacteria 1264
55 Ga0065715_10341747 3300005293 Bacteria 966
56 Ga0070683_100453071 3300005329 Bacteria 1224
57 Ga0070690_100002162 3300005330 Bacteria 10498
58 Ga0070690_100068633 3300005330 Bacteria 2300
59 Ga0070670_100000050 3300005331 Bacteria 132470
60 Ga0070670_100003035 3300005331 Bacteria 13890
61 Ga0070670_100005339 3300005331 Bacteria 10835
62 Ga0070670_100018343 3300005331 Bacteria 6004
63 Ga0070670_100276858 3300005331 Bacteria 1465
64 Ga0070670_100689905 3300005331 Bacteria 918
65 Ga0068869_100002671 3300005334 Bacteria 10776
66 Ga0070666_10020342 3300005335 Bacteria 4290
67 Ga0070680_100005561 3300005336 Bacteria 9539
68 Ga0070689_100003447 3300005340 Bacteria 10517
69 Ga0070661_100000237 3300005344 Bacteria 45515
70 Ga0070661_100022662 3300005344 Bacteria 4497
71 Ga0070661_100274321 3300005344 Bacteria 1307
72 Ga0070668_100001877 3300005347 Bacteria 15355
73 Ga0070669_100000158 3300005353 Bacteria 61318
74 Ga0070669_100000277 3300005353 Bacteria 41213
75 Ga0070675_100001395 3300005354 Bacteria 17713
76 Ga0070671_100045250 3300005355 Bacteria 3659
77 Ga0070671_100070671 3300005355 Bacteria 2912
78 Ga0070671_100284428 3300005355 Bacteria 1407
79 Ga0070673_100000393 3300005364 Bacteria 23110
80 Ga0070673_100013793 3300005364 Bacteria 5606
81 Ga0070659_100000040 3300005366 Bacteria 104145
82 Ga0070659_100008635 3300005366 Bacteria 7451
83 Ga0070667_100000299 3300005367 Bacteria 55531
84 Ga0070667_100028277 3300005367 Bacteria 4667
85 Ga0070667_100203189 3300005367 Bacteria 1759
86 Ga0070714_100018934 3300005435 Bacteria 5601
87 Ga0070714_100425139 3300005435 Bacteria 1259
88 Ga0070713_100000501 3300005436 Bacteria 25040
89 Ga0070713_100000622 3300005436 Bacteria 22633
90 Ga0070710_10003523 3300005437 Bacteria 7419
91 Ga0070711_100001068 3300005439 Bacteria 14617
92 Ga0070705_100016110 3300005440 Bacteria 3879
93 Ga0070700_100174455 3300005441 Bacteria 1491
94 Ga0070663_100026194 3300005455 Bacteria 3946
95 Ga0070678_100147426 3300005456 Bacteria 1891
96 Ga0070678_100289437 3300005456 Bacteria 1388
97 Ga0070662_100000063 3300005457 Bacteria 57210
98 Ga0070662_100172140 3300005457 Bacteria 1701
99 Ga0070681_10030623 3300005458 Bacteria 5400
100 Ga0068867_100093050 3300005459 Bacteria 2290
101 Ga0068867_100100528 3300005459 Bacteria 2208
102 Ga0070679_100071686 3300005530 Bacteria 3456
103 Ga0070684_100002776 3300005535 Bacteria 12967
104 Ga0068853_100000143 3300005539 Bacteria 48815
105 Ga0068853_100047201 3300005539 Bacteria 3696
106 Ga0068853_100079848 3300005539 Bacteria 2861
107 Ga0068853_100302093 3300005539 Bacteria 1480
108 Ga0070672_100022058 3300005543 Bacteria 4670
109 Ga0070686_100007969 3300005544 Bacteria 5922
110 Ga0070696_100208435 3300005546 Bacteria 1462
111 Ga0070693_100342933 3300005547 Bacteria 1020
112 Ga0070665_100000248 3300005548 Bacteria 89239
113 Ga0070665_100001434 3300005548 Bacteria 27937
114 Ga0070665_100010596 3300005548 Bacteria 9333
115 Ga0070665_100020273 3300005548 Bacteria 6676
116 Ga0070665_100047335 3300005548 Bacteria 4317
117 Ga0070665_100057771 3300005548 Bacteria 3889
118 Ga0070665_100224775 3300005548 Bacteria 1877
119 Ga0070704_100061290 3300005549 Bacteria 2692
120 Ga0068855_100011064 3300005563 Bacteria 10886
121 Ga0068855_100159449 3300005563 Bacteria 2562
122 Ga0068855_100240141 3300005563 Bacteria 2025
123 Ga0070664_100000407 3300005564 Bacteria 32028
124 Ga0070664_100000940 3300005564 Bacteria 22757
125 Ga0070664_100008436 3300005564 Bacteria 8333
126 Ga0070664_100055150 3300005564 Bacteria 3373
127 Ga0070664_100577189 3300005564 Bacteria 1041
128 Ga0068857_100059056 3300005577 Bacteria 3406
129 Ga0068854_100004725 3300005578 Bacteria 8585
130 Ga0068856_100025594 3300005614 Bacteria 5754
131 Ga0068856_100135583 3300005614 Bacteria 2467
132 Ga0070702_100006771 3300005615 Bacteria 5447
133 Ga0068859_100001376 3300005617 Bacteria 24747
134 Ga0068859_100237560 3300005617 Bacteria 1911
135 Ga0068864_100000238 3300005618 Bacteria 49284
136 Ga0068864_100022488 3300005618 Bacteria 5287
137 Ga0068864_100033400 3300005618 Bacteria 4374
138 Ga0068866_10176277 3300005718 Bacteria 1259
139 Ga0068861_100051537 3300005719 Bacteria 3124
140 Ga0068851_10000018 3300005834 Bacteria 137425
141 Ga0068870_10020900 3300005840 Bacteria 3195
142 Ga0068863_100000531 3300005841 Bacteria 38939
143 Ga0068863_100000673 3300005841 Bacteria 34509
144 Ga0068863_100005001 3300005841 Bacteria 13072
145 Ga0068863_100338951 3300005841 Bacteria 1463
146 Ga0068858_100003909 3300005842 Bacteria 14720
147 Ga0068858_100004783 3300005842 Bacteria 13259
148 Ga0068858_100007943 3300005842 Bacteria 10225
149 Ga0068858_100376935 3300005842 Bacteria 1361
150 Ga0068860_100015972 3300005843 Bacteria 7328
151 Ga0068862_100000786 3300005844 Bacteria 31460
152 Ga0068862_100001925 3300005844 Bacteria 18852
153 Ga0068862_100015372 3300005844 Bacteria 6358
154 Ga0068862_100158322 3300005844 Bacteria 2020
155 Ga0075365_10041469 3300006038 Bacteria 3007
156 Ga0075363_100009303 3300006048 Bacteria 4616
157 Ga0075364_10000109 3300006051 Bacteria 33870
158 Ga0075364_10034624 3300006051 Bacteria 3260
159 Ga0075364_10054778 3300006051 Bacteria 2609
160 Ga0075364_10078438 3300006051 Bacteria 2182
161 Ga0075364_10110261 3300006051 Bacteria 1836
162 Ga0075364_10131569 3300006051 Bacteria 1679
163 Ga0075432_10004705 3300006058 Bacteria 4647
164 Ga0075432_10007143 3300006058 Bacteria 3803
165 Ga0075432_10021580 3300006058 Bacteria 2201
166 Ga0075432_10064995 3300006058 Bacteria 1303
167 Ga0070715_10000137 3300006163 Bacteria 17172
168 Ga0070715_10130230 3300006163 Bacteria 1210
169 Ga0070716_100000250 3300006173 Bacteria 21487
170 Ga0070716_100009265 3300006173 Bacteria 4906
171 Ga0070712_100000944 3300006175 Bacteria 17506
172 Ga0070712_100069855 3300006175 Bacteria 2507
173 Ga0075362_10000018 3300006177 Bacteria 75123
174 Ga0075362_10003263 3300006177 Bacteria 5637
175 Ga0075369_10002686 3300006186 Bacteria 6376
176 Ga0075369_10013967 3300006186 Bacteria 3199
177 Ga0075366_10003020 3300006195 Bacteria 8779
178 Ga0097621_100002763 3300006237 Bacteria 12003
179 Ga0097621_100042100 3300006237 Bacteria 3678
180 Ga0075370_10000065 3300006353 Bacteria 31858
181 Ga0068871_100007873 3300006358 Bacteria 7638
182 Ga0068871_100094024 3300006358 Bacteria 2502
183 Ga0075428_100000169 3300006844 Bacteria 60729
184 Ga0075428_100003164 3300006844 Bacteria 17986
185 Ga0075428_100032925 3300006844 Bacteria 5724
186 Ga0075428_100627006 3300006844 Bacteria 1147
187 Ga0075430_100001922 3300006846 Bacteria 17042
188 Ga0075430_100043515 3300006846 Bacteria 3795
189 Ga0075431_100000027 3300006847 Bacteria 74360
190 Ga0075431_100001984 3300006847 Bacteria 19531
191 Ga0075431_100019179 3300006847 Bacteria 6971
192 Ga0075431_100288039 3300006847 Bacteria 1662
193 Ga0075429_100000416 3300006880 Bacteria 31687
194 Ga0075429_100023537 3300006880 Bacteria 5346
195 Ga0068865_100002003 3300006881 Bacteria 12025
196 Ga0068865_100004806 3300006881 Bacteria 8166
197 Ga0075436_100170932 3300006914 Bacteria 1535
198 Ga0075436_100413037 3300006914 Bacteria 979
199 Ga0097620_100001375 3300006931 Bacteria 24747
200 Ga0097620_100237587 3300006931 Bacteria 1911
201 Ga0099823_1002256 3300006944 Bacteria 17218
202 Ga0079104_1000291 3300006946 Bacteria 63569
203 Ga0079104_1003204 3300006946 Bacteria 7891
204 Ga0079104_1020394 3300006946 Bacteria 1827
205 Ga0105251_10000033 3300009011 Bacteria 118905
206 Ga0105251_10000068 3300009011 Bacteria 98955
207 Ga0105251_10000881 3300009011 Bacteria 26861
208 Ga0105251_10000985 3300009011 Bacteria 25069
209 Ga0105251_10002062 3300009011 Bacteria 16229
210 Ga0105251_10003716 3300009011 Bacteria 10935
211 Ga0105251_10004230 3300009011 Bacteria 9916
212 Ga0105251_10004706 3300009011 Bacteria 9169
213 Ga0105251_10007970 3300009011 Bacteria 6430
214 Ga0105251_10012227 3300009011 Bacteria 4866
215 Ga0105251_10039793 3300009011 Bacteria 2294
216 Ga0105251_10043483 3300009011 Bacteria 2175
217 Ga0105251_10047642 3300009011 Bacteria 2059
218 Ga0105251_10051112 3300009011 Bacteria 1972
219 Ga0105251_10051586 3300009011 Bacteria 1961
220 Ga0105251_10162101 3300009011 Bacteria 1008
221 Ga0105251_10186259 3300009011 Bacteria 935
222 Ga0105244_10000726 3300009036 Bacteria 28455
223 Ga0105244_10001870 3300009036 Bacteria 16359
224 Ga0105244_10002402 3300009036 Bacteria 14157
225 Ga0105244_10005309 3300009036 Bacteria 8578
226 Ga0105244_10006394 3300009036 Bacteria 7644
227 Ga0105244_10010227 3300009036 Bacteria 5700
228 Ga0105244_10017810 3300009036 Bacteria 4003
229 Ga0105244_10096083 3300009036 Bacteria 1454
230 Ga0105244_10096207 3300009036 Bacteria 1453
231 Ga0105244_10101682 3300009036 Bacteria 1405
232 Ga0105244_10109387 3300009036 Bacteria 1346
233 Ga0105244_10156809 3300009036 Bacteria 1089
234 Ga0105244_10161267 3300009036 Bacteria 1071
235 Ga0105250_10000825 3300009092 Bacteria 18449
236 Ga0105250_10001995 3300009092 Bacteria 10569
237 Ga0105250_10007162 3300009092 Bacteria 4812
238 Ga0105250_10016832 3300009092 Bacteria 2975
239 Ga0105250_10027515 3300009092 Bacteria 2292
240 Ga0105250_10065871 3300009092 Bacteria 1460
241 Ga0105250_10065931 3300009092 Bacteria 1460
242 Ga0105250_10089394 3300009092 Bacteria 1251
243 Ga0105250_10173047 3300009092 Bacteria 904
244 Ga0105240_10000522 3300009093 Bacteria 70833
245 Ga0105240_10008495 3300009093 Bacteria 14686
246 Ga0105240_10073487 3300009093 Bacteria 4222
247 Ga0111539_10000211 3300009094 Bacteria 69441
248 Ga0111539_10040297 3300009094 Bacteria 5625
249 Ga0111539_10076787 3300009094 Bacteria 3933
250 Ga0105245_10008015 3300009098 Bacteria 9237
251 Ga0105247_10012887 3300009101 Bacteria 5017
252 Ga0114129_10001827 3300009147 Bacteria 28986
253 Ga0114129_10005882 3300009147 Bacteria 17371
254 Ga0114129_10526183 3300009147 Bacteria 1541
255 Ga0105243_10000075 3300009148 Bacteria 112098
256 Ga0105243_10000867 3300009148 Bacteria 28621
257 Ga0105243_10001447 3300009148 Bacteria 20865
258 Ga0105243_10075069 3300009148 Bacteria 2744
259 Ga0105243_10098657 3300009148 Bacteria 2420
260 Ga0105243_10118152 3300009148 Bacteria 2230
261 Ga0105243_10135072 3300009148 Bacteria 2098
262 Ga0105241_10039582 3300009174 Bacteria 3556
263 Ga0105242_10000358 3300009176 Bacteria 36515
264 Ga0105242_10003944 3300009176 Bacteria 11524
265 Ga0105242_10016716 3300009176 Bacteria 5707
266 Ga0105248_10002192 3300009177 Bacteria 21611
267 Ga0105248_10028267 3300009177 Bacteria 6246
268 Ga0105248_10172510 3300009177 Bacteria 2438
269 Ga0105248_10180194 3300009177 Bacteria 2381
270 Ga0105237_10002504 3300009545 Bacteria 22765
271 Ga0105237_10058234 3300009545 Bacteria 3867
272 Ga0105238_10016707 3300009551 Bacteria 7436
273 Ga0105238_10091911 3300009551 Bacteria 3022
274 Ga0105238_10165976 3300009551 Bacteria 2184
275 Ga0105238_10504063 3300009551 Bacteria 1212
276 Ga0105249_10000356 3300009553 Bacteria 45856
277 Ga0105249_10007976 3300009553 Bacteria 9231
278 Ga0105239_10179083 3300010375 Bacteria 2371
279 Ga0105239_10219964 3300010375 Bacteria 2130
280 Ga0105239_10611688 3300010375 Bacteria 1243
281 Ga0105239_11075055 3300010375 Bacteria 926
282 Ga0105246_10000436 3300011119 Bacteria 22273
283 Ga0105246_10000504 3300011119 Bacteria 21247
284 Ga0105246_10010430 3300011119 Bacteria 5750
285 Ga0105246_10023186 3300011119 Bacteria 4014
286 Ga0105246_10047287 3300011119 Bacteria 2938
287 Ga0157345_1000163 3300012498 Bacteria 11194
288 Ga0157373_10000586 3300013100 Bacteria 28347
289 Ga0157373_10003492 3300013100 Bacteria 11888
290 Ga0157373_10003814 3300013100 Bacteria 11399
291 Ga0157373_10006402 3300013100 Bacteria 8795
292 Ga0157373_10016680 3300013100 Bacteria 5352
293 Ga0157373_10031150 3300013100 Bacteria 3838
294 Ga0157373_10061092 3300013100 Bacteria 2669
295 Ga0157373_10390036 3300013100 Bacteria 997
296 Ga0157371_10000935 3300013102 Bacteria 32661
297 Ga0157371_10001391 3300013102 Bacteria 25247
298 Ga0157371_10004419 3300013102 Bacteria 12282
299 Ga0157371_10058580 3300013102 Bacteria 2732
300 Ga0157371_10223794 3300013102 Bacteria 1351
301 Ga0157370_10000495 3300013104 Bacteria 48993
302 Ga0157370_10008450 3300013104 Bacteria 11105
303 Ga0157370_10010774 3300013104 Bacteria 9612
304 Ga0157370_10029824 3300013104 Bacteria 5347
305 Ga0157370_10054054 3300013104 Bacteria 3828
306 Ga0157370_10073948 3300013104 Bacteria 3215
307 Ga0157370_10177270 3300013104 Bacteria 1981
308 Ga0157370_10469478 3300013104 Bacteria 1156
309 Ga0157369_10000464 3300013105 Bacteria 53767
310 Ga0157369_10009283 3300013105 Bacteria 11250
311 Ga0157369_10017873 3300013105 Bacteria 7960
312 Ga0157369_10022731 3300013105 Bacteria 6993
313 Ga0157369_10194966 3300013105 Bacteria 2127
314 Ga0157369_10229424 3300013105 Bacteria 1941
315 Ga0157369_10898889 3300013105 Bacteria 908
316 Ga0157374_10095689 3300013296 Bacteria 2840
317 Ga0157378_10003437 3300013297 Bacteria 14049
318 Ga0163162_10001225 3300013306 Bacteria 23961
319 Ga0163162_10014604 3300013306 Bacteria 7673
320 Ga0163162_10037697 3300013306 Bacteria 4825
321 Ga0163162_10082355 3300013306 Bacteria 3290
322 Ga0157375_10005374 3300013308 Bacteria 11127
323 Ga0157375_10008547 3300013308 Bacteria 8964
324 Ga0157375_10009695 3300013308 Bacteria 8467
325 Ga0157375_10049656 3300013308 Bacteria 4112
326 Ga0157375_10062273 3300013308 Bacteria 3706
327 Ga0163163_10122601 3300014325 Bacteria 2634
328 Ga0163163_10190075 3300014325 Bacteria 2102
329 Ga0163163_10489375 3300014325 Bacteria 1292
330 Ga0182008_10001337 3300014497 Bacteria 16791
331 Ga0182008_10003405 3300014497 Bacteria 9609
332 Ga0182008_10005486 3300014497 Bacteria 7221
333 Ga0182008_10009133 3300014497 Bacteria 5367
334 Ga0182008_10010188 3300014497 Bacteria 5038
335 Ga0157377_10037112 3300014745 Bacteria 2684
336 Ga0157379_10001501 3300014968 Bacteria 19208
337 Ga0157379_10022262 3300014968 Bacteria 5614
338 Ga0157376_10160193 3300014969 Bacteria 2039
339 Ga0157376_10199497 3300014969 Bacteria 1840
340 Ga0157376_10224360 3300014969 Bacteria 1742
341 Ga0182006_1001380 3300015261 Bacteria 14787
342 Ga0182006_1001917 3300015261 Bacteria 11851
343 Ga0182006_1002154 3300015261 Bacteria 10922
344 Ga0182006_1003725 3300015261 Bacteria 7705
345 Ga0182006_1060908 3300015261 Bacteria 1424
346 Ga0182007_10000228 3300015262 Bacteria 37784
347 Ga0182007_10054590 3300015262 Bacteria 1314
348 Ga0182005_1000375 3300015265 Bacteria 24704
349 Ga0182005_1004691 3300015265 Bacteria 4368
350 Ga0182005_1015515 3300015265 Bacteria 2123
351 Ga0182005_1022296 3300015265 Bacteria 1735
352 Ga0182005_1028587 3300015265 Bacteria 1520
353 Ga0182005_1073370 3300015265 Bacteria 941
354 Ga0163161_10003439 3300017792 Bacteria 11094
355 Ga0163161_10025857 3300017792 Bacteria 4156
356 Ga0163161_10026043 3300017792 Bacteria 4143
357 Ga0163161_10030292 3300017792 Bacteria 3849
358 Ga0163161_10062624 3300017792 Bacteria 2710
359 Ga0163161_10196908 3300017792 Bacteria 1551
360 Ga0213873_10005190 3300021358 Bacteria 2482
361 Ga0213872_10019359 3300021361 Bacteria 3136
362 Ga0213874_10002493 3300021377 Bacteria 3970
363 Ga0213876_10000183 3300021384 Bacteria 64845
364 Ga0213876_10002636 3300021384 Bacteria 10480
365 Ga0213876_10002883 3300021384 Bacteria 9985
366 Ga0213876_10063026 3300021384 Bacteria 1957
367 Ga0213876_10076158 3300021384 Bacteria 1772
368 Ga0213875_10001986 3300021388 Bacteria 12652
369 Ga0213875_10036093 3300021388 Bacteria 2331
370 Ga0213875_10064935 3300021388 Bacteria 1706
371 Ga0213871_10019712 3300021441 Bacteria 1663
372 Ga0209435_100424 3300025206 Bacteria 8905
373 Ga0209760_100082 3300025207 Bacteria 76168
374 Ga0209760_100230 3300025207 Bacteria 23968
375 Ga0209784_100007 3300025224 Bacteria 747715
376 Ga0209566_100009 3300025225 Bacteria 554018
377 Ga0209674_100021 3300025226 Bacteria 629811
378 Ga0209147_100009 3300025229 Bacteria 747409
379 Ga0209563_100018 3300025230 Bacteria 747850
380 Ga0207427_100005 3300025231 Bacteria 797999
381 Ga0207427_100006 3300025231 Bacteria 785415
382 Ga0209437_100013 3300025233 Bacteria 785457
383 Ga0209437_100018 3300025233 Bacteria 694400
384 Ga0209258_100237 3300025242 Bacteria 102220
385 Ga0209646_1000277 3300025246 Bacteria 45368
386 Ga0209677_100012 3300025253 Bacteria 554018
387 Ga0209759_1006965 3300025256 Bacteria 3713
388 Ga0209759_1017087 3300025256 Bacteria 1801
389 Ga0209129_1001075 3300025258 Bacteria 16097
390 Ga0209129_1014853 3300025258 Unclassified 1635
391 Ga0209233_1000021 3300025261 Bacteria 798078
392 Ga0209233_1000022 3300025261 Bacteria 785415
393 Ga0209565_1000846 3300025263 Bacteria 17296
394 Ga0209130_1025652 3300025284 Bacteria 1274
395 Ga0209675_1000481 3300025291 Bacteria 30301
396 Ga0209676_1000015 3300025292 Bacteria 784458
397 Ga0209676_1000157 3300025292 Bacteria 163094
398 Ga0209676_1000222 3300025292 Bacteria 124695
399 Ga0209676_1000242 3300025292 Bacteria 117224
400 Ga0209676_1000243 3300025292 Bacteria 117113
401 Ga0209676_1000311 3300025292 Bacteria 95478
402 Ga0209676_1000583 3300025292 Bacteria 54696
403 Ga0209676_1002476 3300025292 Bacteria 13015
404 Ga0209564_1000219 3300025295 Bacteria 129725
405 Ga0209758_1004180 3300025297 Bacteria 12268
406 Ga0209050_1000030 3300025298 Bacteria 463381
407 Ga0209050_1000058 3300025298 Bacteria 325558
408 Ga0209050_1000061 3300025298 Bacteria 321435
409 Ga0209050_1000244 3300025298 Bacteria 117105
410 Ga0209050_1000296 3300025298 Bacteria 104732
411 Ga0209050_1000375 3300025298 Bacteria 84503
412 Ga0209050_1001114 3300025298 Bacteria 32494
413 Ga0209050_1059597 3300025298 Bacteria 910
414 Ga0209256_1001588 3300025299 Bacteria 22236
415 Ga0209256_1017602 3300025299 Bacteria 2364
416 Ga0207426_1024894 3300025302 Bacteria 2024
417 Ga0209051_1000088 3300025303 Bacteria 180480
418 Ga0209051_1000143 3300025303 Bacteria 135182
419 Ga0209051_1000295 3300025303 Bacteria 79621
420 Ga0209051_1003593 3300025303 Bacteria 10081
421 Ga0209051_1009993 3300025303 Bacteria 4833
422 Ga0209257_1000140 3300025304 Bacteria 201515
423 Ga0209257_1000422 3300025304 Bacteria 81630
424 Ga0209257_1004459 3300025304 Bacteria 10837
425 Ga0209257_1009479 3300025304 Bacteria 5195
426 Ga0207656_10000009 3300025321 Bacteria 245637
427 Ga0207696_1000055 3300025711 Bacteria 258289
428 Ga0207696_1000127 3300025711 Bacteria 135531
429 Ga0207696_1000151 3300025711 Bacteria 120171
430 Ga0207696_1000165 3300025711 Bacteria 104683
431 Ga0207696_1001704 3300025711 Bacteria 11399
432 Ga0207696_1003033 3300025711 Bacteria 7843
433 Ga0207696_1003607 3300025711 Bacteria 6986
434 Ga0207696_1006652 3300025711 Bacteria 4624
435 Ga0207696_1015269 3300025711 Bacteria 2608
436 Ga0207696_1076906 3300025711 Bacteria 924
437 Ga0207655_1000135 3300025728 Bacteria 143597
438 Ga0207655_1000548 3300025728 Bacteria 47302
439 Ga0207655_1000667 3300025728 Bacteria 40487
440 Ga0207655_1000754 3300025728 Bacteria 36294
441 Ga0207655_1001254 3300025728 Bacteria 24214
442 Ga0207655_1001422 3300025728 Bacteria 22200
443 Ga0207655_1001733 3300025728 Bacteria 19145
444 Ga0207655_1002247 3300025728 Bacteria 15981
445 Ga0207655_1004181 3300025728 Bacteria 10359
446 Ga0207655_1006660 3300025728 Bacteria 7613
447 Ga0207655_1009133 3300025728 Bacteria 6196
448 Ga0207655_1011018 3300025728 Bacteria 5425
449 Ga0207655_1017979 3300025728 Bacteria 3781
450 Ga0207655_1028896 3300025728 Bacteria 2606
451 Ga0207655_1065329 3300025728 Bacteria 1381
452 Ga0207655_1066905 3300025728 Bacteria 1355
453 Ga0207655_1081641 3300025728 Bacteria 1164
454 Ga0207655_1113523 3300025728 Bacteria 911
455 Ga0207713_1000012 3300025735 Bacteria 501860
456 Ga0207713_1000103 3300025735 Bacteria 138415
457 Ga0207713_1000126 3300025735 Bacteria 118913
458 Ga0207713_1000297 3300025735 Bacteria 57038
459 Ga0207713_1000325 3300025735 Bacteria 53895
460 Ga0207713_1000984 3300025735 Bacteria 25052
461 Ga0207713_1002461 3300025735 Bacteria 13461
462 Ga0207713_1003599 3300025735 Bacteria 10444
463 Ga0207713_1004264 3300025735 Bacteria 9335
464 Ga0207713_1004634 3300025735 Bacteria 8877
465 Ga0207713_1004661 3300025735 Bacteria 8849
466 Ga0207713_1005396 3300025735 Bacteria 8014
467 Ga0207713_1005829 3300025735 Bacteria 7620
468 Ga0207713_1008163 3300025735 Bacteria 6061
469 Ga0207713_1016738 3300025735 Bacteria 3711
470 Ga0207713_1017509 3300025735 Bacteria 3588
471 Ga0207713_1025443 3300025735 Bacteria 2733
472 Ga0207713_1046805 3300025735 Bacteria 1756
473 Ga0207713_1088689 3300025735 Bacteria 1092
474 Ga0207713_1098176 3300025735 Bacteria 1016
475 Ga0207692_10015378 3300025898 Bacteria 3366
476 Ga0207710_10038644 3300025900 Bacteria 2111
477 Ga0207680_10085489 3300025903 Bacteria 1993
478 Ga0207647_10000010 3300025904 Bacteria 174219
479 Ga0207685_10011922 3300025905 Bacteria 2635
480 Ga0207643_10017888 3300025908 Bacteria 3881
481 Ga0207705_10002329 3300025909 Bacteria 14696
482 Ga0207707_10080846 3300025912 Bacteria 2837
483 Ga0207695_10001134 3300025913 Bacteria 46205
484 Ga0207695_10001421 3300025913 Bacteria 40289
485 Ga0207695_10028456 3300025913 Bacteria 6197
486 Ga0207671_10000876 3300025914 Bacteria 38121
487 Ga0207671_10334774 3300025914 Bacteria 1199
488 Ga0207693_10000021 3300025915 Bacteria 128800
489 Ga0207663_10056513 3300025916 Bacteria 2468
490 Ga0207660_10003341 3300025917 Bacteria 10470
491 Ga0207660_10133325 3300025917 Bacteria 1893
492 Ga0207662_10002043 3300025918 Bacteria 9992
493 Ga0207657_10007945 3300025919 Bacteria 10817
494 Ga0207649_10000007 3300025920 Bacteria 334217
495 Ga0207652_10054611 3300025921 Bacteria 3434
496 Ga0207681_10000291 3300025923 Bacteria 37201
497 Ga0207681_10001357 3300025923 Bacteria 15813
498 Ga0207681_10213847 3300025923 Bacteria 1488
499 Ga0207681_10414592 3300025923 Bacteria 1090
500 Ga0207694_10060428 3300025924 Bacteria 2949
501 Ga0207650_10000133 3300025925 Bacteria 90953
502 Ga0207650_10000308 3300025925 Bacteria 48275
503 Ga0207650_10000407 3300025925 Bacteria 38580
504 Ga0207650_10014558 3300025925 Bacteria 5465
505 Ga0207650_10492621 3300025925 Bacteria 1024
506 Ga0207659_10035819 3300025926 Bacteria 3433
507 Ga0207700_10000241 3300025928 Bacteria 32753
508 Ga0207700_10054000 3300025928 Bacteria 3013
509 Ga0207664_10015239 3300025929 Bacteria 5573
510 Ga0207644_10082031 3300025931 Bacteria 2384
511 Ga0207690_10000134 3300025932 Bacteria 60374
512 Ga0207690_10019025 3300025932 Bacteria 4218
513 Ga0207690_10059032 3300025932 Bacteria 2598
514 Ga0207706_10000050 3300025933 Bacteria 116811
515 Ga0207686_10001345 3300025934 Bacteria 13988
516 Ga0207686_10007359 3300025934 Bacteria 5925
517 Ga0207686_10067563 3300025934 Bacteria 2287
518 Ga0207709_10000107 3300025935 Bacteria 129240
519 Ga0207709_10000368 3300025935 Bacteria 45426
520 Ga0207709_10001047 3300025935 Bacteria 20429
521 Ga0207709_10044529 3300025935 Bacteria 2682
522 Ga0207670_10005327 3300025936 Bacteria 7050
523 Ga0207669_10047123 3300025937 Bacteria 2551
524 Ga0207704_10039182 3300025938 Bacteria 2756
525 Ga0207704_10055805 3300025938 Bacteria 2416
526 Ga0207665_10000465 3300025939 Bacteria 27775
527 Ga0207691_10133426 3300025940 Bacteria 2192
528 Ga0207711_10005329 3300025941 Bacteria 10907
529 Ga0207711_10046495 3300025941 Bacteria 3709
530 Ga0207711_10442639 3300025941 Bacteria 1209
531 Ga0207689_10020551 3300025942 Bacteria 5555
532 Ga0207679_10000013 3300025945 Bacteria 334197
533 Ga0207679_10016582 3300025945 Bacteria 4895
534 Ga0207679_10039343 3300025945 Bacteria 3376
535 Ga0207667_10096443 3300025949 Bacteria 3052
536 Ga0207667_10109685 3300025949 Bacteria 2846
537 Ga0207667_10176225 3300025949 Bacteria 2197
538 Ga0207651_10033951 3300025960 Bacteria 3297
539 Ga0207651_10201252 3300025960 Bacteria 1596
540 Ga0207712_10000790 3300025961 Bacteria 23489
541 Ga0207668_10000718 3300025972 Bacteria 20265
542 Ga0207640_10080376 3300025981 Bacteria 2225
543 Ga0207658_10000931 3300025986 Bacteria 24185
544 Ga0207658_10085271 3300025986 Bacteria 2432
545 Ga0207677_10096803 3300026023 Bacteria 2160
546 Ga0207703_10002235 3300026035 Bacteria 16933
547 Ga0207703_10499048 3300026035 Bacteria 1142
548 Ga0207639_10000079 3300026041 Bacteria 83859
549 Ga0207639_10157496 3300026041 Bacteria 1910
550 Ga0207678_10012003 3300026067 Bacteria 7609
551 Ga0207678_10184033 3300026067 Bacteria 1784
552 Ga0207708_10058009 3300026075 Bacteria 2954
553 Ga0207702_10099548 3300026078 Bacteria 2563
554 Ga0207702_10130565 3300026078 Bacteria 2260
555 Ga0207641_10011031 3300026088 Bacteria 7410
556 Ga0207641_10024917 3300026088 Bacteria 4932
557 Ga0207641_10164515 3300026088 Bacteria 2019
558 Ga0207641_10172025 3300026088 Bacteria 1978
559 Ga0207648_10007368 3300026089 Bacteria 10835
560 Ga0207648_10070388 3300026089 Bacteria 3050
561 Ga0207676_10000109 3300026095 Bacteria 74080
562 Ga0207676_10005349 3300026095 Bacteria 9092
563 Ga0207674_10025731 3300026116 Bacteria 6267
564 Ga0207683_10000599 3300026121 Bacteria 33250
565 Ga0209281_1000237 3300027111 Bacteria 112688
566 Ga0209281_1002242 3300027111 Bacteria 8247
567 Ga0209281_1003265 3300027111 Bacteria 5497
568 Ga0209389_1000065 3300027296 Bacteria 102064
569 Ga0209389_1041832 3300027296 Bacteria 3489
570 Ga0209371_1000087 3300027312 Bacteria 175021
571 Ga0209371_1000176 3300027312 Bacteria 95739
572 Ga0209371_1000735 3300027312 Bacteria 27499
573 Ga0209371_1010326 3300027312 Bacteria 2885
574 Ga0209999_1001854 3300027543 Bacteria 3677
575 Ga0209983_1026486 3300027665 Bacteria 1227
576 Ga0207428_10006022 3300027907 Bacteria 11219
577 Ga0207428_10039216 3300027907 Bacteria 3845
578 Ga0207428_10039688 3300027907 Bacteria 3823
579 Ga0207428_10043963 3300027907 Bacteria 3605
580 Ga0207428_10078153 3300027907 Bacteria 2590
581 Ga0207428_10079559 3300027907 Bacteria 2563
582 Ga0207428_10233560 3300027907 Bacteria 1376
583 Ga0268266_10000005 3300028379 Bacteria 1448194
584 Ga0268266_10002063 3300028379 Bacteria 22264
585 Ga0268266_10002796 3300028379 Bacteria 18197
586 Ga0268266_10065003 3300028379 Bacteria 3153
587 Ga0268266_10074778 3300028379 Bacteria 2942
588 Ga0268266_10099303 3300028379 Bacteria 2562
589 Ga0268266_10116472 3300028379 Bacteria 2373
590 Ga0268265_10002972 3300028380 Bacteria 12401
591 Ga0268265_10005179 3300028380 Bacteria 8933
592 Ga0268265_10193008 3300028380 Bacteria 1760
593 Ga0268265_10814574 3300028380 Bacteria 911
594 Ga0268264_10209512 3300028381 Bacteria 1788
595 Ga0307517_10003720 3300028786 Bacteria 23706
596 Ga0307517_10032178 3300028786 Bacteria 6072
597 Ga0307515_10021855 3300028794 Bacteria 11317
598 Ga0307515_10027521 3300028794 Bacteria 9715
599 Ga0265338_10011798 3300028800 Bacteria 10044
600 Ga0265338_10071753 3300028800 Bacteria 2960
601 Ga0265338_10189119 3300028800 Bacteria 1562
602 Ga0268256_1000101 3300030500 Bacteria 130956
603 Ga0268256_1000146 3300030500 Bacteria 95753
604 Ga0268256_1000625 3300030500 Bacteria 27486
605 Ga0268256_1011074 3300030500 Bacteria 2885
606 Ga0307511_10008829 3300030521 Bacteria 10062
607 Ga0314311_1262089 3300030733 Bacteria 7107
608 Ga0316178_1036683 3300030735 Bacteria 48421
609 Ga0316183_1050417 3300030742 Bacteria 3627
610 Ga0265760_10026665 3300031090 Bacteria 1691
611 Ga0265329_10016433 3300031242 Bacteria 2563
612 Ga0265331_10026729 3300031250 Unclassified 2898
613 Ga0265327_10000394 3300031251 Bacteria 81965
614 Ga0265327_10000764 3300031251 Bacteria 49808
615 Ga0265327_10000933 3300031251 Bacteria 42834
616 Ga0265327_10001245 3300031251 Bacteria 33996
617 Ga0265327_10005511 3300031251 Bacteria 10525
618 Ga0265316_10000395 3300031344 Bacteria 49755
619 Ga0307513_10021039 3300031456 Bacteria 7710
620 Ga0307513_10053499 3300031456 Bacteria 4338
621 Ga0307509_10114426 3300031507 Bacteria 2692
622 Ga0307408_100000002 3300031548 Bacteria 827227
623 Ga0307408_100002301 3300031548 Bacteria 13596
624 Ga0307408_100045292 3300031548 Bacteria 3141
625 Ga0307408_100162575 3300031548 Bacteria 1774
626 Ga0316575_10000476 3300031665 Bacteria 11561
627 Ga0316579_10026379 3300031691 Bacteria 2631
628 Ga0316578_10008639 3300031728 Bacteria 5194
629 Ga0316577_10000611 3300031733 Bacteria 14754
630 Ga0307413_10135376 3300031824 Bacteria 1693
631 Ga0307406_10497533 3300031901 Bacteria 988
632 Ga0307407_10348269 3300031903 Bacteria 1048
633 Ga0307412_10115149 3300031911 Bacteria 1926
634 Ga0307409_100045637 3300031995 Bacteria 3310
635 Ga0307409_100105426 3300031995 Bacteria 2350
636 Ga0307416_100106393 3300032002 Bacteria 2459
637 Ga0307416_100181428 3300032002 Bacteria 1974
638 Ga0307416_100426991 3300032002 Bacteria 1371
639 Ga0307414_10133798 3300032004 Bacteria 1929
640 Ga0307414_10698186 3300032004 Bacteria 918
641 Ga0307411_10010751 3300032005 Bacteria 4897
642 Ga0307411_10122994 3300032005 Bacteria 1881
643 Ga0307411_10125159 3300032005 Bacteria 1868
644 Ga0307411_10171378 3300032005 Bacteria 1637
645 Ga0307415_100176251 3300032126 Bacteria 1673
646 Ga0307415_100463762 3300032126 Bacteria 1098
647 Ga0316583_10001101 3300032133 Bacteria 8783
648 Ga0316583_10002300 3300032133 Bacteria 6588
649 Ga0316583_10015720 3300032133 Bacteria 2725
650 Ga0316585_10002081 3300032137 Bacteria 5369
651 Ga0316580_10005072 3300032139 Bacteria 3829
652 Ga0307510_10010168 3300033180 Bacteria 11188
653 Ga0307510_10046095 3300033180 Bacteria 4694
654 Ga0316214_1014381 3300033545 Bacteria 1089
655 Ga0373929_0062312 3300035085 Bacteria 876
656 Ga0373934_0000039 3300035086 Bacteria 43197
657 Ga0373923_0270195 3300035111 Bacteria 799
658 Ga0373953_0195503 3300035117 Bacteria 874
659 Ga0373956_0000165 3300035119 Bacteria 24697
660 Ga0373956_0177561 3300035119 Bacteria 1006
661 Ga0373957_0000698 3300035120 Bacteria 8694
662 Ga0373943_0056693 3300035170 Bacteria 1945
663 Ga0373946_0007070 3300035171 Bacteria 4096
664 Ga0373955_0004254 3300035172 Bacteria 6322
665 Ga0316574_0155392 3300035398 Bacteria 1474
666 Ga0373935_0098345 3300035692 Bacteria 1926
667 Ga0373927_0000130 3300035695 Bacteria 57890
668 Ga0373927_0079455 3300035695 Bacteria 2125
669 Ga0373933_0008171 3300035724 Bacteria 5711
670 Ga0373947_0145709 3300035725 Bacteria 1522
671 Ga0373937_0015350 3300036401 Bacteria 6774
672 Ga0373937_0026675 3300036401 Bacteria 5220
673 Ga0373937_0259061 3300036401 Bacteria 1640
674 Ga0316582_0000534 3300036647 Bacteria 14508
675 Ga0316582_0015883 3300036647 Bacteria 4318
676 Ga0316582_0350552 3300036647 Bacteria 1015
677 Ga0316584_0135592 3300036712 Bacteria 1837
678 Ga0316584_0184876 3300036712 Bacteria 1542
679 Ga0373925_0036513 3300037068 Bacteria 3626
680 Ga0395899_0016645 3300037312 Bacteria 5607
681 Ga0395900_0000010 3300037418 Bacteria 461364
682 Ga0395898_0034425 3300037466 Bacteria 5048
683 Ga0395898_0123153 3300037466 Bacteria 2484
684 Ga0395905_0001301 3300037471 Bacteria 30685
685 Ga0316581_0014022 3300037588 Bacteria 2279
686 Ga0436364_0959921 3300037853 Bacteria 2357
687 Ga0436364_1061319 3300037853 Bacteria 1945
688 Ga0436364_1109728 3300037853 Bacteria 2074
689 Ga0436364_1346974 3300037853 Bacteria 3423
690 Ga0395901_0000007 3300038443 Bacteria 497408
691 Ga0400484_04287 3300038725 Bacteria 14642
692 Ga0400484_11728 3300038725 Bacteria 7352
693 Ga0400484_44564 3300038725 Bacteria 1791
694 Ga0400490_06422 3300038726 Bacteria 2206
695 Ga0400490_18130 3300038726 Bacteria 3068
696 Ga0400491_04024 3300038727 Bacteria 1329
697 Ga0436365_0156475 3300039437 Bacteria 37868
698 Ga0436365_0356842 3300039437 Bacteria 18396
699 Ga0436365_0638922 3300039437 Bacteria 1466
700 Ga0436365_0640791 3300039437 Bacteria 50242
701 Ga0436365_1846384 3300039437 Bacteria 2081
702 Ga0436360_0428272 3300039438 Bacteria 6302
703 Ga0436361_0129444 3300039447 Bacteria 9167
704 Ga0436363_0538450 3300039450 Bacteria 22269
705 Ga0436363_1520052 3300039450 Bacteria 6158
706 Ga0436362_0582461 3300039453 Bacteria 7924
707 Ga0439436_0000652 3300041404 Bacteria 9230
708 Ga0439438_000437 3300041405 Bacteria 18952
709 Ga0439438_001281 3300041405 Bacteria 11122
710 Ga0439438_002577 3300041405 Bacteria 7683
711 Ga0439438_005287 3300041405 Bacteria 4778
712 Ga0439438_005461 3300041405 Bacteria 4670
713 Ga0439438_007479 3300041405 Bacteria 3729
714 Ga0439438_007560 3300041405 Bacteria 3700
715 Ga0439447_000128 3300041407 Bacteria 25836
716 Ga0439447_000462 3300041407 Bacteria 15142
717 Ga0439447_004152 3300041407 Bacteria 5032
718 Ga0439466_0000343 3300041411 Bacteria 17888
719 Ga0439466_0001334 3300041411 Bacteria 9623
720 Ga0439466_0004277 3300041411 Bacteria 5514
721 Ga0439466_0006839 3300041411 Bacteria 4324
722 Ga0439466_0022672 3300041411 Bacteria 2213
723 Ga0439466_0036944 3300041411 Bacteria 1647
724 Ga0439466_0072946 3300041411 Bacteria 1091
725 Ga0439465_0002085 3300041413 Bacteria 6568
726 Ga0439432_001014 3300042006 Bacteria 10614
727 Ga0439432_003214 3300042006 Bacteria 6079
728 Ga0439432_003970 3300042006 Bacteria 5437
729 Ga0439432_008308 3300042006 Bacteria 3648
730 Ga0439432_037651 3300042006 Bacteria 1543
731 Ga0439451_003180 3300042009 Bacteria 3333
732 Ga0439452_000190 3300042010 Bacteria 45505
733 Ga0439452_000443 3300042010 Bacteria 23463
734 Ga0439452_001195 3300042010 Bacteria 11155
735 Ga0439452_002167 3300042010 Bacteria 7428
736 Ga0439452_002256 3300042010 Bacteria 7225
737 Ga0439452_032955 3300042010 Bacteria 1261
738 Ga0439456_000036 3300042013 Bacteria 49413
739 Ga0439456_001085 3300042013 Bacteria 5413
740 Ga0439456_004035 3300042013 Bacteria 2980
741 Ga0439463_000120 3300042016 Bacteria 19571
742 Ga0439463_000491 3300042016 Bacteria 11038
743 Ga0439463_003161 3300042016 Bacteria 4180
744 Ga0439463_005639 3300042016 Bacteria 3109
745 Ga0450911_000509 3300042115 Bacteria 12334
746 Ga0450911_000543 3300042115 Bacteria 11754
747 Ga0450911_001948 3300042115 Bacteria 4320
748 Ga0450919_000957 3300042121 Bacteria 3741
749 Ga0450920_002368 3300042122 Bacteria 3201
750 Ga0450922_000657 3300042124 Bacteria 3607
751 Ga0450923_001543 3300042125 Bacteria 3092
752 Ga0450890_000131 3300042127 Bacteria 11737
753 Ga0450900_000084 3300042136 Bacteria 4887
754 Ga0450903_005080 3300042138 Bacteria 2215
755 Ga0450903_008578 3300042138 Bacteria 1671
756 Ga0450905_000122 3300042142 Bacteria 7925
757 Ga0450905_004899 3300042142 Bacteria 1788
758 Ga0450907_000110 3300042146 Bacteria 31083
759 Ga0450907_001935 3300042146 Bacteria 4182
760 Ga0450910_002464 3300042147 Bacteria 2430
761 Ga0450910_024120 3300042147 Bacteria 932
762 Ga0439446_0002401 3300042156 Bacteria 4489
763 Ga0439446_0002959 3300042156 Bacteria 4155
764 Ga0450908_000050 3300042184 Bacteria 23798
765 Ga0450909_000363 3300042185 Bacteria 5765
766 Ga0450909_001941 3300042185 Bacteria 2921
767 Ga0439434_0000092 3300042435 Bacteria 22644
768 Ga0439464_0000277 3300042439 Bacteria 9613
769 Ga0439464_0006232 3300042439 Bacteria 3104
770 Ga0439464_0012378 3300042439 Bacteria 2273
771 Ga0439460_0003102 3300042461 Bacteria 4018
772 Ga0439460_0008742 3300042461 Bacteria 2560
773 Ga0450901_000475 3300042533 Bacteria 4768
774 Ga0451577_0003511 3300042876 Bacteria 17381
775 Ga0451577_0125705 3300042876 Bacteria 2298
776 Ga0451577_0156363 3300042876 Bacteria 2052
777 Ga0439440_0000808 3300042993 Bacteria 5423
778 Ga0466965_0059528 3300044683 Bacteria 1907
779 Ga0466968_0032261 3300044735 Bacteria 2178
780 Ga0495617_000386 3300046452 Bacteria 24346
781 Ga0495617_004591 3300046452 Bacteria 5001
782 Ga0495617_084803 3300046452 Bacteria 1036
783 Ga0495627_000095 3300046453 Bacteria 108094
784 Ga0495627_000646 3300046453 Bacteria 27194
785 Ga0495627_001581 3300046453 Bacteria 12884
786 Ga0495627_004712 3300046453 Bacteria 5637
787 Ga0495603_0001944 3300046455 Bacteria 12181
788 Ga0495590_0000388 3300046457 Bacteria 22311
789 Ga0495590_0000460 3300046457 Bacteria 20084
790 Ga0495590_0001474 3300046457 Bacteria 10144
791 Ga0495590_0007082 3300046457 Bacteria 4340
792 Ga0495590_0025857 3300046457 Bacteria 2062
793 Ga0495591_000334 3300046458 Bacteria 42109
794 Ga0495591_000628 3300046458 Bacteria 26285
795 Ga0495591_000923 3300046458 Bacteria 20257
796 Ga0495591_001427 3300046458 Bacteria 14881
797 Ga0495591_002016 3300046458 Bacteria 11817
798 Ga0495591_002140 3300046458 Bacteria 11330
799 Ga0495591_002379 3300046458 Bacteria 10553
800 Ga0495591_004970 3300046458 Bacteria 6292
801 Ga0495591_005398 3300046458 Bacteria 5930
802 Ga0495591_007620 3300046458 Bacteria 4569
803 Ga0495591_016596 3300046458 Bacteria 2557
804 Ga0495591_018027 3300046458 Bacteria 2405
805 Ga0495638_0000326 3300046460 Bacteria 60360
806 Ga0495638_0004508 3300046460 Bacteria 10549
807 Ga0495638_0034918 3300046460 Bacteria 3208
808 Ga0495638_0045219 3300046460 Bacteria 2770
809 Ga0495638_0065440 3300046460 Bacteria 2237
810 Ga0495638_0225126 3300046460 Bacteria 1046
811 Ga0495638_0288369 3300046460 Bacteria 889
812 Ga0495651_0005051 3300046462 Bacteria 10075
813 Ga0495653_0007203 3300046463 Bacteria 9113
814 Ga0495653_0012336 3300046463 Bacteria 6972
815 Ga0495650_0001617 3300046471 Bacteria 21024
816 Ga0495650_0001916 3300046471 Bacteria 18422
817 Ga0495650_0007358 3300046471 Bacteria 6633
818 Ga0495650_0009773 3300046471 Bacteria 5424
819 Ga0495650_0017685 3300046471 Bacteria 3566
820 Ga0495650_0024217 3300046471 Bacteria 2869
821 Ga0495650_0054220 3300046471 Bacteria 1637
822 Ga0495582_0000456 3300046473 Bacteria 22343
823 Ga0495605_0000019 3300046474 Bacteria 270010
824 Ga0495605_0000376 3300046474 Bacteria 42124
825 Ga0495605_0000384 3300046474 Bacteria 40989
826 Ga0495605_0002242 3300046474 Bacteria 12068
827 Ga0495605_0004010 3300046474 Bacteria 8696
828 Ga0495605_0004235 3300046474 Bacteria 8450
829 Ga0495605_0004852 3300046474 Bacteria 7866
830 Ga0495605_0006168 3300046474 Bacteria 6913
831 Ga0495605_0009596 3300046474 Bacteria 5435
832 Ga0495605_0011143 3300046474 Bacteria 5024
833 Ga0495605_0020125 3300046474 Bacteria 3549
834 Ga0495605_0033602 3300046474 Bacteria 2602
835 Ga0495605_0080499 3300046474 Bacteria 1524
836 Ga0495639_0000295 3300046475 Bacteria 24407
837 Ga0495662_0146533 3300046476 Bacteria 1163
838 Ga0495584_0000408 3300046491 Bacteria 29754
839 Ga0495584_0002140 3300046491 Bacteria 11289
840 Ga0495584_0002646 3300046491 Bacteria 10080
841 Ga0495584_0003319 3300046491 Bacteria 8901
842 Ga0495584_0006064 3300046491 Bacteria 6363
843 Ga0495584_0006289 3300046491 Bacteria 6223
844 Ga0495584_0033007 3300046491 Bacteria 2618
845 Ga0495584_0043001 3300046491 Bacteria 2280
846 Ga0495584_0249412 3300046491 Bacteria 902
847 Ga0495585_0000895 3300046492 Bacteria 25250
848 Ga0495585_0011646 3300046492 Bacteria 5202
849 Ga0495585_0012147 3300046492 Bacteria 5079
850 Ga0495585_0014639 3300046492 Bacteria 4564
851 Ga0495585_0017769 3300046492 Bacteria 4105
852 Ga0495585_0034670 3300046492 Bacteria 2853
853 Ga0495594_0005851 3300046499 Bacteria 6317
854 Ga0495596_0000175 3300046500 Bacteria 44764
855 Ga0495596_0012956 3300046500 Bacteria 3551
856 Ga0495607_0000024 3300046501 Bacteria 159904
857 Ga0495607_0000531 3300046501 Bacteria 37437
858 Ga0495607_0000751 3300046501 Bacteria 31037
859 Ga0495607_0001123 3300046501 Bacteria 24276
860 Ga0495607_0003423 3300046501 Bacteria 12155
861 Ga0495607_0003609 3300046501 Bacteria 11756
862 Ga0495607_0012855 3300046501 Bacteria 5506
863 Ga0495607_0017733 3300046501 Bacteria 4559
864 Ga0495607_0030789 3300046501 Bacteria 3290
865 Ga0495607_0052787 3300046501 Bacteria 2352
866 Ga0495607_0113048 3300046501 Bacteria 1436
867 Ga0495607_0139380 3300046501 Bacteria 1252
868 Ga0495607_0189960 3300046501 Bacteria 1024
869 Ga0495583_0000146 3300046506 Bacteria 119793
870 Ga0495583_0000452 3300046506 Bacteria 61394
871 Ga0495583_0001254 3300046506 Bacteria 26768
872 Ga0495583_0001293 3300046506 Bacteria 26098
873 Ga0495583_0004428 3300046506 Bacteria 10053
874 Ga0495583_0005244 3300046506 Bacteria 8889
875 Ga0495583_0007005 3300046506 Bacteria 7216
876 Ga0495583_0008331 3300046506 Bacteria 6353
877 Ga0495606_0000115 3300046507 Bacteria 135589
878 Ga0495606_0001164 3300046507 Bacteria 37202
879 Ga0495606_0002670 3300046507 Bacteria 20254
880 Ga0495606_0007824 3300046507 Bacteria 9438
881 Ga0495606_0008572 3300046507 Bacteria 8847
882 Ga0495606_0017468 3300046507 Bacteria 5422
883 Ga0495606_0021308 3300046507 Bacteria 4748
884 Ga0495610_0003687 3300046512 Bacteria 11763
885 Ga0495610_0004027 3300046512 Bacteria 11082
886 Ga0495610_0004226 3300046512 Bacteria 10697
887 Ga0495610_0007330 3300046512 Bacteria 7374
888 Ga0495610_0007573 3300046512 Bacteria 7191
889 Ga0495610_0008416 3300046512 Bacteria 6687
890 Ga0495610_0011490 3300046512 Bacteria 5412
891 Ga0495610_0014586 3300046512 Bacteria 4609
892 Ga0495610_0015654 3300046512 Bacteria 4397
893 Ga0495610_0022458 3300046512 Bacteria 3450
894 Ga0495610_0023562 3300046512 Bacteria 3342
895 Ga0495610_0032725 3300046512 Bacteria 2697
896 Ga0495616_0038638 3300046513 Bacteria 2450
897 Ga0495616_0044969 3300046513 Bacteria 2237
898 Ga0495616_0050447 3300046513 Bacteria 2080
899 Ga0495616_0064360 3300046513 Bacteria 1789
900 Ga0495616_0120987 3300046513 Bacteria 1208
901 Ga0495620_0000023 3300046515 Bacteria 131512
902 Ga0495620_0000108 3300046515 Bacteria 66218
903 Ga0495620_0001719 3300046515 Bacteria 12933
904 Ga0495620_0002090 3300046515 Bacteria 11609
905 Ga0495620_0009332 3300046515 Bacteria 5223
906 Ga0495620_0014190 3300046515 Bacteria 4056
907 Ga0495620_0048260 3300046515 Bacteria 1828
908 Ga0495620_0052870 3300046515 Bacteria 1722
909 Ga0495630_0107281 3300046517 Bacteria 2115
910 Ga0495631_0001318 3300046518 Bacteria 15202
911 Ga0495631_0002233 3300046518 Bacteria 11131
912 Ga0495631_0002655 3300046518 Bacteria 9972
913 Ga0495631_0005054 3300046518 Bacteria 6949
914 Ga0495631_0006347 3300046518 Bacteria 6113
915 Ga0495631_0026439 3300046518 Bacteria 2665
916 Ga0495631_0045974 3300046518 Bacteria 1921
917 Ga0495631_0049399 3300046518 Bacteria 1841
918 Ga0495632_0001083 3300046519 Bacteria 23346
919 Ga0495632_0001735 3300046519 Bacteria 17682
920 Ga0495632_0001795 3300046519 Bacteria 17318
921 Ga0495632_0002669 3300046519 Bacteria 13373
922 Ga0495632_0004841 3300046519 Bacteria 9042
923 Ga0495632_0004928 3300046519 Bacteria 8951
924 Ga0495632_0055660 3300046519 Bacteria 1935
925 Ga0495632_0215176 3300046519 Bacteria 870
926 Ga0495637_0000054 3300046520 Bacteria 99531
927 Ga0495637_0000194 3300046520 Bacteria 47572
928 Ga0495637_0000269 3300046520 Bacteria 41036
929 Ga0495637_0000466 3300046520 Bacteria 29566
930 Ga0495637_0002490 3300046520 Bacteria 10165
931 Ga0495637_0003116 3300046520 Bacteria 8852
932 Ga0495637_0004382 3300046520 Bacteria 7320
933 Ga0495637_0005192 3300046520 Bacteria 6669
934 Ga0495637_0011746 3300046520 Bacteria 4199
935 Ga0495637_0019417 3300046520 Bacteria 3142
936 Ga0495637_0057374 3300046520 Bacteria 1608
937 Ga0495643_0000730 3300046522 Bacteria 37461
938 Ga0495643_0001170 3300046522 Bacteria 25602
939 Ga0495643_0015823 3300046522 Bacteria 4445
940 Ga0495643_0018489 3300046522 Bacteria 4048
941 Ga0495643_0052789 3300046522 Bacteria 2181
942 Ga0495643_0075803 3300046522 Bacteria 1759
943 Ga0495644_0001554 3300046523 Bacteria 9358
944 Ga0495644_0003019 3300046523 Bacteria 6662
945 Ga0495644_0003034 3300046523 Bacteria 6645
946 Ga0495644_0003287 3300046523 Bacteria 6390
947 Ga0495648_0000165 3300046524 Bacteria 78462
948 Ga0495648_0000783 3300046524 Bacteria 33886
949 Ga0495648_0001858 3300046524 Bacteria 20225
950 Ga0495648_0002460 3300046524 Bacteria 17056
951 Ga0495648_0002748 3300046524 Bacteria 15885
952 Ga0495648_0004730 3300046524 Bacteria 11529
953 Ga0495648_0005172 3300046524 Bacteria 10916
954 Ga0495648_0007923 3300046524 Bacteria 8427
955 Ga0495648_0008056 3300046524 Bacteria 8336
956 Ga0495648_0012578 3300046524 Bacteria 6301
957 Ga0495648_0043672 3300046524 Bacteria 2806
958 Ga0495648_0113046 3300046524 Bacteria 1473
959 Ga0495648_0146522 3300046524 Bacteria 1236
960 Ga0495666_0001604 3300046526 Bacteria 11127
961 Ga0495666_0008958 3300046526 Bacteria 5007
962 Ga0495666_0036593 3300046526 Bacteria 2390
963 Ga0495642_0000536 3300046528 Bacteria 19246
964 Ga0495642_0000555 3300046528 Bacteria 18832
965 Ga0495642_0001444 3300046528 Bacteria 10638
966 Ga0495654_0000404 3300046530 Bacteria 36985
967 Ga0495654_0001010 3300046530 Bacteria 20620
968 Ga0495654_0001692 3300046530 Bacteria 14844
969 Ga0495654_0002438 3300046530 Bacteria 11969
970 Ga0495654_0005580 3300046530 Bacteria 7283
971 Ga0495654_0006844 3300046530 Bacteria 6432
972 Ga0495654_0007375 3300046530 Bacteria 6144
973 Ga0495654_0007795 3300046530 Bacteria 5953
974 Ga0495654_0031295 3300046530 Bacteria 2701
975 Ga0495654_0032061 3300046530 Bacteria 2664
976 Ga0495654_0032647 3300046530 Bacteria 2638
977 Ga0495665_0190299 3300046531 Bacteria 1065
978 Ga0495586_0005132 3300046535 Bacteria 7010
979 Ga0495587_0003520 3300046536 Bacteria 10428
980 Ga0495609_0000061 3300046538 Bacteria 139848
981 Ga0495609_0000101 3300046538 Bacteria 100818
982 Ga0495609_0000696 3300046538 Bacteria 25895
983 Ga0495609_0004755 3300046538 Bacteria 7342
984 Ga0495609_0005878 3300046538 Bacteria 6355
985 Ga0495609_0009579 3300046538 Bacteria 4683
986 Ga0495609_0062227 3300046538 Bacteria 1648
987 Ga0495597_0009099 3300046542 Bacteria 4931
988 Ga0495597_0011291 3300046542 Bacteria 4335
989 Ga0495597_0030031 3300046542 Bacteria 2478
990 Ga0495597_0059307 3300046542 Bacteria 1671
991 Ga0495597_0070344 3300046542 Bacteria 1509
992 Ga0495645_0005791 3300046543 Bacteria 8525
993 Ga0495622_0001089 3300046557 Bacteria 14195
994 Ga0495622_0001805 3300046557 Bacteria 10548
995 Ga0495622_0009631 3300046557 Bacteria 4466
996 Ga0495622_0010425 3300046557 Bacteria 4292
997 Ga0495622_0060819 3300046557 Bacteria 1749
998 Ga0495633_0000129 3300046558 Bacteria 100833
999 Ga0495633_0003624 3300046558 Bacteria 10211
1000 Ga0495668_0000456 3300046616 Bacteria 52300
1001 Ga0495668_0003520 3300046616 Bacteria 11662
1002 Ga0495668_0005068 3300046616 Bacteria 9068
1003 Ga0495668_0008651 3300046616 Bacteria 6328
1004 Ga0495668_0017023 3300046616 Bacteria 4221
1005 Ga0495668_0024129 3300046616 Bacteria 3460
1006 Ga0495668_0058681 3300046616 Bacteria 2123
1007 Ga0495668_0078486 3300046616 Bacteria 1813
1008 Ga0495668_0087826 3300046616 Bacteria 1705
1009 Ga0495634_0005870 3300046642 Bacteria 9381
1010 Ga0495634_0181392 3300046642 Bacteria 1318
1011 Ga0495611_0000525 3300046648 Bacteria 22782
1012 Ga0495611_0000571 3300046648 Bacteria 21238
1013 Ga0495611_0001821 3300046648 Bacteria 10218
1014 Ga0495611_0012098 3300046648 Bacteria 3667
1015 Ga0495611_0013014 3300046648 Bacteria 3538
1016 Ga0495611_0027813 3300046648 Bacteria 2475
1017 Ga0495625_0000147 3300046660 Bacteria 107983
1018 Ga0495625_0010589 3300046660 Bacteria 7612
1019 Ga0495625_0022435 3300046660 Bacteria 4840
1020 Ga0495625_0023226 3300046660 Bacteria 4739
1021 Ga0495625_0097020 3300046660 Bacteria 2029
1022 Ga0495635_0000583 3300046663 Bacteria 23456
1023 Ga0495635_0012360 3300046663 Bacteria 5983
1024 Ga0495659_0000380 3300046664 Bacteria 17135
1025 Ga0495661_0000153 3300046665 Bacteria 81096
1026 Ga0495661_0000196 3300046665 Bacteria 69840
1027 Ga0495661_0000484 3300046665 Bacteria 41967
1028 Ga0495661_0001282 3300046665 Bacteria 21506
1029 Ga0495661_0001727 3300046665 Bacteria 17684
1030 Ga0495661_0023738 3300046665 Bacteria 3975
1031 Ga0495661_0042494 3300046665 Bacteria 2801
1032 Ga0495661_0137531 3300046665 Bacteria 1332
1033 Ga0495588_0045613 3300046674 Bacteria 2247
1034 Ga0495657_0054974 3300046675 Bacteria 2657
1035 Ga0495623_0017742 3300046679 Bacteria 4597
1036 Ga0495646_0000923 3300046680 Bacteria 16700
1037 Ga0495646_0039662 3300046680 Bacteria 2902
1038 Ga0495658_0043062 3300046683 Bacteria 2523
1039 Ga0495669_0014877 3300046684 Bacteria 3328
1040 Ga0495624_0003816 3300046690 Bacteria 11140
1041 Ga0495670_0000388 3300046691 Bacteria 21005
1042 Ga0495670_0001561 3300046691 Bacteria 11194
1043 Ga0495670_0003729 3300046691 Bacteria 7496
1044 Ga0495670_0013134 3300046691 Bacteria 4071
1045 Ga0495670_0033110 3300046691 Bacteria 2571
1046 Ga0495670_0180903 3300046691 Bacteria 1113
1047 Ga0495671_0000471 3300046692 Bacteria 31523
1048 Ga0495671_0001900 3300046692 Bacteria 13409
1049 Ga0495671_0003438 3300046692 Bacteria 9728
1050 Ga0495671_0007329 3300046692 Bacteria 6297
1051 Ga0495671_0009812 3300046692 Bacteria 5332
1052 Ga0495671_0010835 3300046692 Bacteria 5039
1053 Ga0495671_0026950 3300046692 Bacteria 2973
1054 Ga0495671_0034401 3300046692 Bacteria 2576
1055 Ga0495671_0135720 3300046692 Bacteria 1199
1056 Ga0495649_0000968 3300046694 Bacteria 22667
1057 Ga0495649_0001584 3300046694 Bacteria 17031
1058 Ga0495649_0007483 3300046694 Bacteria 6650
1059 Ga0495649_0027028 3300046694 Bacteria 3185
1060 Ga0495649_0031798 3300046694 Bacteria 2909
1061 Ga0495649_0036976 3300046694 Bacteria 2681
1062 Ga0495649_0053755 3300046694 Bacteria 2179
1063 Ga0495589_0000668 3300046794 Bacteria 22510
1064 Ga0495589_0002719 3300046794 Bacteria 9775
1065 Ga0495589_0011005 3300046794 Bacteria 4696
1066 Ga0495589_0034990 3300046794 Bacteria 2519
1067 Ga0495589_0039482 3300046794 Bacteria 2358
1068 Ga0495600_0038322 3300046809 Bacteria 3118
1069 Ga0495660_0000431 3300046810 Bacteria 35256
1070 Ga0495660_0002451 3300046810 Bacteria 11842
1071 Ga0495660_0005838 3300046810 Bacteria 7344
1072 Ga0495660_0007185 3300046810 Bacteria 6558
1073 Ga0495660_0009508 3300046810 Bacteria 5667
1074 Ga0495660_0010383 3300046810 Bacteria 5417
1075 Ga0495660_0070127 3300046810 Bacteria 1861
1076 Ga0495660_0139177 3300046810 Bacteria 1209
1077 Ga0495660_0166390 3300046810 Bacteria 1077
1078 Ga0495604_0010664 3300047317 Bacteria 7289
1079 Ga0495604_0033515 3300047317 Bacteria 4065
1080 Ga0495636_0013676 3300047318 Bacteria 3221
1081 Ga0495636_0116008 3300047318 Bacteria 1181
1082 Ga0495674_0091398 3300047319 Bacteria 2600
1083 Ga0495672_0003447 3300047320 Bacteria 13529
1084 Ga0495672_0004295 3300047320 Bacteria 11749
1085 Ga0495672_0004628 3300047320 Bacteria 11168
1086 Ga0495672_0005323 3300047320 Bacteria 10239
1087 Ga0495672_0005353 3300047320 Bacteria 10210
1088 Ga0495672_0007677 3300047320 Bacteria 8085
1089 Ga0495672_0008665 3300047320 Bacteria 7470
1090 Ga0495672_0009332 3300047320 Bacteria 7121
1091 Ga0495672_0009374 3300047320 Bacteria 7100
1092 Ga0495672_0012649 3300047320 Bacteria 5873
1093 Ga0495672_0013767 3300047320 Bacteria 5565
1094 Ga0495672_0015335 3300047320 Bacteria 5206
1095 Ga0495672_0027993 3300047320 Bacteria 3573
1096 Ga0495672_0053772 3300047320 Bacteria 2357
1097 Ga0495676_0000027 3300047321 Bacteria 141955
1098 Ga0495676_0017673 3300047321 Bacteria 6297
1099 Ga0495680_0005758 3300047322 Bacteria 11601
1100 Ga0495680_0033959 3300047322 Bacteria 4126
1101 Ga0495683_0000075 3300047323 Bacteria 100715
1102 Ga0495683_0001303 3300047323 Bacteria 16785
1103 Ga0495683_0001374 3300047323 Bacteria 16151
1104 Ga0495683_0030110 3300047323 Bacteria 2770
1105 Ga0495683_0033942 3300047323 Bacteria 2595
1106 Ga0495683_0146379 3300047323 Bacteria 1103
1107 Ga0495687_004754 3300047443 Bacteria 8978
1108 Ga0495687_027947 3300047443 Bacteria 2631
1109 Ga0495687_028807 3300047443 Bacteria 2578
1110 Ga0495675_0025096 3300047444 Bacteria 3801
1111 Ga0495679_000237 3300047446 Bacteria 45847
1112 Ga0495679_000792 3300047446 Bacteria 20055
1113 Ga0495679_028365 3300047446 Bacteria 1837
1114 Ga0495673_0000344 3300047469 Bacteria 58803
1115 Ga0495673_0000389 3300047469 Bacteria 51664
1116 Ga0495673_0001628 3300047469 Bacteria 17374
1117 Ga0495673_0001807 3300047469 Bacteria 16191
1118 Ga0495673_0003384 3300047469 Bacteria 10535
1119 Ga0495673_0003463 3300047469 Bacteria 10384
1120 Ga0495673_0003817 3300047469 Bacteria 9735
1121 Ga0495673_0005394 3300047469 Bacteria 7744
1122 Ga0495673_0006066 3300047469 Bacteria 7177
1123 Ga0495673_0007335 3300047469 Bacteria 6359
1124 Ga0495673_0020644 3300047469 Bacteria 3276
1125 Ga0495673_0022022 3300047469 Bacteria 3131
1126 Ga0495673_0066546 3300047469 Bacteria 1527
1127 Ga0495681_0003081 3300047470 Bacteria 11691
1128 Ga0495681_0003215 3300047470 Bacteria 11403
1129 Ga0495681_0004733 3300047470 Bacteria 9222
1130 Ga0495681_0004777 3300047470 Bacteria 9177
1131 Ga0495681_0006728 3300047470 Bacteria 7498
1132 Ga0495681_0009405 3300047470 Bacteria 6026
1133 Ga0495681_0009407 3300047470 Bacteria 6025
1134 Ga0495681_0014453 3300047470 Bacteria 4523
1135 Ga0495681_0031089 3300047470 Bacteria 2708
1136 Ga0495681_0033287 3300047470 Bacteria 2584
1137 Ga0495681_0116910 3300047470 Bacteria 1148
1138 Ga0495686_0000939 3300047472 Bacteria 36166
1139 Ga0495686_0005925 3300047472 Bacteria 9518
1140 Ga0495686_0026529 3300047472 Bacteria 3789
1141 Ga0495686_0034167 3300047472 Bacteria 3277
1142 Ga0495626_0000067 3300048091 Bacteria 139969
1143 Ga0495626_0000507 3300048091 Bacteria 38997
1144 Ga0495626_0000684 3300048091 Bacteria 32479
1145 Ga0495626_0000996 3300048091 Bacteria 24344
1146 Ga0495626_0001171 3300048091 Bacteria 21808
1147 Ga0495626_0001627 3300048091 Bacteria 17443
1148 Ga0495626_0008526 3300048091 Bacteria 5609
1149 Ga0495626_0018825 3300048091 Bacteria 3459
1150 Ga0495626_0059201 3300048091 Bacteria 1748
1151 Ga0495626_0123277 3300048091 Bacteria 1112
1152 Ga0496100_0103302 3300048903 Bacteria 1967
1153 Ga0496101_0074515 3300048904 Bacteria 2496
1154 Ga0496101_0141962 3300048904 Bacteria 1831
1155 Ga0496102_0001259 3300048905 Bacteria 22840
1156 Ga0496102_0006816 3300048905 Bacteria 9749
1157 Ga0496102_0043521 3300048905 Bacteria 4072
1158 Ga0496102_0067249 3300048905 Bacteria 3286
1159 Ga0496102_0125466 3300048905 Bacteria 2399
1160 Ga0496102_0284314 3300048905 Bacteria 1559
1161 Ga0496103_0005569 3300048906 Bacteria 7531
1162 Ga0496104_0011028 3300048907 Bacteria 8086
1163 Ga0496105_0002288 3300048908 Bacteria 13889
1164 Ga0496105_0141507 3300048908 Bacteria 1980
1165 Ga0496105_0402718 3300048908 Bacteria 1086
1166 Ga0496106_0006654 3300048909 Bacteria 8556
1167 Ga0496106_0029466 3300048909 Bacteria 4091
1168 Ga0496106_0141442 3300048909 Bacteria 1893
1169 Ga0496107_0016644 3300048910 Bacteria 5166
1170 Ga0496108_0021493 3300048911 Bacteria 5303
1171 Ga0496109_0037045 3300048912 Bacteria 4406
1172 Ga0496109_0053159 3300048912 Bacteria 3693
1173 Ga0496110_0073220 3300048913 Bacteria 3040
1174 Ga0496110_0096563 3300048913 Bacteria 2648
1175 Ga0496111_0070257 3300048914 Bacteria 2546
1176 Ga0496112_0054241 3300048915 Bacteria 3938
1177 Ga0496112_0240683 3300048915 Bacteria 1762
1178 Ga0496112_0597880 3300048915 Bacteria 1035
1179 Ga0496113_0033499 3300048916 Bacteria 3741
1180 Ga0496114_0005634 3300048917 Bacteria 9821
1181 Ga0496114_0023930 3300048917 Bacteria 4984
1182 Ga0496114_0024009 3300048917 Bacteria 4975
1183 Ga0496114_0380253 3300048917 Bacteria 1250
1184 Ga0496115_0001599 3300048918 Bacteria 16277
1185 Ga0496115_0001643 3300048918 Bacteria 16076
1186 Ga0496115_0012609 3300048918 Bacteria 6367
1187 Ga0496116_0000242 3300048919 Bacteria 99455
1188 Ga0496116_0000275 3300048919 Bacteria 89714
1189 Ga0496116_0001670 3300048919 Bacteria 24375
1190 Ga0496116_0002076 3300048919 Bacteria 21440
1191 Ga0496116_0007060 3300048919 Bacteria 10060
1192 Ga0496116_0033922 3300048919 Bacteria 3612
1193 Ga0496117_0000270 3300048920 Bacteria 97077
1194 Ga0496117_0000932 3300048920 Bacteria 44792
1195 Ga0496117_0002067 3300048920 Bacteria 26545
1196 Ga0496117_0007272 3300048920 Bacteria 10879
1197 Ga0496117_0007848 3300048920 Bacteria 10266
1198 Ga0496117_0018282 3300048920 Bacteria 5815
1199 Ga0496117_0026880 3300048920 Bacteria 4494
1200 Ga0496117_0061121 3300048920 Bacteria 2592
1201 Ga0496117_0081529 3300048920 Bacteria 2122
1202 Ga0496117_0105827 3300048920 Bacteria 1767
1203 Ga0496118_0001862 3300048921 Bacteria 30191
1204 Ga0496118_0001894 3300048921 Bacteria 29838
1205 Ga0496118_0007945 3300048921 Bacteria 11099
1206 Ga0496118_0010933 3300048921 Bacteria 8924
1207 Ga0496118_0018613 3300048921 Bacteria 6251
1208 Ga0496118_0018851 3300048921 Bacteria 6194
1209 Ga0496118_0061091 3300048921 Bacteria 2792
1210 Ga0496118_0081215 3300048921 Bacteria 2277
1211 Ga0496118_0082230 3300048921 Bacteria 2257
1212 Ga0496118_0158863 3300048921 Bacteria 1401
1213 Ga0496119_0000230 3300048922 Bacteria 78527
1214 Ga0496119_0012199 3300048922 Bacteria 7011
1215 Ga0496120_0000324 3300048923 Bacteria 79261
1216 Ga0496120_0004336 3300048923 Bacteria 11991
1217 Ga0496120_0016350 3300048923 Bacteria 4851
1218 Ga0496121_0000071 3300048924 Bacteria 247039
1219 Ga0496121_0000318 3300048924 Bacteria 100833
1220 Ga0496121_0010903 3300048924 Bacteria 10158
1221 Ga0496121_0029160 3300048924 Bacteria 5113
1222 Ga0496121_0041549 3300048924 Bacteria 4016
1223 Ga0496121_0047928 3300048924 Bacteria 3640
1224 Ga0496121_0080949 3300048924 Bacteria 2572
1225 Ga0496122_0000517 3300048925 Bacteria 79890
1226 Ga0496122_0002629 3300048925 Bacteria 25113
1227 Ga0496122_0007631 3300048925 Bacteria 11947
1228 Ga0496122_0010252 3300048925 Bacteria 9701
1229 Ga0496122_0018736 3300048925 Bacteria 6370
1230 Ga0496122_0019577 3300048925 Bacteria 6173
1231 Ga0496122_0028914 3300048925 Bacteria 4688
1232 Ga0496122_0116564 3300048925 Bacteria 1736
1233 Ga0496122_0180560 3300048925 Bacteria 1259
1234 Ga0496122_0205757 3300048925 Bacteria 1145
1235 Ga0496123_0000243 3300048926 Bacteria 109767
1236 Ga0496123_0007055 3300048926 Bacteria 10690
1237 Ga0496123_0016801 3300048926 Bacteria 5918
1238 Ga0496123_0049415 3300048926 Bacteria 2820
1239 Ga0496123_0049421 3300048926 Bacteria 2820
1240 Ga0496123_0049567 3300048926 Bacteria 2814
1241 Ga0496123_0075778 3300048926 Bacteria 2074
1242 Ga0496124_0000511 3300048927 Bacteria 66830
1243 Ga0496124_0001467 3300048927 Bacteria 34796
1244 Ga0496124_0001534 3300048927 Bacteria 33561
1245 Ga0496124_0002260 3300048927 Bacteria 25562
1246 Ga0496124_0002328 3300048927 Bacteria 25081
1247 Ga0496124_0007063 3300048927 Bacteria 12030
1248 Ga0496124_0026136 3300048927 Bacteria 5270
1249 Ga0496124_0044157 3300048927 Bacteria 3826
1250 Ga0496124_0060578 3300048927 Bacteria 3175
1251 Ga0496124_0083275 3300048927 Bacteria 2624
1252 Ga0496124_0177417 3300048927 Bacteria 1643
1253 Ga0496124_0204528 3300048927 Bacteria 1499
1254 Ga0496125_0000971 3300048928 Bacteria 44877
1255 Ga0496125_0002177 3300048928 Bacteria 26150
1256 Ga0496125_0005751 3300048928 Bacteria 13638
1257 Ga0496125_0006705 3300048928 Bacteria 12379
1258 Ga0496125_0024125 3300048928 Bacteria 5600
1259 Ga0496125_0027152 3300048928 Bacteria 5197
1260 Ga0496125_0097616 3300048928 Bacteria 2176
1261 Ga0496125_0136412 3300048928 Bacteria 1715
1262 Ga0496125_0146754 3300048928 Bacteria 1629
1263 Ga0496126_0018224 3300048929 Bacteria 6967
1264 Ga0496126_0032825 3300048929 Bacteria 4887
1265 Ga0496126_0036273 3300048929 Bacteria 4610
1266 Ga0496126_0053094 3300048929 Bacteria 3679
1267 Ga0496126_0079339 3300048929 Bacteria 2906
1268 Ga0496126_0234714 3300048929 Bacteria 1535
1269 Ga0495678_000106 3300049459 Bacteria 100780
1270 Ga0495678_000499 3300049459 Bacteria 38715
1271 Ga0495678_000648 3300049459 Bacteria 32019
1272 Ga0495678_000694 3300049459 Bacteria 30590
1273 Ga0495678_003175 3300049459 Bacteria 10355
1274 Ga0495678_003193 3300049459 Bacteria 10317
1275 Ga0495678_005483 3300049459 Bacteria 6992
1276 Ga0495678_010464 3300049459 Bacteria 4510
1277 Ga0495678_051038 3300049459 Bacteria 1600
1278 Ga0495682_0000069 3300049460 Bacteria 94250
1279 Ga0495682_0000804 3300049460 Bacteria 19829
1280 Ga0495682_0004192 3300049460 Bacteria 6241
1281 Ga0495682_0012679 3300049460 Bacteria 3226
1282 Ga0495682_0019649 3300049460 Bacteria 2539
1283 Ga0501032_0003622 3300049569 Bacteria 11760
1284 Ga0501032_0144361 3300049569 Bacteria 1567
1285 Ga0501033_0000863 3300049570 Bacteria 27736
1286 Ga0501033_0129227 3300049570 Bacteria 1831
1287 Ga0501034_0000164 3300049571 Bacteria 125152
1288 Ga0501034_0047534 3300049571 Bacteria 4333
1289 Ga0501034_0179869 3300049571 Bacteria 2080
1290 Ga0501034_0199285 3300049571 Bacteria 1961
1291 Ga0501034_0307313 3300049571 Bacteria 1521
1292 Ga0501034_0410791 3300049571 Bacteria 1276
1293 Ga0501036_0001148 3300049572 Bacteria 20168
1294 Ga0501036_0059760 3300049572 Bacteria 3230
1295 Ga0501036_0174913 3300049572 Bacteria 1808
1296 Ga0501037_0039003 3300049573 Bacteria 3498
1297 Ga0501037_0105525 3300049573 Bacteria 2031
1298 Ga0501037_0106816 3300049573 Bacteria 2017
1299 Ga0501038_0004502 3300049574 Bacteria 12962
1300 Ga0501039_0106853 3300049575 Bacteria 2186
1301 Ga0501039_0193977 3300049575 Bacteria 1597
1302 Ga0501041_0016608 3300049577 Bacteria 4379
1303 Ga0501042_0065532 3300049578 Bacteria 2596
1304 Ga0501042_0320016 3300049578 Bacteria 1121
1305 Ga0501043_0076739 3300049579 Bacteria 2625
1306 Ga0501046_0006429 3300049580 Bacteria 10414
1307 Ga0501046_0256311 3300049580 Bacteria 1286
1308 Ga0501047_0004231 3300049581 Bacteria 13513
1309 Ga0501047_0016564 3300049581 Bacteria 7038
1310 Ga0501047_0079481 3300049581 Bacteria 3153
1311 Ga0501047_0159992 3300049581 Bacteria 2124
1312 Ga0501047_0417017 3300049581 Bacteria 1174
1313 Ga0501069_0110950 3300049585 Bacteria 1562
1314 Ga0501069_0317886 3300049585 Bacteria 914
1315 Ga0501070_0062258 3300049586 Bacteria 3091
1316 Ga0501070_0210962 3300049586 Bacteria 1594
1317 Ga0501072_0102593 3300049588 Bacteria 2274
1318 Ga0501073_0044538 3300049589 Bacteria 3127
1319 Ga0501074_0198666 3300049590 Bacteria 1429
1320 Ga0501241_000367 3300049758 Bacteria 9932
1321 Ga0501035_0094792 3300049822 Bacteria 2624
1322 Ga0501035_0360481 3300049822 Bacteria 1215
1323 Ga0501035_0535248 3300049822 Bacteria 961
1324 Ga0501044_0000068 3300049823 Bacteria 126642
1325 Ga0501044_0009147 3300049823 Bacteria 10819
1326 Ga0501044_0115290 3300049823 Bacteria 2692
1327 Ga0501044_0153126 3300049823 Bacteria 2287
1328 Ga0501045_0081398 3300049824 Bacteria 2388
1329 Ga0501045_0144216 3300049824 Bacteria 1771
1330 nmdc:mga03683_8_c1 3300050489 Bacteria 138266
1331 nmdc:mga03n38_5812_c1 3300050490 Bacteria 4236
1332 nmdc:mga00v17_281_c1 3300050491 Bacteria 30104
1333 nmdc:mga0k408_212_c1 3300050493 Bacteria 31209
1334 nmdc:mga0k408_58194_c1 3300050493 Bacteria 2244
1335 nmdc:mga05p37_32052_c1 3300050507 Bacteria 6426
1336 nmdc:mga05p37_536868_c1 3300050507 Bacteria 1334
1337 nmdc:mga05p37_80086_c1 3300050507 Bacteria 4023
1338 nmdc:mga09592_1245_c2 3300050508 Bacteria 19929
1339 nmdc:mga09592_1735_c1 3300050508 Bacteria 17549
1340 nmdc:mga0qj67_6255_c1 3300050509 Bacteria 8736
1341 nmdc:mga0qj67_6308_c1 3300050509 Bacteria 8704
1342 nmdc:mga06r32_100768_c1 3300050510 Bacteria 2834
1343 nmdc:mga06r32_2068_c1 3300050510 Bacteria 17962
1344 nmdc:mga06r32_453135_c1 3300050510 Bacteria 1262
1345 nmdc:mga06r32_48_c1 3300050510 Bacteria 73903
1346 nmdc:mga08y16_435052_c1 3300050511 Bacteria 1340
1347 nmdc:mga08y16_67_c1 3300050511 Bacteria 46512
1348 nmdc:mga08x19_218914_c1 3300050514 Bacteria 1308
1349 nmdc:mga08x19_487811_c1 3300050514 Bacteria 869
1350 nmdc:mga0sz30_48_c1 3300050516 Bacteria 19397
1351 Ga0495619_0303429 3300053085 Bacteria 1106
1352 Ga0500578_0000056 3300053086 Bacteria 120189
1353 Ga0500643_000236 3300053087 Bacteria 51341
1354 Ga0500644_0000089 3300053088 Bacteria 56897
1355 Ga0500641_0007930 3300053096 Bacteria 3786
1356 Ga0500556_0001246 3300053104 Bacteria 11763
1357 Ga0500557_051774 3300053105 Bacteria 1318
1358 Ga0500562_000623 3300053108 Bacteria 8548
1359 Ga0500562_001952 3300053108 Bacteria 5170
1360 Ga0500562_002160 3300053108 Bacteria 4912
1361 Ga0500562_022909 3300053108 Bacteria 1628
1362 Ga0500572_002298 3300053111 Bacteria 4624
1363 Ga0500594_0000069 3300053118 Bacteria 32465
1364 Ga0500595_038862 3300053119 Bacteria 1544
1365 Ga0500608_000207 3300053122 Bacteria 23415
1366 Ga0500618_000754 3300053125 Bacteria 18308
1367 Ga0500658_0016538 3300053134 Bacteria 2749
1368 Ga0500659_0002369 3300053135 Bacteria 11369
1369 Ga0500559_0003257 3300053136 Bacteria 8060
1370 Ga0500568_0003211 3300053139 Bacteria 9282
1371 Ga0500573_0048452 3300053140 Bacteria 2446
1372 Ga0500604_0061682 3300053151 Bacteria 1179
1373 Ga0500616_0006850 3300053153 Bacteria 7365
1374 Ga0500616_0022720 3300053153 Bacteria 3499
1375 Ga0500622_0001390 3300053156 Bacteria 19494
1376 Ga0500622_0001762 3300053156 Bacteria 16622
1377 Ga0500622_0004080 3300053156 Bacteria 9364
1378 Ga0500622_0014917 3300053156 Bacteria 4165
1379 Ga0500622_0014955 3300053156 Bacteria 4160
1380 Ga0500622_0020348 3300053156 Bacteria 3524
1381 Ga0500645_000790 3300053730 Bacteria 19008
1382 Ga0500645_001349 3300053730 Bacteria 12693
1383 Ga0501084_0403429 3300054114 Bacteria 1155
1384 Ga0501082_0000514 3300060353 Bacteria 34391

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037588 Ga0316581_0014022 Ga0316581_0014022_1578_2261 226
2 3300046642 Ga0495634_0181392 Ga0495634_0181392_612_1307 230
3 3300046471 Ga0495650_0024217 Ga0495650_0024217_1030_1725 231
4 2124908027 MRS2a_Contig_7961 MRS2a_00799810 236
5 3300050514 nmdc:mga08x19_487811_c1 nmdc:mga08x19_487811_c1_12_725 236
6 3300021388 Ga0213875_10064935 Ga0213875_100649351 238
7 3300037853 Ga0436364_1061319 Ga0436364_1061319_88_1017 238
8 3300003773 Ga0055537_1002258 Ga0055537_10022585 240
9 3300041405 Ga0439438_005461 Ga0439438_005461_2201_2926 241
10 3300042013 Ga0439456_004035 Ga0439456_004035_761_1486 241
11 3300046458 Ga0495591_000923 Ga0495591_000923_4148_4873 241
12 3300046460 Ga0495638_0034918 Ga0495638_0034918_40_765 241
13 3300046474 Ga0495605_0011143 Ga0495605_0011143_2044_2769 241
14 3300046530 Ga0495654_0002438 Ga0495654_0002438_7392_8117 241
15 3300046535 Ga0495586_0005132 Ga0495586_0005132_1940_2665 241
16 3300046665 Ga0495661_0001282 Ga0495661_0001282_5392_6117 241
17 3300046680 Ga0495646_0000923 Ga0495646_0000923_14002_14727 241
18 3300046691 Ga0495670_0180903 Ga0495670_0180903_347_1072 241
19 3300047470 Ga0495681_0014453 Ga0495681_0014453_1556_2281 241
20 3300048922 Ga0496119_0012199 Ga0496119_0012199_2334_3194 241
21 3300048925 Ga0496122_0205757 Ga0496122_0205757_60_920 241
22 3300048926 Ga0496123_0049415 Ga0496123_0049415_978_1838 241
23 3300021361 Ga0213872_10019359 Ga0213872_100193592 242
24 3300039447 Ga0436361_0129444 Ga0436361_0129444_3831_4646 242
25 3300049573 Ga0501037_0106816 Ga0501037_0106816_125_853 242
26 3300037312 Ga0395899_0016645 Ga0395899_0016645_3392_4210 243
27 3300037418 Ga0395900_0000010 Ga0395900_0000010_357356_358174 243
28 3300037466 Ga0395898_0034425 Ga0395898_0034425_2833_3651 243
29 3300037471 Ga0395905_0001301 Ga0395905_0001301_28146_28964 243
30 3300038443 Ga0395901_0000007 Ga0395901_0000007_441720_442538 243
31 3300049822 Ga0501035_0535248 Ga0501035_0535248_66_842 243
32 3300039437 Ga0436365_0638922 Ga0436365_0638922_359_1123 245
33 3300046512 Ga0495610_0004226 Ga0495610_0004226_6305_7042 245
34 3300049571 Ga0501034_0307313 Ga0501034_0307313_227_1015 245
35 3300049571 Ga0501034_0410791 Ga0501034_0410791_229_1011 245
36 3300049578 Ga0501042_0320016 Ga0501042_0320016_110_880 245
37 3300049585 Ga0501069_0317886 Ga0501069_0317886_97_885 245
38 3300049586 Ga0501070_0062258 Ga0501070_0062258_246_1034 245
39 3300049588 Ga0501072_0102593 Ga0501072_0102593_571_1338 245
40 3300049590 Ga0501074_0198666 Ga0501074_0198666_283_1071 245
41 3300049823 Ga0501044_0115290 Ga0501044_0115290_259_1047 245
42 3300049824 Ga0501045_0081398 Ga0501045_0081398_566_1333 245
43 3300009551 Ga0105238_10016707 Ga0105238_100167073 246
44 3300025914 Ga0207671_10334774 Ga0207671_103347742 246
45 3300025949 Ga0207667_10096443 Ga0207667_100964432 246
46 3300031242 Ga0265329_10016433 Ga0265329_100164333 246
47 3300031251 Ga0265327_10000764 Ga0265327_1000076415 246
48 3300031251 Ga0265327_10001245 Ga0265327_1000124523 246
49 3300031344 Ga0265316_10000395 Ga0265316_1000039538 246
50 3300031824 Ga0307413_10135376 Ga0307413_101353762 247
51 3300031995 Ga0307409_100045637 Ga0307409_1000456374 247
52 3300032005 Ga0307411_10122994 Ga0307411_101229942 247
53 3300032126 Ga0307415_100463762 Ga0307415_1004637621 247
54 iso_pu_bacteria 2894232714 2894233462 247
55 3300005344 Ga0070661_100274321 Ga0070661_1002743211 248
56 3300005455 Ga0070663_100026194 Ga0070663_1000261943 248
57 3300005456 Ga0070678_100289437 Ga0070678_1002894372 248
58 3300005548 Ga0070665_100224775 Ga0070665_1002247752 248
59 3300026067 Ga0207678_10012003 Ga0207678_100120032 248
60 3300044683 Ga0466965_0059528 Ga0466965_0059528_549_1322 248
61 3300049580 Ga0501046_0006429 Ga0501046_0006429_2331_3134 248
62 3300049585 Ga0501069_0110950 Ga0501069_0110950_608_1411 248
63 3300049586 Ga0501070_0210962 Ga0501070_0210962_554_1357 248
64 3300049589 Ga0501073_0044538 Ga0501073_0044538_2267_3070 248
65 3300054114 Ga0501084_0403429 Ga0501084_0403429_47_850 248
66 3300060353 Ga0501082_0000514 Ga0501082_0000514_27867_28670 248
67 3300031665 Ga0316575_10000476 Ga0316575_100004763 249
68 3300031728 Ga0316578_10008639 Ga0316578_100086392 249
69 3300031733 Ga0316577_10000611 Ga0316577_100006115 249
70 3300032005 Ga0307411_10125159 Ga0307411_101251593 249
71 3300032133 Ga0316583_10001101 Ga0316583_100011019 249
72 3300032137 Ga0316585_10002081 Ga0316585_100020814 249
73 3300032139 Ga0316580_10005072 Ga0316580_100050722 249
74 3300035398 Ga0316574_0155392 Ga0316574_0155392_59_826 249
75 3300036647 Ga0316582_0000534 Ga0316582_0000534_4387_5154 249
76 3300036712 Ga0316584_0135592 Ga0316584_0135592_323_1090 249
77 3300049570 Ga0501033_0000863 Ga0501033_0000863_14891_15655 249
78 3300049574 Ga0501038_0004502 Ga0501038_0004502_709_1473 249
79 3300049575 Ga0501039_0193977 Ga0501039_0193977_276_1040 249
80 3300049580 Ga0501046_0256311 Ga0501046_0256311_499_1263 249
81 3300049581 Ga0501047_0159992 Ga0501047_0159992_1328_2092 249
82 3300053139 Ga0500568_0003211 Ga0500568_0003211_4860_5663 249
83 3300003322 rootL2_10219289 rootL2_102192893 250
84 3300003771 Ga0055526_1000674 Ga0055526_100067412 250
85 3300003775 Ga0055524_1000852 Ga0055524_10008526 250
86 3300003791 Ga0055530_10000050 Ga0055530_1000005089 250
87 3300005262 Ga0065165_1037701 Ga0065165_10377011 250
88 3300005435 Ga0070714_100018934 Ga0070714_1000189345 250
89 3300005530 Ga0070679_100071686 Ga0070679_1000716862 250
90 3300006163 Ga0070715_10130230 Ga0070715_101302302 250
91 3300006237 Ga0097621_100042100 Ga0097621_1000421003 250
92 3300006844 Ga0075428_100003164 Ga0075428_1000031649 250
93 3300006844 Ga0075428_100032925 Ga0075428_1000329252 250
94 3300006846 Ga0075430_100001922 Ga0075430_1000019223 250
95 3300006846 Ga0075430_100043515 Ga0075430_1000435153 250
96 3300006847 Ga0075431_100001984 Ga0075431_10000198420 250
97 3300006847 Ga0075431_100019179 Ga0075431_1000191792 250
98 3300006880 Ga0075429_100000416 Ga0075429_10000041632 250
99 3300009094 Ga0111539_10076787 Ga0111539_100767875 250
100 3300009147 Ga0114129_10001827 Ga0114129_100018272 250
101 3300013104 Ga0157370_10029824 Ga0157370_100298242 250
102 3300014969 Ga0157376_10199497 Ga0157376_101994972 250
103 3300014969 Ga0157376_10224360 Ga0157376_102243602 250
104 3300025258 Ga0209129_1014853 Ga0209129_10148532 250
105 3300025263 Ga0209565_1000846 Ga0209565_100084623 250
106 3300025291 Ga0209675_1000481 Ga0209675_100048114 250
107 3300025295 Ga0209564_1000219 Ga0209564_100021912 250
108 3300025298 Ga0209050_1000058 Ga0209050_100005886 250
109 3300025299 Ga0209256_1001588 Ga0209256_10015887 250
110 3300025921 Ga0207652_10054611 Ga0207652_100546113 250
111 3300025929 Ga0207664_10015239 Ga0207664_100152394 250
112 3300027907 Ga0207428_10039216 Ga0207428_100392166 250
113 3300032002 Ga0307416_100426991 Ga0307416_1004269912 250
114 3300033545 Ga0316214_1014381 Ga0316214_10143812 250
115 3300042876 Ga0451577_0003511 Ga0451577_0003511_5287_6099 250
116 3300042876 Ga0451577_0156363 Ga0451577_0156363_561_1373 250
117 3300046457 Ga0495590_0001474 Ga0495590_0001474_3176_3928 250
118 3300046474 Ga0495605_0009596 Ga0495605_0009596_1472_2224 250
119 3300046512 Ga0495610_0022458 Ga0495610_0022458_1811_2563 250
120 3300046528 Ga0495642_0000555 Ga0495642_0000555_7831_8583 250
121 3300046530 Ga0495654_0032647 Ga0495654_0032647_1852_2604 250
122 3300046616 Ga0495668_0003520 Ga0495668_0003520_7639_8391 250
123 3300046692 Ga0495671_0026950 Ga0495671_0026950_2111_2863 250
124 3300046694 Ga0495649_0036976 Ga0495649_0036976_1907_2659 250
125 3300047320 Ga0495672_0004295 Ga0495672_0004295_7697_8449 250
126 3300048905 Ga0496102_0284314 Ga0496102_0284314_70_870 250
127 3300048915 Ga0496112_0054241 Ga0496112_0054241_1005_1847 250
128 3300048917 Ga0496114_0380253 Ga0496114_0380253_175_957 250
129 3300049569 Ga0501032_0144361 Ga0501032_0144361_193_975 250
130 3300049572 Ga0501036_0001148 Ga0501036_0001148_14225_15007 250
131 3300049579 Ga0501043_0076739 Ga0501043_0076739_1511_2293 250
132 3300049823 Ga0501044_0000068 Ga0501044_0000068_14154_14936 250
133 3300050507 nmdc:mga05p37_80086_c1 nmdc:mga05p37_80086_c1_1534_2319 250
134 3300050508 nmdc:mga09592_1245_c2 nmdc:mga09592_1245_c2_9836_10621 250
135 3300050509 nmdc:mga0qj67_6255_c1 nmdc:mga0qj67_6255_c1_3645_4430 250
136 3300050509 nmdc:mga0qj67_6308_c1 nmdc:mga0qj67_6308_c1_6696_7493 250
137 3300050510 nmdc:mga06r32_100768_c1 nmdc:mga06r32_100768_c1_944_1741 250
138 3300050510 nmdc:mga06r32_2068_c1 nmdc:mga06r32_2068_c1_4307_5092 250
139 3300050511 nmdc:mga08y16_435052_c1 nmdc:mga08y16_435052_c1_394_1176 250
140 iso_pu_bacteria 2643221554 2643791656 250
141 iso_pu_bacteria 2739367756 2739790269 250
142 3300005293 Ga0065715_10215900 Ga0065715_102159002 251
143 3300005330 Ga0070690_100068633 Ga0070690_1000686332 251
144 3300005355 Ga0070671_100070671 Ga0070671_1000706712 251
145 3300005364 Ga0070673_100013793 Ga0070673_1000137932 251
146 3300005367 Ga0070667_100028277 Ga0070667_1000282772 251
147 3300005435 Ga0070714_100425139 Ga0070714_1004251392 251
148 3300005436 Ga0070713_100000501 Ga0070713_10000050119 251
149 3300005437 Ga0070710_10003523 Ga0070710_100035236 251
150 3300005439 Ga0070711_100001068 Ga0070711_10000106815 251
151 3300005456 Ga0070678_100147426 Ga0070678_1001474262 251
152 3300005459 Ga0068867_100100528 Ga0068867_1001005282 251
153 3300005546 Ga0070696_100208435 Ga0070696_1002084352 251
154 3300005548 Ga0070665_100010596 Ga0070665_1000105963 251
155 3300005549 Ga0070704_100061290 Ga0070704_1000612902 251
156 3300005563 Ga0068855_100240141 Ga0068855_1002401411 251
157 3300005564 Ga0070664_100577189 Ga0070664_1005771892 251
158 3300005614 Ga0068856_100025594 Ga0068856_1000255942 251
159 3300005617 Ga0068859_100237560 Ga0068859_1002375602 251
160 3300005618 Ga0068864_100022488 Ga0068864_1000224886 251
161 3300005718 Ga0068866_10176277 Ga0068866_101762772 251
162 3300005841 Ga0068863_100005001 Ga0068863_1000050019 251
163 3300005842 Ga0068858_100003909 Ga0068858_1000039095 251
164 3300006163 Ga0070715_10000137 Ga0070715_1000013711 251
165 3300006173 Ga0070716_100000250 Ga0070716_1000002506 251
166 3300006175 Ga0070712_100000944 Ga0070712_1000009443 251
167 3300006237 Ga0097621_100002763 Ga0097621_1000027632 251
168 3300006358 Ga0068871_100007873 Ga0068871_1000078735 251
169 3300006847 Ga0075431_100288039 Ga0075431_1002880393 251
170 3300006914 Ga0075436_100413037 Ga0075436_1004130372 251
171 3300006931 Ga0097620_100237587 Ga0097620_1002375872 251
172 3300009098 Ga0105245_10008015 Ga0105245_100080156 251
173 3300009101 Ga0105247_10012887 Ga0105247_100128875 251
174 3300009174 Ga0105241_10039582 Ga0105241_100395823 251
175 3300009176 Ga0105242_10003944 Ga0105242_100039443 251
176 3300009177 Ga0105248_10028267 Ga0105248_100282675 251
177 3300009545 Ga0105237_10058234 Ga0105237_100582344 251
178 3300010375 Ga0105239_10179083 Ga0105239_101790833 251
179 3300013296 Ga0157374_10095689 Ga0157374_100956892 251
180 3300013297 Ga0157378_10003437 Ga0157378_100034379 251
181 3300013306 Ga0163162_10014604 Ga0163162_100146046 251
182 3300013308 Ga0157375_10062273 Ga0157375_100622733 251
183 3300014968 Ga0157379_10022262 Ga0157379_100222622 251
184 3300021441 Ga0213871_10019712 Ga0213871_100197121 251
185 3300025898 Ga0207692_10015378 Ga0207692_100153783 251
186 3300025903 Ga0207680_10085489 Ga0207680_100854892 251
187 3300025905 Ga0207685_10011922 Ga0207685_100119222 251
188 3300025915 Ga0207693_10000021 Ga0207693_1000002145 251
189 3300025916 Ga0207663_10056513 Ga0207663_100565132 251
190 3300025925 Ga0207650_10014558 Ga0207650_100145587 251
191 3300025928 Ga0207700_10054000 Ga0207700_100540003 251
192 3300025931 Ga0207644_10082031 Ga0207644_100820312 251
193 3300025934 Ga0207686_10067563 Ga0207686_100675632 251
194 3300025938 Ga0207704_10039182 Ga0207704_100391822 251
195 3300025939 Ga0207665_10000465 Ga0207665_1000046515 251
196 3300025941 Ga0207711_10046495 Ga0207711_100464953 251
197 3300025960 Ga0207651_10201252 Ga0207651_102012522 251
198 3300025986 Ga0207658_10085271 Ga0207658_100852712 251
199 3300026023 Ga0207677_10096803 Ga0207677_100968032 251
200 3300026078 Ga0207702_10130565 Ga0207702_101305652 251
201 3300026088 Ga0207641_10164515 Ga0207641_101645151 251
202 3300026089 Ga0207648_10070388 Ga0207648_100703883 251
203 3300026121 Ga0207683_10000599 Ga0207683_100005993 251
204 3300028379 Ga0268266_10099303 Ga0268266_100993033 251
205 3300035111 Ga0373923_0270195 Ga0373923_0270195_15_782 251
206 3300035119 Ga0373956_0177561 Ga0373956_0177561_199_966 251
207 3300035170 Ga0373943_0056693 Ga0373943_0056693_892_1659 251
208 3300035692 Ga0373935_0098345 Ga0373935_0098345_241_1062 251
209 3300035695 Ga0373927_0079455 Ga0373927_0079455_863_1630 251
210 3300035725 Ga0373947_0145709 Ga0373947_0145709_78_845 251
211 3300036401 Ga0373937_0026675 Ga0373937_0026675_558_1325 251
212 3300037466 Ga0395898_0123153 Ga0395898_0123153_1096_1917 251
213 3300039438 Ga0436360_0428272 Ga0436360_0428272_42_863 251
214 3300046476 Ga0495662_0146533 Ga0495662_0146533_97_864 251
215 3300046531 Ga0495665_0190299 Ga0495665_0190299_198_965 251
216 3300046683 Ga0495658_0043062 Ga0495658_0043062_749_1516 251
217 3300047319 Ga0495674_0091398 Ga0495674_0091398_1445_2212 251
218 3300047472 Ga0495686_0034167 Ga0495686_0034167_799_1596 251
219 3300048903 Ga0496100_0103302 Ga0496100_0103302_405_1172 251
220 3300048904 Ga0496101_0074515 Ga0496101_0074515_491_1258 251
221 3300048905 Ga0496102_0006816 Ga0496102_0006816_5032_5799 251
222 3300048905 Ga0496102_0043521 Ga0496102_0043521_1847_2614 251
223 3300048908 Ga0496105_0002288 Ga0496105_0002288_7216_7983 251
224 3300048909 Ga0496106_0006654 Ga0496106_0006654_504_1271 251
225 3300048910 Ga0496107_0016644 Ga0496107_0016644_1567_2334 251
226 3300048911 Ga0496108_0021493 Ga0496108_0021493_936_1703 251
227 3300048912 Ga0496109_0037045 Ga0496109_0037045_734_1501 251
228 3300048913 Ga0496110_0073220 Ga0496110_0073220_854_1621 251
229 3300048914 Ga0496111_0070257 Ga0496111_0070257_734_1501 251
230 3300048915 Ga0496112_0240683 Ga0496112_0240683_631_1398 251
231 3300048916 Ga0496113_0033499 Ga0496113_0033499_256_1023 251
232 3300048917 Ga0496114_0005634 Ga0496114_0005634_5522_6289 251
233 3300048918 Ga0496115_0012609 Ga0496115_0012609_4883_5650 251
234 3300048921 Ga0496118_0158863 Ga0496118_0158863_78_845 251
235 3300048928 Ga0496125_0146754 Ga0496125_0146754_473_1294 251
236 3300048929 Ga0496126_0018224 Ga0496126_0018224_3020_3841 251
237 3300050510 nmdc:mga06r32_453135_c1 nmdc:mga06r32_453135_c1_439_1197 251
238 iso_pu_bacteria 2857504554 2857504819 251
239 3300005844 Ga0068862_100158322 Ga0068862_1001583222 252
240 3300006038 Ga0075365_10041469 Ga0075365_100414692 252
241 3300006175 Ga0070712_100069855 Ga0070712_1000698552 252
242 3300006881 Ga0068865_100002003 Ga0068865_1000020037 252
243 3300009094 Ga0111539_10040297 Ga0111539_100402973 252
244 3300009147 Ga0114129_10526183 Ga0114129_105261832 252
245 3300014325 Ga0163163_10489375 Ga0163163_104893752 252
246 3300021358 Ga0213873_10005190 Ga0213873_100051902 252
247 3300021377 Ga0213874_10002493 Ga0213874_100024933 252
248 3300021384 Ga0213876_10002636 Ga0213876_100026368 252
249 3300021384 Ga0213876_10002883 Ga0213876_100028834 252
250 3300021388 Ga0213875_10001986 Ga0213875_100019863 252
251 3300028380 Ga0268265_10814574 Ga0268265_108145742 252
252 3300028794 Ga0307515_10021855 Ga0307515_100218555 252
253 3300031090 Ga0265760_10026665 Ga0265760_100266652 252
254 3300031691 Ga0316579_10026379 Ga0316579_100263792 252
255 3300032133 Ga0316583_10002300 Ga0316583_100023005 252
256 3300036647 Ga0316582_0015883 Ga0316582_0015883_3050_3979 252
257 3300036647 Ga0316582_0350552 Ga0316582_0350552_54_983 252
258 3300036712 Ga0316584_0184876 Ga0316584_0184876_96_1025 252
259 3300037853 Ga0436364_1346974 Ga0436364_1346974_902_1786 252
260 3300039437 Ga0436365_0156475 Ga0436365_0156475_2521_3405 252
261 3300039437 Ga0436365_0356842 Ga0436365_0356842_12220_13104 252
262 3300039450 Ga0436363_0538450 Ga0436363_0538450_8385_9269 252
263 3300039453 Ga0436362_0582461 Ga0436362_0582461_2560_3444 252
264 3300042439 Ga0439464_0012378 Ga0439464_0012378_1403_2188 252
265 3300046457 Ga0495590_0000388 Ga0495590_0000388_331_1161 252
266 3300046518 Ga0495631_0005054 Ga0495631_0005054_4817_5647 252
267 3300046523 Ga0495644_0003034 Ga0495644_0003034_1957_2715 252
268 3300046524 Ga0495648_0000165 Ga0495648_0000165_31474_32346 252
269 3300046542 Ga0495597_0070344 Ga0495597_0070344_335_1165 252
270 3300046616 Ga0495668_0005068 Ga0495668_0005068_2250_3080 252
271 3300047469 Ga0495673_0000344 Ga0495673_0000344_29602_30477 252
272 3300047472 Ga0495686_0000939 Ga0495686_0000939_7332_8162 252
273 3300048919 Ga0496116_0000275 Ga0496116_0000275_58325_59215 252
274 3300048925 Ga0496122_0028914 Ga0496122_0028914_3191_4024 252
275 3300049459 Ga0495678_000648 Ga0495678_000648_2849_3679 252
276 3300050507 nmdc:mga05p37_536868_c1 nmdc:mga05p37_536868_c1_198_983 252
277 3300053086 Ga0500578_0000056 Ga0500578_0000056_90878_91708 252
278 3300053088 Ga0500644_0000089 Ga0500644_0000089_28291_29166 252
279 3300053108 Ga0500562_002160 Ga0500562_002160_2397_3227 252
280 3300053111 Ga0500572_002298 Ga0500572_002298_2235_3098 252
281 3300053118 Ga0500594_0000069 Ga0500594_0000069_28330_29160 252
282 3300053134 Ga0500658_0016538 Ga0500658_0016538_59_844 252
283 3300053156 Ga0500622_0001762 Ga0500622_0001762_1229_2059 252
284 iso_pu_bacteria 8054460903 8054462585 252
285 3300003781 Ga0055536_1000595 Ga0055536_100059519 253
286 3300003781 Ga0055536_1000604 Ga0055536_100060418 253
287 3300003791 Ga0055530_10000899 Ga0055530_1000089918 253
288 3300003791 Ga0055530_10002781 Ga0055530_100027819 253
289 3300003794 Ga0055531_10000847 Ga0055531_1000084719 253
290 3300005331 Ga0070670_100000050 Ga0070670_100000050110 253
291 3300005347 Ga0070668_100001877 Ga0070668_10000187713 253
292 3300005367 Ga0070667_100000299 Ga0070667_10000029933 253
293 3300005436 Ga0070713_100000622 Ga0070713_10000062222 253
294 3300005548 Ga0070665_100001434 Ga0070665_10000143417 253
295 3300005614 Ga0068856_100135583 Ga0068856_1001355832 253
296 3300005618 Ga0068864_100000238 Ga0068864_10000023825 253
297 3300005841 Ga0068863_100000531 Ga0068863_1000005314 253
298 3300005842 Ga0068858_100007943 Ga0068858_1000079432 253
299 3300005844 Ga0068862_100000786 Ga0068862_10000078610 253
300 3300006048 Ga0075363_100009303 Ga0075363_1000093034 253
301 3300006051 Ga0075364_10034624 Ga0075364_100346243 253
302 3300006177 Ga0075362_10000018 Ga0075362_1000001843 253
303 3300006186 Ga0075369_10002686 Ga0075369_100026863 253
304 3300006186 Ga0075369_10013967 Ga0075369_100139674 253
305 3300006195 Ga0075366_10003020 Ga0075366_100030206 253
306 3300006353 Ga0075370_10000065 Ga0075370_100000656 253
307 3300009093 Ga0105240_10000522 Ga0105240_1000052215 253
308 3300009093 Ga0105240_10073487 Ga0105240_100734874 253
309 3300009553 Ga0105249_10000356 Ga0105249_1000035623 253
310 3300013104 Ga0157370_10177270 Ga0157370_101772701 253
311 3300013105 Ga0157369_10194966 Ga0157369_101949662 253
312 3300013306 Ga0163162_10082355 Ga0163162_100823554 253
313 3300013308 Ga0157375_10049656 Ga0157375_100496563 253
314 3300014325 Ga0163163_10190075 Ga0163163_101900752 253
315 3300014968 Ga0157379_10001501 Ga0157379_1000150112 253
316 3300014969 Ga0157376_10160193 Ga0157376_101601932 253
317 3300021384 Ga0213876_10063026 Ga0213876_100630262 253
318 3300025292 Ga0209676_1000243 Ga0209676_100024367 253
319 3300025292 Ga0209676_1000311 Ga0209676_100031118 253
320 3300025298 Ga0209050_1000244 Ga0209050_100024467 253
321 3300025298 Ga0209050_1000375 Ga0209050_100037518 253
322 3300025299 Ga0209256_1017602 Ga0209256_10176022 253
323 3300025303 Ga0209051_1003593 Ga0209051_10035932 253
324 3300025304 Ga0209257_1000140 Ga0209257_100014057 253
325 3300025304 Ga0209257_1004459 Ga0209257_100445910 253
326 3300025900 Ga0207710_10038644 Ga0207710_100386442 253
327 3300025913 Ga0207695_10001134 Ga0207695_1000113415 253
328 3300025913 Ga0207695_10028456 Ga0207695_100284564 253
329 3300025917 Ga0207660_10133325 Ga0207660_101333252 253
330 3300025923 Ga0207681_10213847 Ga0207681_102138472 253
331 3300025925 Ga0207650_10000133 Ga0207650_1000013367 253
332 3300025928 Ga0207700_10000241 Ga0207700_1000024111 253
333 3300025961 Ga0207712_10000790 Ga0207712_100007905 253
334 3300025972 Ga0207668_10000718 Ga0207668_100007184 253
335 3300025986 Ga0207658_10000931 Ga0207658_1000093125 253
336 3300026035 Ga0207703_10002235 Ga0207703_100022352 253
337 3300026078 Ga0207702_10099548 Ga0207702_100995482 253
338 3300026088 Ga0207641_10011031 Ga0207641_100110312 253
339 3300026095 Ga0207676_10000109 Ga0207676_1000010925 253
340 3300028379 Ga0268266_10002063 Ga0268266_1000206315 253
341 3300028380 Ga0268265_10005179 Ga0268265_100051791 253
342 3300028800 Ga0265338_10011798 Ga0265338_100117983 253
343 3300031250 Ga0265331_10026729 Ga0265331_100267293 253
344 3300031901 Ga0307406_10497533 Ga0307406_104975331 253
345 3300032002 Ga0307416_100181428 Ga0307416_1001814282 253
346 3300032126 Ga0307415_100176251 Ga0307415_1001762512 253
347 3300032133 Ga0316583_10015720 Ga0316583_100157202 253
348 3300035086 Ga0373934_0000039 Ga0373934_0000039_34449_35240 253
349 3300035117 Ga0373953_0195503 Ga0373953_0195503_36_827 253
350 3300035119 Ga0373956_0000165 Ga0373956_0000165_2916_3707 253
351 3300035120 Ga0373957_0000698 Ga0373957_0000698_903_1694 253
352 3300035172 Ga0373955_0004254 Ga0373955_0004254_4065_4856 253
353 3300035724 Ga0373933_0008171 Ga0373933_0008171_2900_3691 253
354 3300036401 Ga0373937_0015350 Ga0373937_0015350_3529_4320 253
355 3300036401 Ga0373937_0259061 Ga0373937_0259061_629_1429 253
356 3300037853 Ga0436364_1109728 Ga0436364_1109728_888_1685 253
357 3300039437 Ga0436365_1846384 Ga0436365_1846384_590_1414 253
358 3300042876 Ga0451577_0125705 Ga0451577_0125705_198_989 253
359 3300044735 Ga0466968_0032261 Ga0466968_0032261_1247_2044 253
360 3300046458 Ga0495591_000628 Ga0495591_000628_3464_4228 253
361 3300046462 Ga0495651_0005051 Ga0495651_0005051_6865_7656 253
362 3300046501 Ga0495607_0000531 Ga0495607_0000531_14942_15706 253
363 3300046616 Ga0495668_0000456 Ga0495668_0000456_27672_28508 253
364 3300046675 Ga0495657_0054974 Ga0495657_0054974_274_1065 253
365 3300048905 Ga0496102_0125466 Ga0496102_0125466_531_1355 253
366 3300048918 Ga0496115_0001599 Ga0496115_0001599_3621_4460 253
367 3300048927 Ga0496124_0177417 Ga0496124_0177417_577_1416 253
368 3300049570 Ga0501033_0129227 Ga0501033_0129227_540_1316 253
369 3300049577 Ga0501041_0016608 Ga0501041_0016608_3194_3970 253
370 3300049578 Ga0501042_0065532 Ga0501042_0065532_214_990 253
371 3300049581 Ga0501047_0079481 Ga0501047_0079481_550_1380 253
372 3300049824 Ga0501045_0144216 Ga0501045_0144216_835_1611 253
373 3300050489 nmdc:mga03683_8_c1 nmdc:mga03683_8_c1_24721_25560 253
374 3300050490 nmdc:mga03n38_5812_c1 nmdc:mga03n38_5812_c1_1851_2690 253
375 3300050493 nmdc:mga0k408_212_c1 nmdc:mga0k408_212_c1_6250_7089 253
376 3300050493 nmdc:mga0k408_58194_c1 nmdc:mga0k408_58194_c1_588_1421 253
377 3300050516 nmdc:mga0sz30_48_c1 nmdc:mga0sz30_48_c1_3463_4302 253
378 3300053085 Ga0495619_0303429 Ga0495619_0303429_45_836 253
379 3300053122 Ga0500608_000207 Ga0500608_000207_13980_14816 253
380 3300053136 Ga0500559_0003257 Ga0500559_0003257_3067_3903 253
381 3300053156 Ga0500622_0001390 Ga0500622_0001390_13669_14457 253
382 3300053156 Ga0500622_0004080 Ga0500622_0004080_2254_3042 253
383 3300053156 Ga0500622_0014955 Ga0500622_0014955_1306_2142 253
384 iso_pu_bacteria 2585428106 2587918025 253
385 iso_pu_bacteria 2643221640 2644224559 253
386 iso_pu_bacteria 2643221642 2644234506 253
387 iso_pu_bacteria 2884960567 2884965366 253
388 iso_pu_bacteria 2928531327 2928532866 253
389 iso_pu_bacteria 2990196909 2990197903 253
390 3300003578 Ga0006562J51391_1013763 Ga0006562J51391_10137633 254
391 3300005331 Ga0070670_100689905 Ga0070670_1006899051 254
392 3300005355 Ga0070671_100284428 Ga0070671_1002844282 254
393 3300005548 Ga0070665_100047335 Ga0070665_1000473354 254
394 3300006844 Ga0075428_100000169 Ga0075428_10000016951 254
395 3300006844 Ga0075428_100627006 Ga0075428_1006270062 254
396 3300006847 Ga0075431_100000027 Ga0075431_10000002761 254
397 3300006880 Ga0075429_100023537 Ga0075429_1000235374 254
398 3300009094 Ga0111539_10000211 Ga0111539_100002119 254
399 3300009147 Ga0114129_10005882 Ga0114129_100058823 254
400 3300009551 Ga0105238_10504063 Ga0105238_105040632 254
401 3300013100 Ga0157373_10061092 Ga0157373_100610922 254
402 3300013102 Ga0157371_10058580 Ga0157371_100585804 254
403 3300021388 Ga0213875_10036093 Ga0213875_100360931 254
404 3300027312 Ga0209371_1000087 Ga0209371_100008773 254
405 3300027907 Ga0207428_10006022 Ga0207428_1000602210 254
406 3300028379 Ga0268266_10074778 Ga0268266_100747782 254
407 3300028786 Ga0307517_10003720 Ga0307517_1000372018 254
408 3300028794 Ga0307515_10027521 Ga0307515_100275219 254
409 3300028800 Ga0265338_10189119 Ga0265338_101891192 254
410 3300030500 Ga0268256_1000101 Ga0268256_100010173 254
411 3300031456 Ga0307513_10053499 Ga0307513_100534995 254
412 3300032002 Ga0307416_100106393 Ga0307416_1001063932 254
413 3300037853 Ga0436364_0959921 Ga0436364_0959921_63_881 254
414 3300039450 Ga0436363_1520052 Ga0436363_1520052_2740_3804 254
415 3300041411 Ga0439466_0072946 Ga0439466_0072946_91_870 254
416 3300042006 Ga0439432_037651 Ga0439432_037651_49_828 254
417 3300042010 Ga0439452_032955 Ga0439452_032955_65_844 254
418 3300042439 Ga0439464_0000277 Ga0439464_0000277_7632_8411 254
419 3300046460 Ga0495638_0000326 Ga0495638_0000326_58466_59311 254
420 3300046512 Ga0495610_0007573 Ga0495610_0007573_2101_2946 254
421 3300046513 Ga0495616_0038638 Ga0495616_0038638_1394_2239 254
422 3300046616 Ga0495668_0087826 Ga0495668_0087826_555_1346 254
423 3300046648 Ga0495611_0027813 Ga0495611_0027813_1288_2112 254
424 3300049571 Ga0501034_0199285 Ga0501034_0199285_545_1327 254
425 3300049581 Ga0501047_0016564 Ga0501047_0016564_296_1123 254
426 3300049581 Ga0501047_0417017 Ga0501047_0417017_11_817 254
427 3300050507 nmdc:mga05p37_32052_c1 nmdc:mga05p37_32052_c1_3975_4769 254
428 3300050508 nmdc:mga09592_1735_c1 nmdc:mga09592_1735_c1_10347_11141 254
429 3300050510 nmdc:mga06r32_48_c1 nmdc:mga06r32_48_c1_22698_23492 254
430 3300050511 nmdc:mga08y16_67_c1 nmdc:mga08y16_67_c1_38280_39074 254
431 3300053087 Ga0500643_000236 Ga0500643_000236_29395_30240 254
432 3300053096 Ga0500641_0007930 Ga0500641_0007930_1537_2382 254
433 3300053104 Ga0500556_0001246 Ga0500556_0001246_2799_3644 254
434 3300053105 Ga0500557_051774 Ga0500557_051774_260_1105 254
435 3300053108 Ga0500562_001952 Ga0500562_001952_2803_3648 254
436 3300053108 Ga0500562_022909 Ga0500562_022909_385_1230 254
437 3300053151 Ga0500604_0061682 Ga0500604_0061682_185_976 254
438 3300053153 Ga0500616_0006850 Ga0500616_0006850_1600_2445 254
439 3300053153 Ga0500616_0022720 Ga0500616_0022720_552_1397 254
440 3300053156 Ga0500622_0014917 Ga0500622_0014917_1777_2622 254
441 3300053156 Ga0500622_0020348 Ga0500622_0020348_1337_2182 254
442 3300053730 Ga0500645_000790 Ga0500645_000790_14212_15057 254
443 3300053730 Ga0500645_001349 Ga0500645_001349_1442_2287 254
444 iso_pu_bacteria 2854911287 2854912013 254
445 iso_pu_bacteria 3007252601 3007254297 254
446 iso_pu_bacteria 3007315729 3007316906 254
447 3300001904 JGI24736J21556_1007395 JGI24736J21556_10073952 255
448 3300003322 rootL2_10301675 rootL2_103016753 255
449 3300003578 Ga0006562J51391_1162000 Ga0006562J51391_11620001 255
450 3300003578 Ga0006562J51391_1162001 Ga0006562J51391_11620013 255
451 3300005262 Ga0065165_1000093 Ga0065165_100009389 255
452 3300005288 Ga0065714_10091673 Ga0065714_100916732 255
453 3300005293 Ga0065715_10341747 Ga0065715_103417471 255
454 3300005329 Ga0070683_100453071 Ga0070683_1004530711 255
455 3300005330 Ga0070690_100002162 Ga0070690_10000216210 255
456 3300005331 Ga0070670_100018343 Ga0070670_1000183436 255
457 3300005331 Ga0070670_100276858 Ga0070670_1002768582 255
458 3300005334 Ga0068869_100002671 Ga0068869_1000026719 255
459 3300005335 Ga0070666_10020342 Ga0070666_100203425 255
460 3300005336 Ga0070680_100005561 Ga0070680_1000055612 255
461 3300005340 Ga0070689_100003447 Ga0070689_1000034473 255
462 3300005344 Ga0070661_100022662 Ga0070661_1000226623 255
463 3300005354 Ga0070675_100001395 Ga0070675_1000013951 255
464 3300005355 Ga0070671_100045250 Ga0070671_1000452503 255
465 3300005364 Ga0070673_100000393 Ga0070673_1000003936 255
466 3300005366 Ga0070659_100000040 Ga0070659_10000004088 255
467 3300005366 Ga0070659_100008635 Ga0070659_1000086356 255
468 3300005440 Ga0070705_100016110 Ga0070705_1000161103 255
469 3300005441 Ga0070700_100174455 Ga0070700_1001744551 255
470 3300005457 Ga0070662_100172140 Ga0070662_1001721401 255
471 3300005458 Ga0070681_10030623 Ga0070681_100306235 255
472 3300005459 Ga0068867_100093050 Ga0068867_1000930502 255
473 3300005535 Ga0070684_100002776 Ga0070684_1000027766 255
474 3300005539 Ga0068853_100079848 Ga0068853_1000798482 255
475 3300005543 Ga0070672_100022058 Ga0070672_1000220582 255
476 3300005544 Ga0070686_100007969 Ga0070686_1000079694 255
477 3300005547 Ga0070693_100342933 Ga0070693_1003429331 255
478 3300005548 Ga0070665_100000248 Ga0070665_10000024868 255
479 3300005548 Ga0070665_100020273 Ga0070665_1000202734 255
480 3300005563 Ga0068855_100011064 Ga0068855_1000110648 255
481 3300005563 Ga0068855_100159449 Ga0068855_1001594492 255
482 3300005564 Ga0070664_100000407 Ga0070664_10000040735 255
483 3300005577 Ga0068857_100059056 Ga0068857_1000590563 255
484 3300005615 Ga0070702_100006771 Ga0070702_1000067715 255
485 3300005617 Ga0068859_100001376 Ga0068859_10000137614 255
486 3300005618 Ga0068864_100033400 Ga0068864_1000334002 255
487 3300005719 Ga0068861_100051537 Ga0068861_1000515372 255
488 3300005840 Ga0068870_10020900 Ga0068870_100209003 255
489 3300005841 Ga0068863_100000673 Ga0068863_1000006738 255
490 3300005842 Ga0068858_100004783 Ga0068858_1000047834 255
491 3300005842 Ga0068858_100376935 Ga0068858_1003769352 255
492 3300005843 Ga0068860_100015972 Ga0068860_1000159722 255
493 3300005844 Ga0068862_100001925 Ga0068862_10000192514 255
494 3300006173 Ga0070716_100009265 Ga0070716_1000092652 255
495 3300006358 Ga0068871_100094024 Ga0068871_1000940242 255
496 3300006881 Ga0068865_100004806 Ga0068865_1000048069 255
497 3300006931 Ga0097620_100001375 Ga0097620_10000137514 255
498 3300009093 Ga0105240_10008495 Ga0105240_100084952 255
499 3300009148 Ga0105243_10098657 Ga0105243_100986572 255
500 3300009177 Ga0105248_10002192 Ga0105248_1000219210 255
501 3300009551 Ga0105238_10091911 Ga0105238_100919113 255
502 3300009551 Ga0105238_10165976 Ga0105238_101659762 255
503 3300009553 Ga0105249_10007976 Ga0105249_100079762 255
504 3300010375 Ga0105239_10219964 Ga0105239_102199642 255
505 3300010375 Ga0105239_11075055 Ga0105239_110750551 255
506 3300013104 Ga0157370_10000495 Ga0157370_1000049542 255
507 3300013105 Ga0157369_10000464 Ga0157369_1000046442 255
508 3300013306 Ga0163162_10037697 Ga0163162_100376975 255
509 3300013308 Ga0157375_10008547 Ga0157375_100085478 255
510 3300014325 Ga0163163_10122601 Ga0163163_101226012 255
511 3300014745 Ga0157377_10037112 Ga0157377_100371122 255
512 3300015265 Ga0182005_1073370 Ga0182005_10733701 255
513 3300021384 Ga0213876_10000183 Ga0213876_1000018331 255
514 3300025258 Ga0209129_1001075 Ga0209129_10010755 255
515 3300025297 Ga0209758_1004180 Ga0209758_10041806 255
516 3300025302 Ga0207426_1024894 Ga0207426_10248943 255
517 3300025904 Ga0207647_10000010 Ga0207647_10000010143 255
518 3300025908 Ga0207643_10017888 Ga0207643_100178883 255
519 3300025909 Ga0207705_10002329 Ga0207705_100023298 255
520 3300025912 Ga0207707_10080846 Ga0207707_100808462 255
521 3300025913 Ga0207695_10001421 Ga0207695_100014213 255
522 3300025917 Ga0207660_10003341 Ga0207660_100033412 255
523 3300025918 Ga0207662_10002043 Ga0207662_100020436 255
524 3300025919 Ga0207657_10007945 Ga0207657_100079458 255
525 3300025924 Ga0207694_10060428 Ga0207694_100604282 255
526 3300025925 Ga0207650_10492621 Ga0207650_104926212 255
527 3300025926 Ga0207659_10035819 Ga0207659_100358193 255
528 3300025932 Ga0207690_10000134 Ga0207690_1000013415 255
529 3300025932 Ga0207690_10019025 Ga0207690_100190254 255
530 3300025936 Ga0207670_10005327 Ga0207670_100053276 255
531 3300025937 Ga0207669_10047123 Ga0207669_100471232 255
532 3300025938 Ga0207704_10055805 Ga0207704_100558053 255
533 3300025940 Ga0207691_10133426 Ga0207691_101334262 255
534 3300025941 Ga0207711_10005329 Ga0207711_1000532911 255
535 3300025942 Ga0207689_10020551 Ga0207689_100205514 255
536 3300025945 Ga0207679_10016582 Ga0207679_100165824 255
537 3300025949 Ga0207667_10109685 Ga0207667_101096853 255
538 3300025949 Ga0207667_10176225 Ga0207667_101762253 255
539 3300025960 Ga0207651_10033951 Ga0207651_100339513 255
540 3300026035 Ga0207703_10499048 Ga0207703_104990481 255
541 3300026075 Ga0207708_10058009 Ga0207708_100580092 255
542 3300026088 Ga0207641_10024917 Ga0207641_100249174 255
543 3300026088 Ga0207641_10172025 Ga0207641_101720252 255
544 3300026089 Ga0207648_10007368 Ga0207648_100073689 255
545 3300026095 Ga0207676_10005349 Ga0207676_100053499 255
546 3300026116 Ga0207674_10025731 Ga0207674_100257317 255
547 3300027543 Ga0209999_1001854 Ga0209999_10018544 255
548 3300028379 Ga0268266_10000005 Ga0268266_100000051138 255
549 3300028379 Ga0268266_10065003 Ga0268266_100650032 255
550 3300028379 Ga0268266_10116472 Ga0268266_101164722 255
551 3300028380 Ga0268265_10193008 Ga0268265_101930082 255
552 3300028381 Ga0268264_10209512 Ga0268264_102095122 255
553 3300031251 Ga0265327_10000394 Ga0265327_1000039468 255
554 3300031251 Ga0265327_10000933 Ga0265327_1000093325 255
555 3300031456 Ga0307513_10021039 Ga0307513_100210397 255
556 3300031548 Ga0307408_100045292 Ga0307408_1000452922 255
557 3300032005 Ga0307411_10171378 Ga0307411_101713781 255
558 3300035085 Ga0373929_0062312 Ga0373929_0062312_36_833 255
559 3300035171 Ga0373946_0007070 Ga0373946_0007070_2082_2918 255
560 3300035695 Ga0373927_0000130 Ga0373927_0000130_392_1228 255
561 3300037068 Ga0373925_0036513 Ga0373925_0036513_1037_1873 255
562 3300038725 Ga0400484_04287 Ga0400484_04287_13177_14001 255
563 3300038725 Ga0400484_11728 Ga0400484_11728_4630_5454 255
564 3300038725 Ga0400484_44564 Ga0400484_44564_361_1185 255
565 3300038726 Ga0400490_06422 Ga0400490_06422_458_1381 255
566 3300038726 Ga0400490_18130 Ga0400490_18130_1687_2511 255
567 3300038727 Ga0400491_04024 Ga0400491_04024_332_1156 255
568 3300039437 Ga0436365_0640791 Ga0436365_0640791_33479_34300 255
569 3300042184 Ga0450908_000050 Ga0450908_000050_8925_9740 255
570 3300046453 Ga0495627_000095 Ga0495627_000095_97362_98162 255
571 3300046474 Ga0495605_0004235 Ga0495605_0004235_3505_4302 255
572 3300046474 Ga0495605_0004852 Ga0495605_0004852_1036_1833 255
573 3300046501 Ga0495607_0000024 Ga0495607_0000024_144413_145210 255
574 3300046543 Ga0495645_0005791 Ga0495645_0005791_423_1265 255
575 3300046616 Ga0495668_0058681 Ga0495668_0058681_125_922 255
576 3300046616 Ga0495668_0078486 Ga0495668_0078486_384_1208 255
577 3300046660 Ga0495625_0097020 Ga0495625_0097020_345_1169 255
578 3300046810 Ga0495660_0000431 Ga0495660_0000431_14728_15516 255
579 3300047320 Ga0495672_0009332 Ga0495672_0009332_1961_2758 255
580 3300047320 Ga0495672_0015335 Ga0495672_0015335_2639_3427 255
581 3300047320 Ga0495672_0053772 Ga0495672_0053772_1092_1910 255
582 3300047469 Ga0495673_0000389 Ga0495673_0000389_12968_13756 255
583 3300048091 Ga0495626_0123277 Ga0495626_0123277_175_963 255
584 3300048909 Ga0496106_0029466 Ga0496106_0029466_194_991 255
585 3300048912 Ga0496109_0053159 Ga0496109_0053159_1318_2115 255
586 3300048913 Ga0496110_0096563 Ga0496110_0096563_1585_2382 255
587 3300048918 Ga0496115_0001643 Ga0496115_0001643_15182_16027 255
588 3300048920 Ga0496117_0026880 Ga0496117_0026880_2096_2878 255
589 3300048921 Ga0496118_0001894 Ga0496118_0001894_1630_2412 255
590 3300048924 Ga0496121_0000071 Ga0496121_0000071_189912_190694 255
591 3300048925 Ga0496122_0180560 Ga0496122_0180560_354_1136 255
592 3300048926 Ga0496123_0049567 Ga0496123_0049567_480_1262 255
593 3300048926 Ga0496123_0075778 Ga0496123_0075778_1124_1906 255
594 3300048927 Ga0496124_0060578 Ga0496124_0060578_1941_2726 255
595 3300048928 Ga0496125_0027152 Ga0496125_0027152_3977_4759 255
596 3300048929 Ga0496126_0079339 Ga0496126_0079339_836_1618 255
597 3300049572 Ga0501036_0174913 Ga0501036_0174913_768_1601 255
598 3300049581 Ga0501047_0004231 Ga0501047_0004231_12607_13440 255
599 3300049822 Ga0501035_0094792 Ga0501035_0094792_1598_2431 255
600 3300049823 Ga0501044_0009147 Ga0501044_0009147_9315_10148 255
601 3300053108 Ga0500562_000623 Ga0500562_000623_2336_3181 255
602 3300053119 Ga0500595_038862 Ga0500595_038862_377_1207 255
603 3300053125 Ga0500618_000754 Ga0500618_000754_12872_13711 255
604 3300053140 Ga0500573_0048452 Ga0500573_0048452_674_1474 255
605 iso_pu_bacteria 2582581279 2585147152 255
606 iso_pu_bacteria 2842914999 2842918295 255
607 iso_pu_bacteria 2919404418 2919406585 255
608 2124908027 MRS2a_Contig_6771 MRS2a_00628600 256
609 3300002737 JGI25162J39368_1000459 JGI25162J39368_100045917 256
610 3300002771 JGI25163J39215_1000407 JGI25163J39215_10004077 256
611 3300002771 JGI25163J39215_1000589 JGI25163J39215_10005893 256
612 3300002772 JGI25164J39214_1000297 JGI25164J39214_100029717 256
613 3300002772 JGI25164J39214_1000314 JGI25164J39214_100031417 256
614 3300003214 JGI25165J46597_1000175 JGI25165J46597_100017517 256
615 3300003214 JGI25165J46597_1000193 JGI25165J46597_100019315 256
616 3300003751 Ga0055538_1000012 Ga0055538_100001219 256
617 3300003752 Ga0055539_1000017 Ga0055539_100001719 256
618 3300003756 Ga0055533_1000021 Ga0055533_100002119 256
619 3300003758 Ga0055532_1000020 Ga0055532_1000020223 256
620 3300003759 Ga0055525_1000117 Ga0055525_100011797 256
621 3300003761 Ga0055535_1012090 Ga0055535_10120902 256
622 3300003781 Ga0055536_1003173 Ga0055536_10031734 256
623 3300003791 Ga0055530_10000081 Ga0055530_1000008156 256
624 3300003791 Ga0055530_10000548 Ga0055530_1000054816 256
625 3300003791 Ga0055530_10004915 Ga0055530_100049152 256
626 3300003792 Ga0055540_1000121 Ga0055540_100012156 256
627 3300003792 Ga0055540_1000242 Ga0055540_100024219 256
628 3300003792 Ga0055540_1001116 Ga0055540_10011163 256
629 3300003794 Ga0055531_10001033 Ga0055531_1000103317 256
630 3300003841 Ga0055541_1000012 Ga0055541_100001219 256
631 3300003856 Ga0058692_1008095 Ga0058692_10080953 256
632 3300005288 Ga0065714_10002860 Ga0065714_100028604 256
633 3300005288 Ga0065714_10004303 Ga0065714_100043036 256
634 3300005288 Ga0065714_10008943 Ga0065714_100089432 256
635 3300005288 Ga0065714_10064636 Ga0065714_100646368 256
636 3300005288 Ga0065714_10064893 Ga0065714_100648932 256
637 3300005288 Ga0065714_10066596 Ga0065714_100665961 256
638 3300005289 Ga0065704_10001959 Ga0065704_100019597 256
639 3300005289 Ga0065704_10008836 Ga0065704_100088363 256
640 3300005289 Ga0065704_10071119 Ga0065704_1007111910 256
641 3300005290 Ga0065712_10068500 Ga0065712_100685007 256
642 3300005331 Ga0070670_100003035 Ga0070670_1000030356 256
643 3300005331 Ga0070670_100005339 Ga0070670_1000053395 256
644 3300005344 Ga0070661_100000237 Ga0070661_10000023724 256
645 3300005353 Ga0070669_100000158 Ga0070669_10000015825 256
646 3300005353 Ga0070669_100000277 Ga0070669_10000027720 256
647 3300005367 Ga0070667_100203189 Ga0070667_1002031891 256
648 3300005457 Ga0070662_100000063 Ga0070662_10000006317 256
649 3300005539 Ga0068853_100000143 Ga0068853_10000014327 256
650 3300005539 Ga0068853_100047201 Ga0068853_1000472012 256
651 3300005539 Ga0068853_100302093 Ga0068853_1003020932 256
652 3300005548 Ga0070665_100057771 Ga0070665_1000577712 256
653 3300005564 Ga0070664_100000940 Ga0070664_10000094018 256
654 3300005564 Ga0070664_100008436 Ga0070664_1000084365 256
655 3300005564 Ga0070664_100055150 Ga0070664_1000551504 256
656 3300005578 Ga0068854_100004725 Ga0068854_1000047257 256
657 3300005834 Ga0068851_10000018 Ga0068851_1000001820 256
658 3300005841 Ga0068863_100338951 Ga0068863_1003389512 256
659 3300005844 Ga0068862_100015372 Ga0068862_1000153721 256
660 3300006051 Ga0075364_10000109 Ga0075364_1000010918 256
661 3300006051 Ga0075364_10054778 Ga0075364_100547782 256
662 3300006051 Ga0075364_10078438 Ga0075364_100784382 256
663 3300006051 Ga0075364_10110261 Ga0075364_101102612 256
664 3300006051 Ga0075364_10131569 Ga0075364_101315692 256
665 3300006058 Ga0075432_10004705 Ga0075432_100047054 256
666 3300006058 Ga0075432_10007143 Ga0075432_100071432 256
667 3300006058 Ga0075432_10021580 Ga0075432_100215802 256
668 3300006058 Ga0075432_10064995 Ga0075432_100649952 256
669 3300006177 Ga0075362_10003263 Ga0075362_100032635 256
670 3300006914 Ga0075436_100170932 Ga0075436_1001709322 256
671 3300006944 Ga0099823_1002256 Ga0099823_100225614 256
672 3300006946 Ga0079104_1000291 Ga0079104_100029138 256
673 3300006946 Ga0079104_1003204 Ga0079104_10032043 256
674 3300006946 Ga0079104_1020394 Ga0079104_10203942 256
675 3300009011 Ga0105251_10000033 Ga0105251_10000033101 256
676 3300009011 Ga0105251_10000068 Ga0105251_1000006879 256
677 3300009011 Ga0105251_10000881 Ga0105251_1000088118 256
678 3300009011 Ga0105251_10000985 Ga0105251_100009856 256
679 3300009011 Ga0105251_10002062 Ga0105251_1000206213 256
680 3300009011 Ga0105251_10003716 Ga0105251_100037165 256
681 3300009011 Ga0105251_10004230 Ga0105251_100042306 256
682 3300009011 Ga0105251_10004706 Ga0105251_100047065 256
683 3300009011 Ga0105251_10007970 Ga0105251_100079707 256
684 3300009011 Ga0105251_10012227 Ga0105251_100122273 256
685 3300009011 Ga0105251_10039793 Ga0105251_100397932 256
686 3300009011 Ga0105251_10043483 Ga0105251_100434832 256
687 3300009011 Ga0105251_10047642 Ga0105251_100476423 256
688 3300009011 Ga0105251_10051112 Ga0105251_100511122 256
689 3300009011 Ga0105251_10051586 Ga0105251_100515862 256
690 3300009011 Ga0105251_10162101 Ga0105251_101621012 256
691 3300009011 Ga0105251_10186259 Ga0105251_101862592 256
692 3300009036 Ga0105244_10000726 Ga0105244_1000072616 256
693 3300009036 Ga0105244_10001870 Ga0105244_1000187012 256
694 3300009036 Ga0105244_10002402 Ga0105244_100024026 256
695 3300009036 Ga0105244_10005309 Ga0105244_100053097 256
696 3300009036 Ga0105244_10006394 Ga0105244_100063944 256
697 3300009036 Ga0105244_10010227 Ga0105244_100102275 256
698 3300009036 Ga0105244_10017810 Ga0105244_100178104 256
699 3300009036 Ga0105244_10096083 Ga0105244_100960832 256
700 3300009036 Ga0105244_10096207 Ga0105244_100962072 256
701 3300009036 Ga0105244_10101682 Ga0105244_101016821 256
702 3300009036 Ga0105244_10109387 Ga0105244_101093872 256
703 3300009036 Ga0105244_10156809 Ga0105244_101568092 256
704 3300009036 Ga0105244_10161267 Ga0105244_101612672 256
705 3300009092 Ga0105250_10000825 Ga0105250_100008257 256
706 3300009092 Ga0105250_10001995 Ga0105250_100019955 256
707 3300009092 Ga0105250_10007162 Ga0105250_100071625 256
708 3300009092 Ga0105250_10016832 Ga0105250_100168323 256
709 3300009092 Ga0105250_10027515 Ga0105250_100275152 256
710 3300009092 Ga0105250_10065871 Ga0105250_100658711 256
711 3300009092 Ga0105250_10065931 Ga0105250_100659312 256
712 3300009092 Ga0105250_10089394 Ga0105250_100893942 256
713 3300009092 Ga0105250_10173047 Ga0105250_101730471 256
714 3300009148 Ga0105243_10000075 Ga0105243_10000075100 256
715 3300009148 Ga0105243_10000867 Ga0105243_100008679 256
716 3300009148 Ga0105243_10001447 Ga0105243_1000144716 256
717 3300009148 Ga0105243_10075069 Ga0105243_100750692 256
718 3300009148 Ga0105243_10118152 Ga0105243_101181522 256
719 3300009148 Ga0105243_10135072 Ga0105243_101350722 256
720 3300009176 Ga0105242_10000358 Ga0105242_1000035816 256
721 3300009176 Ga0105242_10016716 Ga0105242_100167162 256
722 3300009177 Ga0105248_10172510 Ga0105248_101725102 256
723 3300009177 Ga0105248_10180194 Ga0105248_101801943 256
724 3300009545 Ga0105237_10002504 Ga0105237_100025046 256
725 3300010375 Ga0105239_10611688 Ga0105239_106116882 256
726 3300011119 Ga0105246_10000436 Ga0105246_100004366 256
727 3300011119 Ga0105246_10000504 Ga0105246_1000050410 256
728 3300011119 Ga0105246_10010430 Ga0105246_100104303 256
729 3300011119 Ga0105246_10023186 Ga0105246_100231865 256
730 3300011119 Ga0105246_10047287 Ga0105246_100472873 256
731 3300012498 Ga0157345_1000163 Ga0157345_10001636 256
732 3300013100 Ga0157373_10000586 Ga0157373_1000058610 256
733 3300013100 Ga0157373_10003492 Ga0157373_1000349210 256
734 3300013100 Ga0157373_10003814 Ga0157373_100038145 256
735 3300013100 Ga0157373_10006402 Ga0157373_100064024 256
736 3300013100 Ga0157373_10016680 Ga0157373_100166802 256
737 3300013100 Ga0157373_10031150 Ga0157373_100311502 256
738 3300013100 Ga0157373_10390036 Ga0157373_103900361 256
739 3300013102 Ga0157371_10000935 Ga0157371_1000093516 256
740 3300013102 Ga0157371_10001391 Ga0157371_1000139116 256
741 3300013102 Ga0157371_10004419 Ga0157371_100044198 256
742 3300013102 Ga0157371_10223794 Ga0157371_102237942 256
743 3300013104 Ga0157370_10008450 Ga0157370_100084505 256
744 3300013104 Ga0157370_10010774 Ga0157370_100107745 256
745 3300013104 Ga0157370_10054054 Ga0157370_100540544 256
746 3300013104 Ga0157370_10073948 Ga0157370_100739483 256
747 3300013104 Ga0157370_10469478 Ga0157370_104694781 256
748 3300013105 Ga0157369_10009283 Ga0157369_100092836 256
749 3300013105 Ga0157369_10017873 Ga0157369_100178735 256
750 3300013105 Ga0157369_10022731 Ga0157369_100227315 256
751 3300013105 Ga0157369_10229424 Ga0157369_102294242 256
752 3300013105 Ga0157369_10898889 Ga0157369_108988891 256
753 3300013306 Ga0163162_10001225 Ga0163162_100012255 256
754 3300013308 Ga0157375_10005374 Ga0157375_100053746 256
755 3300013308 Ga0157375_10009695 Ga0157375_100096955 256
756 3300014497 Ga0182008_10001337 Ga0182008_100013375 256
757 3300014497 Ga0182008_10003405 Ga0182008_100034057 256
758 3300014497 Ga0182008_10005486 Ga0182008_100054863 256
759 3300014497 Ga0182008_10009133 Ga0182008_100091334 256
760 3300014497 Ga0182008_10010188 Ga0182008_100101884 256
761 3300015261 Ga0182006_1001380 Ga0182006_10013805 256
762 3300015261 Ga0182006_1001917 Ga0182006_10019175 256
763 3300015261 Ga0182006_1002154 Ga0182006_10021545 256
764 3300015261 Ga0182006_1003725 Ga0182006_10037255 256
765 3300015261 Ga0182006_1060908 Ga0182006_10609082 256
766 3300015262 Ga0182007_10000228 Ga0182007_1000022820 256
767 3300015262 Ga0182007_10054590 Ga0182007_100545902 256
768 3300015265 Ga0182005_1000375 Ga0182005_100037520 256
769 3300015265 Ga0182005_1004691 Ga0182005_10046913 256
770 3300015265 Ga0182005_1015515 Ga0182005_10155152 256
771 3300015265 Ga0182005_1022296 Ga0182005_10222962 256
772 3300015265 Ga0182005_1028587 Ga0182005_10285872 256
773 3300017792 Ga0163161_10003439 Ga0163161_100034395 256
774 3300017792 Ga0163161_10025857 Ga0163161_100258574 256
775 3300017792 Ga0163161_10026043 Ga0163161_100260433 256
776 3300017792 Ga0163161_10030292 Ga0163161_100302924 256
777 3300017792 Ga0163161_10062624 Ga0163161_100626242 256
778 3300017792 Ga0163161_10196908 Ga0163161_101969082 256
779 3300021384 Ga0213876_10076158 Ga0213876_100761582 256
780 3300025206 Ga0209435_100424 Ga0209435_1004249 256
781 3300025207 Ga0209760_100082 Ga0209760_10008267 256
782 3300025207 Ga0209760_100230 Ga0209760_1002303 256
783 3300025224 Ga0209784_100007 Ga0209784_10000719 256
784 3300025225 Ga0209566_100009 Ga0209566_10000919 256
785 3300025226 Ga0209674_100021 Ga0209674_10002119 256
786 3300025229 Ga0209147_100009 Ga0209147_10000919 256
787 3300025230 Ga0209563_100018 Ga0209563_10001819 256
788 3300025231 Ga0207427_100005 Ga0207427_100005732 256
789 3300025231 Ga0207427_100006 Ga0207427_10000620 256
790 3300025233 Ga0209437_100013 Ga0209437_10001320 256
791 3300025233 Ga0209437_100018 Ga0209437_100018642 256
792 3300025242 Ga0209258_100237 Ga0209258_10023719 256
793 3300025246 Ga0209646_1000277 Ga0209646_100027720 256
794 3300025253 Ga0209677_100012 Ga0209677_10001219 256
795 3300025256 Ga0209759_1006965 Ga0209759_10069653 256
796 3300025256 Ga0209759_1017087 Ga0209759_10170872 256
797 3300025261 Ga0209233_1000021 Ga0209233_1000021732 256
798 3300025261 Ga0209233_1000022 Ga0209233_100002220 256
799 3300025284 Ga0209130_1025652 Ga0209130_10256522 256
800 3300025292 Ga0209676_1000015 Ga0209676_100001579 256
801 3300025292 Ga0209676_1000157 Ga0209676_100015780 256
802 3300025292 Ga0209676_1000222 Ga0209676_100022222 256
803 3300025292 Ga0209676_1000242 Ga0209676_1000242112 256
804 3300025292 Ga0209676_1000583 Ga0209676_100058338 256
805 3300025292 Ga0209676_1002476 Ga0209676_10024762 256
806 3300025298 Ga0209050_1000030 Ga0209050_1000030359 256
807 3300025298 Ga0209050_1000061 Ga0209050_1000061137 256
808 3300025298 Ga0209050_1000296 Ga0209050_100029622 256
809 3300025298 Ga0209050_1001114 Ga0209050_100111414 256
810 3300025298 Ga0209050_1059597 Ga0209050_10595972 256
811 3300025303 Ga0209051_1000088 Ga0209051_100008891 256
812 3300025303 Ga0209051_1000143 Ga0209051_100014380 256
813 3300025303 Ga0209051_1000295 Ga0209051_100029558 256
814 3300025303 Ga0209051_1009993 Ga0209051_10099934 256
815 3300025304 Ga0209257_1000422 Ga0209257_100042279 256
816 3300025304 Ga0209257_1009479 Ga0209257_10094795 256
817 3300025321 Ga0207656_10000009 Ga0207656_1000000920 256
818 3300025711 Ga0207696_1000055 Ga0207696_1000055235 256
819 3300025711 Ga0207696_1000127 Ga0207696_100012720 256
820 3300025711 Ga0207696_1000151 Ga0207696_100015140 256
821 3300025711 Ga0207696_1000165 Ga0207696_100016520 256
822 3300025711 Ga0207696_1001704 Ga0207696_10017045 256
823 3300025711 Ga0207696_1003033 Ga0207696_10030336 256
824 3300025711 Ga0207696_1003607 Ga0207696_10036075 256
825 3300025711 Ga0207696_1006652 Ga0207696_10066522 256
826 3300025711 Ga0207696_1015269 Ga0207696_10152692 256
827 3300025711 Ga0207696_1076906 Ga0207696_10769061 256
828 3300025728 Ga0207655_1000135 Ga0207655_1000135119 256
829 3300025728 Ga0207655_1000548 Ga0207655_100054821 256
830 3300025728 Ga0207655_1000667 Ga0207655_100066721 256
831 3300025728 Ga0207655_1000754 Ga0207655_100075420 256
832 3300025728 Ga0207655_1001254 Ga0207655_10012547 256
833 3300025728 Ga0207655_1001422 Ga0207655_10014224 256
834 3300025728 Ga0207655_1001733 Ga0207655_10017335 256
835 3300025728 Ga0207655_1002247 Ga0207655_10022472 256
836 3300025728 Ga0207655_1004181 Ga0207655_10041814 256
837 3300025728 Ga0207655_1006660 Ga0207655_10066605 256
838 3300025728 Ga0207655_1009133 Ga0207655_10091334 256
839 3300025728 Ga0207655_1011018 Ga0207655_10110181 256
840 3300025728 Ga0207655_1017979 Ga0207655_10179792 256
841 3300025728 Ga0207655_1028896 Ga0207655_10288962 256
842 3300025728 Ga0207655_1065329 Ga0207655_10653292 256
843 3300025728 Ga0207655_1066905 Ga0207655_10669052 256
844 3300025728 Ga0207655_1081641 Ga0207655_10816412 256
845 3300025728 Ga0207655_1113523 Ga0207655_11135231 256
846 3300025735 Ga0207713_1000012 Ga0207713_1000012282 256
847 3300025735 Ga0207713_1000103 Ga0207713_1000103111 256
848 3300025735 Ga0207713_1000126 Ga0207713_100012618 256
849 3300025735 Ga0207713_1000297 Ga0207713_10002976 256
850 3300025735 Ga0207713_1000325 Ga0207713_100032534 256
851 3300025735 Ga0207713_1000984 Ga0207713_10009846 256
852 3300025735 Ga0207713_1002461 Ga0207713_10024619 256
853 3300025735 Ga0207713_1003599 Ga0207713_10035997 256
854 3300025735 Ga0207713_1004264 Ga0207713_10042644 256
855 3300025735 Ga0207713_1004634 Ga0207713_10046344 256
856 3300025735 Ga0207713_1004661 Ga0207713_10046615 256
857 3300025735 Ga0207713_1005396 Ga0207713_10053965 256
858 3300025735 Ga0207713_1005829 Ga0207713_10058292 256
859 3300025735 Ga0207713_1008163 Ga0207713_10081634 256
860 3300025735 Ga0207713_1016738 Ga0207713_10167382 256
861 3300025735 Ga0207713_1017509 Ga0207713_10175092 256
862 3300025735 Ga0207713_1025443 Ga0207713_10254432 256
863 3300025735 Ga0207713_1046805 Ga0207713_10468052 256
864 3300025735 Ga0207713_1088689 Ga0207713_10886892 256
865 3300025735 Ga0207713_1098176 Ga0207713_10981762 256
866 3300025914 Ga0207671_10000876 Ga0207671_1000087620 256
867 3300025920 Ga0207649_10000007 Ga0207649_10000007284 256
868 3300025923 Ga0207681_10000291 Ga0207681_1000029120 256
869 3300025923 Ga0207681_10001357 Ga0207681_1000135714 256
870 3300025923 Ga0207681_10414592 Ga0207681_104145922 256
871 3300025925 Ga0207650_10000308 Ga0207650_1000030819 256
872 3300025925 Ga0207650_10000407 Ga0207650_1000040717 256
873 3300025932 Ga0207690_10059032 Ga0207690_100590322 256
874 3300025933 Ga0207706_10000050 Ga0207706_1000005020 256
875 3300025934 Ga0207686_10001345 Ga0207686_1000134511 256
876 3300025934 Ga0207686_10007359 Ga0207686_100073595 256
877 3300025935 Ga0207709_10000107 Ga0207709_1000010748 256
878 3300025935 Ga0207709_10000368 Ga0207709_100003685 256
879 3300025935 Ga0207709_10001047 Ga0207709_1000104711 256
880 3300025935 Ga0207709_10044529 Ga0207709_100445292 256
881 3300025941 Ga0207711_10442639 Ga0207711_104426392 256
882 3300025945 Ga0207679_10000013 Ga0207679_1000001320 256
883 3300025945 Ga0207679_10039343 Ga0207679_100393434 256
884 3300025981 Ga0207640_10080376 Ga0207640_100803762 256
885 3300026041 Ga0207639_10000079 Ga0207639_1000007920 256
886 3300026041 Ga0207639_10157496 Ga0207639_101574962 256
887 3300026067 Ga0207678_10184033 Ga0207678_101840332 256
888 3300027111 Ga0209281_1000237 Ga0209281_100023743 256
889 3300027111 Ga0209281_1002242 Ga0209281_10022423 256
890 3300027111 Ga0209281_1003265 Ga0209281_10032654 256
891 3300027296 Ga0209389_1000065 Ga0209389_100006584 256
892 3300027296 Ga0209389_1041832 Ga0209389_10418322 256
893 3300027312 Ga0209371_1000176 Ga0209371_100017627 256
894 3300027312 Ga0209371_1000735 Ga0209371_100073521 256
895 3300027312 Ga0209371_1010326 Ga0209371_10103262 256
896 3300027665 Ga0209983_1026486 Ga0209983_10264862 256
897 3300027907 Ga0207428_10039688 Ga0207428_100396882 256
898 3300027907 Ga0207428_10043963 Ga0207428_100439633 256
899 3300027907 Ga0207428_10078153 Ga0207428_100781532 256
900 3300027907 Ga0207428_10079559 Ga0207428_100795592 256
901 3300027907 Ga0207428_10233560 Ga0207428_102335602 256
902 3300028379 Ga0268266_10002796 Ga0268266_100027965 256
903 3300028380 Ga0268265_10002972 Ga0268265_100029729 256
904 3300028786 Ga0307517_10032178 Ga0307517_100321783 256
905 3300028800 Ga0265338_10071753 Ga0265338_100717532 256
906 3300030500 Ga0268256_1000146 Ga0268256_100014673 256
907 3300030500 Ga0268256_1000625 Ga0268256_10006256 256
908 3300030500 Ga0268256_1011074 Ga0268256_10110744 256
909 3300030521 Ga0307511_10008829 Ga0307511_100088297 256
910 3300030733 Ga0314311_1262089 Ga0314311_12620898 256
911 3300030735 Ga0316178_1036683 Ga0316178_103668310 256
912 3300030742 Ga0316183_1050417 Ga0316183_10504173 256
913 3300031251 Ga0265327_10005511 Ga0265327_100055112 256
914 3300031507 Ga0307509_10114426 Ga0307509_101144262 256
915 3300031548 Ga0307408_100000002 Ga0307408_100000002373 256
916 3300031548 Ga0307408_100002301 Ga0307408_10000230110 256
917 3300031548 Ga0307408_100162575 Ga0307408_1001625752 256
918 3300031903 Ga0307407_10348269 Ga0307407_103482691 256
919 3300031911 Ga0307412_10115149 Ga0307412_101151491 256
920 3300031995 Ga0307409_100105426 Ga0307409_1001054262 256
921 3300032004 Ga0307414_10133798 Ga0307414_101337982 256
922 3300032004 Ga0307414_10698186 Ga0307414_106981862 256
923 3300032005 Ga0307411_10010751 Ga0307411_100107513 256
924 3300033180 Ga0307510_10010168 Ga0307510_100101686 256
925 3300033180 Ga0307510_10046095 Ga0307510_100460953 256
926 3300041404 Ga0439436_0000652 Ga0439436_0000652_5193_5981 256
927 3300041405 Ga0439438_000437 Ga0439438_000437_16359_17129 256
928 3300041405 Ga0439438_001281 Ga0439438_001281_5259_6047 256
929 3300041405 Ga0439438_002577 Ga0439438_002577_3300_4070 256
930 3300041405 Ga0439438_005287 Ga0439438_005287_2818_3588 256
931 3300041405 Ga0439438_007479 Ga0439438_007479_1378_2181 256
932 3300041405 Ga0439438_007560 Ga0439438_007560_2494_3264 256
933 3300041407 Ga0439447_000128 Ga0439447_000128_3482_4270 256
934 3300041407 Ga0439447_000462 Ga0439447_000462_10542_11312 256
935 3300041407 Ga0439447_004152 Ga0439447_004152_747_1517 256
936 3300041411 Ga0439466_0000343 Ga0439466_0000343_2711_3481 256
937 3300041411 Ga0439466_0001334 Ga0439466_0001334_270_1040 256
938 3300041411 Ga0439466_0004277 Ga0439466_0004277_4375_5163 256
939 3300041411 Ga0439466_0006839 Ga0439466_0006839_865_1635 256
940 3300041411 Ga0439466_0022672 Ga0439466_0022672_60_830 256
941 3300041411 Ga0439466_0036944 Ga0439466_0036944_110_880 256
942 3300041413 Ga0439465_0002085 Ga0439465_0002085_2273_3043 256
943 3300042006 Ga0439432_001014 Ga0439432_001014_6160_6951 256
944 3300042006 Ga0439432_003214 Ga0439432_003214_3024_3794 256
945 3300042006 Ga0439432_003970 Ga0439432_003970_2778_3566 256
946 3300042006 Ga0439432_008308 Ga0439432_008308_2531_3301 256
947 3300042009 Ga0439451_003180 Ga0439451_003180_1303_2073 256
948 3300042010 Ga0439452_000190 Ga0439452_000190_27655_28425 256
949 3300042010 Ga0439452_000443 Ga0439452_000443_1191_1961 256
950 3300042010 Ga0439452_001195 Ga0439452_001195_3922_4692 256
951 3300042010 Ga0439452_002167 Ga0439452_002167_1309_2097 256
952 3300042010 Ga0439452_002256 Ga0439452_002256_4312_5082 256
953 3300042013 Ga0439456_000036 Ga0439456_000036_21016_21819 256
954 3300042013 Ga0439456_001085 Ga0439456_001085_2034_2804 256
955 3300042016 Ga0439463_000120 Ga0439463_000120_15080_15853 256
956 3300042016 Ga0439463_000491 Ga0439463_000491_7159_7950 256
957 3300042016 Ga0439463_003161 Ga0439463_003161_3332_4135 256
958 3300042016 Ga0439463_005639 Ga0439463_005639_271_1041 256
959 3300042115 Ga0450911_000509 Ga0450911_000509_7695_8465 256
960 3300042115 Ga0450911_000543 Ga0450911_000543_8916_9686 256
961 3300042115 Ga0450911_001948 Ga0450911_001948_3324_4109 256
962 3300042121 Ga0450919_000957 Ga0450919_000957_1464_2234 256
963 3300042122 Ga0450920_002368 Ga0450920_002368_1438_2208 256
964 3300042124 Ga0450922_000657 Ga0450922_000657_1862_2632 256
965 3300042125 Ga0450923_001543 Ga0450923_001543_1507_2295 256
966 3300042127 Ga0450890_000131 Ga0450890_000131_7653_8423 256
967 3300042136 Ga0450900_000084 Ga0450900_000084_2394_3167 256
968 3300042138 Ga0450903_005080 Ga0450903_005080_1375_2145 256
969 3300042138 Ga0450903_008578 Ga0450903_008578_639_1409 256
970 3300042142 Ga0450905_000122 Ga0450905_000122_3475_4266 256
971 3300042142 Ga0450905_004899 Ga0450905_004899_69_842 256
972 3300042146 Ga0450907_000110 Ga0450907_000110_2868_3638 256
973 3300042146 Ga0450907_001935 Ga0450907_001935_2840_3610 256
974 3300042147 Ga0450910_002464 Ga0450910_002464_1023_1793 256
975 3300042147 Ga0450910_024120 Ga0450910_024120_132_902 256
976 3300042156 Ga0439446_0002401 Ga0439446_0002401_10_798 256
977 3300042156 Ga0439446_0002959 Ga0439446_0002959_1909_2679 256
978 3300042185 Ga0450909_000363 Ga0450909_000363_1151_1921 256
979 3300042185 Ga0450909_001941 Ga0450909_001941_307_1077 256
980 3300042435 Ga0439434_0000092 Ga0439434_0000092_21430_22200 256
981 3300042439 Ga0439464_0006232 Ga0439464_0006232_1810_2601 256
982 3300042461 Ga0439460_0003102 Ga0439460_0003102_1959_2729 256
983 3300042461 Ga0439460_0008742 Ga0439460_0008742_1119_1889 256
984 3300042533 Ga0450901_000475 Ga0450901_000475_1587_2360 256
985 3300042993 Ga0439440_0000808 Ga0439440_0000808_1129_1899 256
986 3300046452 Ga0495617_000386 Ga0495617_000386_7331_8101 256
987 3300046452 Ga0495617_004591 Ga0495617_004591_1778_2548 256
988 3300046452 Ga0495617_084803 Ga0495617_084803_236_1006 256
989 3300046453 Ga0495627_000646 Ga0495627_000646_3820_4590 256
990 3300046453 Ga0495627_001581 Ga0495627_001581_263_1033 256
991 3300046453 Ga0495627_004712 Ga0495627_004712_2924_3730 256
992 3300046455 Ga0495603_0001944 Ga0495603_0001944_10849_11619 256
993 3300046457 Ga0495590_0000460 Ga0495590_0000460_16188_16958 256
994 3300046457 Ga0495590_0007082 Ga0495590_0007082_35_805 256
995 3300046457 Ga0495590_0025857 Ga0495590_0025857_1113_1904 256
996 3300046458 Ga0495591_000334 Ga0495591_000334_22030_22821 256
997 3300046458 Ga0495591_001427 Ga0495591_001427_11099_11890 256
998 3300046458 Ga0495591_002016 Ga0495591_002016_4417_5187 256
999 3300046458 Ga0495591_002140 Ga0495591_002140_3886_4656 256
1000 3300046458 Ga0495591_002379 Ga0495591_002379_6277_7068 256
1001 3300046458 Ga0495591_004970 Ga0495591_004970_1696_2466 256
1002 3300046458 Ga0495591_005398 Ga0495591_005398_3013_3783 256
1003 3300046458 Ga0495591_007620 Ga0495591_007620_565_1371 256
1004 3300046458 Ga0495591_016596 Ga0495591_016596_1708_2478 256
1005 3300046458 Ga0495591_018027 Ga0495591_018027_1178_1948 256
1006 3300046460 Ga0495638_0004508 Ga0495638_0004508_8746_9516 256
1007 3300046460 Ga0495638_0045219 Ga0495638_0045219_1928_2698 256
1008 3300046460 Ga0495638_0065440 Ga0495638_0065440_586_1356 256
1009 3300046460 Ga0495638_0225126 Ga0495638_0225126_32_805 256
1010 3300046460 Ga0495638_0288369 Ga0495638_0288369_38_808 256
1011 3300046463 Ga0495653_0007203 Ga0495653_0007203_3868_4671 256
1012 3300046463 Ga0495653_0012336 Ga0495653_0012336_3413_4183 256
1013 3300046471 Ga0495650_0001617 Ga0495650_0001617_5571_6362 256
1014 3300046471 Ga0495650_0001916 Ga0495650_0001916_15173_15976 256
1015 3300046471 Ga0495650_0007358 Ga0495650_0007358_1257_2027 256
1016 3300046471 Ga0495650_0009773 Ga0495650_0009773_2890_3660 256
1017 3300046471 Ga0495650_0017685 Ga0495650_0017685_56_862 256
1018 3300046471 Ga0495650_0054220 Ga0495650_0054220_799_1599 256
1019 3300046473 Ga0495582_0000456 Ga0495582_0000456_14040_14810 256
1020 3300046474 Ga0495605_0000019 Ga0495605_0000019_235560_236366 256
1021 3300046474 Ga0495605_0000376 Ga0495605_0000376_22243_23034 256
1022 3300046474 Ga0495605_0000384 Ga0495605_0000384_5937_6740 256
1023 3300046474 Ga0495605_0002242 Ga0495605_0002242_9813_10583 256
1024 3300046474 Ga0495605_0004010 Ga0495605_0004010_1833_2603 256
1025 3300046474 Ga0495605_0006168 Ga0495605_0006168_6065_6838 256
1026 3300046474 Ga0495605_0020125 Ga0495605_0020125_1921_2691 256
1027 3300046474 Ga0495605_0033602 Ga0495605_0033602_1084_1887 256
1028 3300046474 Ga0495605_0080499 Ga0495605_0080499_692_1483 256
1029 3300046475 Ga0495639_0000295 Ga0495639_0000295_7355_8125 256
1030 3300046491 Ga0495584_0000408 Ga0495584_0000408_15484_16254 256
1031 3300046491 Ga0495584_0002140 Ga0495584_0002140_10506_11276 256
1032 3300046491 Ga0495584_0002646 Ga0495584_0002646_3422_4192 256
1033 3300046491 Ga0495584_0003319 Ga0495584_0003319_6359_7129 256
1034 3300046491 Ga0495584_0006064 Ga0495584_0006064_3585_4355 256
1035 3300046491 Ga0495584_0006289 Ga0495584_0006289_1454_2257 256
1036 3300046491 Ga0495584_0033007 Ga0495584_0033007_41_811 256
1037 3300046491 Ga0495584_0043001 Ga0495584_0043001_265_1056 256
1038 3300046491 Ga0495584_0249412 Ga0495584_0249412_39_809 256
1039 3300046492 Ga0495585_0000895 Ga0495585_0000895_16748_17518 256
1040 3300046492 Ga0495585_0011646 Ga0495585_0011646_1563_2333 256
1041 3300046492 Ga0495585_0012147 Ga0495585_0012147_1937_2743 256
1042 3300046492 Ga0495585_0014639 Ga0495585_0014639_3330_4121 256
1043 3300046492 Ga0495585_0017769 Ga0495585_0017769_10_780 256
1044 3300046492 Ga0495585_0034670 Ga0495585_0034670_1363_2133 256
1045 3300046499 Ga0495594_0005851 Ga0495594_0005851_3035_3841 256
1046 3300046500 Ga0495596_0000175 Ga0495596_0000175_27334_28104 256
1047 3300046500 Ga0495596_0012956 Ga0495596_0012956_2284_3075 256
1048 3300046501 Ga0495607_0000751 Ga0495607_0000751_22359_23150 256
1049 3300046501 Ga0495607_0001123 Ga0495607_0001123_1833_2603 256
1050 3300046501 Ga0495607_0003423 Ga0495607_0003423_9661_10452 256
1051 3300046501 Ga0495607_0003609 Ga0495607_0003609_7164_7934 256
1052 3300046501 Ga0495607_0012855 Ga0495607_0012855_3777_4550 256
1053 3300046501 Ga0495607_0017733 Ga0495607_0017733_3248_4021 256
1054 3300046501 Ga0495607_0030789 Ga0495607_0030789_1740_2510 256
1055 3300046501 Ga0495607_0052787 Ga0495607_0052787_325_1095 256
1056 3300046501 Ga0495607_0113048 Ga0495607_0113048_514_1305 256
1057 3300046501 Ga0495607_0139380 Ga0495607_0139380_440_1210 256
1058 3300046501 Ga0495607_0189960 Ga0495607_0189960_34_840 256
1059 3300046506 Ga0495583_0000146 Ga0495583_0000146_33645_34451 256
1060 3300046506 Ga0495583_0000452 Ga0495583_0000452_19421_20191 256
1061 3300046506 Ga0495583_0001254 Ga0495583_0001254_18586_19377 256
1062 3300046506 Ga0495583_0001293 Ga0495583_0001293_18574_19365 256
1063 3300046506 Ga0495583_0004428 Ga0495583_0004428_3033_3824 256
1064 3300046506 Ga0495583_0005244 Ga0495583_0005244_3218_4021 256
1065 3300046506 Ga0495583_0007005 Ga0495583_0007005_3926_4696 256
1066 3300046506 Ga0495583_0008331 Ga0495583_0008331_2096_2866 256
1067 3300046507 Ga0495606_0000115 Ga0495606_0000115_17548_18339 256
1068 3300046507 Ga0495606_0001164 Ga0495606_0001164_15987_16778 256
1069 3300046507 Ga0495606_0002670 Ga0495606_0002670_3389_4159 256
1070 3300046507 Ga0495606_0007824 Ga0495606_0007824_1078_1848 256
1071 3300046507 Ga0495606_0008572 Ga0495606_0008572_5742_6515 256
1072 3300046507 Ga0495606_0017468 Ga0495606_0017468_3150_3920 256
1073 3300046507 Ga0495606_0021308 Ga0495606_0021308_2272_3042 256
1074 3300046512 Ga0495610_0003687 Ga0495610_0003687_3899_4669 256
1075 3300046512 Ga0495610_0004027 Ga0495610_0004027_3608_4378 256
1076 3300046512 Ga0495610_0007330 Ga0495610_0007330_6036_6806 256
1077 3300046512 Ga0495610_0008416 Ga0495610_0008416_2682_3485 256
1078 3300046512 Ga0495610_0011490 Ga0495610_0011490_3310_4116 256
1079 3300046512 Ga0495610_0014586 Ga0495610_0014586_2123_2893 256
1080 3300046512 Ga0495610_0015654 Ga0495610_0015654_3539_4330 256
1081 3300046512 Ga0495610_0023562 Ga0495610_0023562_778_1548 256
1082 3300046512 Ga0495610_0032725 Ga0495610_0032725_1855_2625 256
1083 3300046513 Ga0495616_0044969 Ga0495616_0044969_1026_1796 256
1084 3300046513 Ga0495616_0050447 Ga0495616_0050447_493_1284 256
1085 3300046513 Ga0495616_0064360 Ga0495616_0064360_67_837 256
1086 3300046513 Ga0495616_0120987 Ga0495616_0120987_382_1152 256
1087 3300046515 Ga0495620_0000023 Ga0495620_0000023_21147_21938 256
1088 3300046515 Ga0495620_0000108 Ga0495620_0000108_33669_34475 256
1089 3300046515 Ga0495620_0001719 Ga0495620_0001719_8205_8975 256
1090 3300046515 Ga0495620_0002090 Ga0495620_0002090_3036_3827 256
1091 3300046515 Ga0495620_0009332 Ga0495620_0009332_3234_4004 256
1092 3300046515 Ga0495620_0014190 Ga0495620_0014190_3050_3841 256
1093 3300046515 Ga0495620_0048260 Ga0495620_0048260_495_1265 256
1094 3300046515 Ga0495620_0052870 Ga0495620_0052870_857_1648 256
1095 3300046517 Ga0495630_0107281 Ga0495630_0107281_947_1750 256
1096 3300046518 Ga0495631_0001318 Ga0495631_0001318_3582_4352 256
1097 3300046518 Ga0495631_0002233 Ga0495631_0002233_6568_7338 256
1098 3300046518 Ga0495631_0002655 Ga0495631_0002655_3320_4126 256
1099 3300046518 Ga0495631_0006347 Ga0495631_0006347_1819_2610 256
1100 3300046518 Ga0495631_0026439 Ga0495631_0026439_513_1283 256
1101 3300046518 Ga0495631_0045974 Ga0495631_0045974_1105_1875 256
1102 3300046518 Ga0495631_0049399 Ga0495631_0049399_353_1144 256
1103 3300046519 Ga0495632_0001083 Ga0495632_0001083_6498_7268 256
1104 3300046519 Ga0495632_0001735 Ga0495632_0001735_12913_13704 256
1105 3300046519 Ga0495632_0001795 Ga0495632_0001795_1993_2784 256
1106 3300046519 Ga0495632_0002669 Ga0495632_0002669_6410_7180 256
1107 3300046519 Ga0495632_0004841 Ga0495632_0004841_2739_3530 256
1108 3300046519 Ga0495632_0004928 Ga0495632_0004928_3619_4389 256
1109 3300046519 Ga0495632_0055660 Ga0495632_0055660_586_1356 256
1110 3300046519 Ga0495632_0215176 Ga0495632_0215176_69_839 256
1111 3300046520 Ga0495637_0000054 Ga0495637_0000054_77283_78074 256
1112 3300046520 Ga0495637_0000194 Ga0495637_0000194_19320_20090 256
1113 3300046520 Ga0495637_0000269 Ga0495637_0000269_21471_22262 256
1114 3300046520 Ga0495637_0000466 Ga0495637_0000466_19172_19942 256
1115 3300046520 Ga0495637_0002490 Ga0495637_0002490_3646_4416 256
1116 3300046520 Ga0495637_0003116 Ga0495637_0003116_4746_5516 256
1117 3300046520 Ga0495637_0004382 Ga0495637_0004382_3334_4140 256
1118 3300046520 Ga0495637_0005192 Ga0495637_0005192_2955_3725 256
1119 3300046520 Ga0495637_0011746 Ga0495637_0011746_1635_2405 256
1120 3300046520 Ga0495637_0019417 Ga0495637_0019417_1409_2179 256
1121 3300046520 Ga0495637_0057374 Ga0495637_0057374_765_1535 256
1122 3300046522 Ga0495643_0000730 Ga0495643_0000730_17382_18173 256
1123 3300046522 Ga0495643_0001170 Ga0495643_0001170_3489_4280 256
1124 3300046522 Ga0495643_0015823 Ga0495643_0015823_2995_3786 256
1125 3300046522 Ga0495643_0018489 Ga0495643_0018489_129_899 256
1126 3300046522 Ga0495643_0052789 Ga0495643_0052789_1191_1961 256
1127 3300046522 Ga0495643_0075803 Ga0495643_0075803_922_1692 256
1128 3300046523 Ga0495644_0001554 Ga0495644_0001554_6230_7021 256
1129 3300046523 Ga0495644_0003019 Ga0495644_0003019_4082_4852 256
1130 3300046523 Ga0495644_0003287 Ga0495644_0003287_3847_4617 256
1131 3300046524 Ga0495648_0000783 Ga0495648_0000783_23251_24042 256
1132 3300046524 Ga0495648_0001858 Ga0495648_0001858_15729_16499 256
1133 3300046524 Ga0495648_0002460 Ga0495648_0002460_3244_4035 256
1134 3300046524 Ga0495648_0002748 Ga0495648_0002748_12976_13782 256
1135 3300046524 Ga0495648_0004730 Ga0495648_0004730_1833_2603 256
1136 3300046524 Ga0495648_0005172 Ga0495648_0005172_5546_6337 256
1137 3300046524 Ga0495648_0007923 Ga0495648_0007923_3471_4241 256
1138 3300046524 Ga0495648_0008056 Ga0495648_0008056_3691_4461 256
1139 3300046524 Ga0495648_0012578 Ga0495648_0012578_2029_2835 256
1140 3300046524 Ga0495648_0043672 Ga0495648_0043672_946_1716 256
1141 3300046524 Ga0495648_0113046 Ga0495648_0113046_453_1223 256
1142 3300046524 Ga0495648_0146522 Ga0495648_0146522_418_1188 256
1143 3300046526 Ga0495666_0001604 Ga0495666_0001604_5392_6162 256
1144 3300046526 Ga0495666_0008958 Ga0495666_0008958_1997_2800 256
1145 3300046526 Ga0495666_0036593 Ga0495666_0036593_84_854 256
1146 3300046528 Ga0495642_0000536 Ga0495642_0000536_3857_4627 256
1147 3300046528 Ga0495642_0001444 Ga0495642_0001444_3346_4116 256
1148 3300046530 Ga0495654_0000404 Ga0495654_0000404_32816_33607 256
1149 3300046530 Ga0495654_0001010 Ga0495654_0001010_1297_2103 256
1150 3300046530 Ga0495654_0001692 Ga0495654_0001692_2791_3561 256
1151 3300046530 Ga0495654_0005580 Ga0495654_0005580_570_1340 256
1152 3300046530 Ga0495654_0006844 Ga0495654_0006844_1714_2484 256
1153 3300046530 Ga0495654_0007375 Ga0495654_0007375_3800_4570 256
1154 3300046530 Ga0495654_0007795 Ga0495654_0007795_1701_2471 256
1155 3300046530 Ga0495654_0031295 Ga0495654_0031295_1873_2643 256
1156 3300046530 Ga0495654_0032061 Ga0495654_0032061_1860_2630 256
1157 3300046536 Ga0495587_0003520 Ga0495587_0003520_2357_3127 256
1158 3300046538 Ga0495609_0000061 Ga0495609_0000061_21455_22246 256
1159 3300046538 Ga0495609_0000101 Ga0495609_0000101_33646_34452 256
1160 3300046538 Ga0495609_0000696 Ga0495609_0000696_3299_4069 256
1161 3300046538 Ga0495609_0004755 Ga0495609_0004755_920_1690 256
1162 3300046538 Ga0495609_0005878 Ga0495609_0005878_1191_1961 256
1163 3300046538 Ga0495609_0009579 Ga0495609_0009579_3843_4613 256
1164 3300046538 Ga0495609_0062227 Ga0495609_0062227_670_1476 256
1165 3300046542 Ga0495597_0009099 Ga0495597_0009099_2354_3124 256
1166 3300046542 Ga0495597_0011291 Ga0495597_0011291_1477_2247 256
1167 3300046542 Ga0495597_0030031 Ga0495597_0030031_570_1340 256
1168 3300046542 Ga0495597_0059307 Ga0495597_0059307_739_1530 256
1169 3300046557 Ga0495622_0001089 Ga0495622_0001089_9143_9913 256
1170 3300046557 Ga0495622_0001805 Ga0495622_0001805_6622_7392 256
1171 3300046557 Ga0495622_0009631 Ga0495622_0009631_3255_4025 256
1172 3300046557 Ga0495622_0010425 Ga0495622_0010425_1630_2400 256
1173 3300046557 Ga0495622_0060819 Ga0495622_0060819_163_954 256
1174 3300046558 Ga0495633_0000129 Ga0495633_0000129_66317_67123 256
1175 3300046558 Ga0495633_0003624 Ga0495633_0003624_7425_8195 256
1176 3300046616 Ga0495668_0008651 Ga0495668_0008651_4420_5190 256
1177 3300046616 Ga0495668_0017023 Ga0495668_0017023_2392_3183 256
1178 3300046616 Ga0495668_0024129 Ga0495668_0024129_2620_3411 256
1179 3300046642 Ga0495634_0005870 Ga0495634_0005870_3898_4701 256
1180 3300046648 Ga0495611_0000525 Ga0495611_0000525_19140_19931 256
1181 3300046648 Ga0495611_0000571 Ga0495611_0000571_3731_4501 256
1182 3300046648 Ga0495611_0001821 Ga0495611_0001821_280_1086 256
1183 3300046648 Ga0495611_0012098 Ga0495611_0012098_1764_2555 256
1184 3300046648 Ga0495611_0013014 Ga0495611_0013014_282_1052 256
1185 3300046660 Ga0495625_0000147 Ga0495625_0000147_21597_22388 256
1186 3300046660 Ga0495625_0010589 Ga0495625_0010589_756_1526 256
1187 3300046660 Ga0495625_0022435 Ga0495625_0022435_3509_4279 256
1188 3300046660 Ga0495625_0023226 Ga0495625_0023226_2041_2811 256
1189 3300046663 Ga0495635_0000583 Ga0495635_0000583_15358_16128 256
1190 3300046663 Ga0495635_0012360 Ga0495635_0012360_3776_4579 256
1191 3300046664 Ga0495659_0000380 Ga0495659_0000380_16271_17041 256
1192 3300046665 Ga0495661_0000153 Ga0495661_0000153_21612_22403 256
1193 3300046665 Ga0495661_0000196 Ga0495661_0000196_33703_34509 256
1194 3300046665 Ga0495661_0000484 Ga0495661_0000484_19138_19908 256
1195 3300046665 Ga0495661_0001727 Ga0495661_0001727_9555_10346 256
1196 3300046665 Ga0495661_0023738 Ga0495661_0023738_1021_1791 256
1197 3300046665 Ga0495661_0042494 Ga0495661_0042494_49_819 256
1198 3300046665 Ga0495661_0137531 Ga0495661_0137531_441_1211 256
1199 3300046674 Ga0495588_0045613 Ga0495588_0045613_1034_1804 256
1200 3300046679 Ga0495623_0017742 Ga0495623_0017742_72_875 256
1201 3300046680 Ga0495646_0039662 Ga0495646_0039662_801_1604 256
1202 3300046684 Ga0495669_0014877 Ga0495669_0014877_67_837 256
1203 3300046690 Ga0495624_0003816 Ga0495624_0003816_3716_4486 256
1204 3300046691 Ga0495670_0000388 Ga0495670_0000388_3656_4426 256
1205 3300046691 Ga0495670_0001561 Ga0495670_0001561_4173_4943 256
1206 3300046691 Ga0495670_0003729 Ga0495670_0003729_5078_5848 256
1207 3300046691 Ga0495670_0013134 Ga0495670_0013134_12_782 256
1208 3300046691 Ga0495670_0033110 Ga0495670_0033110_1775_2545 256
1209 3300046692 Ga0495671_0000471 Ga0495671_0000471_25273_26043 256
1210 3300046692 Ga0495671_0001900 Ga0495671_0001900_945_1751 256
1211 3300046692 Ga0495671_0003438 Ga0495671_0003438_6159_6965 256
1212 3300046692 Ga0495671_0007329 Ga0495671_0007329_5219_6010 256
1213 3300046692 Ga0495671_0009812 Ga0495671_0009812_384_1154 256
1214 3300046692 Ga0495671_0010835 Ga0495671_0010835_2914_3684 256
1215 3300046692 Ga0495671_0034401 Ga0495671_0034401_119_889 256
1216 3300046692 Ga0495671_0135720 Ga0495671_0135720_401_1171 256
1217 3300046694 Ga0495649_0000968 Ga0495649_0000968_385_1155 256
1218 3300046694 Ga0495649_0001584 Ga0495649_0001584_11460_12230 256
1219 3300046694 Ga0495649_0007483 Ga0495649_0007483_3826_4617 256
1220 3300046694 Ga0495649_0027028 Ga0495649_0027028_1346_2116 256
1221 3300046694 Ga0495649_0031798 Ga0495649_0031798_1922_2692 256
1222 3300046694 Ga0495649_0053755 Ga0495649_0053755_1073_1843 256
1223 3300046794 Ga0495589_0000668 Ga0495589_0000668_5638_6408 256
1224 3300046794 Ga0495589_0002719 Ga0495589_0002719_1667_2473 256
1225 3300046794 Ga0495589_0011005 Ga0495589_0011005_3533_4336 256
1226 3300046794 Ga0495589_0034990 Ga0495589_0034990_1727_2497 256
1227 3300046794 Ga0495589_0039482 Ga0495589_0039482_431_1201 256
1228 3300046809 Ga0495600_0038322 Ga0495600_0038322_945_1715 256
1229 3300046810 Ga0495660_0002451 Ga0495660_0002451_3199_4005 256
1230 3300046810 Ga0495660_0005838 Ga0495660_0005838_3752_4543 256
1231 3300046810 Ga0495660_0007185 Ga0495660_0007185_2825_3595 256
1232 3300046810 Ga0495660_0009508 Ga0495660_0009508_1712_2503 256
1233 3300046810 Ga0495660_0010383 Ga0495660_0010383_4634_5404 256
1234 3300046810 Ga0495660_0070127 Ga0495660_0070127_596_1366 256
1235 3300046810 Ga0495660_0139177 Ga0495660_0139177_125_895 256
1236 3300046810 Ga0495660_0166390 Ga0495660_0166390_247_1017 256
1237 3300047317 Ga0495604_0010664 Ga0495604_0010664_4999_5769 256
1238 3300047317 Ga0495604_0033515 Ga0495604_0033515_352_1155 256
1239 3300047318 Ga0495636_0013676 Ga0495636_0013676_2067_2837 256
1240 3300047318 Ga0495636_0116008 Ga0495636_0116008_185_955 256
1241 3300047320 Ga0495672_0003447 Ga0495672_0003447_3266_4036 256
1242 3300047320 Ga0495672_0004628 Ga0495672_0004628_6639_7409 256
1243 3300047320 Ga0495672_0005323 Ga0495672_0005323_3688_4491 256
1244 3300047320 Ga0495672_0005353 Ga0495672_0005353_6082_6873 256
1245 3300047320 Ga0495672_0007677 Ga0495672_0007677_3627_4397 256
1246 3300047320 Ga0495672_0008665 Ga0495672_0008665_874_1644 256
1247 3300047320 Ga0495672_0009374 Ga0495672_0009374_2086_2889 256
1248 3300047320 Ga0495672_0012649 Ga0495672_0012649_3855_4625 256
1249 3300047320 Ga0495672_0013767 Ga0495672_0013767_3816_4586 256
1250 3300047320 Ga0495672_0027993 Ga0495672_0027993_935_1741 256
1251 3300047321 Ga0495676_0000027 Ga0495676_0000027_119415_120206 256
1252 3300047321 Ga0495676_0017673 Ga0495676_0017673_1657_2427 256
1253 3300047322 Ga0495680_0005758 Ga0495680_0005758_10600_11370 256
1254 3300047322 Ga0495680_0033959 Ga0495680_0033959_1648_2451 256
1255 3300047323 Ga0495683_0000075 Ga0495683_0000075_33578_34384 256
1256 3300047323 Ga0495683_0001303 Ga0495683_0001303_3267_4037 256
1257 3300047323 Ga0495683_0001374 Ga0495683_0001374_10772_11542 256
1258 3300047323 Ga0495683_0030110 Ga0495683_0030110_426_1196 256
1259 3300047323 Ga0495683_0033942 Ga0495683_0033942_711_1481 256
1260 3300047323 Ga0495683_0146379 Ga0495683_0146379_305_1075 256
1261 3300047443 Ga0495687_004754 Ga0495687_004754_7506_8276 256
1262 3300047443 Ga0495687_027947 Ga0495687_027947_1286_2056 256
1263 3300047443 Ga0495687_028807 Ga0495687_028807_1698_2468 256
1264 3300047444 Ga0495675_0025096 Ga0495675_0025096_1500_2270 256
1265 3300047446 Ga0495679_000237 Ga0495679_000237_21603_22394 256
1266 3300047446 Ga0495679_000792 Ga0495679_000792_13412_14218 256
1267 3300047446 Ga0495679_028365 Ga0495679_028365_417_1217 256
1268 3300047469 Ga0495673_0001628 Ga0495673_0001628_15246_16016 256
1269 3300047469 Ga0495673_0001807 Ga0495673_0001807_3211_4002 256
1270 3300047469 Ga0495673_0003384 Ga0495673_0003384_3147_3938 256
1271 3300047469 Ga0495673_0003463 Ga0495673_0003463_3959_4729 256
1272 3300047469 Ga0495673_0003817 Ga0495673_0003817_4442_5212 256
1273 3300047469 Ga0495673_0005394 Ga0495673_0005394_6879_7670 256
1274 3300047469 Ga0495673_0006066 Ga0495673_0006066_5888_6658 256
1275 3300047469 Ga0495673_0007335 Ga0495673_0007335_1692_2483 256
1276 3300047469 Ga0495673_0020644 Ga0495673_0020644_1553_2323 256
1277 3300047469 Ga0495673_0022022 Ga0495673_0022022_1185_1991 256
1278 3300047469 Ga0495673_0066546 Ga0495673_0066546_75_845 256
1279 3300047470 Ga0495681_0003081 Ga0495681_0003081_3350_4120 256
1280 3300047470 Ga0495681_0003215 Ga0495681_0003215_7228_8019 256
1281 3300047470 Ga0495681_0004733 Ga0495681_0004733_2825_3595 256
1282 3300047470 Ga0495681_0004777 Ga0495681_0004777_561_1331 256
1283 3300047470 Ga0495681_0006728 Ga0495681_0006728_23_793 256
1284 3300047470 Ga0495681_0009405 Ga0495681_0009405_3548_4318 256
1285 3300047470 Ga0495681_0009407 Ga0495681_0009407_2989_3759 256
1286 3300047470 Ga0495681_0031089 Ga0495681_0031089_1615_2385 256
1287 3300047470 Ga0495681_0033287 Ga0495681_0033287_569_1339 256
1288 3300047470 Ga0495681_0116910 Ga0495681_0116910_161_931 256
1289 3300047472 Ga0495686_0005925 Ga0495686_0005925_6391_7194 256
1290 3300047472 Ga0495686_0026529 Ga0495686_0026529_836_1606 256
1291 3300048091 Ga0495626_0000067 Ga0495626_0000067_117706_118497 256
1292 3300048091 Ga0495626_0000507 Ga0495626_0000507_26961_27731 256
1293 3300048091 Ga0495626_0000684 Ga0495626_0000684_27293_28063 256
1294 3300048091 Ga0495626_0000996 Ga0495626_0000996_16301_17071 256
1295 3300048091 Ga0495626_0001171 Ga0495626_0001171_17007_17777 256
1296 3300048091 Ga0495626_0001627 Ga0495626_0001627_16115_16885 256
1297 3300048091 Ga0495626_0008526 Ga0495626_0008526_2189_2959 256
1298 3300048091 Ga0495626_0018825 Ga0495626_0018825_801_1571 256
1299 3300048091 Ga0495626_0059201 Ga0495626_0059201_496_1266 256
1300 3300048904 Ga0496101_0141962 Ga0496101_0141962_323_1216 256
1301 3300048905 Ga0496102_0001259 Ga0496102_0001259_16847_17650 256
1302 3300048905 Ga0496102_0067249 Ga0496102_0067249_2124_2915 256
1303 3300048906 Ga0496103_0005569 Ga0496103_0005569_4597_5400 256
1304 3300048907 Ga0496104_0011028 Ga0496104_0011028_2557_3357 256
1305 3300048908 Ga0496105_0141507 Ga0496105_0141507_97_897 256
1306 3300048908 Ga0496105_0402718 Ga0496105_0402718_287_1057 256
1307 3300048909 Ga0496106_0141442 Ga0496106_0141442_257_1150 256
1308 3300048915 Ga0496112_0597880 Ga0496112_0597880_148_918 256
1309 3300048917 Ga0496114_0023930 Ga0496114_0023930_1905_2699 256
1310 3300048917 Ga0496114_0024009 Ga0496114_0024009_2443_3234 256
1311 3300048919 Ga0496116_0000242 Ga0496116_0000242_16342_17145 256
1312 3300048919 Ga0496116_0001670 Ga0496116_0001670_16318_17088 256
1313 3300048919 Ga0496116_0002076 Ga0496116_0002076_16718_17488 256
1314 3300048919 Ga0496116_0007060 Ga0496116_0007060_2861_3652 256
1315 3300048919 Ga0496116_0033922 Ga0496116_0033922_1535_2338 256
1316 3300048920 Ga0496117_0000270 Ga0496117_0000270_16347_17150 256
1317 3300048920 Ga0496117_0000932 Ga0496117_0000932_7686_8489 256
1318 3300048920 Ga0496117_0002067 Ga0496117_0002067_7872_8663 256
1319 3300048920 Ga0496117_0007272 Ga0496117_0007272_6161_6955 256
1320 3300048920 Ga0496117_0007848 Ga0496117_0007848_3381_4172 256
1321 3300048920 Ga0496117_0018282 Ga0496117_0018282_3735_4535 256
1322 3300048920 Ga0496117_0061121 Ga0496117_0061121_120_890 256
1323 3300048920 Ga0496117_0081529 Ga0496117_0081529_14_817 256
1324 3300048920 Ga0496117_0105827 Ga0496117_0105827_786_1577 256
1325 3300048921 Ga0496118_0001862 Ga0496118_0001862_24448_25248 256
1326 3300048921 Ga0496118_0007945 Ga0496118_0007945_6384_7178 256
1327 3300048921 Ga0496118_0010933 Ga0496118_0010933_2006_2797 256
1328 3300048921 Ga0496118_0018613 Ga0496118_0018613_2514_3305 256
1329 3300048921 Ga0496118_0018851 Ga0496118_0018851_1537_2340 256
1330 3300048921 Ga0496118_0061091 Ga0496118_0061091_1972_2742 256
1331 3300048921 Ga0496118_0081215 Ga0496118_0081215_1470_2240 256
1332 3300048921 Ga0496118_0082230 Ga0496118_0082230_546_1349 256
1333 3300048922 Ga0496119_0000230 Ga0496119_0000230_35006_35806 256
1334 3300048923 Ga0496120_0000324 Ga0496120_0000324_38173_38973 256
1335 3300048923 Ga0496120_0004336 Ga0496120_0004336_7626_8429 256
1336 3300048923 Ga0496120_0016350 Ga0496120_0016350_749_1519 256
1337 3300048924 Ga0496121_0000318 Ga0496121_0000318_83681_84484 256
1338 3300048924 Ga0496121_0010903 Ga0496121_0010903_1839_2630 256
1339 3300048924 Ga0496121_0029160 Ga0496121_0029160_1547_2338 256
1340 3300048924 Ga0496121_0041549 Ga0496121_0041549_2085_2855 256
1341 3300048924 Ga0496121_0047928 Ga0496121_0047928_2829_3599 256
1342 3300048924 Ga0496121_0080949 Ga0496121_0080949_857_1648 256
1343 3300048925 Ga0496122_0000517 Ga0496122_0000517_57231_58022 256
1344 3300048925 Ga0496122_0002629 Ga0496122_0002629_2847_3641 256
1345 3300048925 Ga0496122_0007631 Ga0496122_0007631_7318_8088 256
1346 3300048925 Ga0496122_0010252 Ga0496122_0010252_4925_5731 256
1347 3300048925 Ga0496122_0018736 Ga0496122_0018736_2094_2864 256
1348 3300048925 Ga0496122_0019577 Ga0496122_0019577_2322_3113 256
1349 3300048925 Ga0496122_0116564 Ga0496122_0116564_177_968 256
1350 3300048926 Ga0496123_0000243 Ga0496123_0000243_21869_22660 256
1351 3300048926 Ga0496123_0007055 Ga0496123_0007055_7897_8691 256
1352 3300048926 Ga0496123_0016801 Ga0496123_0016801_1814_2605 256
1353 3300048926 Ga0496123_0049421 Ga0496123_0049421_1216_2016 256
1354 3300048927 Ga0496124_0000511 Ga0496124_0000511_21504_22310 256
1355 3300048927 Ga0496124_0001467 Ga0496124_0001467_26250_27041 256
1356 3300048927 Ga0496124_0001534 Ga0496124_0001534_29310_30104 256
1357 3300048927 Ga0496124_0002260 Ga0496124_0002260_16341_17111 256
1358 3300048927 Ga0496124_0002328 Ga0496124_0002328_6674_7465 256
1359 3300048927 Ga0496124_0007063 Ga0496124_0007063_7654_8457 256
1360 3300048927 Ga0496124_0026136 Ga0496124_0026136_2184_2969 256
1361 3300048927 Ga0496124_0044157 Ga0496124_0044157_1270_2061 256
1362 3300048927 Ga0496124_0083275 Ga0496124_0083275_204_995 256
1363 3300048927 Ga0496124_0204528 Ga0496124_0204528_10_780 256
1364 3300048928 Ga0496125_0000971 Ga0496125_0000971_36300_37103 256
1365 3300048928 Ga0496125_0002177 Ga0496125_0002177_21604_22395 256
1366 3300048928 Ga0496125_0005751 Ga0496125_0005751_9359_10129 256
1367 3300048928 Ga0496125_0006705 Ga0496125_0006705_7447_8217 256
1368 3300048928 Ga0496125_0024125 Ga0496125_0024125_2312_3103 256
1369 3300048928 Ga0496125_0097616 Ga0496125_0097616_474_1244 256
1370 3300048928 Ga0496125_0136412 Ga0496125_0136412_343_1137 256
1371 3300048929 Ga0496126_0032825 Ga0496126_0032825_3093_3884 256
1372 3300048929 Ga0496126_0036273 Ga0496126_0036273_2487_3290 256
1373 3300048929 Ga0496126_0053094 Ga0496126_0053094_1313_2116 256
1374 3300048929 Ga0496126_0234714 Ga0496126_0234714_711_1511 256
1375 3300049459 Ga0495678_000106 Ga0495678_000106_33622_34428 256
1376 3300049459 Ga0495678_000499 Ga0495678_000499_21471_22262 256
1377 3300049459 Ga0495678_000694 Ga0495678_000694_14559_15329 256
1378 3300049459 Ga0495678_003175 Ga0495678_003175_3912_4682 256
1379 3300049459 Ga0495678_003193 Ga0495678_003193_3678_4448 256
1380 3300049459 Ga0495678_005483 Ga0495678_005483_1806_2576 256
1381 3300049459 Ga0495678_010464 Ga0495678_010464_2125_2895 256
1382 3300049459 Ga0495678_051038 Ga0495678_051038_337_1107 256
1383 3300049460 Ga0495682_0000069 Ga0495682_0000069_72461_73264 256
1384 3300049460 Ga0495682_0000804 Ga0495682_0000804_15451_16242 256
1385 3300049460 Ga0495682_0004192 Ga0495682_0004192_3850_4620 256
1386 3300049460 Ga0495682_0012679 Ga0495682_0012679_786_1592 256
1387 3300049460 Ga0495682_0019649 Ga0495682_0019649_340_1110 256
1388 3300049569 Ga0501032_0003622 Ga0501032_0003622_7952_8740 256
1389 3300049571 Ga0501034_0000164 Ga0501034_0000164_102983_103774 256
1390 3300049571 Ga0501034_0047534 Ga0501034_0047534_3398_4186 256
1391 3300049571 Ga0501034_0179869 Ga0501034_0179869_803_1690 256
1392 3300049572 Ga0501036_0059760 Ga0501036_0059760_2006_2893 256
1393 3300049573 Ga0501037_0039003 Ga0501037_0039003_1504_2391 256
1394 3300049573 Ga0501037_0105525 Ga0501037_0105525_797_1585 256
1395 3300049575 Ga0501039_0106853 Ga0501039_0106853_509_1297 256
1396 3300049758 Ga0501241_000367 Ga0501241_000367_41_844 256
1397 3300049822 Ga0501035_0360481 Ga0501035_0360481_331_1122 256
1398 3300049823 Ga0501044_0153126 Ga0501044_0153126_692_1579 256
1399 3300050491 nmdc:mga00v17_281_c1 nmdc:mga00v17_281_c1_20594_21394 256
1400 3300050514 nmdc:mga08x19_218914_c1 nmdc:mga08x19_218914_c1_516_1286 256
1401 3300053135 Ga0500659_0002369 Ga0500659_0002369_7458_8249 256
1402 iso_pu_bacteria 2511231006 2511264707 256
1403 iso_pu_bacteria 2511231007 2511274358 256
1404 iso_pu_bacteria 2511231008 2511279877 256
1405 iso_pu_bacteria 2511231010 2511289676 256
1406 iso_pu_bacteria 2511231011 2511294619 256
1407 iso_pu_bacteria 2511231012 2511298914 256
1408 iso_pu_bacteria 2511231014 2511316653 256
1409 iso_pu_bacteria 2511231015 2511322229 256
1410 iso_pu_bacteria 2511231016 2511325259 256
1411 iso_pu_bacteria 2511231017 2511332243 256
1412 iso_pu_bacteria 2511231018 2511337679 256
1413 iso_pu_bacteria 2511231019 2511347423 256
1414 iso_pu_bacteria 2511231020 2511348017 256
1415 iso_pu_bacteria 2511231021 2511359161 256
1416 iso_pu_bacteria 2511231022 2511366119 256
1417 iso_pu_bacteria 2511231023 2511370485 256
1418 iso_pu_bacteria 2511231024 2511374111 256
1419 iso_pu_bacteria 2511231031 2511412436 256
1420 iso_pu_bacteria 2511231156 2511822028 256
1421 iso_pu_bacteria 2512047018 2512325220 256
1422 iso_pu_bacteria 2554235231 2555245324 256
1423 iso_pu_bacteria 2554235341 2555667039 256
1424 iso_pu_bacteria 2582580891 2583795318 256
1425 iso_pu_bacteria 2597489887 2597855290 256
1426 iso_pu_bacteria 2597489888 2597861291 256
1427 iso_pu_bacteria 2597489889 2597867038 256
1428 iso_pu_bacteria 2599185160 2599355552 256
1429 iso_pu_bacteria 2599185161 2599363045 256
1430 iso_pu_bacteria 2599185162 2599368649 256
1431 iso_pu_bacteria 2599185163 2599376154 256
1432 iso_pu_bacteria 2599185164 2599380658 256
1433 iso_pu_bacteria 2599185165 2599387826 256
1434 iso_pu_bacteria 2599185166 2599395012 256
1435 iso_pu_bacteria 2599185167 2599401178 256
1436 iso_pu_bacteria 2599185168 2599406777 256
1437 iso_pu_bacteria 2599185179 2599449489 256
1438 iso_pu_bacteria 2599185181 2599462386 256
1439 iso_pu_bacteria 2599185182 2599468191 256
1440 iso_pu_bacteria 2599185185 2599487416 256
1441 iso_pu_bacteria 2599185186 2599491403 256
1442 iso_pu_bacteria 2599185188 2599503809 256
1443 iso_pu_bacteria 2599185189 2599506117 256
1444 iso_pu_bacteria 2599185190 2599511561 256
1445 iso_pu_bacteria 2599185191 2599516535 256
1446 iso_pu_bacteria 2599185212 2599612602 256
1447 iso_pu_bacteria 2599185248 2599767796 256
1448 iso_pu_bacteria 2599185257 2599804228 256
1449 iso_pu_bacteria 2599185288 2599879412 256
1450 iso_pu_bacteria 2599185289 2599887887 256
1451 iso_pu_bacteria 2599185290 2599893064 256
1452 iso_pu_bacteria 2599185291 2599899422 256
1453 iso_pu_bacteria 2599185300 2599933242 256
1454 iso_pu_bacteria 2599185302 2599942009 256
1455 iso_pu_bacteria 2599185303 2599948642 256
1456 iso_pu_bacteria 2599185304 2599954990 256
1457 iso_pu_bacteria 2599185305 2599963555 256
1458 iso_pu_bacteria 2599185306 2599966418 256
1459 iso_pu_bacteria 2599185307 2599975260 256
1460 iso_pu_bacteria 2599185308 2599977267 256
1461 iso_pu_bacteria 2599185309 2599986297 256
1462 iso_pu_bacteria 2599185310 2599991350 256
1463 iso_pu_bacteria 2599185311 2599995157 256
1464 iso_pu_bacteria 2599185312 2600000821 256
1465 iso_pu_bacteria 2599185313 2600007479 256
1466 iso_pu_bacteria 2599185314 2600011300 256
1467 iso_pu_bacteria 2599185315 2600020220 256
1468 iso_pu_bacteria 2599185316 2600026583 256
1469 iso_pu_bacteria 2599185317 2600029535 256
1470 iso_pu_bacteria 2599185318 2600037613 256
1471 iso_pu_bacteria 2599185319 2600044259 256
1472 iso_pu_bacteria 2599185320 2600050041 256
1473 iso_pu_bacteria 2599185321 2600054711 256
1474 iso_pu_bacteria 2599185322 2600059884 256
1475 iso_pu_bacteria 2599185323 2600065313 256
1476 iso_pu_bacteria 2599185324 2600073254 256
1477 iso_pu_bacteria 2599185325 2600078975 256
1478 iso_pu_bacteria 2599185356 2600215008 256
1479 iso_pu_bacteria 2600254930 2600358781 256
1480 iso_pu_bacteria 2600254931 2600363099 256
1481 iso_pu_bacteria 2600254954 2600444059 256
1482 iso_pu_bacteria 2600255283 2601627776 256
1483 iso_pu_bacteria 2600255296 2601693365 256
1484 iso_pu_bacteria 2600255313 2601775174 256
1485 iso_pu_bacteria 2600255318 2601798179 256
1486 iso_pu_bacteria 2600255389 2602008456 256
1487 iso_pu_bacteria 2603880185 2606077067 256
1488 iso_pu_bacteria 2603880199 2606129687 256
1489 iso_pu_bacteria 2619619299 2621296454 256
1490 iso_pu_bacteria 2623620443 2624477816 256
1491 iso_pu_bacteria 2623620446 2624489394 256
1492 iso_pu_bacteria 2636415599 2637222601 256
1493 iso_pu_bacteria 2643221565 2643843160 256
1494 iso_pu_bacteria 2643221571 2643873580 256
1495 iso_pu_bacteria 2643221589 2643956028 256
1496 iso_pu_bacteria 2643221602 2644020150 256
1497 iso_pu_bacteria 2643221633 2644184160 256
1498 iso_pu_bacteria 2643221650 2644282868 256
1499 iso_pu_bacteria 2643221713 2644619829 256
1500 iso_pu_bacteria 2643221713 2644624403 256
1501 iso_pu_bacteria 2667528170 2671091926 256
1502 iso_pu_bacteria 2667528171 2671099686 256
1503 iso_pu_bacteria 2667528176 2671129630 256
1504 iso_pu_bacteria 2671180172 2671771237 256
1505 iso_pu_bacteria 2675903420 2677900378 256
1506 iso_pu_bacteria 2713897148 2715749498 256
1507 iso_pu_bacteria 2713897149 2715754501 256
1508 iso_pu_bacteria 2721755607 2723246194 256
1509 iso_pu_bacteria 2738541265 2738673400 256
1510 iso_pu_bacteria 2738541271 2738690667 256
1511 iso_pu_bacteria 2738541282 2738751793 256
1512 iso_pu_bacteria 2738541294 2738807636 256
1513 iso_pu_bacteria 2738541303 2738860834 256
1514 iso_pu_bacteria 2738541309 2738894996 256
1515 iso_pu_bacteria 2738543004 2739200947 256
1516 iso_pu_bacteria 2738543015 2739261783 256
1517 iso_pu_bacteria 2738543016 2739266441 256
1518 iso_pu_bacteria 2740892503 2743740859 256
1519 iso_pu_bacteria 2765235841 2765581304 256
1520 iso_pu_bacteria 2773857670 2774118028 256
1521 iso_pu_bacteria 2773857673 2774136542 256
1522 iso_pu_bacteria 2775507074 2777024532 256
1523 iso_pu_bacteria 2784132063 2784261468 256
1524 iso_pu_bacteria 2784132072 2784316515 256
1525 iso_pu_bacteria 2791355520 2794593599 256
1526 iso_pu_bacteria 2806310737 2807405887 256
1527 iso_pu_bacteria 2806310745 2807454222 256
1528 iso_pu_bacteria 2808606377 2808928106 256
1529 iso_pu_bacteria 2808606381 2808950712 256
1530 iso_pu_bacteria 2808606382 2808960679 256
1531 iso_pu_bacteria 2808606385 2808980054 256
1532 iso_pu_bacteria 2808606386 2808984878 256
1533 iso_pu_bacteria 2808606388 2808995774 256
1534 iso_pu_bacteria 2808606415 2809128782 256
1535 iso_pu_bacteria 2808606419 2809148403 256
1536 iso_pu_bacteria 2808606445 2809217567 256
1537 iso_pu_bacteria 2816332298 2817488067 256
1538 iso_pu_bacteria 2818991456 2819655471 256
1539 iso_pu_bacteria 2818991464 2819704833 256
1540 iso_pu_bacteria 2825651385 2825654711 256
1541 iso_pu_bacteria 2834028612 2834031325 256
1542 iso_pu_bacteria 2842826826 2842832029 256
1543 iso_pu_bacteria 2842832357 2842833792 256
1544 iso_pu_bacteria 2842837860 2842838300 256
1545 iso_pu_bacteria 2842843487 2842846019 256
1546 iso_pu_bacteria 2844665904 2844667526 256
1547 iso_pu_bacteria 2852103415 2852104452 256
1548 iso_pu_bacteria 2852612431 2852616722 256
1549 iso_pu_bacteria 2852618963 2852620169 256
1550 iso_pu_bacteria 2852657418 2852662618 256
1551 iso_pu_bacteria 2852667396 2852671690 256
1552 iso_pu_bacteria 2860339153 2860345255 256
1553 iso_pu_bacteria 2860867994 2860868091 256
1554 iso_pu_bacteria 2878029506 2878029759 256
1555 iso_pu_bacteria 2880230671 2880230709 256
1556 iso_pu_bacteria 2881927736 2881930383 256
1557 iso_pu_bacteria 2895511927 2895516146 256
1558 iso_pu_bacteria 2904518522 2904518601 256
1559 iso_pu_bacteria 2904550169 2904553445 256
1560 iso_pu_bacteria 2908446538 2908446680 256
1561 iso_pu_bacteria 2912963787 2912963878 256
1562 iso_pu_bacteria 2913036834 2913036889 256
1563 iso_pu_bacteria 2917070673 2917070776 256
1564 iso_pu_bacteria 2919063839 2919067984 256
1565 iso_pu_bacteria 2919385768 2919388831 256
1566 iso_pu_bacteria 2919456309 2919457910 256
1567 iso_pu_bacteria 2919481497 2919487008 256
1568 iso_pu_bacteria 2919487758 2919487788 256
1569 iso_pu_bacteria 2919501602 2919502431 256
1570 iso_pu_bacteria 2919697872 2919702401 256
1571 iso_pu_bacteria 2923153595 2923153691 256
1572 iso_pu_bacteria 2923586266 2923589319 256
1573 iso_pu_bacteria 2926063275 2926064104 256
1574 iso_pu_bacteria 2929189879 2929189974 256
1575 iso_pu_bacteria 2931369376 2931372314 256
1576 iso_pu_bacteria 2931390751 2931391035 256
1577 iso_pu_bacteria 2931396565 2931398454 256
1578 iso_pu_bacteria 2932406140 2932408908 256
1579 iso_pu_bacteria 2935353572 2935357889 256
1580 iso_pu_bacteria 2939577877 2939582040 256
1581 iso_pu_bacteria 2939636861 2939640518 256
1582 iso_pu_bacteria 2939651529 2939654481 256
1583 iso_pu_bacteria 2945928738 2945930508 256
1584 iso_pu_bacteria 2946006987 2946012854 256
1585 iso_pu_bacteria 2946027586 2946028283 256
1586 iso_pu_bacteria 2947233263 2947234800 256
1587 iso_pu_bacteria 2969304461 2969304515 256
1588 iso_pu_bacteria 2974289157 2974293729 256
1589 iso_pu_bacteria 2984286254 2984292422 256
1590 iso_pu_bacteria 2984559226 2984559295 256
1591 iso_pu_bacteria 2984595703 2984595822 256
1592 iso_pu_bacteria 2998139840 2998140079 256
1593 iso_pu_bacteria 3007395558 3007398984 256
1594 iso_pu_bacteria 3007419365 3007419676 256
1595 iso_pu_bacteria 3007511990 3007517497 256
1596 iso_pu_bacteria 3007614139 3007617039 256
1597 iso_pu_bacteria 3007619802 3007623822 256
1598 iso_pu_bacteria 3007718800 3007722069 256
1599 iso_pu_bacteria 3007803356 3007804067 256
1600 iso_pu_bacteria 3007855910 3007859528 256
1601 iso_pu_bacteria 3007861166 3007864739 256
1602 iso_pu_bacteria 3007872151 3007874926 256
1603 iso_pu_bacteria 637000220 637317442 256
1604 iso_pu_bacteria 8015687852 8015687954 256
1605 iso_pu_bacteria 8019769354 8019769379 256
1606 iso_pu_bacteria 8019775933 8019779624 256
1607 iso_pu_bacteria 8029995093 8029995171 256
1608 iso_pu_bacteria 8052494512 8052494532 256
1609 iso_pu_bacteria 8054285046 8054287164 256
1610 iso_pu_bacteria 8054347763 8054349217 256
1611 iso_pu_bacteria 8054503363 8054503641 256
1612 iso_pu_bacteria 8054929484 8054930026 256
1613 iso_pu_bacteria 8055770955 8055771052 256
1614 iso_pu_bacteria 8055817908 8055818004 256
1615 iso_pu_bacteria 8055878733 8055881566 256
1616 iso_pu_bacteria 8056115690 8056116229 256
1617 iso_pu_bacteria 8056120720 8056120816 256
1618 iso_pu_bacteria 8056125926 8056126098 256
1619 iso_pu_bacteria 8056131705 8056131973 256
1620 iso_pu_bacteria 8056137416 8056137510 256
1621 iso_pu_bacteria 8056148874 8056151129 256
1622 iso_pu_bacteria 8056155041 8056160076 256
1623 iso_pu_bacteria 8056161164 8056164002 256
1624 iso_pu_bacteria 8056166840 8056170968 256
1625 iso_pu_bacteria 8056172158 8056177101 256
1626 iso_pu_bacteria 8056177738 8056182192 256
1627 iso_pu_bacteria 8056569372 8056570810 256
1628 iso_pu_bacteria 8057798959 8057802334 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

61

212

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9709 2 240
7ch8-assembly1.cif.gz_I cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9692 2 240
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.9556 2 240
8fee-assembly1.cif.gz_H structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.9541 2 240
7d06-assembly1.cif.gz_B cryo em structure of the nucleotide free acinetobacter mlafedb complex 0.9536 2 240
ID Description Score Start End Superfamily
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9594 2 64 3.40.50.300
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9556 2 241 3.40.50.300
af_Q2G1F8_275_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9536 1 240 3.40.50.300
af_I6Y482_280_547_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9471 1 243 3.40.50.300
af_P37313_10_333_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9462 2 240 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A4P6FWW7-F1-model_v4 ABC transporter ATP-binding protein 1.001 1 256 GO:0005524
GO:0016887
AF-A0A846V1C7-F1-model_v4 Phospholipid/cholesterol/gamma-HCH transport system ATP-binding protein 0.9986 1 255 GO:0005524
GO:0016887
AF-A0A4P6FWW7-F1-model_v4 ABC transporter ATP-binding protein 0.9972 1 256 GO:0005524
GO:0016887
AF-A0A1Q3LL68-F1-model_v4 ABC transporter ATP-binding protein 0.9918 2 247 GO:0005524
GO:0016887
AF-A0A846V1C7-F1-model_v4 Phospholipid/cholesterol/gamma-HCH transport system ATP-binding protein 0.9908 1 255 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
92.2 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map