F495112

General Info

Members Datasets Scaffolds Average Seq Length
1628 340 1628 137

Family's Representative Sequence

Representative Sequence 3300005364|Ga0070673_100192820|Ga0070673_1001928202
Length 159
Sequence LSEESLEQLLETAKTARLQSIAPFSNFLVGAAIKTGDGKVYTGCNVESASYGLTVCAERVAIWKALSEGERDFTELAIVADTSTLTPPCGTCRQIIWEFAKNATIILGNLHGESQIVSIRELLPRAFDARFLKKAAEEAKQAADRNDDPSVSEVSTTTR

Samples

Sample ID Description Type Environment
1 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
198 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
199 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
200 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
201 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
202 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
203 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
204 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
205 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
206 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
207 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
210 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
211 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
212 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
213 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
219 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
220 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
221 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
222 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
223 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
224 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
225 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
226 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
227 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
228 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
229 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
230 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
231 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
232 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
233 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
234 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
239 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
240 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
241 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
242 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
243 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
244 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
245 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
246 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
247 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
248 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
249 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
250 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
251 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
252 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
253 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
254 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
255 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
256 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
259 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
260 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
261 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
262 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
263 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
264 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
265 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
266 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
267 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
268 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
269 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
270 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
282 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
283 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
284 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
285 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
286 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
287 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
288 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
294 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
295 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
296 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
297 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
298 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
299 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
300 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
301 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
302 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
303 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
304 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
305 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
306 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
307 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
308 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
309 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
310 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
311 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
312 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
313 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
314 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
315 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
316 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
317 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
318 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
319 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
320 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
321 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
322 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
323 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
324 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
325 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
326 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
327 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
328 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
329 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
330 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
331 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
332 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
333 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
334 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
335 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
336 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
337 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
338 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
339 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
340 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.12
Nodule 0
Rhizoplane 1.9
Rhizosphere 97.6
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNBas_1000099 3300000531 Bacteria 2674
2 CNAas_1002826 3300000532 Unclassified 1195
3 JGI24748J21848_1000012 3300002074 Bacteria 152599
4 JGI24033J26618_1034113 3300002155 Unclassified 693
5 JGI24034J26672_10000003 3300002239 Bacteria 501747
6 JGI24751J29686_10000071 3300002459 Bacteria 58417
7 JGI25406J46586_10001975 3300003203 Bacteria 9693
8 JGI25406J46586_10077451 3300003203 Unclassified 1027
9 JGI25406J46586_10127752 3300003203 Bacteria 746
10 Ga0065714_10064464 3300005288 Bacteria 65432
11 Ga0065704_10002722 3300005289 Bacteria 6819
12 Ga0065704_10006287 3300005289 Bacteria 2826
13 Ga0065704_10083590 3300005289 Unclassified 3445
14 Ga0065704_10186578 3300005289 Unclassified 1191
15 Ga0065712_10000137 3300005290 Bacteria 65446
16 Ga0065712_10001969 3300005290 Bacteria 5215
17 Ga0065712_10073101 3300005290 Bacteria 4505
18 Ga0065712_10086766 3300005290 Bacteria 2617
19 Ga0065712_10102026 3300005290 Bacteria 2012
20 Ga0065712_10291821 3300005290 Bacteria 876
21 Ga0065712_10326215 3300005290 Unclassified 821
22 Ga0065712_10484034 3300005290 Unclassified 654
23 Ga0065715_10004257 3300005293 Bacteria 5130
24 Ga0065715_10008064 3300005293 Bacteria 4344
25 Ga0065715_10009897 3300005293 Bacteria 2306
26 Ga0065715_10089567 3300005293 Bacteria 9442
27 Ga0065715_10098523 3300005293 Bacteria 3535
28 Ga0065715_10121355 3300005293 Bacteria 2232
29 Ga0065715_10131618 3300005293 Bacteria 2004
30 Ga0065715_10173224 3300005293 Bacteria 1531
31 Ga0065715_10199617 3300005293 Bacteria 1368
32 Ga0065715_10300357 3300005293 Bacteria 1042
33 Ga0065715_10328989 3300005293 Unclassified 973
34 Ga0065707_10008118 3300005295 Bacteria 3125
35 Ga0065707_10018597 3300005295 Unclassified 1696
36 Ga0065707_10090374 3300005295 Bacteria 4153
37 Ga0065707_10173317 3300005295 Bacteria 1469
38 Ga0065707_10353321 3300005295 Bacteria 915
39 Ga0065707_10399617 3300005295 Bacteria 854
40 Ga0065707_10488241 3300005295 Unclassified 767
41 Ga0065707_10495906 3300005295 Unclassified 761
42 Ga0065707_10599063 3300005295 Archaea 691
43 Ga0070676_10617103 3300005328 Bacteria 784
44 Ga0070676_10927053 3300005328 Unclassified 650
45 Ga0070676_11060174 3300005328 Bacteria 611
46 Ga0070683_100079253 3300005329 Bacteria 3074
47 Ga0070690_100001096 3300005330 Bacteria 13932
48 Ga0070690_100019052 3300005330 Bacteria 4157
49 Ga0070690_100054302 3300005330 Bacteria 2564
50 Ga0070690_100076702 3300005330 Bacteria 2181
51 Ga0070690_100371885 3300005330 Bacteria 1043
52 Ga0070690_100454791 3300005330 Bacteria 950
53 Ga0070670_100000070 3300005331 Bacteria 103166
54 Ga0070670_100001040 3300005331 Bacteria 21991
55 Ga0070670_100045921 3300005331 Bacteria 3755
56 Ga0070670_100067882 3300005331 Bacteria 3059
57 Ga0070670_100106464 3300005331 Unclassified 2416
58 Ga0070670_100108344 3300005331 Bacteria 2393
59 Ga0070670_100130889 3300005331 Unclassified 2167
60 Ga0070670_100166699 3300005331 Unclassified 1910
61 Ga0070670_100190801 3300005331 Unclassified 1780
62 Ga0070670_100266476 3300005331 Bacteria 1494
63 Ga0070670_100360745 3300005331 Bacteria 1278
64 Ga0070670_100728023 3300005331 Unclassified 893
65 Ga0070670_101076201 3300005331 Unclassified 733
66 Ga0070677_10509903 3300005333 Unclassified 653
67 Ga0068869_100008540 3300005334 Bacteria 6610
68 Ga0068869_100020229 3300005334 Bacteria 4562
69 Ga0068869_100020557 3300005334 Bacteria 4528
70 Ga0068869_100024570 3300005334 Bacteria 4174
71 Ga0068869_100031116 3300005334 Bacteria 3753
72 Ga0068869_100101279 3300005334 Unclassified 2179
73 Ga0068869_100150889 3300005334 Bacteria 1802
74 Ga0068869_100356732 3300005334 Bacteria 1193
75 Ga0068869_100411652 3300005334 Bacteria 1114
76 Ga0068869_100439247 3300005334 Bacteria 1080
77 Ga0068869_100706658 3300005334 Bacteria 860
78 Ga0068869_101248534 3300005334 Bacteria 654
79 Ga0070666_10029776 3300005335 Bacteria 3592
80 Ga0070666_10057618 3300005335 Bacteria 2625
81 Ga0070666_10321126 3300005335 Bacteria 1104
82 Ga0070680_100001227 3300005336 Bacteria 18465
83 Ga0070680_100009427 3300005336 Bacteria 7500
84 Ga0070680_100903137 3300005336 Unclassified 762
85 Ga0070682_100000114 3300005337 Bacteria 71510
86 Ga0070682_100010806 3300005337 Bacteria 5194
87 Ga0070682_100073166 3300005337 Bacteria 2198
88 Ga0068868_100022678 3300005338 Bacteria 4743
89 Ga0068868_100058339 3300005338 Bacteria 3051
90 Ga0068868_100060139 3300005338 Bacteria 3007
91 Ga0068868_101227975 3300005338 Unclassified 694
92 Ga0068868_101237035 3300005338 Unclassified 691
93 Ga0070660_100388404 3300005339 Bacteria 1153
94 Ga0070689_100000879 3300005340 Bacteria 18723
95 Ga0070689_100008455 3300005340 Bacteria 7251
96 Ga0070689_100128706 3300005340 Bacteria 2029
97 Ga0070689_100153367 3300005340 Bacteria 1859
98 Ga0070689_100207339 3300005340 Bacteria 1603
99 Ga0070689_100415305 3300005340 Bacteria 1139
100 Ga0070689_100455143 3300005340 Unclassified 1090
101 Ga0070689_100555694 3300005340 Bacteria 989
102 Ga0070689_100822001 3300005340 Bacteria 818
103 Ga0070689_100850828 3300005340 Unclassified 805
104 Ga0070689_101409218 3300005340 Unclassified 630
105 Ga0070691_10379639 3300005341 Unclassified 791
106 Ga0070691_10493324 3300005341 Unclassified 707
107 Ga0070691_10778061 3300005341 Unclassified 581
108 Ga0070687_100048357 3300005343 Unclassified 2187
109 Ga0070687_100051400 3300005343 Bacteria 2133
110 Ga0070687_100108348 3300005343 Unclassified 1568
111 Ga0070687_100254795 3300005343 Bacteria 1092
112 Ga0070687_100374877 3300005343 Unclassified 925
113 Ga0070687_100377620 3300005343 Unclassified 923
114 Ga0070687_100574470 3300005343 Bacteria 770
115 Ga0070687_100649333 3300005343 Bacteria 731
116 Ga0070687_100832188 3300005343 Unclassified 656
117 Ga0070661_100125295 3300005344 Bacteria 1927
118 Ga0070661_101807308 3300005344 Unclassified 519
119 Ga0070692_10001325 3300005345 Bacteria 8905
120 Ga0070692_10035995 3300005345 Bacteria 2510
121 Ga0070692_10053670 3300005345 Bacteria 2102
122 Ga0070692_10069707 3300005345 Bacteria 1871
123 Ga0070692_10150055 3300005345 Bacteria 1327
124 Ga0070692_10302009 3300005345 Bacteria 978
125 Ga0070692_10371822 3300005345 Bacteria 894
126 Ga0070692_10449311 3300005345 Unclassified 824
127 Ga0070692_10616145 3300005345 Bacteria 720
128 Ga0070692_10622606 3300005345 Unclassified 717
129 Ga0070692_11299475 3300005345 Unclassified 522
130 Ga0070668_100003133 3300005347 Bacteria 12211
131 Ga0070668_101705682 3300005347 Bacteria 578
132 Ga0070669_100010550 3300005353 Bacteria 6559
133 Ga0070669_100113817 3300005353 Bacteria 2056
134 Ga0070669_100215814 3300005353 Unclassified 1515
135 Ga0070669_100311447 3300005353 Unclassified 1269
136 Ga0070669_100481952 3300005353 Bacteria 1027
137 Ga0070669_100530248 3300005353 Unclassified 980
138 Ga0070669_100584128 3300005353 Bacteria 934
139 Ga0070669_101249839 3300005353 Bacteria 642
140 Ga0070675_100054881 3300005354 Bacteria 3279
141 Ga0070675_100148639 3300005354 Unclassified 2007
142 Ga0070675_100219934 3300005354 Bacteria 1654
143 Ga0070675_100443849 3300005354 Bacteria 1163
144 Ga0070675_100514468 3300005354 Unclassified 1080
145 Ga0070675_100725113 3300005354 Bacteria 906
146 Ga0070675_102100987 3300005354 Bacteria 521
147 Ga0070671_100015270 3300005355 Bacteria 6201
148 Ga0070671_100040270 3300005355 Bacteria 3880
149 Ga0070671_100069343 3300005355 Unclassified 2941
150 Ga0070671_100243792 3300005355 Bacteria 1526
151 Ga0070671_100416970 3300005355 Bacteria 1150
152 Ga0070671_100420600 3300005355 Bacteria 1144
153 Ga0070671_101834561 3300005355 Unclassified 539
154 Ga0070674_100110781 3300005356 Bacteria 2015
155 Ga0070673_100130948 3300005364 Bacteria 2104
156 Ga0070673_100157691 3300005364 Bacteria 1927
157 Ga0070673_100179690 3300005364 Unclassified 1811
158 Ga0070673_100192820 3300005364 Bacteria 1751
159 Ga0070673_100401517 3300005364 Unclassified 1226
160 Ga0070673_100594706 3300005364 Bacteria 1009
161 Ga0070673_100798828 3300005364 Bacteria 871
162 Ga0070673_100845334 3300005364 Bacteria 847
163 Ga0070673_100905026 3300005364 Unclassified 818
164 Ga0070688_100186325 3300005365 Bacteria 1443
165 Ga0070688_100315028 3300005365 Bacteria 1135
166 Ga0070688_100875189 3300005365 Unclassified 707
167 Ga0070659_100004261 3300005366 Bacteria 10208
168 Ga0070659_100152859 3300005366 Bacteria 1884
169 Ga0070659_100256651 3300005366 Unclassified 1450
170 Ga0070667_100041936 3300005367 Bacteria 3838
171 Ga0070667_100114084 3300005367 Bacteria 2346
172 Ga0070667_100766191 3300005367 Unclassified 895
173 Ga0070703_10000023 3300005406 Bacteria 74686
174 Ga0070703_10000463 3300005406 Bacteria 16097
175 Ga0070701_10043282 3300005438 Bacteria 2303
176 Ga0070701_10050026 3300005438 Bacteria 2162
177 Ga0070701_10073100 3300005438 Unclassified 1838
178 Ga0070701_10170363 3300005438 Bacteria 1267
179 Ga0070701_10189973 3300005438 Unclassified 1208
180 Ga0070711_100535538 3300005439 Bacteria 970
181 Ga0070705_100078377 3300005440 Bacteria 2021
182 Ga0070705_100082159 3300005440 Bacteria 1982
183 Ga0070705_100163664 3300005440 Bacteria 1490
184 Ga0070705_100175411 3300005440 Bacteria 1447
185 Ga0070705_100213748 3300005440 Unclassified 1331
186 Ga0070705_100267747 3300005440 Bacteria 1208
187 Ga0070705_100308450 3300005440 Bacteria 1137
188 Ga0070705_100501433 3300005440 Bacteria 921
189 Ga0070705_100657795 3300005440 Bacteria 818
190 Ga0070705_100685724 3300005440 Bacteria 803
191 Ga0070705_100716154 3300005440 Bacteria 788
192 Ga0070705_100778834 3300005440 Unclassified 759
193 Ga0070705_101143830 3300005440 Unclassified 639
194 Ga0070700_100000283 3300005441 Bacteria 26787
195 Ga0070700_100010688 3300005441 Bacteria 5071
196 Ga0070700_100040506 3300005441 Bacteria 2852
197 Ga0070700_100089442 3300005441 Bacteria 2006
198 Ga0070700_100255231 3300005441 Bacteria 1260
199 Ga0070700_100292964 3300005441 Bacteria 1185
200 Ga0070700_100457361 3300005441 Unclassified 973
201 Ga0070700_100700654 3300005441 Bacteria 805
202 Ga0070700_100995779 3300005441 Bacteria 689
203 Ga0070700_101881491 3300005441 Bacteria 517
204 Ga0070694_100001642 3300005444 Bacteria 13145
205 Ga0070694_100008998 3300005444 Bacteria 6118
206 Ga0070694_100010512 3300005444 Bacteria 5713
207 Ga0070694_100013102 3300005444 Bacteria 5172
208 Ga0070694_100024884 3300005444 Bacteria 3868
209 Ga0070694_100036763 3300005444 Bacteria 3245
210 Ga0070694_100048971 3300005444 Bacteria 2843
211 Ga0070694_100085213 3300005444 Bacteria 2206
212 Ga0070694_100106356 3300005444 Unclassified 1993
213 Ga0070694_100165074 3300005444 Unclassified 1628
214 Ga0070694_100225127 3300005444 Bacteria 1409
215 Ga0070694_100254905 3300005444 Bacteria 1329
216 Ga0070694_100264011 3300005444 Bacteria 1307
217 Ga0070694_100312005 3300005444 Bacteria 1208
218 Ga0070694_100353136 3300005444 Bacteria 1139
219 Ga0070694_100605032 3300005444 Unclassified 883
220 Ga0070694_100776536 3300005444 Unclassified 784
221 Ga0070694_100794226 3300005444 Bacteria 776
222 Ga0070694_100915435 3300005444 Bacteria 725
223 Ga0070694_101173956 3300005444 Unclassified 642
224 Ga0070694_101356434 3300005444 Bacteria 599
225 Ga0070694_101681422 3300005444 Bacteria 540
226 Ga0070708_100000903 3300005445 Bacteria 22490
227 Ga0070708_100084833 3300005445 Unclassified 2873
228 Ga0070708_100155893 3300005445 Unclassified 2126
229 Ga0070708_100265611 3300005445 Bacteria 1614
230 Ga0070708_100480562 3300005445 Bacteria 1172
231 Ga0070708_100514397 3300005445 Bacteria 1129
232 Ga0070708_100703015 3300005445 Bacteria 951
233 Ga0070708_101357092 3300005445 Unclassified 664
234 Ga0070678_100034036 3300005456 Bacteria 3544
235 Ga0070678_100058565 3300005456 Unclassified 2828
236 Ga0070662_100105429 3300005457 Bacteria 2140
237 Ga0070662_100242846 3300005457 Unclassified 1445
238 Ga0070662_100438500 3300005457 Unclassified 1082
239 Ga0070662_100513391 3300005457 Bacteria 1000
240 Ga0070662_100533003 3300005457 Bacteria 982
241 Ga0070662_100654995 3300005457 Bacteria 886
242 Ga0070662_100808255 3300005457 Unclassified 797
243 Ga0070681_10000108 3300005458 Bacteria 61616
244 Ga0070681_10001112 3300005458 Bacteria 23022
245 Ga0070681_10002318 3300005458 Bacteria 17402
246 Ga0070681_10052510 3300005458 Bacteria 4065
247 Ga0070681_10151778 3300005458 Bacteria 2243
248 Ga0068867_100014412 3300005459 Bacteria 5602
249 Ga0068867_100135260 3300005459 Bacteria 1920
250 Ga0068867_100176086 3300005459 Bacteria 1697
251 Ga0068867_100368887 3300005459 Bacteria 1203
252 Ga0068867_100466265 3300005459 Unclassified 1079
253 Ga0068867_100530217 3300005459 Bacteria 1017
254 Ga0068867_100851947 3300005459 Bacteria 817
255 Ga0068867_101310539 3300005459 Unclassified 669
256 Ga0068867_101622559 3300005459 Unclassified 605
257 Ga0068867_101760784 3300005459 Bacteria 582
258 Ga0068867_102222373 3300005459 Bacteria 521
259 Ga0070685_10045347 3300005466 Bacteria 2521
260 Ga0070685_10172886 3300005466 Unclassified 1385
261 Ga0070685_10249853 3300005466 Bacteria 1174
262 Ga0070706_100000216 3300005467 Bacteria 71047
263 Ga0070706_100003143 3300005467 Bacteria 16332
264 Ga0070706_100003795 3300005467 Bacteria 14752
265 Ga0070706_100006466 3300005467 Bacteria 11061
266 Ga0070706_100046836 3300005467 Unclassified 3992
267 Ga0070706_100064280 3300005467 Unclassified 3391
268 Ga0070706_100422387 3300005467 Unclassified 1241
269 Ga0070706_100453388 3300005467 Bacteria 1193
270 Ga0070706_100650184 3300005467 Bacteria 979
271 Ga0070706_100743618 3300005467 Unclassified 909
272 Ga0070706_101062101 3300005467 Bacteria 746
273 Ga0070707_100000089 3300005468 Bacteria 82091
274 Ga0070707_100005561 3300005468 Bacteria 11772
275 Ga0070707_100008263 3300005468 Bacteria 9660
276 Ga0070707_100247163 3300005468 Bacteria 1736
277 Ga0070707_100501538 3300005468 Bacteria 1175
278 Ga0070707_100511884 3300005468 Bacteria 1162
279 Ga0070707_100574228 3300005468 Unclassified 1090
280 Ga0070707_100800271 3300005468 Bacteria 906
281 Ga0070698_100000726 3300005471 Bacteria 35381
282 Ga0070698_100002253 3300005471 Bacteria 21337
283 Ga0070698_100005354 3300005471 Bacteria 14037
284 Ga0070698_100012469 3300005471 Bacteria 8997
285 Ga0070698_100017479 3300005471 Bacteria 7558
286 Ga0070698_100028485 3300005471 Bacteria 5801
287 Ga0070698_100029158 3300005471 Bacteria 5728
288 Ga0070698_100277520 3300005471 Bacteria 1607
289 Ga0070698_100738795 3300005471 Bacteria 927
290 Ga0070698_100912261 3300005471 Bacteria 824
291 Ga0070698_101164434 3300005471 Unclassified 720
292 Ga0070698_101478853 3300005471 Unclassified 630
293 Ga0070698_101946629 3300005471 Bacteria 541
294 Ga0070699_100003096 3300005518 Bacteria 14727
295 Ga0070699_100007696 3300005518 Bacteria 9365
296 Ga0070699_100018592 3300005518 Bacteria 5969
297 Ga0070699_100047606 3300005518 Bacteria 3710
298 Ga0070699_100054078 3300005518 Bacteria 3475
299 Ga0070699_100133686 3300005518 Bacteria 2187
300 Ga0070699_100162800 3300005518 Bacteria 1975
301 Ga0070699_100228307 3300005518 Unclassified 1660
302 Ga0070699_100228535 3300005518 Unclassified 1659
303 Ga0070699_100452917 3300005518 Bacteria 1164
304 Ga0070699_100553469 3300005518 Bacteria 1047
305 Ga0070679_100000197 3300005530 Bacteria 49336
306 Ga0070679_100189052 3300005530 Bacteria 2029
307 Ga0070679_100439166 3300005530 Unclassified 1250
308 Ga0070679_100997029 3300005530 Unclassified 782
309 Ga0070684_100181462 3300005535 Bacteria 1914
310 Ga0070697_100000067 3300005536 Bacteria 83699
311 Ga0070697_100004607 3300005536 Bacteria 10588
312 Ga0070697_100011835 3300005536 Bacteria 6828
313 Ga0070697_100060276 3300005536 Unclassified 3092
314 Ga0070697_100157839 3300005536 Unclassified 1916
315 Ga0070697_100176500 3300005536 Unclassified 1810
316 Ga0070697_100219732 3300005536 Bacteria 1619
317 Ga0070697_100428134 3300005536 Unclassified 1151
318 Ga0070697_100452752 3300005536 Bacteria 1118
319 Ga0068853_100003126 3300005539 Bacteria 12658
320 Ga0068853_100024190 3300005539 Bacteria 5091
321 Ga0068853_100036593 3300005539 Unclassified 4175
322 Ga0068853_100135736 3300005539 Bacteria 2205
323 Ga0070672_100131667 3300005543 Bacteria 2056
324 Ga0070672_100325841 3300005543 Bacteria 1306
325 Ga0070672_101028988 3300005543 Unclassified 730
326 Ga0070672_101527773 3300005543 Unclassified 598
327 Ga0070686_100001061 3300005544 Bacteria 15853
328 Ga0070686_100003700 3300005544 Bacteria 8398
329 Ga0070686_100038380 3300005544 Unclassified 2977
330 Ga0070686_100078008 3300005544 Bacteria 2186
331 Ga0070686_100184584 3300005544 Bacteria 1484
332 Ga0070686_100240668 3300005544 Bacteria 1317
333 Ga0070686_100341778 3300005544 Bacteria 1122
334 Ga0070686_100632033 3300005544 Bacteria 847
335 Ga0070695_100050215 3300005545 Unclassified 2673
336 Ga0070695_100075555 3300005545 Bacteria 2217
337 Ga0070695_100158185 3300005545 Unclassified 1588
338 Ga0070695_100190544 3300005545 Bacteria 1459
339 Ga0070695_100266213 3300005545 Unclassified 1254
340 Ga0070695_100285395 3300005545 Bacteria 1215
341 Ga0070695_100479124 3300005545 Bacteria 959
342 Ga0070695_100701958 3300005545 Bacteria 803
343 Ga0070695_100805101 3300005545 Bacteria 753
344 Ga0070695_100808204 3300005545 Unclassified 752
345 Ga0070695_101050673 3300005545 Unclassified 664
346 Ga0070695_101151643 3300005545 Unclassified 636
347 Ga0070695_101346962 3300005545 Unclassified 591
348 Ga0070695_101681928 3300005545 Unclassified 531
349 Ga0070696_100039578 3300005546 Bacteria 3255
350 Ga0070696_100040645 3300005546 Unclassified 3211
351 Ga0070696_100057080 3300005546 Unclassified 2724
352 Ga0070696_100076343 3300005546 Unclassified 2366
353 Ga0070696_100078855 3300005546 Bacteria 2329
354 Ga0070696_100116560 3300005546 Bacteria 1929
355 Ga0070696_100133208 3300005546 Unclassified 1810
356 Ga0070696_100239286 3300005546 Unclassified 1368
357 Ga0070696_100242300 3300005546 Unclassified 1361
358 Ga0070696_100637333 3300005546 Bacteria 863
359 Ga0070696_100740784 3300005546 Unclassified 804
360 Ga0070696_100800768 3300005546 Unclassified 775
361 Ga0070696_101210089 3300005546 Unclassified 638
362 Ga0070693_100006498 3300005547 Bacteria 5668
363 Ga0070693_100031651 3300005547 Bacteria 2902
364 Ga0070693_100076283 3300005547 Bacteria 1987
365 Ga0070693_100109161 3300005547 Unclassified 1699
366 Ga0070693_100220745 3300005547 Unclassified 1242
367 Ga0070693_100223508 3300005547 Unclassified 1235
368 Ga0070693_100353174 3300005547 Bacteria 1007
369 Ga0070693_100642642 3300005547 Bacteria 771
370 Ga0070693_101593887 3300005547 Unclassified 512
371 Ga0070665_100762654 3300005548 Bacteria 980
372 Ga0070704_100005305 3300005549 Bacteria 7511
373 Ga0070704_100007677 3300005549 Bacteria 6430
374 Ga0070704_100013265 3300005549 Bacteria 5109
375 Ga0070704_100044293 3300005549 Bacteria 3091
376 Ga0070704_100058158 3300005549 Bacteria 2753
377 Ga0070704_100234550 3300005549 Bacteria 1499
378 Ga0070704_100328260 3300005549 Unclassified 1284
379 Ga0070704_100338199 3300005549 Bacteria 1267
380 Ga0070704_100373322 3300005549 Bacteria 1210
381 Ga0070704_100409274 3300005549 Unclassified 1159
382 Ga0070704_100438727 3300005549 Bacteria 1122
383 Ga0070704_100733123 3300005549 Bacteria 879
384 Ga0070704_100739074 3300005549 Unclassified 875
385 Ga0070704_100760092 3300005549 Bacteria 863
386 Ga0070704_100863868 3300005549 Unclassified 812
387 Ga0070704_100944805 3300005549 Unclassified 777
388 Ga0070704_101293653 3300005549 Unclassified 667
389 Ga0070704_101310354 3300005549 Unclassified 663
390 Ga0068855_100084940 3300005563 Bacteria 3663
391 Ga0068855_100089239 3300005563 Bacteria 3560
392 Ga0068855_100928028 3300005563 Unclassified 918
393 Ga0068855_101359853 3300005563 Unclassified 733
394 Ga0070664_100001032 3300005564 Bacteria 21889
395 Ga0070664_100024581 3300005564 Bacteria 4985
396 Ga0070664_100185668 3300005564 Bacteria 1850
397 Ga0070664_100259307 3300005564 Bacteria 1564
398 Ga0070664_100284337 3300005564 Unclassified 1492
399 Ga0070664_100289077 3300005564 Bacteria 1479
400 Ga0070664_100514407 3300005564 Unclassified 1104
401 Ga0070664_100709155 3300005564 Unclassified 938
402 Ga0070664_101086865 3300005564 Unclassified 753
403 Ga0070664_101373420 3300005564 Unclassified 668
404 Ga0070664_101373688 3300005564 Unclassified 668
405 Ga0068857_100004297 3300005577 Bacteria 12017
406 Ga0068857_100061721 3300005577 Bacteria 3330
407 Ga0068857_100073556 3300005577 Bacteria 3045
408 Ga0068857_100094458 3300005577 Bacteria 2678
409 Ga0068857_100124783 3300005577 Unclassified 2320
410 Ga0068857_100284138 3300005577 Unclassified 1522
411 Ga0068857_100882335 3300005577 Unclassified 857
412 Ga0068857_101327450 3300005577 Unclassified 698
413 Ga0068854_100059261 3300005578 Bacteria 2766
414 Ga0068854_100153468 3300005578 Bacteria 1778
415 Ga0068854_100219770 3300005578 Unclassified 1503
416 Ga0068854_100298402 3300005578 Unclassified 1303
417 Ga0068854_100519381 3300005578 Unclassified 1005
418 Ga0068854_100833651 3300005578 Unclassified 806
419 Ga0068854_101594027 3300005578 Unclassified 595
420 Ga0068856_100015548 3300005614 Bacteria 7356
421 Ga0068856_100907324 3300005614 Unclassified 900
422 Ga0070702_100017917 3300005615 Bacteria 3662
423 Ga0070702_100022621 3300005615 Unclassified 3327
424 Ga0070702_100090190 3300005615 Bacteria 1857
425 Ga0070702_100170098 3300005615 Bacteria 1417
426 Ga0070702_100395830 3300005615 Unclassified 987
427 Ga0070702_100453679 3300005615 Unclassified 931
428 Ga0070702_100569110 3300005615 Bacteria 844
429 Ga0070702_100864437 3300005615 Unclassified 705
430 Ga0070702_101030703 3300005615 Unclassified 653
431 Ga0070702_101357921 3300005615 Unclassified 579
432 Ga0068852_100157041 3300005616 Bacteria 2120
433 Ga0068852_100238145 3300005616 Bacteria 1738
434 Ga0068852_100307712 3300005616 Bacteria 1535
435 Ga0068852_100411833 3300005616 Bacteria 1332
436 Ga0068852_101520112 3300005616 Bacteria 692
437 Ga0068852_102516591 3300005616 Unclassified 535
438 Ga0068859_100018570 3300005617 Bacteria 6989
439 Ga0068859_100027831 3300005617 Bacteria 5670
440 Ga0068859_100038978 3300005617 Bacteria 4766
441 Ga0068859_100049769 3300005617 Unclassified 4209
442 Ga0068859_100055057 3300005617 Bacteria 4002
443 Ga0068859_100064599 3300005617 Bacteria 3692
444 Ga0068859_100065591 3300005617 Bacteria 3664
445 Ga0068859_100074954 3300005617 Unclassified 3423
446 Ga0068859_100158410 3300005617 Bacteria 2342
447 Ga0068859_100159781 3300005617 Bacteria 2333
448 Ga0068859_100208076 3300005617 Bacteria 2042
449 Ga0068859_100241774 3300005617 Bacteria 1894
450 Ga0068859_100313979 3300005617 Bacteria 1661
451 Ga0068859_100401466 3300005617 Bacteria 1467
452 Ga0068859_100459306 3300005617 Bacteria 1369
453 Ga0068859_100532150 3300005617 Bacteria 1270
454 Ga0068859_100550156 3300005617 Unclassified 1248
455 Ga0068859_100702482 3300005617 Bacteria 1102
456 Ga0068859_100705542 3300005617 Unclassified 1099
457 Ga0068859_100794096 3300005617 Bacteria 1034
458 Ga0068859_100818085 3300005617 Unclassified 1018
459 Ga0068859_100829072 3300005617 Bacteria 1011
460 Ga0068859_100833812 3300005617 Bacteria 1008
461 Ga0068859_100964029 3300005617 Unclassified 936
462 Ga0068859_101263462 3300005617 Unclassified 813
463 Ga0068859_101697786 3300005617 Unclassified 697
464 Ga0068859_101764285 3300005617 Unclassified 684
465 Ga0068859_103168528 3300005617 Unclassified 501
466 Ga0068864_100002023 3300005618 Bacteria 16729
467 Ga0068864_100005011 3300005618 Bacteria 10848
468 Ga0068864_100010047 3300005618 Bacteria 7815
469 Ga0068864_100015136 3300005618 Bacteria 6414
470 Ga0068864_100023777 3300005618 Bacteria 5148
471 Ga0068864_100049457 3300005618 Bacteria 3617
472 Ga0068864_100052709 3300005618 Bacteria 3507
473 Ga0068864_100066956 3300005618 Bacteria 3118
474 Ga0068864_100131007 3300005618 Unclassified 2252
475 Ga0068864_100144154 3300005618 Unclassified 2151
476 Ga0068864_100196009 3300005618 Unclassified 1853
477 Ga0068864_100199446 3300005618 Bacteria 1837
478 Ga0068864_100248328 3300005618 Bacteria 1651
479 Ga0068864_100251706 3300005618 Bacteria 1640
480 Ga0068864_100347374 3300005618 Bacteria 1399
481 Ga0068864_100365369 3300005618 Bacteria 1365
482 Ga0068864_100476948 3300005618 Bacteria 1197
483 Ga0068864_100970709 3300005618 Unclassified 842
484 Ga0068864_101022680 3300005618 Unclassified 820
485 Ga0068864_101041240 3300005618 Unclassified 813
486 Ga0068864_101289564 3300005618 Unclassified 731
487 Ga0068864_101628447 3300005618 Unclassified 650
488 Ga0068866_10010211 3300005718 Bacteria 4017
489 Ga0068866_10113571 3300005718 Bacteria 1515
490 Ga0068866_10761773 3300005718 Unclassified 669
491 Ga0068861_100001677 3300005719 Bacteria 14191
492 Ga0068861_100021073 3300005719 Bacteria 4683
493 Ga0068861_100048605 3300005719 Bacteria 3208
494 Ga0068861_100162462 3300005719 Bacteria 1843
495 Ga0068861_100203541 3300005719 Bacteria 1663
496 Ga0068861_100258359 3300005719 Unclassified 1490
497 Ga0068861_100355745 3300005719 Bacteria 1286
498 Ga0068861_100422401 3300005719 Bacteria 1188
499 Ga0068861_101859983 3300005719 Unclassified 598
500 Ga0068851_10047172 3300005834 Bacteria 2181
501 Ga0068851_10389269 3300005834 Bacteria 818
502 Ga0068870_10018253 3300005840 Bacteria 3383
503 Ga0068870_10195313 3300005840 Bacteria 1224
504 Ga0068870_10198154 3300005840 Bacteria 1216
505 Ga0068870_10213231 3300005840 Bacteria 1177
506 Ga0068870_11228008 3300005840 Unclassified 544
507 Ga0068870_11236332 3300005840 Unclassified 542
508 Ga0068863_100004782 3300005841 Bacteria 13342
509 Ga0068863_100047054 3300005841 Bacteria 4093
510 Ga0068863_100052378 3300005841 Unclassified 3868
511 Ga0068863_100067440 3300005841 Bacteria 3384
512 Ga0068863_100070819 3300005841 Unclassified 3298
513 Ga0068863_100437398 3300005841 Bacteria 1282
514 Ga0068863_100528285 3300005841 Bacteria 1164
515 Ga0068863_100565134 3300005841 Bacteria 1124
516 Ga0068863_100699655 3300005841 Bacteria 1007
517 Ga0068863_100732956 3300005841 Bacteria 983
518 Ga0068863_100999731 3300005841 Bacteria 839
519 Ga0068863_102520999 3300005841 Unclassified 523
520 Ga0068858_100000052 3300005842 Bacteria 119935
521 Ga0068858_100036732 3300005842 Bacteria 4542
522 Ga0068858_100040942 3300005842 Bacteria 4298
523 Ga0068858_100043731 3300005842 Bacteria 4153
524 Ga0068858_100060984 3300005842 Bacteria 3486
525 Ga0068858_100080793 3300005842 Bacteria 3021
526 Ga0068858_100082175 3300005842 Unclassified 2994
527 Ga0068858_100103208 3300005842 Bacteria 2660
528 Ga0068858_100253660 3300005842 Bacteria 1671
529 Ga0068858_100343033 3300005842 Bacteria 1430
530 Ga0068858_101110274 3300005842 Unclassified 776
531 Ga0068858_101650749 3300005842 Archaea 633
532 Ga0068858_101856722 3300005842 Unclassified 595
533 Ga0068860_100041828 3300005843 Unclassified 4378
534 Ga0068860_100123809 3300005843 Bacteria 2478
535 Ga0068860_100210430 3300005843 Bacteria 1886
536 Ga0068860_100258999 3300005843 Unclassified 1695
537 Ga0068860_100322134 3300005843 Unclassified 1517
538 Ga0068860_100362189 3300005843 Unclassified 1429
539 Ga0068860_100380894 3300005843 Bacteria 1392
540 Ga0068860_100429574 3300005843 Bacteria 1310
541 Ga0068860_100458266 3300005843 Unclassified 1268
542 Ga0068860_100701937 3300005843 Unclassified 1021
543 Ga0068860_100891666 3300005843 Bacteria 905
544 Ga0068860_101460811 3300005843 Unclassified 705
545 Ga0068860_101507161 3300005843 Bacteria 694
546 Ga0068860_101787024 3300005843 Unclassified 637
547 Ga0068862_100006215 3300005844 Bacteria 9948
548 Ga0068862_100030627 3300005844 Bacteria 4535
549 Ga0068862_100109541 3300005844 Unclassified 2423
550 Ga0068862_100122486 3300005844 Bacteria 2293
551 Ga0068862_100132588 3300005844 Unclassified 2205
552 Ga0068862_100177499 3300005844 Bacteria 1910
553 Ga0068862_100183889 3300005844 Unclassified 1877
554 Ga0068862_100275660 3300005844 Bacteria 1540
555 Ga0068862_100311644 3300005844 Bacteria 1450
556 Ga0068862_100551449 3300005844 Bacteria 1101
557 Ga0068862_100709215 3300005844 Unclassified 975
558 Ga0068862_101034284 3300005844 Unclassified 814
559 Ga0081540_1089515 3300005983 Bacteria 1357
560 Ga0081539_10001579 3300005985 Bacteria 37669
561 Ga0081539_10003279 3300005985 Bacteria 20298
562 Ga0081539_10045133 3300005985 Archaea 2537
563 Ga0081539_10191901 3300005985 Unclassified 950
564 Ga0075432_10155641 3300006058 Bacteria 881
565 Ga0075432_10453810 3300006058 Unclassified 563
566 Ga0070715_10049192 3300006163 Unclassified 1806
567 Ga0070716_100000009 3300006173 Bacteria 173295
568 Ga0070716_100078393 3300006173 Bacteria 1964
569 Ga0070716_100084520 3300006173 Bacteria 1904
570 Ga0070716_100094470 3300006173 Unclassified 1818
571 Ga0097621_100005455 3300006237 Bacteria 8956
572 Ga0097621_100015104 3300006237 Bacteria 5800
573 Ga0097621_100019059 3300006237 Bacteria 5260
574 Ga0097621_102134538 3300006237 Unclassified 536
575 Ga0068871_100004690 3300006358 Bacteria 9554
576 Ga0068871_100012016 3300006358 Bacteria 6371
577 Ga0068871_100169928 3300006358 Bacteria 1868
578 Ga0068871_100305065 3300006358 Bacteria 1398
579 Ga0068871_101565807 3300006358 Unclassified 623
580 Ga0075428_100307491 3300006844 Bacteria 1704
581 Ga0075428_100332445 3300006844 Bacteria 1632
582 Ga0075428_100495580 3300006844 Bacteria 1307
583 Ga0075428_100658671 3300006844 Bacteria 1116
584 Ga0075428_100780756 3300006844 Bacteria 1016
585 Ga0075428_101532060 3300006844 Bacteria 698
586 Ga0075430_100057726 3300006846 Bacteria 3264
587 Ga0075431_100036171 3300006847 Bacteria 5086
588 Ga0075431_100153902 3300006847 Bacteria 2366
589 Ga0075431_100341408 3300006847 Bacteria 1507
590 Ga0075433_10003403 3300006852 Bacteria 12284
591 Ga0075433_10068289 3300006852 Bacteria 3120
592 Ga0075433_10073052 3300006852 Bacteria 3017
593 Ga0075433_10085773 3300006852 Unclassified 2780
594 Ga0075433_10097198 3300006852 Unclassified 2606
595 Ga0075433_10098556 3300006852 Unclassified 2587
596 Ga0075433_10309958 3300006852 Bacteria 1397
597 Ga0075433_10364142 3300006852 Bacteria 1277
598 Ga0075433_10601846 3300006852 Unclassified 965
599 Ga0075433_10777577 3300006852 Bacteria 837
600 Ga0075433_11344705 3300006852 Unclassified 618
601 Ga0075434_100105220 3300006871 Unclassified 2832
602 Ga0075434_100118098 3300006871 Bacteria 2666
603 Ga0075434_100157875 3300006871 Unclassified 2288
604 Ga0075434_100243903 3300006871 Bacteria 1817
605 Ga0075434_100256137 3300006871 Bacteria 1769
606 Ga0075434_100608748 3300006871 Bacteria 1111
607 Ga0075434_100794545 3300006871 Bacteria 963
608 Ga0075434_100841746 3300006871 Bacteria 933
609 Ga0075434_101037509 3300006871 Unclassified 834
610 Ga0075429_100107769 3300006880 Unclassified 2434
611 Ga0075429_100125522 3300006880 Bacteria 2244
612 Ga0075429_100190943 3300006880 Bacteria 1795
613 Ga0075429_100365803 3300006880 Bacteria 1263
614 Ga0075429_100393288 3300006880 Bacteria 1214
615 Ga0075429_101130242 3300006880 Unclassified 684
616 Ga0068865_100008775 3300006881 Bacteria 6248
617 Ga0068865_100168946 3300006881 Bacteria 1675
618 Ga0068865_100190307 3300006881 Bacteria 1586
619 Ga0068865_100241827 3300006881 Bacteria 1421
620 Ga0068865_100496698 3300006881 Bacteria 1017
621 Ga0068865_100532848 3300006881 Bacteria 984
622 Ga0068865_100606233 3300006881 Unclassified 926
623 Ga0068865_101656952 3300006881 Unclassified 576
624 Ga0075436_100000221 3300006914 Bacteria 35387
625 Ga0075436_100877631 3300006914 Unclassified 670
626 Ga0097620_100018570 3300006931 Bacteria 6989
627 Ga0097620_100027833 3300006931 Bacteria 5670
628 Ga0097620_100038979 3300006931 Bacteria 4766
629 Ga0097620_100049771 3300006931 Unclassified 4209
630 Ga0097620_100055060 3300006931 Bacteria 4002
631 Ga0097620_100064602 3300006931 Bacteria 3692
632 Ga0097620_100065597 3300006931 Bacteria 3664
633 Ga0097620_100074953 3300006931 Unclassified 3423
634 Ga0097620_100158409 3300006931 Bacteria 2342
635 Ga0097620_100159777 3300006931 Bacteria 2333
636 Ga0097620_100208056 3300006931 Bacteria 2042
637 Ga0097620_100241788 3300006931 Bacteria 1894
638 Ga0097620_100314023 3300006931 Bacteria 1661
639 Ga0097620_100401459 3300006931 Bacteria 1467
640 Ga0097620_100459296 3300006931 Bacteria 1369
641 Ga0097620_100532183 3300006931 Bacteria 1270
642 Ga0097620_100550170 3300006931 Unclassified 1248
643 Ga0097620_100702651 3300006931 Bacteria 1102
644 Ga0097620_100705541 3300006931 Unclassified 1099
645 Ga0097620_100794080 3300006931 Bacteria 1034
646 Ga0097620_100818080 3300006931 Unclassified 1018
647 Ga0097620_100829077 3300006931 Bacteria 1011
648 Ga0097620_100833809 3300006931 Bacteria 1008
649 Ga0097620_100963893 3300006931 Unclassified 936
650 Ga0097620_101263490 3300006931 Unclassified 813
651 Ga0097620_101697786 3300006931 Unclassified 697
652 Ga0097620_101764194 3300006931 Unclassified 684
653 Ga0097620_103168988 3300006931 Unclassified 501
654 Ga0075435_100000617 3300007076 Bacteria 21873
655 Ga0075435_100056168 3300007076 Bacteria 3181
656 Ga0075435_100377364 3300007076 Bacteria 1218
657 Ga0075435_101182429 3300007076 Unclassified 669
658 Ga0099794_10006326 3300007265 Bacteria 4787
659 Ga0099794_10220568 3300007265 Bacteria 974
660 Ga0099794_10374998 3300007265 Bacteria 742
661 Ga0105251_10022239 3300009011 Bacteria 3297
662 Ga0105251_10106020 3300009011 Bacteria 1283
663 Ga0105251_10177180 3300009011 Bacteria 960
664 Ga0105251_10466683 3300009011 Bacteria 587
665 Ga0105251_10608005 3300009011 Bacteria 519
666 Ga0105250_10088759 3300009092 Unclassified 1256
667 Ga0105240_10693986 3300009093 Bacteria 1112
668 Ga0105240_10878565 3300009093 Bacteria 966
669 Ga0105240_11038662 3300009093 Bacteria 875
670 Ga0105240_11142573 3300009093 Unclassified 827
671 Ga0105240_11206653 3300009093 Unclassified 801
672 Ga0105240_11240732 3300009093 Bacteria 788
673 Ga0111539_10051056 3300009094 Bacteria 4926
674 Ga0111539_10074737 3300009094 Bacteria 3993
675 Ga0111539_10077682 3300009094 Bacteria 3907
676 Ga0111539_10175550 3300009094 Unclassified 2503
677 Ga0111539_10184822 3300009094 Bacteria 2434
678 Ga0111539_10262672 3300009094 Bacteria 2010
679 Ga0111539_10582865 3300009094 Bacteria 1303
680 Ga0111539_10763459 3300009094 Bacteria 1125
681 Ga0111539_12750094 3300009094 Unclassified 570
682 Ga0105245_10094033 3300009098 Bacteria 2763
683 Ga0105245_10094706 3300009098 Unclassified 2753
684 Ga0105245_10154994 3300009098 Unclassified 2169
685 Ga0105245_10335785 3300009098 Bacteria 1493
686 Ga0105245_10506146 3300009098 Bacteria 1224
687 Ga0105245_10660907 3300009098 Bacteria 1076
688 Ga0105245_10716774 3300009098 Unclassified 1034
689 Ga0105245_10734500 3300009098 Bacteria 1022
690 Ga0105245_10782410 3300009098 Unclassified 991
691 Ga0105245_10817948 3300009098 Bacteria 970
692 Ga0105245_10968746 3300009098 Unclassified 894
693 Ga0105245_11453208 3300009098 Unclassified 736
694 Ga0105245_11878144 3300009098 Unclassified 652
695 Ga0105245_12520163 3300009098 Bacteria 568
696 Ga0105245_12925073 3300009098 Bacteria 529
697 Ga0105247_10000003 3300009101 Bacteria 694517
698 Ga0105247_10009077 3300009101 Bacteria 6052
699 Ga0105247_10040976 3300009101 Bacteria 2832
700 Ga0105247_10076533 3300009101 Bacteria 2101
701 Ga0105247_10537875 3300009101 Unclassified 857
702 Ga0105247_10948349 3300009101 Bacteria 668
703 Ga0114129_10018794 3300009147 Bacteria 9842
704 Ga0114129_10022923 3300009147 Bacteria 8856
705 Ga0114129_10062002 3300009147 Bacteria 5225
706 Ga0114129_10094727 3300009147 Unclassified 4135
707 Ga0114129_10120523 3300009147 Unclassified 3612
708 Ga0114129_10263707 3300009147 Bacteria 2308
709 Ga0114129_10350305 3300009147 Unclassified 1956
710 Ga0114129_10390636 3300009147 Bacteria 1835
711 Ga0114129_10707111 3300009147 Unclassified 1294
712 Ga0114129_10741120 3300009147 Bacteria 1259
713 Ga0114129_10798749 3300009147 Bacteria 1204
714 Ga0114129_10965648 3300009147 Bacteria 1075
715 Ga0114129_11061044 3300009147 Bacteria 1017
716 Ga0114129_11107356 3300009147 Bacteria 991
717 Ga0114129_11549211 3300009147 Bacteria 813
718 Ga0114129_11897259 3300009147 Bacteria 723
719 Ga0114129_12694416 3300009147 Archaea 592
720 Ga0105243_10000022 3300009148 Bacteria 203002
721 Ga0105243_10008399 3300009148 Bacteria 7926
722 Ga0105243_10011797 3300009148 Bacteria 6608
723 Ga0105243_10023958 3300009148 Bacteria 4651
724 Ga0105243_10066317 3300009148 Bacteria 2903
725 Ga0105243_10072857 3300009148 Unclassified 2782
726 Ga0105243_10140416 3300009148 Unclassified 2060
727 Ga0105243_10182122 3300009148 Bacteria 1828
728 Ga0105243_10246102 3300009148 Bacteria 1594
729 Ga0105243_10651726 3300009148 Bacteria 1020
730 Ga0105243_10663227 3300009148 Unclassified 1012
731 Ga0105243_10684526 3300009148 Bacteria 998
732 Ga0105243_10722954 3300009148 Unclassified 973
733 Ga0105243_11536799 3300009148 Unclassified 690
734 Ga0105243_11936214 3300009148 Unclassified 623
735 Ga0105241_10022857 3300009174 Bacteria 4635
736 Ga0105241_10129124 3300009174 Bacteria 2044
737 Ga0105241_10186788 3300009174 Bacteria 1723
738 Ga0105241_10256979 3300009174 Bacteria 1483
739 Ga0105241_10298522 3300009174 Bacteria 1382
740 Ga0105241_10326983 3300009174 Bacteria 1324
741 Ga0105241_10400321 3300009174 Unclassified 1204
742 Ga0105241_10626576 3300009174 Bacteria 974
743 Ga0105241_10815242 3300009174 Bacteria 861
744 Ga0105241_10957807 3300009174 Unclassified 798
745 Ga0105241_11148105 3300009174 Bacteria 733
746 Ga0105241_11282970 3300009174 Unclassified 697
747 Ga0105242_10001313 3300009176 Bacteria 19649
748 Ga0105242_10001862 3300009176 Bacteria 16553
749 Ga0105242_10041256 3300009176 Bacteria 3722
750 Ga0105242_10057456 3300009176 Bacteria 3187
751 Ga0105242_10165728 3300009176 Bacteria 1938
752 Ga0105242_10258618 3300009176 Bacteria 1572
753 Ga0105242_10474857 3300009176 Bacteria 1184
754 Ga0105242_10497431 3300009176 Unclassified 1159
755 Ga0105242_10536994 3300009176 Bacteria 1119
756 Ga0105242_10986553 3300009176 Unclassified 849
757 Ga0105242_11155825 3300009176 Unclassified 791
758 Ga0105242_11348169 3300009176 Unclassified 739
759 Ga0105242_11354017 3300009176 Unclassified 737
760 Ga0105248_10000847 3300009177 Bacteria 34381
761 Ga0105248_10009021 3300009177 Bacteria 10968
762 Ga0105248_10027794 3300009177 Bacteria 6298
763 Ga0105248_10143753 3300009177 Unclassified 2692
764 Ga0105248_10364879 3300009177 Bacteria 1626
765 Ga0105248_10414973 3300009177 Bacteria 1516
766 Ga0105248_10481150 3300009177 Bacteria 1399
767 Ga0105248_10520509 3300009177 Bacteria 1341
768 Ga0105248_10889666 3300009177 Unclassified 1005
769 Ga0105248_11303493 3300009177 Unclassified 821
770 Ga0105248_11471836 3300009177 Unclassified 771
771 Ga0105248_11579460 3300009177 Unclassified 743
772 Ga0105248_11591190 3300009177 Bacteria 740
773 Ga0105248_11686499 3300009177 Bacteria 718
774 Ga0105248_13224757 3300009177 Unclassified 519
775 Ga0105237_10001294 3300009545 Bacteria 33284
776 Ga0105237_10321835 3300009545 Bacteria 1550
777 Ga0105237_10375952 3300009545 Bacteria 1425
778 Ga0105237_10553029 3300009545 Bacteria 1157
779 Ga0105237_10731699 3300009545 Unclassified 996
780 Ga0105237_11773947 3300009545 Bacteria 625
781 Ga0105238_10178866 3300009551 Bacteria 2098
782 Ga0105238_10254056 3300009551 Bacteria 1736
783 Ga0105238_10699062 3300009551 Bacteria 1026
784 Ga0105249_10002142 3300009553 Bacteria 17106
785 Ga0105249_10012565 3300009553 Bacteria 7463
786 Ga0105249_10014137 3300009553 Bacteria 7056
787 Ga0105249_10040998 3300009553 Bacteria 4207
788 Ga0105249_10083968 3300009553 Bacteria 2965
789 Ga0105249_10134389 3300009553 Unclassified 2365
790 Ga0105249_10150412 3300009553 Unclassified 2241
791 Ga0105249_10251176 3300009553 Unclassified 1753
792 Ga0105249_10339470 3300009553 Bacteria 1518
793 Ga0105249_10420922 3300009553 Unclassified 1369
794 Ga0105249_10531418 3300009553 Unclassified 1225
795 Ga0105249_10884278 3300009553 Bacteria 960
796 Ga0105249_10975020 3300009553 Bacteria 916
797 Ga0105249_11011429 3300009553 Bacteria 900
798 Ga0105249_11025453 3300009553 Bacteria 894
799 Ga0105249_11902687 3300009553 Unclassified 668
800 Ga0105249_13389259 3300009553 Unclassified 513
801 Ga0105239_10008638 3300010375 Bacteria 11544
802 Ga0105239_10132041 3300010375 Bacteria 2778
803 Ga0105239_10177349 3300010375 Bacteria 2383
804 Ga0105239_10407227 3300010375 Bacteria 1540
805 Ga0105239_10511034 3300010375 Bacteria 1366
806 Ga0105239_10619985 3300010375 Bacteria 1234
807 Ga0105239_10632721 3300010375 Unclassified 1221
808 Ga0105239_10814171 3300010375 Unclassified 1070
809 Ga0105239_11215848 3300010375 Unclassified 868
810 Ga0105246_10012887 3300011119 Bacteria 5230
811 Ga0105246_10124351 3300011119 Bacteria 1917
812 Ga0105246_10281191 3300011119 Unclassified 1335
813 Ga0105246_10666880 3300011119 Bacteria 907
814 Ga0105246_10680900 3300011119 Unclassified 899
815 Ga0105246_10706463 3300011119 Unclassified 884
816 Ga0105246_11205746 3300011119 Unclassified 697
817 Ga0157373_10030047 3300013100 Unclassified 3910
818 Ga0157373_10033504 3300013100 Bacteria 3696
819 Ga0157373_10060039 3300013100 Bacteria 2694
820 Ga0157373_10072255 3300013100 Bacteria 2435
821 Ga0157373_10120400 3300013100 Bacteria 1845
822 Ga0157373_11025141 3300013100 Unclassified 617
823 Ga0157370_10273617 3300013104 Unclassified 1560
824 Ga0157369_10069065 3300013105 Bacteria 3796
825 Ga0157374_10157907 3300013296 Bacteria 2208
826 Ga0157374_10285954 3300013296 Bacteria 1629
827 Ga0157374_10384509 3300013296 Bacteria 1398
828 Ga0157374_10831611 3300013296 Unclassified 940
829 Ga0157374_11025008 3300013296 Unclassified 845
830 Ga0157378_10000184 3300013297 Bacteria 59983
831 Ga0157378_10008939 3300013297 Bacteria 8719
832 Ga0157378_10011628 3300013297 Bacteria 7706
833 Ga0157378_10013919 3300013297 Bacteria 7037
834 Ga0157378_10018186 3300013297 Bacteria 6170
835 Ga0157378_10018580 3300013297 Bacteria 6110
836 Ga0157378_10034858 3300013297 Bacteria 4450
837 Ga0157378_10058073 3300013297 Bacteria 3450
838 Ga0157378_10082677 3300013297 Bacteria 2904
839 Ga0157378_10088964 3300013297 Bacteria 2803
840 Ga0157378_10102017 3300013297 Bacteria 2621
841 Ga0157378_10190981 3300013297 Unclassified 1932
842 Ga0157378_10294002 3300013297 Bacteria 1570
843 Ga0157378_10322381 3300013297 Bacteria 1501
844 Ga0157378_10381171 3300013297 Bacteria 1385
845 Ga0157378_10434189 3300013297 Bacteria 1300
846 Ga0157378_10536525 3300013297 Bacteria 1173
847 Ga0157378_10766348 3300013297 Unclassified 989
848 Ga0163162_10000023 3300013306 Bacteria 193395
849 Ga0163162_10006881 3300013306 Bacteria 11037
850 Ga0163162_10010962 3300013306 Bacteria 8828
851 Ga0163162_10037023 3300013306 Unclassified 4866
852 Ga0163162_10039315 3300013306 Unclassified 4727
853 Ga0163162_10040558 3300013306 Bacteria 4656
854 Ga0163162_10110224 3300013306 Bacteria 2850
855 Ga0163162_10115445 3300013306 Unclassified 2785
856 Ga0163162_10283735 3300013306 Bacteria 1788
857 Ga0163162_10393000 3300013306 Unclassified 1519
858 Ga0163162_10406026 3300013306 Bacteria 1495
859 Ga0163162_10577558 3300013306 Unclassified 1251
860 Ga0163162_10627717 3300013306 Bacteria 1199
861 Ga0163162_10782613 3300013306 Bacteria 1072
862 Ga0163162_11162159 3300013306 Unclassified 875
863 Ga0163162_11168197 3300013306 Unclassified 873
864 Ga0163162_11272983 3300013306 Unclassified 835
865 Ga0163162_11963298 3300013306 Unclassified 670
866 Ga0157372_10008865 3300013307 Bacteria 10684
867 Ga0157372_10125075 3300013307 Bacteria 2956
868 Ga0157372_10508200 3300013307 Bacteria 1405
869 Ga0157372_10836998 3300013307 Bacteria 1068
870 Ga0157372_11539971 3300013307 Bacteria 766
871 Ga0157372_11786441 3300013307 Unclassified 707
872 Ga0157375_10009137 3300013308 Bacteria 8684
873 Ga0157375_10029676 3300013308 Bacteria 5146
874 Ga0157375_10084091 3300013308 Bacteria 3230
875 Ga0157375_10095044 3300013308 Bacteria 3050
876 Ga0157375_10135122 3300013308 Unclassified 2589
877 Ga0157375_10239526 3300013308 Bacteria 1974
878 Ga0157375_10285397 3300013308 Unclassified 1814
879 Ga0157375_10472937 3300013308 Unclassified 1418
880 Ga0157375_10512840 3300013308 Unclassified 1363
881 Ga0157375_10550094 3300013308 Bacteria 1316
882 Ga0157375_11019934 3300013308 Unclassified 966
883 Ga0157375_11145739 3300013308 Unclassified 911
884 Ga0157375_11454625 3300013308 Unclassified 808
885 Ga0157375_12828153 3300013308 Unclassified 580
886 Ga0157375_13215970 3300013308 Bacteria 545
887 Ga0163163_10000223 3300014325 Bacteria 58398
888 Ga0163163_10003486 3300014325 Bacteria 13352
889 Ga0163163_10007381 3300014325 Bacteria 9699
890 Ga0163163_10033109 3300014325 Bacteria 4997
891 Ga0163163_10035157 3300014325 Bacteria 4859
892 Ga0163163_10039944 3300014325 Bacteria 4581
893 Ga0163163_10062161 3300014325 Bacteria 3700
894 Ga0163163_10067219 3300014325 Bacteria 3563
895 Ga0163163_10301310 3300014325 Unclassified 1655
896 Ga0163163_10305737 3300014325 Bacteria 1643
897 Ga0163163_10323044 3300014325 Bacteria 1597
898 Ga0163163_10522263 3300014325 Unclassified 1250
899 Ga0163163_10569651 3300014325 Unclassified 1195
900 Ga0163163_10747806 3300014325 Bacteria 1041
901 Ga0163163_11172833 3300014325 Unclassified 831
902 Ga0163163_11176507 3300014325 Bacteria 829
903 Ga0163163_11385914 3300014325 Unclassified 765
904 Ga0163163_11438335 3300014325 Unclassified 751
905 Ga0157380_10004587 3300014326 Bacteria 9592
906 Ga0157380_10019502 3300014326 Bacteria 5054
907 Ga0157380_10064316 3300014326 Bacteria 2944
908 Ga0157380_10067362 3300014326 Bacteria 2883
909 Ga0157380_10116546 3300014326 Bacteria 2255
910 Ga0157380_10144600 3300014326 Bacteria 2048
911 Ga0157380_10263300 3300014326 Bacteria 1567
912 Ga0157380_10285556 3300014326 Bacteria 1512
913 Ga0157380_10286491 3300014326 Bacteria 1510
914 Ga0157380_10302658 3300014326 Bacteria 1474
915 Ga0182008_10116048 3300014497 Unclassified 1328
916 Ga0157377_10090425 3300014745 Unclassified 1807
917 Ga0157377_10475765 3300014745 Bacteria 868
918 Ga0157377_11095875 3300014745 Unclassified 610
919 Ga0157379_10027909 3300014968 Bacteria 5024
920 Ga0157379_10028452 3300014968 Bacteria 4971
921 Ga0157379_10063103 3300014968 Unclassified 3313
922 Ga0157379_10076651 3300014968 Unclassified 2994
923 Ga0157379_10216626 3300014968 Bacteria 1734
924 Ga0157379_10563506 3300014968 Bacteria 1061
925 Ga0157376_10053347 3300014969 Bacteria 3366
926 Ga0157376_10110788 3300014969 Bacteria 2416
927 Ga0157376_10143207 3300014969 Unclassified 2147
928 Ga0157376_10424061 3300014969 Bacteria 1292
929 Ga0157376_10651136 3300014969 Bacteria 1054
930 Ga0182007_10055981 3300015262 Bacteria 1296
931 Ga0163161_10002484 3300017792 Bacteria 13143
932 Ga0163161_10780334 3300017792 Unclassified 801
933 Ga0207672_1000061 3300025223 Bacteria 14428
934 Ga0207426_1059415 3300025302 Bacteria 1106
935 Ga0207656_10065645 3300025321 Bacteria 1602
936 Ga0207656_10200749 3300025321 Unclassified 963
937 Ga0207653_10000223 3300025885 Bacteria 37689
938 Ga0207653_10000545 3300025885 Bacteria 13919
939 Ga0207682_10104755 3300025893 Bacteria 1240
940 Ga0207682_10428427 3300025893 Unclassified 626
941 Ga0207642_10196178 3300025899 Bacteria 1112
942 Ga0207642_10590292 3300025899 Bacteria 690
943 Ga0207642_10690851 3300025899 Unclassified 642
944 Ga0207642_10808772 3300025899 Unclassified 596
945 Ga0207710_10000001 3300025900 Bacteria 1797433
946 Ga0207710_10001999 3300025900 Bacteria 9718
947 Ga0207710_10124238 3300025900 Bacteria 1235
948 Ga0207710_10372502 3300025900 Unclassified 730
949 Ga0207688_10174282 3300025901 Unclassified 1280
950 Ga0207688_10403191 3300025901 Unclassified 848
951 Ga0207680_10016269 3300025903 Bacteria 3901
952 Ga0207680_10102402 3300025903 Bacteria 1842
953 Ga0207647_10002354 3300025904 Bacteria 14365
954 Ga0207647_10048150 3300025904 Bacteria 2648
955 Ga0207647_10153081 3300025904 Unclassified 1347
956 Ga0207647_10679261 3300025904 Unclassified 563
957 Ga0207685_10000020 3300025905 Bacteria 138584
958 Ga0207685_10117816 3300025905 Bacteria 1161
959 Ga0207645_10099750 3300025907 Unclassified 1873
960 Ga0207645_10234905 3300025907 Bacteria 1211
961 Ga0207645_10259072 3300025907 Unclassified 1152
962 Ga0207645_10486535 3300025907 Bacteria 835
963 Ga0207645_10750573 3300025907 Unclassified 663
964 Ga0207643_10002043 3300025908 Bacteria 11130
965 Ga0207643_10033470 3300025908 Bacteria 2876
966 Ga0207643_10327923 3300025908 Unclassified 957
967 Ga0207643_10379202 3300025908 Bacteria 891
968 Ga0207643_10674001 3300025908 Unclassified 668
969 Ga0207643_10900803 3300025908 Bacteria 573
970 Ga0207684_10000117 3300025910 Bacteria 148207
971 Ga0207684_10005064 3300025910 Bacteria 12282
972 Ga0207684_10008048 3300025910 Bacteria 9413
973 Ga0207684_10009494 3300025910 Bacteria 8590
974 Ga0207684_10025841 3300025910 Bacteria 5004
975 Ga0207684_10079994 3300025910 Bacteria 2780
976 Ga0207684_10095382 3300025910 Bacteria 2538
977 Ga0207684_10310675 3300025910 Bacteria 1359
978 Ga0207654_10021845 3300025911 Bacteria 3408
979 Ga0207654_10070763 3300025911 Bacteria 2072
980 Ga0207654_10120032 3300025911 Bacteria 1649
981 Ga0207654_10465224 3300025911 Bacteria 889
982 Ga0207707_10000013 3300025912 Bacteria 264517
983 Ga0207707_10002535 3300025912 Bacteria 16393
984 Ga0207707_10234963 3300025912 Unclassified 1595
985 Ga0207707_10408162 3300025912 Unclassified 1166
986 Ga0207707_10455132 3300025912 Bacteria 1095
987 Ga0207695_10094772 3300025913 Bacteria 2991
988 Ga0207695_10576311 3300025913 Bacteria 1007
989 Ga0207671_10001043 3300025914 Bacteria 33697
990 Ga0207663_10411645 3300025916 Bacteria 1036
991 Ga0207660_10000926 3300025917 Bacteria 19371
992 Ga0207660_10255940 3300025917 Bacteria 1383
993 Ga0207660_10814598 3300025917 Unclassified 762
994 Ga0207662_10007754 3300025918 Bacteria 5848
995 Ga0207662_10141328 3300025918 Bacteria 1525
996 Ga0207662_10183865 3300025918 Unclassified 1346
997 Ga0207662_10222916 3300025918 Bacteria 1229
998 Ga0207662_10275399 3300025918 Bacteria 1112
999 Ga0207662_10277227 3300025918 Bacteria 1108
1000 Ga0207662_10308805 3300025918 Unclassified 1053
1001 Ga0207662_10322024 3300025918 Bacteria 1032
1002 Ga0207662_10362405 3300025918 Bacteria 976
1003 Ga0207662_10476703 3300025918 Bacteria 856
1004 Ga0207662_10670415 3300025918 Unclassified 725
1005 Ga0207657_10017319 3300025919 Bacteria 6913
1006 Ga0207657_10075506 3300025919 Bacteria 2844
1007 Ga0207657_10399155 3300025919 Bacteria 1081
1008 Ga0207649_10029516 3300025920 Bacteria 3239
1009 Ga0207649_11318412 3300025920 Unclassified 571
1010 Ga0207652_10000071 3300025921 Bacteria 109636
1011 Ga0207652_10026321 3300025921 Bacteria 4844
1012 Ga0207652_10500078 3300025921 Bacteria 1094
1013 Ga0207652_11365793 3300025921 Bacteria 612
1014 Ga0207646_10000881 3300025922 Bacteria 38734
1015 Ga0207646_10008993 3300025922 Bacteria 9931
1016 Ga0207646_10032665 3300025922 Bacteria 4709
1017 Ga0207646_10072025 3300025922 Unclassified 3087
1018 Ga0207646_10080950 3300025922 Bacteria 2904
1019 Ga0207646_10281154 3300025922 Bacteria 1504
1020 Ga0207646_10361092 3300025922 Unclassified 1312
1021 Ga0207646_10690396 3300025922 Unclassified 913
1022 Ga0207646_10809048 3300025922 Bacteria 834
1023 Ga0207646_11085430 3300025922 Unclassified 705
1024 Ga0207646_11439668 3300025922 Bacteria 598
1025 Ga0207681_10003629 3300025923 Bacteria 9593
1026 Ga0207681_10109020 3300025923 Bacteria 2011
1027 Ga0207681_10143441 3300025923 Bacteria 1781
1028 Ga0207681_10327894 3300025923 Bacteria 1219
1029 Ga0207681_10570181 3300025923 Bacteria 933
1030 Ga0207694_10142633 3300025924 Bacteria 1927
1031 Ga0207694_10499750 3300025924 Bacteria 1018
1032 Ga0207650_10000017 3300025925 Bacteria 354674
1033 Ga0207650_10000890 3300025925 Bacteria 22583
1034 Ga0207650_10084053 3300025925 Bacteria 2419
1035 Ga0207650_10160327 3300025925 Unclassified 1782
1036 Ga0207650_10250046 3300025925 Bacteria 1435
1037 Ga0207650_10282805 3300025925 Bacteria 1351
1038 Ga0207650_10288452 3300025925 Bacteria 1338
1039 Ga0207650_10291008 3300025925 Bacteria 1332
1040 Ga0207650_10426282 3300025925 Unclassified 1101
1041 Ga0207650_10713383 3300025925 Unclassified 848
1042 Ga0207650_11047378 3300025925 Bacteria 694
1043 Ga0207650_11459308 3300025925 Unclassified 582
1044 Ga0207659_10136404 3300025926 Unclassified 1900
1045 Ga0207659_10179058 3300025926 Bacteria 1678
1046 Ga0207659_10445546 3300025926 Unclassified 1090
1047 Ga0207659_10886410 3300025926 Unclassified 767
1048 Ga0207659_10929774 3300025926 Bacteria 748
1049 Ga0207687_10143515 3300025927 Bacteria 1814
1050 Ga0207687_10152692 3300025927 Unclassified 1764
1051 Ga0207687_10696560 3300025927 Bacteria 862
1052 Ga0207687_10721981 3300025927 Bacteria 847
1053 Ga0207687_11071540 3300025927 Unclassified 692
1054 Ga0207644_10001827 3300025931 Bacteria 13817
1055 Ga0207644_10017866 3300025931 Bacteria 4796
1056 Ga0207644_10763294 3300025931 Bacteria 808
1057 Ga0207690_10178671 3300025932 Bacteria 1596
1058 Ga0207690_10292585 3300025932 Bacteria 1272
1059 Ga0207690_10547311 3300025932 Unclassified 941
1060 Ga0207690_10560921 3300025932 Unclassified 929
1061 Ga0207706_10102864 3300025933 Unclassified 2513
1062 Ga0207706_10136028 3300025933 Bacteria 2162
1063 Ga0207706_10194242 3300025933 Unclassified 1781
1064 Ga0207706_10215332 3300025933 Unclassified 1683
1065 Ga0207686_10000002 3300025934 Bacteria 453961
1066 Ga0207686_10000699 3300025934 Bacteria 20779
1067 Ga0207686_10001125 3300025934 Bacteria 15447
1068 Ga0207686_10126538 3300025934 Bacteria 1747
1069 Ga0207686_10196482 3300025934 Bacteria 1442
1070 Ga0207686_10350750 3300025934 Bacteria 1111
1071 Ga0207686_10358533 3300025934 Bacteria 1100
1072 Ga0207686_10438387 3300025934 Bacteria 1003
1073 Ga0207686_10513715 3300025934 Unclassified 931
1074 Ga0207709_10000012 3300025935 Bacteria 552803
1075 Ga0207709_10002207 3300025935 Bacteria 12420
1076 Ga0207709_10005715 3300025935 Bacteria 7025
1077 Ga0207709_10067649 3300025935 Bacteria 2255
1078 Ga0207709_10081217 3300025935 Unclassified 2089
1079 Ga0207709_10088609 3300025935 Unclassified 2015
1080 Ga0207709_10342434 3300025935 Bacteria 1126
1081 Ga0207709_10515185 3300025935 Unclassified 935
1082 Ga0207709_10588451 3300025935 Unclassified 880
1083 Ga0207670_10034449 3300025936 Bacteria 3272
1084 Ga0207670_10222567 3300025936 Unclassified 1445
1085 Ga0207670_10330128 3300025936 Bacteria 1202
1086 Ga0207670_10334210 3300025936 Bacteria 1196
1087 Ga0207670_10345063 3300025936 Bacteria 1178
1088 Ga0207670_10382418 3300025936 Bacteria 1121
1089 Ga0207670_10434920 3300025936 Unclassified 1055
1090 Ga0207670_10488158 3300025936 Bacteria 998
1091 Ga0207670_11261582 3300025936 Unclassified 626
1092 Ga0207704_10050767 3300025938 Bacteria 2504
1093 Ga0207704_10276269 3300025938 Bacteria 1275
1094 Ga0207704_10443635 3300025938 Bacteria 1034
1095 Ga0207704_11113004 3300025938 Bacteria 671
1096 Ga0207665_10000001 3300025939 Bacteria 279842
1097 Ga0207665_10076482 3300025939 Bacteria 2295
1098 Ga0207665_10132372 3300025939 Unclassified 1772
1099 Ga0207665_10153203 3300025939 Bacteria 1653
1100 Ga0207665_10501507 3300025939 Unclassified 938
1101 Ga0207691_10008014 3300025940 Bacteria 10154
1102 Ga0207691_10087278 3300025940 Bacteria 2799
1103 Ga0207691_10471936 3300025940 Bacteria 1067
1104 Ga0207691_11494913 3300025940 Bacteria 552
1105 Ga0207711_10004200 3300025941 Bacteria 12328
1106 Ga0207711_10096345 3300025941 Bacteria 2611
1107 Ga0207711_10118056 3300025941 Bacteria 2366
1108 Ga0207711_10193066 3300025941 Bacteria 1856
1109 Ga0207711_10247974 3300025941 Bacteria 1634
1110 Ga0207711_10412271 3300025941 Bacteria 1256
1111 Ga0207711_10423705 3300025941 Bacteria 1238
1112 Ga0207711_10779840 3300025941 Unclassified 890
1113 Ga0207689_10002507 3300025942 Bacteria 17060
1114 Ga0207689_10005313 3300025942 Bacteria 11543
1115 Ga0207689_10029378 3300025942 Bacteria 4591
1116 Ga0207689_10033815 3300025942 Bacteria 4246
1117 Ga0207689_10050739 3300025942 Bacteria 3420
1118 Ga0207689_10051969 3300025942 Bacteria 3378
1119 Ga0207689_10133559 3300025942 Bacteria 2043
1120 Ga0207689_10154307 3300025942 Bacteria 1893
1121 Ga0207689_10228067 3300025942 Bacteria 1539
1122 Ga0207689_10243978 3300025942 Bacteria 1485
1123 Ga0207689_10288218 3300025942 Bacteria 1360
1124 Ga0207689_10345518 3300025942 Bacteria 1236
1125 Ga0207689_10516800 3300025942 Bacteria 1001
1126 Ga0207689_10601331 3300025942 Bacteria 925
1127 Ga0207689_11080413 3300025942 Bacteria 676
1128 Ga0207679_10015116 3300025945 Bacteria 5091
1129 Ga0207679_10172782 3300025945 Bacteria 1781
1130 Ga0207679_10255059 3300025945 Bacteria 1493
1131 Ga0207679_10674006 3300025945 Unclassified 937
1132 Ga0207679_11143481 3300025945 Bacteria 714
1133 Ga0207679_11232765 3300025945 Unclassified 687
1134 Ga0207667_10632776 3300025949 Bacteria 1077
1135 Ga0207667_11056177 3300025949 Bacteria 797
1136 Ga0207651_10064930 3300025960 Bacteria 2557
1137 Ga0207651_10158450 3300025960 Unclassified 1771
1138 Ga0207651_10284679 3300025960 Bacteria 1368
1139 Ga0207651_10349436 3300025960 Bacteria 1245
1140 Ga0207651_10583873 3300025960 Bacteria 975
1141 Ga0207651_10656121 3300025960 Unclassified 921
1142 Ga0207651_10666329 3300025960 Unclassified 914
1143 Ga0207651_10716595 3300025960 Bacteria 882
1144 Ga0207651_11349822 3300025960 Unclassified 641
1145 Ga0207712_10000785 3300025961 Bacteria 23685
1146 Ga0207712_10010774 3300025961 Bacteria 5812
1147 Ga0207712_10021869 3300025961 Unclassified 4203
1148 Ga0207712_10074588 3300025961 Unclassified 2450
1149 Ga0207712_10220796 3300025961 Bacteria 1515
1150 Ga0207712_10228662 3300025961 Unclassified 1492
1151 Ga0207712_10460676 3300025961 Unclassified 1080
1152 Ga0207712_10672605 3300025961 Bacteria 901
1153 Ga0207712_10711319 3300025961 Unclassified 877
1154 Ga0207712_10965912 3300025961 Unclassified 755
1155 Ga0207712_11136611 3300025961 Bacteria 696
1156 Ga0207668_10001179 3300025972 Bacteria 15521
1157 Ga0207640_10094569 3300025981 Bacteria 2079
1158 Ga0207640_10512755 3300025981 Bacteria 1001
1159 Ga0207640_10611950 3300025981 Bacteria 924
1160 Ga0207640_10627008 3300025981 Bacteria 913
1161 Ga0207640_10631690 3300025981 Unclassified 910
1162 Ga0207640_10926502 3300025981 Unclassified 762
1163 Ga0207658_10278170 3300025986 Unclassified 1434
1164 Ga0207658_10368918 3300025986 Bacteria 1254
1165 Ga0207658_10897990 3300025986 Bacteria 807
1166 Ga0207658_11037280 3300025986 Bacteria 748
1167 Ga0207658_11904061 3300025986 Unclassified 542
1168 Ga0207677_10055043 3300026023 Unclassified 2718
1169 Ga0207677_10266854 3300026023 Bacteria 1398
1170 Ga0207677_10679201 3300026023 Unclassified 912
1171 Ga0207703_10000406 3300026035 Bacteria 46246
1172 Ga0207703_10022630 3300026035 Bacteria 4933
1173 Ga0207703_10155419 3300026035 Bacteria 1998
1174 Ga0207703_10159273 3300026035 Bacteria 1976
1175 Ga0207703_10325408 3300026035 Bacteria 1409
1176 Ga0207703_10327072 3300026035 Unclassified 1405
1177 Ga0207703_10337300 3300026035 Bacteria 1384
1178 Ga0207703_10339362 3300026035 Bacteria 1380
1179 Ga0207703_10476323 3300026035 Bacteria 1169
1180 Ga0207703_11108488 3300026035 Bacteria 760
1181 Ga0207639_10058510 3300026041 Bacteria 2965
1182 Ga0207639_10242229 3300026041 Unclassified 1568
1183 Ga0207639_10374288 3300026041 Bacteria 1277
1184 Ga0207639_10714846 3300026041 Unclassified 930
1185 Ga0207639_11683657 3300026041 Unclassified 594
1186 Ga0207678_10435839 3300026067 Bacteria 1138
1187 Ga0207708_10000057 3300026075 Bacteria 97103
1188 Ga0207708_10013962 3300026075 Bacteria 6000
1189 Ga0207708_10054953 3300026075 Bacteria 3036
1190 Ga0207708_10082472 3300026075 Bacteria 2472
1191 Ga0207708_10376105 3300026075 Unclassified 1170
1192 Ga0207708_10376153 3300026075 Unclassified 1170
1193 Ga0207708_10473429 3300026075 Bacteria 1046
1194 Ga0207708_10479962 3300026075 Bacteria 1039
1195 Ga0207708_11569390 3300026075 Unclassified 578
1196 Ga0207702_10018048 3300026078 Bacteria 5838
1197 Ga0207641_10028892 3300026088 Bacteria 4583
1198 Ga0207641_10047349 3300026088 Bacteria 3625
1199 Ga0207641_10346734 3300026088 Bacteria 1414
1200 Ga0207641_10360948 3300026088 Bacteria 1387
1201 Ga0207641_10555953 3300026088 Bacteria 1120
1202 Ga0207641_10793581 3300026088 Unclassified 936
1203 Ga0207641_10954546 3300026088 Bacteria 853
1204 Ga0207648_10007657 3300026089 Bacteria 10570
1205 Ga0207648_10031731 3300026089 Bacteria 4669
1206 Ga0207648_10112325 3300026089 Bacteria 2392
1207 Ga0207648_10287725 3300026089 Bacteria 1471
1208 Ga0207648_10504697 3300026089 Bacteria 1107
1209 Ga0207648_10644535 3300026089 Bacteria 979
1210 Ga0207648_10947492 3300026089 Unclassified 805
1211 Ga0207648_11652340 3300026089 Unclassified 602
1212 Ga0207676_10006550 3300026095 Bacteria 8233
1213 Ga0207676_10022816 3300026095 Bacteria 4608
1214 Ga0207676_10029450 3300026095 Bacteria 4111
1215 Ga0207676_10125677 3300026095 Unclassified 2172
1216 Ga0207676_10136324 3300026095 Bacteria 2095
1217 Ga0207676_10175340 3300026095 Bacteria 1872
1218 Ga0207676_10224846 3300026095 Bacteria 1674
1219 Ga0207676_10267742 3300026095 Bacteria 1546
1220 Ga0207676_10283352 3300026095 Bacteria 1505
1221 Ga0207676_10538282 3300026095 Bacteria 1114
1222 Ga0207676_10700998 3300026095 Unclassified 981
1223 Ga0207676_10728913 3300026095 Unclassified 962
1224 Ga0207676_10751691 3300026095 Bacteria 948
1225 Ga0207676_11047665 3300026095 Unclassified 805
1226 Ga0207676_12371303 3300026095 Unclassified 528
1227 Ga0207674_10002176 3300026116 Bacteria 24790
1228 Ga0207674_10005492 3300026116 Bacteria 15055
1229 Ga0207674_10040934 3300026116 Bacteria 4795
1230 Ga0207674_10098114 3300026116 Bacteria 2913
1231 Ga0207674_10229536 3300026116 Unclassified 1804
1232 Ga0207674_10294053 3300026116 Unclassified 1573
1233 Ga0207675_100001706 3300026118 Bacteria 22007
1234 Ga0207675_100004788 3300026118 Bacteria 13036
1235 Ga0207675_100032877 3300026118 Bacteria 4833
1236 Ga0207675_100054678 3300026118 Unclassified 3724
1237 Ga0207675_100090585 3300026118 Bacteria 2876
1238 Ga0207675_100180626 3300026118 Bacteria 2020
1239 Ga0207675_100230470 3300026118 Bacteria 1787
1240 Ga0207675_100247050 3300026118 Unclassified 1726
1241 Ga0207675_100298271 3300026118 Unclassified 1569
1242 Ga0207675_100745543 3300026118 Bacteria 990
1243 Ga0207675_100833396 3300026118 Bacteria 937
1244 Ga0207675_100955628 3300026118 Bacteria 874
1245 Ga0207675_100974190 3300026118 Unclassified 866
1246 Ga0207675_102069066 3300026118 Unclassified 586
1247 Ga0207675_102125731 3300026118 Bacteria 577
1248 Ga0207675_102206068 3300026118 Bacteria 566
1249 Ga0207683_10072785 3300026121 Unclassified 3040
1250 Ga0207683_10765723 3300026121 Bacteria 896
1251 Ga0207698_10224950 3300026142 Bacteria 1699
1252 Ga0207698_10267409 3300026142 Unclassified 1574
1253 Ga0207698_10296651 3300026142 Bacteria 1503
1254 Ga0207698_10660596 3300026142 Bacteria 1036
1255 Ga0207698_10784277 3300026142 Bacteria 954
1256 Ga0207698_11159020 3300026142 Bacteria 786
1257 Ga0207698_11537732 3300026142 Unclassified 681
1258 Ga0207698_11601646 3300026142 Unclassified 667
1259 Ga0207428_10002259 3300027907 Bacteria 19342
1260 Ga0207428_10036099 3300027907 Bacteria 4035
1261 Ga0207428_10106231 3300027907 Bacteria 2165
1262 Ga0207428_10310012 3300027907 Bacteria 1167
1263 Ga0268266_10633778 3300028379 Bacteria 1028
1264 Ga0268265_10015510 3300028380 Bacteria 5217
1265 Ga0268265_10085532 3300028380 Bacteria 2503
1266 Ga0268265_10482646 3300028380 Bacteria 1164
1267 Ga0268265_10635867 3300028380 Bacteria 1024
1268 Ga0268265_11294018 3300028380 Unclassified 729
1269 Ga0268265_12120003 3300028380 Unclassified 569
1270 Ga0268265_12220993 3300028380 Unclassified 556
1271 Ga0268264_10028208 3300028381 Bacteria 4590
1272 Ga0268264_10106264 3300028381 Bacteria 2450
1273 Ga0268264_10115695 3300028381 Bacteria 2356
1274 Ga0268264_10162047 3300028381 Bacteria 2016
1275 Ga0268264_10198856 3300028381 Bacteria 1832
1276 Ga0268264_10199061 3300028381 Bacteria 1831
1277 Ga0268264_10306400 3300028381 Bacteria 1497
1278 Ga0268264_10323978 3300028381 Unclassified 1458
1279 Ga0268264_11365871 3300028381 Bacteria 719
1280 Ga0268264_11451070 3300028381 Unclassified 697
1281 Ga0316182_1170057 3300030745 Unclassified 981
1282 Ga0316182_1272275 3300030745 Unclassified 589
1283 Ga0265330_10000008 3300031235 Bacteria 192028
1284 Ga0265332_10001548 3300031238 Bacteria 12644
1285 Ga0265328_10193773 3300031239 Unclassified 770
1286 Ga0265329_10007563 3300031242 Bacteria 4190
1287 Ga0265316_10000036 3300031344 Bacteria 150384
1288 Ga0307513_10274505 3300031456 Bacteria 1467
1289 Ga0307513_10411337 3300031456 Bacteria 1085
1290 Ga0307408_100013151 3300031548 Bacteria 5492
1291 Ga0307408_100104908 3300031548 Bacteria 2160
1292 Ga0307408_100108372 3300031548 Bacteria 2129
1293 Ga0307408_100113058 3300031548 Bacteria 2089
1294 Ga0307408_100188503 3300031548 Bacteria 1660
1295 Ga0307408_100449739 3300031548 Bacteria 1117
1296 Ga0307408_100527938 3300031548 Bacteria 1038
1297 Ga0307408_100677872 3300031548 Bacteria 924
1298 Ga0307408_100751913 3300031548 Unclassified 881
1299 Ga0307408_101746367 3300031548 Bacteria 594
1300 Ga0265314_10000005 3300031711 Bacteria 668532
1301 Ga0265342_10000041 3300031712 Bacteria 139895
1302 Ga0316578_10217115 3300031728 Bacteria 1150
1303 Ga0307405_10002498 3300031731 Bacteria 8129
1304 Ga0307405_10025566 3300031731 Bacteria 3392
1305 Ga0307405_10072733 3300031731 Bacteria 2217
1306 Ga0307405_10082002 3300031731 Bacteria 2110
1307 Ga0307405_10083583 3300031731 Bacteria 2093
1308 Ga0307405_10296624 3300031731 Bacteria 1224
1309 Ga0307405_10448812 3300031731 Bacteria 1022
1310 Ga0307405_11281862 3300031731 Unclassified 637
1311 Ga0307413_10013429 3300031824 Bacteria 4117
1312 Ga0307413_10022279 3300031824 Bacteria 3411
1313 Ga0307413_10448802 3300031824 Unclassified 1023
1314 Ga0307413_11037096 3300031824 Unclassified 705
1315 Ga0307413_11342118 3300031824 Bacteria 627
1316 Ga0307410_10011643 3300031852 Bacteria 5041
1317 Ga0307410_10021711 3300031852 Bacteria 3953
1318 Ga0307410_10024555 3300031852 Bacteria 3767
1319 Ga0307410_10027890 3300031852 Bacteria 3574
1320 Ga0307410_10406158 3300031852 Bacteria 1102
1321 Ga0307410_10653374 3300031852 Bacteria 882
1322 Ga0307410_11496875 3300031852 Unclassified 594
1323 Ga0307410_11760962 3300031852 Bacteria 550
1324 Ga0307406_10001954 3300031901 Bacteria 11261
1325 Ga0307406_10009539 3300031901 Bacteria 5448
1326 Ga0307406_10010591 3300031901 Bacteria 5204
1327 Ga0307406_10099313 3300031901 Bacteria 1979
1328 Ga0307406_10125087 3300031901 Bacteria 1795
1329 Ga0307406_10150420 3300031901 Bacteria 1660
1330 Ga0307406_11078768 3300031901 Unclassified 692
1331 Ga0307406_11837362 3300031901 Unclassified 539
1332 Ga0307407_10001790 3300031903 Bacteria 8039
1333 Ga0307407_10002617 3300031903 Bacteria 7112
1334 Ga0307407_10002963 3300031903 Bacteria 6810
1335 Ga0307407_10012504 3300031903 Bacteria 4082
1336 Ga0307407_10027925 3300031903 Bacteria 3010
1337 Ga0307407_10065534 3300031903 Bacteria 2139
1338 Ga0307407_10180945 3300031903 Bacteria 1397
1339 Ga0307407_11102278 3300031903 Unclassified 617
1340 Ga0307412_10006810 3300031911 Bacteria 6482
1341 Ga0307412_10016167 3300031911 Bacteria 4438
1342 Ga0307412_10059146 3300031911 Bacteria 2567
1343 Ga0307412_10332420 3300031911 Bacteria 1213
1344 Ga0307412_11444065 3300031911 Unclassified 624
1345 Ga0307409_100004384 3300031995 Bacteria 7921
1346 Ga0307409_100005772 3300031995 Bacteria 7177
1347 Ga0307409_100044037 3300031995 Bacteria 3357
1348 Ga0307409_100267052 3300031995 Unclassified 1574
1349 Ga0307409_100560526 3300031995 Bacteria 1123
1350 Ga0307409_101649251 3300031995 Unclassified 670
1351 Ga0307409_102442398 3300031995 Bacteria 552
1352 Ga0307416_100002928 3300032002 Bacteria 9949
1353 Ga0307416_100005888 3300032002 Bacteria 7608
1354 Ga0307416_100034895 3300032002 Bacteria 3834
1355 Ga0307416_100094888 3300032002 Bacteria 2574
1356 Ga0307416_100155522 3300032002 Bacteria 2104
1357 Ga0307416_100166043 3300032002 Bacteria 2048
1358 Ga0307416_100374598 3300032002 Bacteria 1451
1359 Ga0307416_100770770 3300032002 Bacteria 1056
1360 Ga0307416_101136514 3300032002 Unclassified 886
1361 Ga0307416_101289678 3300032002 Unclassified 836
1362 Ga0307416_101499439 3300032002 Bacteria 780
1363 Ga0307416_102667895 3300032002 Bacteria 597
1364 Ga0307416_103043780 3300032002 Unclassified 561
1365 Ga0307414_10005886 3300032004 Bacteria 6786
1366 Ga0307414_10025721 3300032004 Bacteria 3775
1367 Ga0307414_10182125 3300032004 Bacteria 1691
1368 Ga0307414_10417160 3300032004 Bacteria 1170
1369 Ga0307411_10003466 3300032005 Bacteria 7324
1370 Ga0307411_10004402 3300032005 Bacteria 6737
1371 Ga0307411_10015041 3300032005 Bacteria 4329
1372 Ga0307411_10033681 3300032005 Unclassified 3179
1373 Ga0307411_10660129 3300032005 Bacteria 906
1374 Ga0307411_11117957 3300032005 Bacteria 711
1375 Ga0307415_100018684 3300032126 Bacteria 4192
1376 Ga0307415_100019501 3300032126 Bacteria 4118
1377 Ga0307415_100024571 3300032126 Bacteria 3764
1378 Ga0307415_100081720 3300032126 Bacteria 2309
1379 Ga0307415_100126833 3300032126 Bacteria 1925
1380 Ga0307415_100329357 3300032126 Bacteria 1277
1381 Ga0307415_100399579 3300032126 Unclassified 1173
1382 Ga0307415_100684778 3300032126 Bacteria 923
1383 Ga0307415_100815608 3300032126 Bacteria 853
1384 Ga0307415_100904298 3300032126 Bacteria 814
1385 Ga0307415_101142668 3300032126 Bacteria 731
1386 Ga0373950_0122176 3300034818 Unclassified 577
1387 Ga0373959_0010730 3300034820 Bacteria 1607
1388 Ga0373929_0140704 3300035085 Unclassified 640
1389 Ga0373944_0249818 3300035089 Unclassified 654
1390 Ga0373949_0043235 3300035090 Unclassified 1114
1391 Ga0373949_0070326 3300035090 Bacteria 916
1392 Ga0373951_0002115 3300035091 Bacteria 5078
1393 Ga0373951_0009844 3300035091 Bacteria 2149
1394 Ga0373952_0110218 3300035092 Unclassified 736
1395 Ga0373932_0375940 3300035112 Archaea 545
1396 Ga0373941_0016919 3300035115 Bacteria 1990
1397 Ga0373941_0043415 3300035115 Bacteria 1400
1398 Ga0373945_0018013 3300035116 Bacteria 2399
1399 Ga0373960_0199537 3300035121 Unclassified 707
1400 Ga0373942_0005910 3300035207 Bacteria 2831
1401 Ga0373931_0457764 3300035691 Unclassified 817
1402 Ga0373947_0216322 3300035725 Bacteria 1258
1403 Ga0316584_0038601 3300036712 Unclassified 3553
1404 Ga0395899_0475136 3300037312 Unclassified 815
1405 Ga0395899_0541715 3300037312 Unclassified 749
1406 Ga0395900_0176796 3300037418 Bacteria 2171
1407 Ga0395900_0262248 3300037418 Unclassified 1725
1408 Ga0395900_0307090 3300037418 Bacteria 1571
1409 Ga0395900_0557211 3300037418 Bacteria 1090
1410 Ga0395900_0751864 3300037418 Bacteria 905
1411 Ga0395900_1205205 3300037418 Unclassified 672
1412 Ga0395898_0123956 3300037466 Bacteria 2476
1413 Ga0395898_0262813 3300037466 Bacteria 1646
1414 Ga0395905_0104247 3300037471 Bacteria 2662
1415 Ga0395905_0192163 3300037471 Bacteria 1915
1416 Ga0395905_1782063 3300037471 Unclassified 521
1417 Ga0436364_0052710 3300037853 Bacteria 666
1418 Ga0395901_0084146 3300038443 Bacteria 3325
1419 Ga0395901_0139221 3300038443 Bacteria 2551
1420 Ga0395901_0335357 3300038443 Bacteria 1563
1421 Ga0395901_0698619 3300038443 Bacteria 1012
1422 Ga0395901_1388306 3300038443 Unclassified 661
1423 Ga0395901_1870720 3300038443 Unclassified 548
1424 Ga0242419_002104 3300038698 Bacteria 1280
1425 Ga0242420_004336 3300038996 Unclassified 2141
1426 Ga0242420_037852 3300038996 Bacteria 914
1427 Ga0242420_114969 3300038996 Unclassified 582
1428 Ga0436365_0228365 3300039437 Bacteria 6395
1429 Ga0436365_0853746 3300039437 Bacteria 770
1430 Ga0436363_1060242 3300039450 Unclassified 580
1431 Ga0439438_148105 3300041405 Unclassified 560
1432 Ga0451791_0088673 3300041451 Bacteria 1816
1433 Ga0439432_080508 3300042006 Unclassified 987
1434 Ga0439455_0067373 3300042012 Unclassified 957
1435 Ga0439455_0078069 3300042012 Unclassified 897
1436 Ga0450888_025740 3300042126 Bacteria 770
1437 Ga0439446_0006193 3300042156 Bacteria 3109
1438 Ga0439444_0126980 3300042437 Bacteria 600
1439 Ga0439459_0114716 3300042438 Unclassified 673
1440 Ga0439464_0056902 3300042439 Bacteria 1139
1441 Ga0451577_0098434 3300042876 Bacteria 2612
1442 Ga0451577_0634788 3300042876 Unclassified 969
1443 Ga0451577_0973060 3300042876 Unclassified 763
1444 Ga0451576_0168952 3300045051 Bacteria 2282
1445 Ga0451576_0237928 3300045051 Bacteria 1902
1446 Ga0451576_0419454 3300045051 Unclassified 1404
1447 Ga0451576_0511139 3300045051 Bacteria 1262
1448 Ga0451576_0585032 3300045051 Bacteria 1173
1449 Ga0495582_0340683 3300046473 Unclassified 863
1450 Ga0495610_0037199 3300046512 Bacteria 2479
1451 Ga0495630_0297608 3300046517 Bacteria 1233
1452 Ga0495663_0000171 3300046525 Bacteria 26086
1453 Ga0495663_0078253 3300046525 Bacteria 1062
1454 Ga0495598_0004493 3300046537 Bacteria 3023
1455 Ga0495598_0015751 3300046537 Bacteria 1915
1456 Ga0495598_0040555 3300046537 Unclassified 1358
1457 Ga0495598_0132496 3300046537 Bacteria 856
1458 Ga0495598_0197665 3300046537 Bacteria 725
1459 Ga0495598_0359937 3300046537 Unclassified 562
1460 Ga0495621_0000156 3300046539 Bacteria 15052
1461 Ga0495621_0083562 3300046539 Bacteria 1194
1462 Ga0495621_0189787 3300046539 Bacteria 823
1463 Ga0495668_0000763 3300046616 Bacteria 37837
1464 Ga0495668_0064066 3300046616 Bacteria 2024
1465 Ga0495670_0161074 3300046691 Bacteria 1179
1466 Ga0495636_0049807 3300047318 Bacteria 1752
1467 Ga0495672_0042128 3300047320 Unclassified 2755
1468 Ga0495676_0249858 3300047321 Bacteria 1210
1469 Ga0495685_077112 3300047447 Bacteria 1112
1470 Ga0495684_0188535 3300047471 Bacteria 1526
1471 Ga0496100_0355692 3300048903 Bacteria 1107
1472 Ga0496102_1394200 3300048905 Unclassified 620
1473 Ga0496103_0221328 3300048906 Bacteria 1217
1474 Ga0496104_0025481 3300048907 Bacteria 5452
1475 Ga0496104_0198785 3300048907 Bacteria 1917
1476 Ga0496104_0336176 3300048907 Bacteria 1423
1477 Ga0496106_0052945 3300048909 Bacteria 3064
1478 Ga0496106_0120172 3300048909 Bacteria 2053
1479 Ga0496106_0418119 3300048909 Unclassified 1077
1480 Ga0496106_0873856 3300048909 Unclassified 711
1481 Ga0496107_0039353 3300048910 Bacteria 3392
1482 Ga0496107_0236126 3300048910 Bacteria 1360
1483 Ga0496107_0357441 3300048910 Bacteria 1087
1484 Ga0496107_0490031 3300048910 Bacteria 912
1485 Ga0496108_0058081 3300048911 Bacteria 3251
1486 Ga0496108_0108156 3300048911 Bacteria 2375
1487 Ga0496108_0306252 3300048911 Bacteria 1384
1488 Ga0496108_1106620 3300048911 Bacteria 673
1489 Ga0496109_1305334 3300048912 Unclassified 662
1490 Ga0496110_0138311 3300048913 Unclassified 2202
1491 Ga0496110_0439049 3300048913 Bacteria 1190
1492 Ga0496111_0585179 3300048914 Bacteria 818
1493 Ga0496112_0236884 3300048915 Bacteria 1779
1494 Ga0496112_0384257 3300048915 Bacteria 1345
1495 Ga0496113_0246786 3300048916 Bacteria 1425
1496 Ga0496113_0274218 3300048916 Unclassified 1348
1497 Ga0496113_0529025 3300048916 Bacteria 946
1498 Ga0496113_0697777 3300048916 Unclassified 810
1499 Ga0496113_1253304 3300048916 Unclassified 578
1500 Ga0496114_0278718 3300048917 Bacteria 1474
1501 Ga0501291_040870 3300049514 Unclassified 815
1502 Ga0501292_000790 3300049515 Bacteria 3851
1503 Ga0501292_004622 3300049515 Bacteria 1891
1504 Ga0501296_001574 3300049519 Bacteria 2319
1505 Ga0501297_006690 3300049520 Bacteria 1235
1506 Ga0501298_000241 3300049521 Bacteria 7073
1507 Ga0501298_030892 3300049521 Bacteria 1051
1508 Ga0501299_001065 3300049522 Bacteria 3414
1509 Ga0501299_219920 3300049522 Unclassified 512
1510 Ga0501303_008931 3300049526 Unclassified 918
1511 Ga0501031_0405135 3300049568 Bacteria 882
1512 Ga0501038_0000426 3300049574 Bacteria 36732
1513 Ga0501039_1109991 3300049575 Bacteria 613
1514 Ga0501040_0169611 3300049576 Bacteria 1545
1515 Ga0501048_0437598 3300049582 Bacteria 936
1516 Ga0501048_0466942 3300049582 Unclassified 904
1517 Ga0501072_0013245 3300049588 Bacteria 6316
1518 Ga0501074_0527804 3300049590 Bacteria 836
1519 Ga0501075_0509111 3300049591 Bacteria 919
1520 Ga0501076_0671624 3300049592 Bacteria 855
1521 Ga0501198_004697 3300049649 Unclassified 1904
1522 Ga0501202_000446 3300049652 Bacteria 5844
1523 Ga0501202_067366 3300049652 Bacteria 819
1524 Ga0501207_003306 3300049654 Bacteria 2143
1525 Ga0501216_001852 3300049660 Bacteria 2920
1526 Ga0501217_001051 3300049661 Bacteria 5017
1527 Ga0501217_005198 3300049661 Bacteria 2712
1528 Ga0501217_020959 3300049661 Bacteria 1540
1529 Ga0501217_311194 3300049661 Unclassified 522
1530 Ga0501222_063498 3300049662 Unclassified 563
1531 Ga0501223_000840 3300049663 Bacteria 7295
1532 Ga0501224_000336 3300049664 Bacteria 5510
1533 Ga0501224_015643 3300049664 Bacteria 1124
1534 Ga0501227_000955 3300049665 Bacteria 6350
1535 Ga0501227_050778 3300049665 Bacteria 1046
1536 Ga0501233_000613 3300049668 Bacteria 5841
1537 Ga0501235_001735 3300049669 Bacteria 4676
1538 Ga0501235_046659 3300049669 Bacteria 998
1539 Ga0501235_087129 3300049669 Unclassified 751
1540 Ga0501235_103557 3300049669 Unclassified 697
1541 Ga0501243_001824 3300049675 Unclassified 3087
1542 Ga0501243_039467 3300049675 Unclassified 826
1543 Ga0501248_020163 3300049678 Unclassified 683
1544 Ga0501250_006241 3300049680 Unclassified 1254
1545 Ga0501250_048359 3300049680 Bacteria 645
1546 Ga0501253_011602 3300049683 Unclassified 1359
1547 Ga0501257_012421 3300049686 Bacteria 1948
1548 Ga0501257_202198 3300049686 Unclassified 572
1549 Ga0501259_006501 3300049688 Bacteria 1861
1550 Ga0501259_016453 3300049688 Bacteria 1272
1551 Ga0501261_021432 3300049690 Bacteria 929
1552 Ga0501221_018693 3300049704 Unclassified 1337
1553 Ga0501221_044405 3300049704 Bacteria 981
1554 Ga0501221_193391 3300049704 Bacteria 562
1555 Ga0501225_0000929 3300049705 Bacteria 9133
1556 Ga0501225_0013302 3300049705 Bacteria 2305
1557 Ga0501225_0016071 3300049705 Bacteria 2081
1558 Ga0501267_009405 3300049764 Unclassified 975
1559 Ga0501268_004605 3300049765 Bacteria 1950
1560 Ga0501268_070125 3300049765 Bacteria 708
1561 Ga0501272_004539 3300049769 Bacteria 1444
1562 Ga0501273_013377 3300049770 Bacteria 1046
1563 Ga0501275_031772 3300049772 Unclassified 702
1564 Ga0501279_013185 3300049775 Bacteria 1130
1565 Ga0501283_000377 3300049779 Bacteria 5917
1566 Ga0501283_001846 3300049779 Bacteria 2745
1567 Ga0501204_004672 3300049850 Unclassified 1479
1568 Ga0501204_048049 3300049850 Unclassified 646
1569 Ga0501212_002665 3300049851 Bacteria 2176
1570 Ga0501226_000536 3300049853 Bacteria 5263
1571 nmdc:mga05p37_1087927_c1 3300050507 Bacteria 839
1572 nmdc:mga05p37_1347502_c1 3300050507 Bacteria 723
1573 nmdc:mga05p37_1522850_c1 3300050507 Bacteria 664
1574 nmdc:mga05p37_159731_c1 3300050507 Unclassified 2753
1575 nmdc:mga05p37_1749301_c1 3300050507 Unclassified 603
1576 nmdc:mga05p37_187097_c1 3300050507 Unclassified 2517
1577 nmdc:mga05p37_273532_c1 3300050507 Bacteria 2017
1578 nmdc:mga05p37_35981_c1 3300050507 Bacteria 6075
1579 nmdc:mga05p37_495219_c1 3300050507 Bacteria 1404
1580 nmdc:mga05p37_525869_c1 3300050507 Bacteria 1352
1581 nmdc:mga05p37_53763_c1 3300050507 Bacteria 4953
1582 nmdc:mga05p37_62336_c1 3300050507 Unclassified 4589
1583 nmdc:mga09592_443668_c1 3300050508 Bacteria 1120
1584 nmdc:mga09592_787969_c1 3300050508 Bacteria 805
1585 nmdc:mga0qj67_559986_c1 3300050509 Unclassified 916
1586 nmdc:mga0qj67_578266_c1 3300050509 Unclassified 900
1587 nmdc:mga06r32_30069_c1 3300050510 Bacteria 5095
1588 nmdc:mga06r32_331427_c1 3300050510 Bacteria 1507
1589 nmdc:mga06r32_351890_c1 3300050510 Archaea 1457
1590 nmdc:mga06r32_382114_c1 3300050510 Bacteria 1391
1591 nmdc:mga08y16_1484452_c1 3300050511 Unclassified 639
1592 nmdc:mga08y16_150695_c1 3300050511 Unclassified 2417
1593 nmdc:mga08y16_172168_c1 3300050511 Bacteria 2249
1594 nmdc:mga08y16_2220_c1 3300050511 Bacteria 19906
1595 nmdc:mga08y16_495663_c1 3300050511 Unclassified 1242
1596 nmdc:mga08y16_69530_c1 3300050511 Bacteria 3671
1597 nmdc:mga0n895_106852_c1 3300050512 Bacteria 2812
1598 nmdc:mga0n895_1177662_c1 3300050512 Unclassified 741
1599 nmdc:mga0n895_195125_c1 3300050512 Unclassified 2056
1600 nmdc:mga0n895_37242_c1 3300050512 Bacteria 4704
1601 nmdc:mga0n895_405586_c1 3300050512 Bacteria 1378
1602 nmdc:mga0n895_419330_c1 3300050512 Bacteria 1353
1603 nmdc:mga0n895_492370_c1 3300050512 Unclassified 1236
1604 nmdc:mga0n895_495086_c1 3300050512 Unclassified 1232
1605 nmdc:mga0n895_555757_c1 3300050512 Unclassified 1153
1606 nmdc:mga0n895_880691_c1 3300050512 Bacteria 882
1607 nmdc:mga0rr50_1060741_c1 3300050513 Unclassified 690
1608 nmdc:mga0rr50_2739_c1 3300050513 Bacteria 10002
1609 nmdc:mga0rr50_399010_c1 3300050513 Bacteria 1161
1610 nmdc:mga0rr50_489730_c1 3300050513 Bacteria 1045
1611 nmdc:mga08x19_478595_c1 3300050514 Unclassified 878
1612 nmdc:mga08x19_8_c1 3300050514 Bacteria 427794
1613 nmdc:mga0a205_12302_c1 3300050515 Bacteria 7916
1614 nmdc:mga0a205_14553_c1 3300050515 Bacteria 3460
1615 nmdc:mga0a205_221865_c1 3300050515 Bacteria 1775
1616 nmdc:mga0a205_238101_c1 3300050515 Unclassified 1701
1617 nmdc:mga0a205_365824_c1 3300050515 Bacteria 1308
1618 nmdc:mga0a205_43948_c1 3300050515 Bacteria 4306
1619 nmdc:mga0a205_463965_c1 3300050515 Bacteria 1126
1620 nmdc:mga0a205_74384_c1 3300050515 Bacteria 3283
1621 nmdc:mga0a205_79533_c1 3300050515 Unclassified 3168
1622 Ga0495655_0035019 3300053083 Unclassified 1246
1623 Ga0500616_0003347 3300053153 Bacteria 12331
1624 Ga0501084_0198375 3300054114 Bacteria 1693
1625 Ga0501084_1225253 3300054114 Bacteria 629
1626 Ga0501082_1431887 3300060353 Unclassified 603
1627 Ga0530510_0064895 3300061734 Unclassified 2645
1628 Ga0530510_0461276 3300061734 Bacteria 961

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005578 Ga0068854_100219770 Ga0068854_1002197703 116
2 3300005843 Ga0068860_100258999 Ga0068860_1002589993 116
3 3300005844 Ga0068862_100275660 Ga0068862_1002756602 116
4 3300037853 Ga0436364_0052710 Ga0436364_0052710_163_552 127
5 3300039437 Ga0436365_0853746 Ga0436365_0853746_352_750 127
6 3300032126 Ga0307415_100815608 Ga0307415_1008156082 128
7 3300031824 Ga0307413_11342118 Ga0307413_113421181 129
8 3300031852 Ga0307410_10653374 Ga0307410_106533742 129
9 3300031901 Ga0307406_10099313 Ga0307406_100993132 129
10 3300046537 Ga0495598_0132496 Ga0495598_0132496_303_695 129
11 3300046539 Ga0495621_0189787 Ga0495621_0189787_18_410 129
12 3300046691 Ga0495670_0161074 Ga0495670_0161074_449_841 129
13 3300050515 nmdc:mga0a205_74384_c1 nmdc:mga0a205_74384_c1_2626_3018 129
14 3300005842 Ga0068858_101856722 Ga0068858_1018567222 130
15 3300006846 Ga0075430_100057726 Ga0075430_1000577263 130
16 3300006847 Ga0075431_100036171 Ga0075431_1000361712 130
17 3300006880 Ga0075429_100190943 Ga0075429_1001909432 130
18 3300009147 Ga0114129_11061044 Ga0114129_110610441 130
19 3300009147 Ga0114129_11897259 Ga0114129_118972592 130
20 3300035089 Ga0373944_0249818 Ga0373944_0249818_240_638 130
21 3300035116 Ga0373945_0018013 Ga0373945_0018013_762_1160 130
22 3300035725 Ga0373947_0216322 Ga0373947_0216322_649_1047 130
23 3300042876 Ga0451577_0634788 Ga0451577_0634788_388_780 130
24 3300047321 Ga0495676_0249858 Ga0495676_0249858_137_535 130
25 3300049588 Ga0501072_0013245 Ga0501072_0013245_5031_5426 130
26 3300050507 nmdc:mga05p37_1087927_c1 nmdc:mga05p37_1087927_c1_412_807 130
27 3300050507 nmdc:mga05p37_1347502_c1 nmdc:mga05p37_1347502_c1_100_495 130
28 3300050510 nmdc:mga06r32_30069_c1 nmdc:mga06r32_30069_c1_551_946 130
29 3300060353 Ga0501082_1431887 Ga0501082_1431887_86_481 130
30 3300005290 Ga0065712_10086766 Ga0065712_100867662 131
31 3300005290 Ga0065712_10291821 Ga0065712_102918213 131
32 3300005295 Ga0065707_10090374 Ga0065707_100903742 131
33 3300005328 Ga0070676_10927053 Ga0070676_109270531 131
34 3300005330 Ga0070690_100019052 Ga0070690_1000190525 131
35 3300005331 Ga0070670_100108344 Ga0070670_1001083442 131
36 3300005335 Ga0070666_10321126 Ga0070666_103211262 131
37 3300005340 Ga0070689_100128706 Ga0070689_1001287063 131
38 3300005340 Ga0070689_100207339 Ga0070689_1002073392 131
39 3300005344 Ga0070661_100125295 Ga0070661_1001252953 131
40 3300005345 Ga0070692_10035995 Ga0070692_100359953 131
41 3300005345 Ga0070692_10616145 Ga0070692_106161452 131
42 3300005347 Ga0070668_101705682 Ga0070668_1017056821 131
43 3300005353 Ga0070669_101249839 Ga0070669_1012498392 131
44 3300005355 Ga0070671_100420600 Ga0070671_1004206002 131
45 3300005367 Ga0070667_100041936 Ga0070667_1000419362 131
46 3300005367 Ga0070667_100766191 Ga0070667_1007661912 131
47 3300005441 Ga0070700_100700654 Ga0070700_1007006542 131
48 3300005444 Ga0070694_101356434 Ga0070694_1013564341 131
49 3300005457 Ga0070662_100513391 Ga0070662_1005133911 131
50 3300005457 Ga0070662_100533003 Ga0070662_1005330032 131
51 3300005458 Ga0070681_10052510 Ga0070681_100525102 131
52 3300005458 Ga0070681_10151778 Ga0070681_101517783 131
53 3300005459 Ga0068867_100466265 Ga0068867_1004662652 131
54 3300005459 Ga0068867_100851947 Ga0068867_1008519471 131
55 3300005466 Ga0070685_10045347 Ga0070685_100453472 131
56 3300005530 Ga0070679_100439166 Ga0070679_1004391661 131
57 3300005539 Ga0068853_100024190 Ga0068853_1000241905 131
58 3300005545 Ga0070695_101151643 Ga0070695_1011516431 131
59 3300005548 Ga0070665_100762654 Ga0070665_1007626542 131
60 3300005549 Ga0070704_100005305 Ga0070704_1000053053 131
61 3300005563 Ga0068855_100084940 Ga0068855_1000849403 131
62 3300005563 Ga0068855_100089239 Ga0068855_1000892392 131
63 3300005564 Ga0070664_100024581 Ga0070664_1000245813 131
64 3300005564 Ga0070664_100185668 Ga0070664_1001856683 131
65 3300005577 Ga0068857_100061721 Ga0068857_1000617213 131
66 3300005577 Ga0068857_100094458 Ga0068857_1000944583 131
67 3300005616 Ga0068852_100307712 Ga0068852_1003077122 131
68 3300005616 Ga0068852_101520112 Ga0068852_1015201122 131
69 3300005617 Ga0068859_100049769 Ga0068859_1000497693 131
70 3300005617 Ga0068859_100064599 Ga0068859_1000645992 131
71 3300005618 Ga0068864_100052709 Ga0068864_1000527092 131
72 3300005618 Ga0068864_100066956 Ga0068864_1000669563 131
73 3300005618 Ga0068864_100199446 Ga0068864_1001994462 131
74 3300005719 Ga0068861_100258359 Ga0068861_1002583592 131
75 3300005840 Ga0068870_10198154 Ga0068870_101981542 131
76 3300005841 Ga0068863_100067440 Ga0068863_1000674405 131
77 3300005841 Ga0068863_100070819 Ga0068863_1000708194 131
78 3300005842 Ga0068858_100080793 Ga0068858_1000807933 131
79 3300005843 Ga0068860_100701937 Ga0068860_1007019372 131
80 3300005844 Ga0068862_100132588 Ga0068862_1001325882 131
81 3300005844 Ga0068862_100177499 Ga0068862_1001774992 131
82 3300006163 Ga0070715_10049192 Ga0070715_100491922 131
83 3300006358 Ga0068871_100305065 Ga0068871_1003050652 131
84 3300006358 Ga0068871_101565807 Ga0068871_1015658072 131
85 3300006881 Ga0068865_100241827 Ga0068865_1002418272 131
86 3300006931 Ga0097620_100049771 Ga0097620_1000497713 131
87 3300006931 Ga0097620_100064602 Ga0097620_1000646024 131
88 3300009011 Ga0105251_10106020 Ga0105251_101060202 131
89 3300009011 Ga0105251_10608005 Ga0105251_106080051 131
90 3300009101 Ga0105247_10040976 Ga0105247_100409763 131
91 3300009148 Ga0105243_10023958 Ga0105243_100239582 131
92 3300009176 Ga0105242_10041256 Ga0105242_100412562 131
93 3300009177 Ga0105248_11303493 Ga0105248_113034932 131
94 3300009177 Ga0105248_11686499 Ga0105248_116864992 131
95 3300009545 Ga0105237_10553029 Ga0105237_105530292 131
96 3300009545 Ga0105237_11773947 Ga0105237_117739472 131
97 3300009553 Ga0105249_10083968 Ga0105249_100839683 131
98 3300009553 Ga0105249_10339470 Ga0105249_103394702 131
99 3300009553 Ga0105249_11025453 Ga0105249_110254531 131
100 3300009553 Ga0105249_13389259 Ga0105249_133892591 131
101 3300010375 Ga0105239_10177349 Ga0105239_101773493 131
102 3300010375 Ga0105239_10632721 Ga0105239_106327212 131
103 3300013100 Ga0157373_10060039 Ga0157373_100600392 131
104 3300013104 Ga0157370_10273617 Ga0157370_102736173 131
105 3300013105 Ga0157369_10069065 Ga0157369_100690653 131
106 3300013296 Ga0157374_10384509 Ga0157374_103845092 131
107 3300013306 Ga0163162_10577558 Ga0163162_105775582 131
108 3300013306 Ga0163162_10782613 Ga0163162_107826132 131
109 3300013307 Ga0157372_10125075 Ga0157372_101250752 131
110 3300013308 Ga0157375_10084091 Ga0157375_100840912 131
111 3300013308 Ga0157375_13215970 Ga0157375_132159702 131
112 3300014325 Ga0163163_10035157 Ga0163163_100351572 131
113 3300014325 Ga0163163_10569651 Ga0163163_105696512 131
114 3300014326 Ga0157380_10286491 Ga0157380_102864912 131
115 3300014968 Ga0157379_10028452 Ga0157379_100284526 131
116 3300014969 Ga0157376_10424061 Ga0157376_104240612 131
117 3300025302 Ga0207426_1059415 Ga0207426_10594152 131
118 3300025899 Ga0207642_10196178 Ga0207642_101961782 131
119 3300025903 Ga0207680_10016269 Ga0207680_100162694 131
120 3300025904 Ga0207647_10679261 Ga0207647_106792612 131
121 3300025905 Ga0207685_10117816 Ga0207685_101178162 131
122 3300025907 Ga0207645_10486535 Ga0207645_104865351 131
123 3300025907 Ga0207645_10750573 Ga0207645_107505731 131
124 3300025911 Ga0207654_10465224 Ga0207654_104652242 131
125 3300025912 Ga0207707_10234963 Ga0207707_102349632 131
126 3300025918 Ga0207662_10362405 Ga0207662_103624052 131
127 3300025919 Ga0207657_10017319 Ga0207657_100173193 131
128 3300025921 Ga0207652_11365793 Ga0207652_113657932 131
129 3300025925 Ga0207650_11047378 Ga0207650_110473782 131
130 3300025932 Ga0207690_10560921 Ga0207690_105609212 131
131 3300025933 Ga0207706_10136028 Ga0207706_101360282 131
132 3300025936 Ga0207670_10330128 Ga0207670_103301282 131
133 3300025940 Ga0207691_11494913 Ga0207691_114949131 131
134 3300025942 Ga0207689_11080413 Ga0207689_110804132 131
135 3300025945 Ga0207679_10015116 Ga0207679_100151164 131
136 3300025945 Ga0207679_11143481 Ga0207679_111434811 131
137 3300025949 Ga0207667_11056177 Ga0207667_110561771 131
138 3300025961 Ga0207712_10021869 Ga0207712_100218693 131
139 3300025961 Ga0207712_10460676 Ga0207712_104606762 131
140 3300025986 Ga0207658_10278170 Ga0207658_102781702 131
141 3300025986 Ga0207658_11037280 Ga0207658_110372802 131
142 3300026041 Ga0207639_10058510 Ga0207639_100585101 131
143 3300026075 Ga0207708_10479962 Ga0207708_104799622 131
144 3300026088 Ga0207641_10047349 Ga0207641_100473494 131
145 3300026088 Ga0207641_10346734 Ga0207641_103467342 131
146 3300026089 Ga0207648_10504697 Ga0207648_105046971 131
147 3300026095 Ga0207676_10267742 Ga0207676_102677422 131
148 3300026095 Ga0207676_10283352 Ga0207676_102833522 131
149 3300026116 Ga0207674_10005492 Ga0207674_100054923 131
150 3300026116 Ga0207674_10098114 Ga0207674_100981143 131
151 3300026118 Ga0207675_100054678 Ga0207675_1000546784 131
152 3300026118 Ga0207675_100180626 Ga0207675_1001806263 131
153 3300026118 Ga0207675_102125731 Ga0207675_1021257312 131
154 3300026142 Ga0207698_10224950 Ga0207698_102249503 131
155 3300028379 Ga0268266_10633778 Ga0268266_106337782 131
156 3300028380 Ga0268265_10482646 Ga0268265_104826462 131
157 3300028381 Ga0268264_10115695 Ga0268264_101156952 131
158 3300030745 Ga0316182_1170057 Ga0316182_11700572 131
159 3300031548 Ga0307408_100013151 Ga0307408_1000131515 131
160 3300031548 Ga0307408_100108372 Ga0307408_1001083723 131
161 3300031548 Ga0307408_100527938 Ga0307408_1005279382 131
162 3300031548 Ga0307408_100677872 Ga0307408_1006778721 131
163 3300031548 Ga0307408_100751913 Ga0307408_1007519132 131
164 3300031728 Ga0316578_10217115 Ga0316578_102171152 131
165 3300031731 Ga0307405_10002498 Ga0307405_100024986 131
166 3300031731 Ga0307405_10082002 Ga0307405_100820022 131
167 3300031731 Ga0307405_10083583 Ga0307405_100835833 131
168 3300031824 Ga0307413_10013429 Ga0307413_100134294 131
169 3300031824 Ga0307413_10022279 Ga0307413_100222794 131
170 3300031824 Ga0307413_10448802 Ga0307413_104488022 131
171 3300031824 Ga0307413_11037096 Ga0307413_110370962 131
172 3300031852 Ga0307410_10011643 Ga0307410_100116433 131
173 3300031852 Ga0307410_10021711 Ga0307410_100217114 131
174 3300031852 Ga0307410_10024555 Ga0307410_100245555 131
175 3300031852 Ga0307410_11760962 Ga0307410_117609621 131
176 3300031901 Ga0307406_10009539 Ga0307406_100095393 131
177 3300031901 Ga0307406_10010591 Ga0307406_100105913 131
178 3300031901 Ga0307406_10125087 Ga0307406_101250873 131
179 3300031901 Ga0307406_11078768 Ga0307406_110787681 131
180 3300031903 Ga0307407_10001790 Ga0307407_100017902 131
181 3300031903 Ga0307407_10002617 Ga0307407_100026172 131
182 3300031903 Ga0307407_10002963 Ga0307407_100029635 131
183 3300031903 Ga0307407_10027925 Ga0307407_100279253 131
184 3300031903 Ga0307407_10180945 Ga0307407_101809453 131
185 3300031903 Ga0307407_11102278 Ga0307407_111022781 131
186 3300031911 Ga0307412_10016167 Ga0307412_100161675 131
187 3300031911 Ga0307412_10059146 Ga0307412_100591462 131
188 3300031911 Ga0307412_11444065 Ga0307412_114440651 131
189 3300031995 Ga0307409_100004384 Ga0307409_1000043845 131
190 3300031995 Ga0307409_100005772 Ga0307409_1000057724 131
191 3300031995 Ga0307409_100044037 Ga0307409_1000440371 131
192 3300031995 Ga0307409_100267052 Ga0307409_1002670522 131
193 3300031995 Ga0307409_101649251 Ga0307409_1016492512 131
194 3300031995 Ga0307409_102442398 Ga0307409_1024423981 131
195 3300032002 Ga0307416_100002928 Ga0307416_1000029285 131
196 3300032002 Ga0307416_100034895 Ga0307416_1000348953 131
197 3300032002 Ga0307416_100094888 Ga0307416_1000948884 131
198 3300032002 Ga0307416_100166043 Ga0307416_1001660432 131
199 3300032002 Ga0307416_101499439 Ga0307416_1014994392 131
200 3300032002 Ga0307416_102667895 Ga0307416_1026678951 131
201 3300032002 Ga0307416_103043780 Ga0307416_1030437801 131
202 3300032004 Ga0307414_10005886 Ga0307414_100058863 131
203 3300032004 Ga0307414_10417160 Ga0307414_104171602 131
204 3300032005 Ga0307411_10003466 Ga0307411_100034662 131
205 3300032005 Ga0307411_10004402 Ga0307411_100044025 131
206 3300032005 Ga0307411_10033681 Ga0307411_100336813 131
207 3300032005 Ga0307411_11117957 Ga0307411_111179571 131
208 3300032126 Ga0307415_100018684 Ga0307415_1000186843 131
209 3300032126 Ga0307415_100024571 Ga0307415_1000245713 131
210 3300032126 Ga0307415_100126833 Ga0307415_1001268332 131
211 3300032126 Ga0307415_100329357 Ga0307415_1003293572 131
212 3300032126 Ga0307415_100684778 Ga0307415_1006847782 131
213 3300032126 Ga0307415_100904298 Ga0307415_1009042982 131
214 3300032126 Ga0307415_101142668 Ga0307415_1011426682 131
215 3300036712 Ga0316584_0038601 Ga0316584_0038601_2587_2991 131
216 3300041405 Ga0439438_148105 Ga0439438_148105_13_435 131
217 3300041451 Ga0451791_0088673 Ga0451791_0088673_665_1063 131
218 3300042006 Ga0439432_080508 Ga0439432_080508_513_935 131
219 3300046537 Ga0495598_0015751 Ga0495598_0015751_1276_1677 131
220 3300046616 Ga0495668_0000763 Ga0495668_0000763_6357_6755 131
221 3300048917 Ga0496114_0278718 Ga0496114_0278718_433_831 131
222 3300049686 Ga0501257_012421 Ga0501257_012421_1246_1644 131
223 3300049704 Ga0501221_193391 Ga0501221_193391_140_538 131
224 3300049765 Ga0501268_004605 Ga0501268_004605_88_486 131
225 3300037471 Ga0395905_0104247 Ga0395905_0104247_1550_1954 132
226 3300037471 Ga0395905_1782063 Ga0395905_1782063_45_449 132
227 3300005295 Ga0065707_10353321 Ga0065707_103533212 133
228 3300005340 Ga0070689_100850828 Ga0070689_1008508282 133
229 3300005341 Ga0070691_10778061 Ga0070691_107780611 133
230 3300005353 Ga0070669_100584128 Ga0070669_1005841281 133
231 3300005354 Ga0070675_100443849 Ga0070675_1004438491 133
232 3300005440 Ga0070705_100078377 Ga0070705_1000783772 133
233 3300005441 Ga0070700_100292964 Ga0070700_1002929642 133
234 3300005467 Ga0070706_101062101 Ga0070706_1010621012 133
235 3300005468 Ga0070707_100000089 Ga0070707_1000000892 133
236 3300005545 Ga0070695_101681928 Ga0070695_1016819281 133
237 3300005549 Ga0070704_100944805 Ga0070704_1009448052 133
238 3300005618 Ga0068864_100196009 Ga0068864_1001960092 133
239 3300005844 Ga0068862_101034284 Ga0068862_1010342842 133
240 3300009148 Ga0105243_10246102 Ga0105243_102461023 133
241 3300009174 Ga0105241_10256979 Ga0105241_102569792 133
242 3300013100 Ga0157373_11025141 Ga0157373_110251412 133
243 3300013297 Ga0157378_10082677 Ga0157378_100826775 133
244 3300025893 Ga0207682_10428427 Ga0207682_104284272 133
245 3300025913 Ga0207695_10094772 Ga0207695_100947724 133
246 3300025922 Ga0207646_10000881 Ga0207646_1000088131 133
247 3300025936 Ga0207670_10488158 Ga0207670_104881582 133
248 3300026118 Ga0207675_100833396 Ga0207675_1008333962 133
249 3300028380 Ga0268265_11294018 Ga0268265_112940181 133
250 3300031235 Ga0265330_10000008 Ga0265330_1000000836 133
251 3300031238 Ga0265332_10001548 Ga0265332_100015489 133
252 3300031239 Ga0265328_10193773 Ga0265328_101937732 133
253 3300031242 Ga0265329_10007563 Ga0265329_100075633 133
254 3300031344 Ga0265316_10000036 Ga0265316_1000003639 133
255 3300031711 Ga0265314_10000005 Ga0265314_10000005517 133
256 3300031712 Ga0265342_10000041 Ga0265342_1000004152 133
257 3300039450 Ga0436363_1060242 Ga0436363_1060242_132_545 133
258 3300000532 CNAas_1002826 CNAas_10028262 134
259 3300002155 JGI24033J26618_1034113 JGI24033J26618_10341131 134
260 3300005288 Ga0065714_10064464 Ga0065714_1006446434 134
261 3300005289 Ga0065704_10002722 Ga0065704_100027226 134
262 3300005290 Ga0065712_10000137 Ga0065712_1000013734 134
263 3300005290 Ga0065712_10102026 Ga0065712_101020262 134
264 3300005290 Ga0065712_10326215 Ga0065712_103262152 134
265 3300005293 Ga0065715_10009897 Ga0065715_100098972 134
266 3300005293 Ga0065715_10089567 Ga0065715_100895674 134
267 3300005293 Ga0065715_10131618 Ga0065715_101316183 134
268 3300005328 Ga0070676_10617103 Ga0070676_106171031 134
269 3300005331 Ga0070670_100067882 Ga0070670_1000678822 134
270 3300005331 Ga0070670_100190801 Ga0070670_1001908013 134
271 3300005331 Ga0070670_100360745 Ga0070670_1003607452 134
272 3300005331 Ga0070670_101076201 Ga0070670_1010762011 134
273 3300005334 Ga0068869_100101279 Ga0068869_1001012792 134
274 3300005334 Ga0068869_101248534 Ga0068869_1012485341 134
275 3300005337 Ga0070682_100010806 Ga0070682_1000108062 134
276 3300005340 Ga0070689_100000879 Ga0070689_10000087918 134
277 3300005340 Ga0070689_101409218 Ga0070689_1014092181 134
278 3300005343 Ga0070687_100108348 Ga0070687_1001083482 134
279 3300005343 Ga0070687_100254795 Ga0070687_1002547952 134
280 3300005345 Ga0070692_10053670 Ga0070692_100536702 134
281 3300005345 Ga0070692_10371822 Ga0070692_103718222 134
282 3300005345 Ga0070692_11299475 Ga0070692_112994751 134
283 3300005353 Ga0070669_100481952 Ga0070669_1004819521 134
284 3300005354 Ga0070675_102100987 Ga0070675_1021009871 134
285 3300005355 Ga0070671_101834561 Ga0070671_1018345611 134
286 3300005364 Ga0070673_100179690 Ga0070673_1001796901 134
287 3300005364 Ga0070673_100594706 Ga0070673_1005947062 134
288 3300005364 Ga0070673_100798828 Ga0070673_1007988281 134
289 3300005365 Ga0070688_100315028 Ga0070688_1003150282 134
290 3300005406 Ga0070703_10000023 Ga0070703_1000002357 134
291 3300005438 Ga0070701_10073100 Ga0070701_100731002 134
292 3300005439 Ga0070711_100535538 Ga0070711_1005355381 134
293 3300005440 Ga0070705_100082159 Ga0070705_1000821592 134
294 3300005440 Ga0070705_100213748 Ga0070705_1002137482 134
295 3300005440 Ga0070705_100778834 Ga0070705_1007788341 134
296 3300005441 Ga0070700_100000283 Ga0070700_10000028311 134
297 3300005441 Ga0070700_100457361 Ga0070700_1004573612 134
298 3300005444 Ga0070694_100013102 Ga0070694_1000131025 134
299 3300005444 Ga0070694_100024884 Ga0070694_1000248844 134
300 3300005444 Ga0070694_100085213 Ga0070694_1000852132 134
301 3300005444 Ga0070694_100264011 Ga0070694_1002640112 134
302 3300005444 Ga0070694_100605032 Ga0070694_1006050321 134
303 3300005444 Ga0070694_100776536 Ga0070694_1007765362 134
304 3300005456 Ga0070678_100058565 Ga0070678_1000585653 134
305 3300005457 Ga0070662_100242846 Ga0070662_1002428462 134
306 3300005457 Ga0070662_100654995 Ga0070662_1006549951 134
307 3300005459 Ga0068867_100368887 Ga0068867_1003688872 134
308 3300005459 Ga0068867_101622559 Ga0068867_1016225591 134
309 3300005467 Ga0070706_100000216 Ga0070706_10000021613 134
310 3300005467 Ga0070706_100064280 Ga0070706_1000642802 134
311 3300005468 Ga0070707_100008263 Ga0070707_1000082634 134
312 3300005471 Ga0070698_100000726 Ga0070698_10000072626 134
313 3300005471 Ga0070698_100012469 Ga0070698_1000124692 134
314 3300005471 Ga0070698_100029158 Ga0070698_1000291584 134
315 3300005518 Ga0070699_100047606 Ga0070699_1000476062 134
316 3300005530 Ga0070679_100189052 Ga0070679_1001890523 134
317 3300005539 Ga0068853_100135736 Ga0068853_1001357362 134
318 3300005544 Ga0070686_100078008 Ga0070686_1000780082 134
319 3300005544 Ga0070686_100341778 Ga0070686_1003417782 134
320 3300005544 Ga0070686_100632033 Ga0070686_1006320332 134
321 3300005545 Ga0070695_100190544 Ga0070695_1001905442 134
322 3300005545 Ga0070695_100266213 Ga0070695_1002662132 134
323 3300005545 Ga0070695_100285395 Ga0070695_1002853952 134
324 3300005545 Ga0070695_100808204 Ga0070695_1008082041 134
325 3300005546 Ga0070696_100040645 Ga0070696_1000406452 134
326 3300005547 Ga0070693_100076283 Ga0070693_1000762833 134
327 3300005547 Ga0070693_100109161 Ga0070693_1001091612 134
328 3300005547 Ga0070693_101593887 Ga0070693_1015938871 134
329 3300005549 Ga0070704_100007677 Ga0070704_1000076775 134
330 3300005549 Ga0070704_100058158 Ga0070704_1000581583 134
331 3300005549 Ga0070704_100733123 Ga0070704_1007331232 134
332 3300005563 Ga0068855_101359853 Ga0068855_1013598532 134
333 3300005564 Ga0070664_100289077 Ga0070664_1002890772 134
334 3300005577 Ga0068857_100073556 Ga0068857_1000735562 134
335 3300005577 Ga0068857_100284138 Ga0068857_1002841383 134
336 3300005577 Ga0068857_101327450 Ga0068857_1013274502 134
337 3300005578 Ga0068854_100059261 Ga0068854_1000592612 134
338 3300005578 Ga0068854_100153468 Ga0068854_1001534682 134
339 3300005578 Ga0068854_101594027 Ga0068854_1015940272 134
340 3300005615 Ga0070702_100022621 Ga0070702_1000226212 134
341 3300005615 Ga0070702_100090190 Ga0070702_1000901903 134
342 3300005615 Ga0070702_100864437 Ga0070702_1008644371 134
343 3300005616 Ga0068852_100238145 Ga0068852_1002381452 134
344 3300005617 Ga0068859_100027831 Ga0068859_1000278315 134
345 3300005617 Ga0068859_100055057 Ga0068859_1000550575 134
346 3300005617 Ga0068859_100158410 Ga0068859_1001584102 134
347 3300005617 Ga0068859_100208076 Ga0068859_1002080762 134
348 3300005617 Ga0068859_100401466 Ga0068859_1004014662 134
349 3300005617 Ga0068859_100550156 Ga0068859_1005501562 134
350 3300005617 Ga0068859_100794096 Ga0068859_1007940962 134
351 3300005618 Ga0068864_100002023 Ga0068864_10000202318 134
352 3300005618 Ga0068864_100015136 Ga0068864_1000151365 134
353 3300005618 Ga0068864_100023777 Ga0068864_1000237776 134
354 3300005618 Ga0068864_100144154 Ga0068864_1001441542 134
355 3300005618 Ga0068864_100347374 Ga0068864_1003473742 134
356 3300005618 Ga0068864_100476948 Ga0068864_1004769482 134
357 3300005618 Ga0068864_101041240 Ga0068864_1010412402 134
358 3300005718 Ga0068866_10010211 Ga0068866_100102112 134
359 3300005719 Ga0068861_100001677 Ga0068861_1000016777 134
360 3300005719 Ga0068861_100203541 Ga0068861_1002035412 134
361 3300005719 Ga0068861_101859983 Ga0068861_1018599832 134
362 3300005840 Ga0068870_10213231 Ga0068870_102132312 134
363 3300005840 Ga0068870_11228008 Ga0068870_112280081 134
364 3300005841 Ga0068863_100047054 Ga0068863_1000470544 134
365 3300005841 Ga0068863_100052378 Ga0068863_1000523785 134
366 3300005841 Ga0068863_100437398 Ga0068863_1004373982 134
367 3300005841 Ga0068863_102520999 Ga0068863_1025209991 134
368 3300005842 Ga0068858_100040942 Ga0068858_1000409425 134
369 3300005842 Ga0068858_100082175 Ga0068858_1000821752 134
370 3300005842 Ga0068858_100253660 Ga0068858_1002536602 134
371 3300005842 Ga0068858_101650749 Ga0068858_1016507491 134
372 3300005843 Ga0068860_100210430 Ga0068860_1002104303 134
373 3300005843 Ga0068860_100362189 Ga0068860_1003621892 134
374 3300005843 Ga0068860_100380894 Ga0068860_1003808942 134
375 3300005843 Ga0068860_101460811 Ga0068860_1014608112 134
376 3300005844 Ga0068862_100109541 Ga0068862_1001095412 134
377 3300005844 Ga0068862_100311644 Ga0068862_1003116442 134
378 3300005844 Ga0068862_100551449 Ga0068862_1005514492 134
379 3300005985 Ga0081539_10191901 Ga0081539_101919012 134
380 3300006058 Ga0075432_10155641 Ga0075432_101556412 134
381 3300006058 Ga0075432_10453810 Ga0075432_104538101 134
382 3300006237 Ga0097621_100019059 Ga0097621_1000190594 134
383 3300006358 Ga0068871_100004690 Ga0068871_1000046901 134
384 3300006844 Ga0075428_100307491 Ga0075428_1003074912 134
385 3300006844 Ga0075428_100780756 Ga0075428_1007807562 134
386 3300006844 Ga0075428_101532060 Ga0075428_1015320602 134
387 3300006847 Ga0075431_100153902 Ga0075431_1001539024 134
388 3300006852 Ga0075433_10003403 Ga0075433_1000340310 134
389 3300006852 Ga0075433_10097198 Ga0075433_100971982 134
390 3300006871 Ga0075434_100157875 Ga0075434_1001578753 134
391 3300006871 Ga0075434_100243903 Ga0075434_1002439032 134
392 3300006871 Ga0075434_100256137 Ga0075434_1002561372 134
393 3300006871 Ga0075434_100608748 Ga0075434_1006087482 134
394 3300006871 Ga0075434_100794545 Ga0075434_1007945452 134
395 3300006871 Ga0075434_101037509 Ga0075434_1010375092 134
396 3300006880 Ga0075429_100107769 Ga0075429_1001077693 134
397 3300006880 Ga0075429_100393288 Ga0075429_1003932882 134
398 3300006881 Ga0068865_100496698 Ga0068865_1004966982 134
399 3300006881 Ga0068865_101656952 Ga0068865_1016569522 134
400 3300006914 Ga0075436_100000221 Ga0075436_1000002216 134
401 3300006931 Ga0097620_100027833 Ga0097620_1000278333 134
402 3300006931 Ga0097620_100055060 Ga0097620_1000550602 134
403 3300006931 Ga0097620_100158409 Ga0097620_1001584092 134
404 3300006931 Ga0097620_100208056 Ga0097620_1002080562 134
405 3300006931 Ga0097620_100401459 Ga0097620_1004014592 134
406 3300006931 Ga0097620_100550170 Ga0097620_1005501702 134
407 3300006931 Ga0097620_100794080 Ga0097620_1007940802 134
408 3300007076 Ga0075435_100000617 Ga0075435_10000061713 134
409 3300007076 Ga0075435_100056168 Ga0075435_1000561683 134
410 3300007076 Ga0075435_100377364 Ga0075435_1003773642 134
411 3300007265 Ga0099794_10220568 Ga0099794_102205682 134
412 3300009011 Ga0105251_10022239 Ga0105251_100222392 134
413 3300009011 Ga0105251_10466683 Ga0105251_104666832 134
414 3300009093 Ga0105240_11206653 Ga0105240_112066532 134
415 3300009094 Ga0111539_10051056 Ga0111539_100510565 134
416 3300009094 Ga0111539_10074737 Ga0111539_100747374 134
417 3300009094 Ga0111539_10582865 Ga0111539_105828653 134
418 3300009094 Ga0111539_10763459 Ga0111539_107634591 134
419 3300009094 Ga0111539_12750094 Ga0111539_127500941 134
420 3300009098 Ga0105245_10506146 Ga0105245_105061462 134
421 3300009098 Ga0105245_10716774 Ga0105245_107167742 134
422 3300009098 Ga0105245_10817948 Ga0105245_108179482 134
423 3300009098 Ga0105245_11453208 Ga0105245_114532082 134
424 3300009098 Ga0105245_11878144 Ga0105245_118781442 134
425 3300009098 Ga0105245_12520163 Ga0105245_125201632 134
426 3300009098 Ga0105245_12925073 Ga0105245_129250731 134
427 3300009101 Ga0105247_10537875 Ga0105247_105378752 134
428 3300009147 Ga0114129_10120523 Ga0114129_101205232 134
429 3300009147 Ga0114129_10263707 Ga0114129_102637073 134
430 3300009147 Ga0114129_10741120 Ga0114129_107411202 134
431 3300009147 Ga0114129_11107356 Ga0114129_111073562 134
432 3300009147 Ga0114129_12694416 Ga0114129_126944162 134
433 3300009148 Ga0105243_10651726 Ga0105243_106517262 134
434 3300009148 Ga0105243_10684526 Ga0105243_106845262 134
435 3300009148 Ga0105243_10722954 Ga0105243_107229541 134
436 3300009174 Ga0105241_10298522 Ga0105241_102985222 134
437 3300009174 Ga0105241_10326983 Ga0105241_103269832 134
438 3300009174 Ga0105241_11148105 Ga0105241_111481052 134
439 3300009176 Ga0105242_10001862 Ga0105242_100018622 134
440 3300009177 Ga0105248_10000847 Ga0105248_100008475 134
441 3300009177 Ga0105248_10143753 Ga0105248_101437532 134
442 3300009177 Ga0105248_10520509 Ga0105248_105205093 134
443 3300009177 Ga0105248_10889666 Ga0105248_108896662 134
444 3300009177 Ga0105248_11471836 Ga0105248_114718362 134
445 3300009177 Ga0105248_13224757 Ga0105248_132247571 134
446 3300009551 Ga0105238_10178866 Ga0105238_101788663 134
447 3300009553 Ga0105249_10134389 Ga0105249_101343892 134
448 3300009553 Ga0105249_10975020 Ga0105249_109750202 134
449 3300010375 Ga0105239_10511034 Ga0105239_105110342 134
450 3300010375 Ga0105239_11215848 Ga0105239_112158482 134
451 3300011119 Ga0105246_10012887 Ga0105246_100128872 134
452 3300013100 Ga0157373_10033504 Ga0157373_100335042 134
453 3300013297 Ga0157378_10011628 Ga0157378_100116287 134
454 3300013297 Ga0157378_10034858 Ga0157378_100348583 134
455 3300013297 Ga0157378_10294002 Ga0157378_102940023 134
456 3300013297 Ga0157378_10381171 Ga0157378_103811712 134
457 3300013306 Ga0163162_10115445 Ga0163162_101154453 134
458 3300013306 Ga0163162_10627717 Ga0163162_106277172 134
459 3300013306 Ga0163162_11162159 Ga0163162_111621592 134
460 3300013306 Ga0163162_11168197 Ga0163162_111681972 134
461 3300013307 Ga0157372_10508200 Ga0157372_105082002 134
462 3300013307 Ga0157372_11539971 Ga0157372_115399712 134
463 3300013308 Ga0157375_10029676 Ga0157375_100296765 134
464 3300013308 Ga0157375_10239526 Ga0157375_102395262 134
465 3300013308 Ga0157375_10285397 Ga0157375_102853972 134
466 3300013308 Ga0157375_10550094 Ga0157375_105500943 134
467 3300013308 Ga0157375_12828153 Ga0157375_128281531 134
468 3300014325 Ga0163163_10033109 Ga0163163_100331095 134
469 3300014325 Ga0163163_10301310 Ga0163163_103013102 134
470 3300014325 Ga0163163_10747806 Ga0163163_107478062 134
471 3300014326 Ga0157380_10263300 Ga0157380_102633003 134
472 3300014326 Ga0157380_10302658 Ga0157380_103026582 134
473 3300014745 Ga0157377_10475765 Ga0157377_104757652 134
474 3300014968 Ga0157379_10076651 Ga0157379_100766512 134
475 3300025885 Ga0207653_10000223 Ga0207653_1000022327 134
476 3300025900 Ga0207710_10124238 Ga0207710_101242382 134
477 3300025900 Ga0207710_10372502 Ga0207710_103725022 134
478 3300025904 Ga0207647_10002354 Ga0207647_1000235411 134
479 3300025907 Ga0207645_10259072 Ga0207645_102590722 134
480 3300025908 Ga0207643_10002043 Ga0207643_100020436 134
481 3300025908 Ga0207643_10379202 Ga0207643_103792022 134
482 3300025910 Ga0207684_10000117 Ga0207684_10000117108 134
483 3300025910 Ga0207684_10310675 Ga0207684_103106752 134
484 3300025911 Ga0207654_10120032 Ga0207654_101200322 134
485 3300025916 Ga0207663_10411645 Ga0207663_104116452 134
486 3300025918 Ga0207662_10007754 Ga0207662_100077543 134
487 3300025918 Ga0207662_10275399 Ga0207662_102753992 134
488 3300025921 Ga0207652_10026321 Ga0207652_100263214 134
489 3300025922 Ga0207646_10008993 Ga0207646_100089938 134
490 3300025922 Ga0207646_10080950 Ga0207646_100809503 134
491 3300025922 Ga0207646_10281154 Ga0207646_102811543 134
492 3300025923 Ga0207681_10570181 Ga0207681_105701812 134
493 3300025925 Ga0207650_10160327 Ga0207650_101603273 134
494 3300025925 Ga0207650_10250046 Ga0207650_102500462 134
495 3300025925 Ga0207650_10291008 Ga0207650_102910082 134
496 3300025925 Ga0207650_11459308 Ga0207650_114593082 134
497 3300025926 Ga0207659_10886410 Ga0207659_108864102 134
498 3300025933 Ga0207706_10102864 Ga0207706_101028642 134
499 3300025934 Ga0207686_10000699 Ga0207686_1000069915 134
500 3300025934 Ga0207686_10513715 Ga0207686_105137152 134
501 3300025935 Ga0207709_10067649 Ga0207709_100676492 134
502 3300025935 Ga0207709_10342434 Ga0207709_103424342 134
503 3300025936 Ga0207670_10034449 Ga0207670_100344493 134
504 3300025936 Ga0207670_10222567 Ga0207670_102225672 134
505 3300025938 Ga0207704_10276269 Ga0207704_102762692 134
506 3300025940 Ga0207691_10471936 Ga0207691_104719362 134
507 3300025941 Ga0207711_10004200 Ga0207711_100042005 134
508 3300025941 Ga0207711_10412271 Ga0207711_104122711 134
509 3300025942 Ga0207689_10154307 Ga0207689_101543072 134
510 3300025945 Ga0207679_10674006 Ga0207679_106740062 134
511 3300025949 Ga0207667_10632776 Ga0207667_106327762 134
512 3300025960 Ga0207651_10284679 Ga0207651_102846792 134
513 3300025960 Ga0207651_10656121 Ga0207651_106561212 134
514 3300025960 Ga0207651_11349822 Ga0207651_113498222 134
515 3300025961 Ga0207712_10672605 Ga0207712_106726052 134
516 3300025981 Ga0207640_10094569 Ga0207640_100945693 134
517 3300025981 Ga0207640_10512755 Ga0207640_105127552 134
518 3300025981 Ga0207640_10611950 Ga0207640_106119502 134
519 3300026023 Ga0207677_10679201 Ga0207677_106792012 134
520 3300026035 Ga0207703_10022630 Ga0207703_100226303 134
521 3300026035 Ga0207703_10159273 Ga0207703_101592732 134
522 3300026035 Ga0207703_10339362 Ga0207703_103393622 134
523 3300026041 Ga0207639_10714846 Ga0207639_107148462 134
524 3300026041 Ga0207639_11683657 Ga0207639_116836572 134
525 3300026075 Ga0207708_10000057 Ga0207708_1000005767 134
526 3300026075 Ga0207708_10013962 Ga0207708_100139625 134
527 3300026075 Ga0207708_10376105 Ga0207708_103761052 134
528 3300026075 Ga0207708_10376153 Ga0207708_103761532 134
529 3300026088 Ga0207641_10028892 Ga0207641_100288923 134
530 3300026088 Ga0207641_10555953 Ga0207641_105559532 134
531 3300026088 Ga0207641_10793581 Ga0207641_107935812 134
532 3300026089 Ga0207648_10031731 Ga0207648_100317312 134
533 3300026089 Ga0207648_10644535 Ga0207648_106445352 134
534 3300026089 Ga0207648_11652340 Ga0207648_116523402 134
535 3300026095 Ga0207676_10006550 Ga0207676_100065502 134
536 3300026095 Ga0207676_10136324 Ga0207676_101363242 134
537 3300026095 Ga0207676_10700998 Ga0207676_107009982 134
538 3300026095 Ga0207676_10751691 Ga0207676_107516912 134
539 3300026116 Ga0207674_10040934 Ga0207674_100409346 134
540 3300026116 Ga0207674_10229536 Ga0207674_102295363 134
541 3300026116 Ga0207674_10294053 Ga0207674_102940532 134
542 3300026118 Ga0207675_100004788 Ga0207675_1000047886 134
543 3300026118 Ga0207675_100090585 Ga0207675_1000905854 134
544 3300026118 Ga0207675_100955628 Ga0207675_1009556281 134
545 3300026121 Ga0207683_10072785 Ga0207683_100727852 134
546 3300026142 Ga0207698_10784277 Ga0207698_107842772 134
547 3300026142 Ga0207698_11537732 Ga0207698_115377321 134
548 3300027907 Ga0207428_10002259 Ga0207428_1000225922 134
549 3300027907 Ga0207428_10310012 Ga0207428_103100121 134
550 3300028380 Ga0268265_10635867 Ga0268265_106358672 134
551 3300028380 Ga0268265_12120003 Ga0268265_121200032 134
552 3300028381 Ga0268264_10162047 Ga0268264_101620472 134
553 3300028381 Ga0268264_10199061 Ga0268264_101990612 134
554 3300028381 Ga0268264_10323978 Ga0268264_103239783 134
555 3300028381 Ga0268264_11451070 Ga0268264_114510702 134
556 3300030745 Ga0316182_1272275 Ga0316182_12722752 134
557 3300031548 Ga0307408_100113058 Ga0307408_1001130582 134
558 3300031548 Ga0307408_100449739 Ga0307408_1004497392 134
559 3300031731 Ga0307405_10025566 Ga0307405_100255663 134
560 3300031731 Ga0307405_10448812 Ga0307405_104488122 134
561 3300031852 Ga0307410_10027890 Ga0307410_100278903 134
562 3300031852 Ga0307410_10406158 Ga0307410_104061582 134
563 3300031901 Ga0307406_10001954 Ga0307406_100019547 134
564 3300031903 Ga0307407_10012504 Ga0307407_100125044 134
565 3300031911 Ga0307412_10006810 Ga0307412_100068107 134
566 3300031995 Ga0307409_100560526 Ga0307409_1005605262 134
567 3300032002 Ga0307416_100005888 Ga0307416_1000058884 134
568 3300032002 Ga0307416_101289678 Ga0307416_1012896782 134
569 3300032004 Ga0307414_10025721 Ga0307414_100257213 134
570 3300032005 Ga0307411_10015041 Ga0307411_100150413 134
571 3300032126 Ga0307415_100081720 Ga0307415_1000817203 134
572 3300034820 Ga0373959_0010730 Ga0373959_0010730_483_887 134
573 3300035090 Ga0373949_0070326 Ga0373949_0070326_387_791 134
574 3300035091 Ga0373951_0009844 Ga0373951_0009844_114_518 134
575 3300035112 Ga0373932_0375940 Ga0373932_0375940_104_508 134
576 3300035115 Ga0373941_0016919 Ga0373941_0016919_672_1076 134
577 3300035691 Ga0373931_0457764 Ga0373931_0457764_32_436 134
578 3300037312 Ga0395899_0475136 Ga0395899_0475136_99_503 134
579 3300037312 Ga0395899_0541715 Ga0395899_0541715_164_568 134
580 3300037418 Ga0395900_0262248 Ga0395900_0262248_1168_1572 134
581 3300037418 Ga0395900_0307090 Ga0395900_0307090_964_1368 134
582 3300037418 Ga0395900_1205205 Ga0395900_1205205_125_529 134
583 3300037466 Ga0395898_0123956 Ga0395898_0123956_1208_1612 134
584 3300037466 Ga0395898_0262813 Ga0395898_0262813_1168_1572 134
585 3300038443 Ga0395901_0698619 Ga0395901_0698619_100_504 134
586 3300042012 Ga0439455_0067373 Ga0439455_0067373_402_806 134
587 3300042438 Ga0439459_0114716 Ga0439459_0114716_24_428 134
588 3300042876 Ga0451577_0973060 Ga0451577_0973060_115_519 134
589 3300045051 Ga0451576_0237928 Ga0451576_0237928_882_1286 134
590 3300045051 Ga0451576_0511139 Ga0451576_0511139_287_694 134
591 3300045051 Ga0451576_0585032 Ga0451576_0585032_242_649 134
592 3300046517 Ga0495630_0297608 Ga0495630_0297608_788_1195 134
593 3300046537 Ga0495598_0040555 Ga0495598_0040555_251_661 134
594 3300046537 Ga0495598_0197665 Ga0495598_0197665_54_461 134
595 3300047471 Ga0495684_0188535 Ga0495684_0188535_204_611 134
596 3300048905 Ga0496102_1394200 Ga0496102_1394200_193_597 134
597 3300048909 Ga0496106_0052945 Ga0496106_0052945_631_1035 134
598 3300048910 Ga0496107_0039353 Ga0496107_0039353_2965_3369 134
599 3300048910 Ga0496107_0236126 Ga0496107_0236126_439_843 134
600 3300048912 Ga0496109_1305334 Ga0496109_1305334_44_448 134
601 3300048915 Ga0496112_0384257 Ga0496112_0384257_744_1148 134
602 3300048916 Ga0496113_0529025 Ga0496113_0529025_224_628 134
603 3300048916 Ga0496113_1253304 Ga0496113_1253304_125_529 134
604 3300049514 Ga0501291_040870 Ga0501291_040870_22_426 134
605 3300049522 Ga0501299_219920 Ga0501299_219920_92_496 134
606 3300049576 Ga0501040_0169611 Ga0501040_0169611_844_1248 134
607 3300049582 Ga0501048_0437598 Ga0501048_0437598_471_875 134
608 3300049582 Ga0501048_0466942 Ga0501048_0466942_361_765 134
609 3300049591 Ga0501075_0509111 Ga0501075_0509111_407_811 134
610 3300049592 Ga0501076_0671624 Ga0501076_0671624_350_754 134
611 3300049649 Ga0501198_004697 Ga0501198_004697_335_739 134
612 3300049652 Ga0501202_000446 Ga0501202_000446_5427_5831 134
613 3300049654 Ga0501207_003306 Ga0501207_003306_1264_1668 134
614 3300049661 Ga0501217_001051 Ga0501217_001051_412_816 134
615 3300049662 Ga0501222_063498 Ga0501222_063498_82_486 134
616 3300049663 Ga0501223_000840 Ga0501223_000840_6166_6570 134
617 3300049664 Ga0501224_000336 Ga0501224_000336_4212_4616 134
618 3300049665 Ga0501227_000955 Ga0501227_000955_180_584 134
619 3300049665 Ga0501227_050778 Ga0501227_050778_614_1018 134
620 3300049668 Ga0501233_000613 Ga0501233_000613_427_831 134
621 3300049669 Ga0501235_001735 Ga0501235_001735_4204_4608 134
622 3300049669 Ga0501235_087129 Ga0501235_087129_130_534 134
623 3300049675 Ga0501243_039467 Ga0501243_039467_249_653 134
624 3300049680 Ga0501250_006241 Ga0501250_006241_34_438 134
625 3300049683 Ga0501253_011602 Ga0501253_011602_220_624 134
626 3300049686 Ga0501257_202198 Ga0501257_202198_84_488 134
627 3300049688 Ga0501259_006501 Ga0501259_006501_1432_1836 134
628 3300049705 Ga0501225_0000929 Ga0501225_0000929_3170_3574 134
629 3300049764 Ga0501267_009405 Ga0501267_009405_548_952 134
630 3300049770 Ga0501273_013377 Ga0501273_013377_572_976 134
631 3300049850 Ga0501204_004672 Ga0501204_004672_1050_1454 134
632 3300049853 Ga0501226_000536 Ga0501226_000536_4244_4648 134
633 3300050507 nmdc:mga05p37_1749301_c1 nmdc:mga05p37_1749301_c1_68_472 134
634 3300050509 nmdc:mga0qj67_578266_c1 nmdc:mga0qj67_578266_c1_304_708 134
635 3300050510 nmdc:mga06r32_331427_c1 nmdc:mga06r32_331427_c1_202_606 134
636 3300050510 nmdc:mga06r32_351890_c1 nmdc:mga06r32_351890_c1_420_824 134
637 3300050511 nmdc:mga08y16_2220_c1 nmdc:mga08y16_2220_c1_295_699 134
638 3300050512 nmdc:mga0n895_106852_c1 nmdc:mga0n895_106852_c1_1266_1673 134
639 3300050512 nmdc:mga0n895_37242_c1 nmdc:mga0n895_37242_c1_840_1244 134
640 3300050512 nmdc:mga0n895_405586_c1 nmdc:mga0n895_405586_c1_51_455 134
641 3300050512 nmdc:mga0n895_495086_c1 nmdc:mga0n895_495086_c1_84_488 134
642 3300050512 nmdc:mga0n895_555757_c1 nmdc:mga0n895_555757_c1_427_837 134
643 3300050512 nmdc:mga0n895_880691_c1 nmdc:mga0n895_880691_c1_424_828 134
644 3300050513 nmdc:mga0rr50_2739_c1 nmdc:mga0rr50_2739_c1_4417_4827 134
645 3300050513 nmdc:mga0rr50_399010_c1 nmdc:mga0rr50_399010_c1_577_984 134
646 3300050513 nmdc:mga0rr50_489730_c1 nmdc:mga0rr50_489730_c1_602_1006 134
647 3300050514 nmdc:mga08x19_8_c1 nmdc:mga08x19_8_c1_279872_280282 134
648 3300050515 nmdc:mga0a205_12302_c1 nmdc:mga0a205_12302_c1_6326_6733 134
649 3300050515 nmdc:mga0a205_238101_c1 nmdc:mga0a205_238101_c1_541_945 134
650 3300050515 nmdc:mga0a205_43948_c1 nmdc:mga0a205_43948_c1_1719_2123 134
651 3300054114 Ga0501084_1225253 Ga0501084_1225253_113_517 134
652 3300061734 Ga0530510_0064895 Ga0530510_0064895_247_651 134
653 3300061734 Ga0530510_0461276 Ga0530510_0461276_430_834 134
654 3300002074 JGI24748J21848_1000012 JGI24748J21848_100001296 135
655 3300002239 JGI24034J26672_10000003 JGI24034J26672_10000003391 135
656 3300005289 Ga0065704_10083590 Ga0065704_100835904 135
657 3300005289 Ga0065704_10186578 Ga0065704_101865782 135
658 3300005290 Ga0065712_10484034 Ga0065712_104840342 135
659 3300005293 Ga0065715_10121355 Ga0065715_101213552 135
660 3300005293 Ga0065715_10300357 Ga0065715_103003572 135
661 3300005295 Ga0065707_10008118 Ga0065707_100081182 135
662 3300005295 Ga0065707_10488241 Ga0065707_104882411 135
663 3300005331 Ga0070670_100045921 Ga0070670_1000459214 135
664 3300005334 Ga0068869_100024570 Ga0068869_1000245702 135
665 3300005334 Ga0068869_100439247 Ga0068869_1004392472 135
666 3300005335 Ga0070666_10029776 Ga0070666_100297765 135
667 3300005338 Ga0068868_100060139 Ga0068868_1000601392 135
668 3300005340 Ga0070689_100415305 Ga0070689_1004153052 135
669 3300005340 Ga0070689_100555694 Ga0070689_1005556941 135
670 3300005340 Ga0070689_100822001 Ga0070689_1008220012 135
671 3300005341 Ga0070691_10379639 Ga0070691_103796392 135
672 3300005343 Ga0070687_100377620 Ga0070687_1003776202 135
673 3300005343 Ga0070687_100574470 Ga0070687_1005744702 135
674 3300005343 Ga0070687_100649333 Ga0070687_1006493332 135
675 3300005343 Ga0070687_100832188 Ga0070687_1008321881 135
676 3300005345 Ga0070692_10001325 Ga0070692_100013256 135
677 3300005345 Ga0070692_10069707 Ga0070692_100697072 135
678 3300005345 Ga0070692_10150055 Ga0070692_101500552 135
679 3300005345 Ga0070692_10302009 Ga0070692_103020092 135
680 3300005347 Ga0070668_100003133 Ga0070668_1000031339 135
681 3300005353 Ga0070669_100530248 Ga0070669_1005302481 135
682 3300005354 Ga0070675_100054881 Ga0070675_1000548812 135
683 3300005354 Ga0070675_100514468 Ga0070675_1005144682 135
684 3300005355 Ga0070671_100069343 Ga0070671_1000693431 135
685 3300005355 Ga0070671_100416970 Ga0070671_1004169702 135
686 3300005364 Ga0070673_100130948 Ga0070673_1001309482 135
687 3300005364 Ga0070673_100845334 Ga0070673_1008453341 135
688 3300005366 Ga0070659_100152859 Ga0070659_1001528592 135
689 3300005366 Ga0070659_100256651 Ga0070659_1002566513 135
690 3300005367 Ga0070667_100114084 Ga0070667_1001140842 135
691 3300005406 Ga0070703_10000463 Ga0070703_1000046315 135
692 3300005438 Ga0070701_10043282 Ga0070701_100432823 135
693 3300005438 Ga0070701_10189973 Ga0070701_101899732 135
694 3300005440 Ga0070705_100175411 Ga0070705_1001754112 135
695 3300005440 Ga0070705_100657795 Ga0070705_1006577951 135
696 3300005440 Ga0070705_100716154 Ga0070705_1007161542 135
697 3300005440 Ga0070705_101143830 Ga0070705_1011438301 135
698 3300005441 Ga0070700_100010688 Ga0070700_1000106884 135
699 3300005441 Ga0070700_100255231 Ga0070700_1002552312 135
700 3300005444 Ga0070694_100001642 Ga0070694_1000016421 135
701 3300005444 Ga0070694_100008998 Ga0070694_1000089985 135
702 3300005444 Ga0070694_100036763 Ga0070694_1000367634 135
703 3300005444 Ga0070694_100165074 Ga0070694_1001650742 135
704 3300005444 Ga0070694_100353136 Ga0070694_1003531362 135
705 3300005444 Ga0070694_100915435 Ga0070694_1009154351 135
706 3300005444 Ga0070694_101681422 Ga0070694_1016814221 135
707 3300005445 Ga0070708_100703015 Ga0070708_1007030152 135
708 3300005459 Ga0068867_100135260 Ga0068867_1001352602 135
709 3300005459 Ga0068867_100530217 Ga0068867_1005302171 135
710 3300005466 Ga0070685_10249853 Ga0070685_102498532 135
711 3300005467 Ga0070706_100650184 Ga0070706_1006501842 135
712 3300005468 Ga0070707_100800271 Ga0070707_1008002712 135
713 3300005471 Ga0070698_101478853 Ga0070698_1014788531 135
714 3300005518 Ga0070699_100228307 Ga0070699_1002283072 135
715 3300005535 Ga0070684_100181462 Ga0070684_1001814623 135
716 3300005536 Ga0070697_100176500 Ga0070697_1001765002 135
717 3300005543 Ga0070672_100325841 Ga0070672_1003258412 135
718 3300005544 Ga0070686_100001061 Ga0070686_1000010614 135
719 3300005544 Ga0070686_100184584 Ga0070686_1001845843 135
720 3300005545 Ga0070695_100075555 Ga0070695_1000755553 135
721 3300005545 Ga0070695_100158185 Ga0070695_1001581852 135
722 3300005545 Ga0070695_100701958 Ga0070695_1007019581 135
723 3300005547 Ga0070693_100006498 Ga0070693_1000064986 135
724 3300005549 Ga0070704_100044293 Ga0070704_1000442932 135
725 3300005549 Ga0070704_100739074 Ga0070704_1007390741 135
726 3300005549 Ga0070704_100863868 Ga0070704_1008638682 135
727 3300005564 Ga0070664_100259307 Ga0070664_1002593073 135
728 3300005577 Ga0068857_100882335 Ga0068857_1008823352 135
729 3300005578 Ga0068854_100519381 Ga0068854_1005193812 135
730 3300005615 Ga0070702_100017917 Ga0070702_1000179172 135
731 3300005615 Ga0070702_100170098 Ga0070702_1001700983 135
732 3300005615 Ga0070702_100453679 Ga0070702_1004536791 135
733 3300005615 Ga0070702_100569110 Ga0070702_1005691101 135
734 3300005615 Ga0070702_101030703 Ga0070702_1010307031 135
735 3300005616 Ga0068852_100157041 Ga0068852_1001570413 135
736 3300005616 Ga0068852_100411833 Ga0068852_1004118332 135
737 3300005617 Ga0068859_100018570 Ga0068859_1000185705 135
738 3300005617 Ga0068859_100038978 Ga0068859_1000389784 135
739 3300005617 Ga0068859_100074954 Ga0068859_1000749544 135
740 3300005617 Ga0068859_100159781 Ga0068859_1001597812 135
741 3300005617 Ga0068859_100241774 Ga0068859_1002417742 135
742 3300005617 Ga0068859_100313979 Ga0068859_1003139791 135
743 3300005617 Ga0068859_100459306 Ga0068859_1004593062 135
744 3300005617 Ga0068859_100833812 Ga0068859_1008338122 135
745 3300005617 Ga0068859_100964029 Ga0068859_1009640292 135
746 3300005617 Ga0068859_101764285 Ga0068859_1017642852 135
747 3300005618 Ga0068864_100005011 Ga0068864_1000050115 135
748 3300005618 Ga0068864_100049457 Ga0068864_1000494573 135
749 3300005618 Ga0068864_100131007 Ga0068864_1001310073 135
750 3300005618 Ga0068864_100365369 Ga0068864_1003653692 135
751 3300005618 Ga0068864_101289564 Ga0068864_1012895642 135
752 3300005718 Ga0068866_10113571 Ga0068866_101135711 135
753 3300005834 Ga0068851_10047172 Ga0068851_100471723 135
754 3300005840 Ga0068870_10018253 Ga0068870_100182533 135
755 3300005840 Ga0068870_10195313 Ga0068870_101953131 135
756 3300005840 Ga0068870_11236332 Ga0068870_112363321 135
757 3300005841 Ga0068863_100528285 Ga0068863_1005282852 135
758 3300005841 Ga0068863_100699655 Ga0068863_1006996552 135
759 3300005841 Ga0068863_100999731 Ga0068863_1009997311 135
760 3300005842 Ga0068858_100000052 Ga0068858_100000052100 135
761 3300005842 Ga0068858_100036732 Ga0068858_1000367325 135
762 3300005842 Ga0068858_100103208 Ga0068858_1001032082 135
763 3300005842 Ga0068858_100343033 Ga0068858_1003430332 135
764 3300005843 Ga0068860_100429574 Ga0068860_1004295742 135
765 3300005843 Ga0068860_100891666 Ga0068860_1008916662 135
766 3300005844 Ga0068862_100122486 Ga0068862_1001224863 135
767 3300005844 Ga0068862_100183889 Ga0068862_1001838892 135
768 3300006173 Ga0070716_100084520 Ga0070716_1000845202 135
769 3300006237 Ga0097621_100015104 Ga0097621_1000151044 135
770 3300006237 Ga0097621_102134538 Ga0097621_1021345381 135
771 3300006358 Ga0068871_100169928 Ga0068871_1001699282 135
772 3300006844 Ga0075428_100332445 Ga0075428_1003324452 135
773 3300006844 Ga0075428_100658671 Ga0075428_1006586711 135
774 3300006847 Ga0075431_100341408 Ga0075431_1003414082 135
775 3300006880 Ga0075429_100365803 Ga0075429_1003658031 135
776 3300006881 Ga0068865_100606233 Ga0068865_1006062331 135
777 3300006931 Ga0097620_100018570 Ga0097620_1000185705 135
778 3300006931 Ga0097620_100038979 Ga0097620_1000389794 135
779 3300006931 Ga0097620_100074953 Ga0097620_1000749534 135
780 3300006931 Ga0097620_100159777 Ga0097620_1001597772 135
781 3300006931 Ga0097620_100241788 Ga0097620_1002417882 135
782 3300006931 Ga0097620_100314023 Ga0097620_1003140231 135
783 3300006931 Ga0097620_100459296 Ga0097620_1004592962 135
784 3300006931 Ga0097620_100833809 Ga0097620_1008338092 135
785 3300006931 Ga0097620_100963893 Ga0097620_1009638932 135
786 3300006931 Ga0097620_101764194 Ga0097620_1017641942 135
787 3300009011 Ga0105251_10177180 Ga0105251_101771802 135
788 3300009093 Ga0105240_11038662 Ga0105240_110386622 135
789 3300009093 Ga0105240_11240732 Ga0105240_112407322 135
790 3300009094 Ga0111539_10175550 Ga0111539_101755504 135
791 3300009094 Ga0111539_10184822 Ga0111539_101848223 135
792 3300009094 Ga0111539_10262672 Ga0111539_102626722 135
793 3300009098 Ga0105245_10154994 Ga0105245_101549942 135
794 3300009098 Ga0105245_10660907 Ga0105245_106609072 135
795 3300009098 Ga0105245_10734500 Ga0105245_107345001 135
796 3300009101 Ga0105247_10000003 Ga0105247_10000003385 135
797 3300009101 Ga0105247_10948349 Ga0105247_109483492 135
798 3300009147 Ga0114129_10018794 Ga0114129_100187947 135
799 3300009147 Ga0114129_10094727 Ga0114129_100947272 135
800 3300009147 Ga0114129_10798749 Ga0114129_107987492 135
801 3300009147 Ga0114129_10965648 Ga0114129_109656482 135
802 3300009148 Ga0105243_10000022 Ga0105243_10000022150 135
803 3300009148 Ga0105243_10140416 Ga0105243_101404162 135
804 3300009174 Ga0105241_10129124 Ga0105241_101291242 135
805 3300009174 Ga0105241_10400321 Ga0105241_104003212 135
806 3300009176 Ga0105242_10001313 Ga0105242_1000131315 135
807 3300009176 Ga0105242_10536994 Ga0105242_105369942 135
808 3300009176 Ga0105242_10986553 Ga0105242_109865532 135
809 3300009177 Ga0105248_10009021 Ga0105248_100090217 135
810 3300009177 Ga0105248_10414973 Ga0105248_104149732 135
811 3300009177 Ga0105248_10481150 Ga0105248_104811502 135
812 3300009545 Ga0105237_10001294 Ga0105237_1000129419 135
813 3300009551 Ga0105238_10699062 Ga0105238_106990622 135
814 3300009553 Ga0105249_10002142 Ga0105249_100021424 135
815 3300009553 Ga0105249_10150412 Ga0105249_101504122 135
816 3300009553 Ga0105249_10884278 Ga0105249_108842782 135
817 3300009553 Ga0105249_11011429 Ga0105249_110114291 135
818 3300010375 Ga0105239_10132041 Ga0105239_101320413 135
819 3300010375 Ga0105239_10407227 Ga0105239_104072272 135
820 3300011119 Ga0105246_10124351 Ga0105246_101243512 135
821 3300011119 Ga0105246_11205746 Ga0105246_112057462 135
822 3300013100 Ga0157373_10030047 Ga0157373_100300474 135
823 3300013296 Ga0157374_10285954 Ga0157374_102859542 135
824 3300013296 Ga0157374_10831611 Ga0157374_108316112 135
825 3300013297 Ga0157378_10018186 Ga0157378_100181865 135
826 3300013297 Ga0157378_10018580 Ga0157378_100185806 135
827 3300013306 Ga0163162_10000023 Ga0163162_10000023134 135
828 3300013306 Ga0163162_10006881 Ga0163162_100068817 135
829 3300013306 Ga0163162_10040558 Ga0163162_100405584 135
830 3300013306 Ga0163162_10110224 Ga0163162_101102244 135
831 3300013306 Ga0163162_11963298 Ga0163162_119632982 135
832 3300013307 Ga0157372_10008865 Ga0157372_100088659 135
833 3300013308 Ga0157375_10095044 Ga0157375_100950441 135
834 3300013308 Ga0157375_10135122 Ga0157375_101351222 135
835 3300013308 Ga0157375_10512840 Ga0157375_105128402 135
836 3300013308 Ga0157375_11019934 Ga0157375_110199342 135
837 3300014325 Ga0163163_10003486 Ga0163163_100034864 135
838 3300014325 Ga0163163_10007381 Ga0163163_100073814 135
839 3300014325 Ga0163163_10323044 Ga0163163_103230442 135
840 3300014326 Ga0157380_10019502 Ga0157380_100195024 135
841 3300014326 Ga0157380_10116546 Ga0157380_101165463 135
842 3300014326 Ga0157380_10144600 Ga0157380_101446003 135
843 3300014968 Ga0157379_10027909 Ga0157379_100279093 135
844 3300014968 Ga0157379_10216626 Ga0157379_102166262 135
845 3300014969 Ga0157376_10110788 Ga0157376_101107882 135
846 3300014969 Ga0157376_10143207 Ga0157376_101432072 135
847 3300014969 Ga0157376_10651136 Ga0157376_106511362 135
848 3300017792 Ga0163161_10780334 Ga0163161_107803342 135
849 3300025223 Ga0207672_1000061 Ga0207672_10000617 135
850 3300025321 Ga0207656_10065645 Ga0207656_100656452 135
851 3300025885 Ga0207653_10000545 Ga0207653_100005453 135
852 3300025899 Ga0207642_10590292 Ga0207642_105902921 135
853 3300025900 Ga0207710_10000001 Ga0207710_10000001925 135
854 3300025904 Ga0207647_10153081 Ga0207647_101530813 135
855 3300025907 Ga0207645_10099750 Ga0207645_100997502 135
856 3300025908 Ga0207643_10033470 Ga0207643_100334702 135
857 3300025908 Ga0207643_10327923 Ga0207643_103279232 135
858 3300025908 Ga0207643_10674001 Ga0207643_106740011 135
859 3300025910 Ga0207684_10095382 Ga0207684_100953823 135
860 3300025912 Ga0207707_10455132 Ga0207707_104551322 135
861 3300025914 Ga0207671_10001043 Ga0207671_1000104320 135
862 3300025918 Ga0207662_10141328 Ga0207662_101413282 135
863 3300025918 Ga0207662_10308805 Ga0207662_103088053 135
864 3300025918 Ga0207662_10476703 Ga0207662_104767031 135
865 3300025919 Ga0207657_10399155 Ga0207657_103991552 135
866 3300025922 Ga0207646_10072025 Ga0207646_100720252 135
867 3300025922 Ga0207646_10809048 Ga0207646_108090482 135
868 3300025923 Ga0207681_10109020 Ga0207681_101090203 135
869 3300025924 Ga0207694_10499750 Ga0207694_104997502 135
870 3300025925 Ga0207650_10282805 Ga0207650_102828052 135
871 3300025926 Ga0207659_10179058 Ga0207659_101790582 135
872 3300025931 Ga0207644_10001827 Ga0207644_1000182710 135
873 3300025931 Ga0207644_10763294 Ga0207644_107632942 135
874 3300025932 Ga0207690_10292585 Ga0207690_102925851 135
875 3300025932 Ga0207690_10547311 Ga0207690_105473112 135
876 3300025934 Ga0207686_10000002 Ga0207686_10000002214 135
877 3300025934 Ga0207686_10196482 Ga0207686_101964823 135
878 3300025934 Ga0207686_10350750 Ga0207686_103507502 135
879 3300025935 Ga0207709_10000012 Ga0207709_1000001234 135
880 3300025935 Ga0207709_10088609 Ga0207709_100886092 135
881 3300025936 Ga0207670_10334210 Ga0207670_103342102 135
882 3300025936 Ga0207670_10382418 Ga0207670_103824182 135
883 3300025936 Ga0207670_11261582 Ga0207670_112615821 135
884 3300025939 Ga0207665_10076482 Ga0207665_100764823 135
885 3300025941 Ga0207711_10096345 Ga0207711_100963453 135
886 3300025941 Ga0207711_10118056 Ga0207711_101180562 135
887 3300025941 Ga0207711_10423705 Ga0207711_104237052 135
888 3300025942 Ga0207689_10029378 Ga0207689_100293784 135
889 3300025942 Ga0207689_10133559 Ga0207689_101335593 135
890 3300025942 Ga0207689_10228067 Ga0207689_102280672 135
891 3300025942 Ga0207689_10516800 Ga0207689_105168002 135
892 3300025960 Ga0207651_10064930 Ga0207651_100649304 135
893 3300025960 Ga0207651_10583873 Ga0207651_105838731 135
894 3300025961 Ga0207712_10000785 Ga0207712_1000078523 135
895 3300025961 Ga0207712_10074588 Ga0207712_100745882 135
896 3300025961 Ga0207712_11136611 Ga0207712_111366111 135
897 3300025972 Ga0207668_10001179 Ga0207668_100011794 135
898 3300025981 Ga0207640_10631690 Ga0207640_106316902 135
899 3300025981 Ga0207640_10926502 Ga0207640_109265022 135
900 3300025986 Ga0207658_10368918 Ga0207658_103689182 135
901 3300025986 Ga0207658_11904061 Ga0207658_119040611 135
902 3300026023 Ga0207677_10266854 Ga0207677_102668542 135
903 3300026035 Ga0207703_10000406 Ga0207703_100004067 135
904 3300026035 Ga0207703_10155419 Ga0207703_101554192 135
905 3300026035 Ga0207703_10325408 Ga0207703_103254082 135
906 3300026035 Ga0207703_10337300 Ga0207703_103373002 135
907 3300026035 Ga0207703_10476323 Ga0207703_104763232 135
908 3300026035 Ga0207703_11108488 Ga0207703_111084881 135
909 3300026067 Ga0207678_10435839 Ga0207678_104358392 135
910 3300026088 Ga0207641_10360948 Ga0207641_103609482 135
911 3300026088 Ga0207641_10954546 Ga0207641_109545462 135
912 3300026095 Ga0207676_10029450 Ga0207676_100294504 135
913 3300026095 Ga0207676_10175340 Ga0207676_101753403 135
914 3300026095 Ga0207676_11047665 Ga0207676_110476652 135
915 3300026095 Ga0207676_12371303 Ga0207676_123713032 135
916 3300026118 Ga0207675_100298271 Ga0207675_1002982712 135
917 3300026118 Ga0207675_102069066 Ga0207675_1020690662 135
918 3300026142 Ga0207698_10267409 Ga0207698_102674092 135
919 3300026142 Ga0207698_10660596 Ga0207698_106605962 135
920 3300026142 Ga0207698_11159020 Ga0207698_111590202 135
921 3300027907 Ga0207428_10036099 Ga0207428_100360993 135
922 3300027907 Ga0207428_10106231 Ga0207428_101062312 135
923 3300031548 Ga0307408_100188503 Ga0307408_1001885032 135
924 3300031731 Ga0307405_10296624 Ga0307405_102966242 135
925 3300031901 Ga0307406_10150420 Ga0307406_101504202 135
926 3300031911 Ga0307412_10332420 Ga0307412_103324202 135
927 3300032002 Ga0307416_100155522 Ga0307416_1001555222 135
928 3300032002 Ga0307416_100770770 Ga0307416_1007707702 135
929 3300035085 Ga0373929_0140704 Ga0373929_0140704_79_486 135
930 3300035090 Ga0373949_0043235 Ga0373949_0043235_31_438 135
931 3300035091 Ga0373951_0002115 Ga0373951_0002115_4332_4739 135
932 3300035121 Ga0373960_0199537 Ga0373960_0199537_178_585 135
933 3300035207 Ga0373942_0005910 Ga0373942_0005910_601_1008 135
934 3300037418 Ga0395900_0176796 Ga0395900_0176796_23_445 135
935 3300037471 Ga0395905_0192163 Ga0395905_0192163_434_856 135
936 3300038443 Ga0395901_1388306 Ga0395901_1388306_94_516 135
937 3300038443 Ga0395901_1870720 Ga0395901_1870720_95_508 135
938 3300042437 Ga0439444_0126980 Ga0439444_0126980_157_570 135
939 3300046473 Ga0495582_0340683 Ga0495582_0340683_424_837 135
940 3300046525 Ga0495663_0078253 Ga0495663_0078253_577_993 135
941 3300046539 Ga0495621_0083562 Ga0495621_0083562_338_754 135
942 3300048903 Ga0496100_0355692 Ga0496100_0355692_599_1012 135
943 3300048909 Ga0496106_0873856 Ga0496106_0873856_56_469 135
944 3300048911 Ga0496108_1106620 Ga0496108_1106620_204_617 135
945 3300048916 Ga0496113_0246786 Ga0496113_0246786_35_442 135
946 3300048916 Ga0496113_0274218 Ga0496113_0274218_448_858 135
947 3300049568 Ga0501031_0405135 Ga0501031_0405135_385_798 135
948 3300049574 Ga0501038_0000426 Ga0501038_0000426_1082_1489 135
949 3300049575 Ga0501039_1109991 Ga0501039_1109991_96_509 135
950 3300049590 Ga0501074_0527804 Ga0501074_0527804_410_823 135
951 3300049661 Ga0501217_311194 Ga0501217_311194_29_436 135
952 3300049704 Ga0501221_044405 Ga0501221_044405_101_508 135
953 3300050507 nmdc:mga05p37_1522850_c1 nmdc:mga05p37_1522850_c1_59_472 135
954 3300050507 nmdc:mga05p37_273532_c1 nmdc:mga05p37_273532_c1_332_745 135
955 3300050507 nmdc:mga05p37_495219_c1 nmdc:mga05p37_495219_c1_446_865 135
956 3300050507 nmdc:mga05p37_53763_c1 nmdc:mga05p37_53763_c1_2139_2558 135
957 3300050507 nmdc:mga05p37_62336_c1 nmdc:mga05p37_62336_c1_3687_4106 135
958 3300050508 nmdc:mga09592_787969_c1 nmdc:mga09592_787969_c1_100_510 135
959 3300050509 nmdc:mga0qj67_559986_c1 nmdc:mga0qj67_559986_c1_440_850 135
960 3300050510 nmdc:mga06r32_382114_c1 nmdc:mga06r32_382114_c1_540_959 135
961 3300050511 nmdc:mga08y16_1484452_c1 nmdc:mga08y16_1484452_c1_65_478 135
962 3300050511 nmdc:mga08y16_172168_c1 nmdc:mga08y16_172168_c1_1622_2035 135
963 3300050511 nmdc:mga08y16_495663_c1 nmdc:mga08y16_495663_c1_250_663 135
964 3300050511 nmdc:mga08y16_69530_c1 nmdc:mga08y16_69530_c1_2702_3112 135
965 3300053083 Ga0495655_0035019 Ga0495655_0035019_197_607 135
966 3300054114 Ga0501084_0198375 Ga0501084_0198375_62_475 135
967 3300002459 JGI24751J29686_10000071 JGI24751J29686_1000007139 136
968 3300003203 JGI25406J46586_10001975 JGI25406J46586_100019752 136
969 3300003203 JGI25406J46586_10077451 JGI25406J46586_100774512 136
970 3300005290 Ga0065712_10073101 Ga0065712_100731012 136
971 3300005293 Ga0065715_10008064 Ga0065715_100080643 136
972 3300005293 Ga0065715_10328989 Ga0065715_103289891 136
973 3300005295 Ga0065707_10495906 Ga0065707_104959062 136
974 3300005328 Ga0070676_11060174 Ga0070676_110601741 136
975 3300005330 Ga0070690_100371885 Ga0070690_1003718852 136
976 3300005330 Ga0070690_100454791 Ga0070690_1004547912 136
977 3300005331 Ga0070670_100000070 Ga0070670_10000007011 136
978 3300005331 Ga0070670_100130889 Ga0070670_1001308893 136
979 3300005331 Ga0070670_100166699 Ga0070670_1001666993 136
980 3300005334 Ga0068869_100031116 Ga0068869_1000311162 136
981 3300005334 Ga0068869_100150889 Ga0068869_1001508892 136
982 3300005334 Ga0068869_100356732 Ga0068869_1003567322 136
983 3300005336 Ga0070680_100001227 Ga0070680_10000122714 136
984 3300005337 Ga0070682_100073166 Ga0070682_1000731662 136
985 3300005338 Ga0068868_100022678 Ga0068868_1000226784 136
986 3300005338 Ga0068868_101227975 Ga0068868_1012279751 136
987 3300005338 Ga0068868_101237035 Ga0068868_1012370352 136
988 3300005340 Ga0070689_100153367 Ga0070689_1001533672 136
989 3300005343 Ga0070687_100048357 Ga0070687_1000483571 136
990 3300005345 Ga0070692_10449311 Ga0070692_104493112 136
991 3300005353 Ga0070669_100113817 Ga0070669_1001138173 136
992 3300005353 Ga0070669_100311447 Ga0070669_1003114472 136
993 3300005355 Ga0070671_100243792 Ga0070671_1002437922 136
994 3300005356 Ga0070674_100110781 Ga0070674_1001107812 136
995 3300005365 Ga0070688_100186325 Ga0070688_1001863252 136
996 3300005440 Ga0070705_100501433 Ga0070705_1005014331 136
997 3300005440 Ga0070705_100685724 Ga0070705_1006857241 136
998 3300005441 Ga0070700_100040506 Ga0070700_1000405062 136
999 3300005444 Ga0070694_100254905 Ga0070694_1002549052 136
1000 3300005444 Ga0070694_100312005 Ga0070694_1003120052 136
1001 3300005444 Ga0070694_100794226 Ga0070694_1007942261 136
1002 3300005444 Ga0070694_101173956 Ga0070694_1011739561 136
1003 3300005445 Ga0070708_100000903 Ga0070708_10000090310 136
1004 3300005445 Ga0070708_100084833 Ga0070708_1000848332 136
1005 3300005445 Ga0070708_100265611 Ga0070708_1002656112 136
1006 3300005445 Ga0070708_100480562 Ga0070708_1004805622 136
1007 3300005458 Ga0070681_10000108 Ga0070681_1000010857 136
1008 3300005459 Ga0068867_100176086 Ga0068867_1001760862 136
1009 3300005459 Ga0068867_101760784 Ga0068867_1017607841 136
1010 3300005459 Ga0068867_102222373 Ga0068867_1022223731 136
1011 3300005467 Ga0070706_100003143 Ga0070706_1000031434 136
1012 3300005467 Ga0070706_100006466 Ga0070706_1000064666 136
1013 3300005467 Ga0070706_100453388 Ga0070706_1004533882 136
1014 3300005467 Ga0070706_100743618 Ga0070706_1007436181 136
1015 3300005468 Ga0070707_100005561 Ga0070707_1000055618 136
1016 3300005468 Ga0070707_100247163 Ga0070707_1002471633 136
1017 3300005468 Ga0070707_100501538 Ga0070707_1005015382 136
1018 3300005468 Ga0070707_100511884 Ga0070707_1005118842 136
1019 3300005468 Ga0070707_100574228 Ga0070707_1005742282 136
1020 3300005471 Ga0070698_100002253 Ga0070698_1000022534 136
1021 3300005471 Ga0070698_100028485 Ga0070698_1000284856 136
1022 3300005518 Ga0070699_100003096 Ga0070699_10000309610 136
1023 3300005518 Ga0070699_100162800 Ga0070699_1001628002 136
1024 3300005518 Ga0070699_100452917 Ga0070699_1004529171 136
1025 3300005530 Ga0070679_100000197 Ga0070679_10000019740 136
1026 3300005536 Ga0070697_100011835 Ga0070697_1000118352 136
1027 3300005536 Ga0070697_100060276 Ga0070697_1000602762 136
1028 3300005536 Ga0070697_100157839 Ga0070697_1001578393 136
1029 3300005536 Ga0070697_100219732 Ga0070697_1002197322 136
1030 3300005536 Ga0070697_100428134 Ga0070697_1004281342 136
1031 3300005543 Ga0070672_100131667 Ga0070672_1001316673 136
1032 3300005544 Ga0070686_100038380 Ga0070686_1000383802 136
1033 3300005545 Ga0070695_100050215 Ga0070695_1000502152 136
1034 3300005545 Ga0070695_100479124 Ga0070695_1004791241 136
1035 3300005546 Ga0070696_100057080 Ga0070696_1000570802 136
1036 3300005546 Ga0070696_100076343 Ga0070696_1000763432 136
1037 3300005546 Ga0070696_100133208 Ga0070696_1001332082 136
1038 3300005546 Ga0070696_100239286 Ga0070696_1002392861 136
1039 3300005546 Ga0070696_100740784 Ga0070696_1007407842 136
1040 3300005547 Ga0070693_100642642 Ga0070693_1006426422 136
1041 3300005549 Ga0070704_100234550 Ga0070704_1002345502 136
1042 3300005549 Ga0070704_100328260 Ga0070704_1003282602 136
1043 3300005549 Ga0070704_100760092 Ga0070704_1007600921 136
1044 3300005577 Ga0068857_100124783 Ga0068857_1001247833 136
1045 3300005578 Ga0068854_100833651 Ga0068854_1008336512 136
1046 3300005615 Ga0070702_100395830 Ga0070702_1003958302 136
1047 3300005617 Ga0068859_100532150 Ga0068859_1005321502 136
1048 3300005617 Ga0068859_100702482 Ga0068859_1007024822 136
1049 3300005617 Ga0068859_100829072 Ga0068859_1008290722 136
1050 3300005617 Ga0068859_101263462 Ga0068859_1012634622 136
1051 3300005617 Ga0068859_101697786 Ga0068859_1016977862 136
1052 3300005617 Ga0068859_103168528 Ga0068859_1031685281 136
1053 3300005719 Ga0068861_100021073 Ga0068861_1000210734 136
1054 3300005719 Ga0068861_100355745 Ga0068861_1003557452 136
1055 3300005842 Ga0068858_100060984 Ga0068858_1000609844 136
1056 3300005843 Ga0068860_100041828 Ga0068860_1000418282 136
1057 3300005843 Ga0068860_100123809 Ga0068860_1001238094 136
1058 3300005843 Ga0068860_101507161 Ga0068860_1015071612 136
1059 3300005843 Ga0068860_101787024 Ga0068860_1017870242 136
1060 3300005983 Ga0081540_1089515 Ga0081540_10895152 136
1061 3300005985 Ga0081539_10003279 Ga0081539_1000327913 136
1062 3300005985 Ga0081539_10045133 Ga0081539_100451333 136
1063 3300006852 Ga0075433_10073052 Ga0075433_100730524 136
1064 3300006852 Ga0075433_10085773 Ga0075433_100857731 136
1065 3300006852 Ga0075433_10601846 Ga0075433_106018462 136
1066 3300006852 Ga0075433_10777577 Ga0075433_107775772 136
1067 3300006871 Ga0075434_100118098 Ga0075434_1001180982 136
1068 3300006881 Ga0068865_100190307 Ga0068865_1001903072 136
1069 3300006881 Ga0068865_100532848 Ga0068865_1005328481 136
1070 3300006931 Ga0097620_100532183 Ga0097620_1005321832 136
1071 3300006931 Ga0097620_100702651 Ga0097620_1007026511 136
1072 3300006931 Ga0097620_100829077 Ga0097620_1008290772 136
1073 3300006931 Ga0097620_101263490 Ga0097620_1012634902 136
1074 3300006931 Ga0097620_101697786 Ga0097620_1016977862 136
1075 3300006931 Ga0097620_103168988 Ga0097620_1031689881 136
1076 3300007076 Ga0075435_101182429 Ga0075435_1011824292 136
1077 3300007265 Ga0099794_10374998 Ga0099794_103749982 136
1078 3300009093 Ga0105240_10878565 Ga0105240_108785652 136
1079 3300009093 Ga0105240_11142573 Ga0105240_111425732 136
1080 3300009094 Ga0111539_10077682 Ga0111539_100776822 136
1081 3300009098 Ga0105245_10094706 Ga0105245_100947062 136
1082 3300009098 Ga0105245_10335785 Ga0105245_103357852 136
1083 3300009098 Ga0105245_10782410 Ga0105245_107824102 136
1084 3300009101 Ga0105247_10009077 Ga0105247_100090774 136
1085 3300009101 Ga0105247_10076533 Ga0105247_100765332 136
1086 3300009147 Ga0114129_10022923 Ga0114129_100229232 136
1087 3300009147 Ga0114129_10350305 Ga0114129_103503053 136
1088 3300009147 Ga0114129_10390636 Ga0114129_103906362 136
1089 3300009147 Ga0114129_11549211 Ga0114129_115492112 136
1090 3300009148 Ga0105243_10008399 Ga0105243_100083997 136
1091 3300009148 Ga0105243_10663227 Ga0105243_106632272 136
1092 3300009148 Ga0105243_11536799 Ga0105243_115367992 136
1093 3300009148 Ga0105243_11936214 Ga0105243_119362141 136
1094 3300009174 Ga0105241_10186788 Ga0105241_101867882 136
1095 3300009174 Ga0105241_10815242 Ga0105241_108152422 136
1096 3300009174 Ga0105241_11282970 Ga0105241_112829701 136
1097 3300009176 Ga0105242_10057456 Ga0105242_100574563 136
1098 3300009176 Ga0105242_11155825 Ga0105242_111558252 136
1099 3300009177 Ga0105248_10364879 Ga0105248_103648792 136
1100 3300009545 Ga0105237_10375952 Ga0105237_103759522 136
1101 3300009551 Ga0105238_10254056 Ga0105238_102540562 136
1102 3300009553 Ga0105249_10012565 Ga0105249_100125654 136
1103 3300009553 Ga0105249_10014137 Ga0105249_100141375 136
1104 3300010375 Ga0105239_10008638 Ga0105239_100086389 136
1105 3300011119 Ga0105246_10666880 Ga0105246_106668802 136
1106 3300013297 Ga0157378_10000184 Ga0157378_1000018413 136
1107 3300013297 Ga0157378_10013919 Ga0157378_100139198 136
1108 3300013297 Ga0157378_10190981 Ga0157378_101909811 136
1109 3300013297 Ga0157378_10434189 Ga0157378_104341892 136
1110 3300013297 Ga0157378_10766348 Ga0157378_107663482 136
1111 3300013306 Ga0163162_10010962 Ga0163162_100109626 136
1112 3300013306 Ga0163162_10039315 Ga0163162_100393155 136
1113 3300013306 Ga0163162_10406026 Ga0163162_104060262 136
1114 3300013308 Ga0157375_10009137 Ga0157375_100091372 136
1115 3300013308 Ga0157375_11145739 Ga0157375_111457392 136
1116 3300014325 Ga0163163_10000223 Ga0163163_1000022343 136
1117 3300014325 Ga0163163_11176507 Ga0163163_111765072 136
1118 3300014325 Ga0163163_11385914 Ga0163163_113859141 136
1119 3300014325 Ga0163163_11438335 Ga0163163_114383352 136
1120 3300014326 Ga0157380_10285556 Ga0157380_102855563 136
1121 3300014968 Ga0157379_10563506 Ga0157379_105635062 136
1122 3300025321 Ga0207656_10200749 Ga0207656_102007492 136
1123 3300025893 Ga0207682_10104755 Ga0207682_101047552 136
1124 3300025899 Ga0207642_10808772 Ga0207642_108087721 136
1125 3300025900 Ga0207710_10001999 Ga0207710_100019998 136
1126 3300025901 Ga0207688_10403191 Ga0207688_104031912 136
1127 3300025907 Ga0207645_10234905 Ga0207645_102349051 136
1128 3300025910 Ga0207684_10005064 Ga0207684_100050643 136
1129 3300025910 Ga0207684_10009494 Ga0207684_100094947 136
1130 3300025910 Ga0207684_10079994 Ga0207684_100799942 136
1131 3300025911 Ga0207654_10070763 Ga0207654_100707633 136
1132 3300025912 Ga0207707_10000013 Ga0207707_10000013136 136
1133 3300025913 Ga0207695_10576311 Ga0207695_105763112 136
1134 3300025917 Ga0207660_10000926 Ga0207660_1000092614 136
1135 3300025918 Ga0207662_10222916 Ga0207662_102229161 136
1136 3300025918 Ga0207662_10277227 Ga0207662_102772272 136
1137 3300025918 Ga0207662_10322024 Ga0207662_103220242 136
1138 3300025921 Ga0207652_10000071 Ga0207652_1000007139 136
1139 3300025922 Ga0207646_10032665 Ga0207646_100326653 136
1140 3300025922 Ga0207646_10361092 Ga0207646_103610922 136
1141 3300025922 Ga0207646_10690396 Ga0207646_106903962 136
1142 3300025922 Ga0207646_11085430 Ga0207646_110854301 136
1143 3300025923 Ga0207681_10327894 Ga0207681_103278941 136
1144 3300025924 Ga0207694_10142633 Ga0207694_101426332 136
1145 3300025925 Ga0207650_10000017 Ga0207650_10000017252 136
1146 3300025925 Ga0207650_10288452 Ga0207650_102884522 136
1147 3300025927 Ga0207687_10143515 Ga0207687_101435152 136
1148 3300025934 Ga0207686_10001125 Ga0207686_100011258 136
1149 3300025935 Ga0207709_10005715 Ga0207709_100057152 136
1150 3300025935 Ga0207709_10515185 Ga0207709_105151852 136
1151 3300025938 Ga0207704_10443635 Ga0207704_104436352 136
1152 3300025938 Ga0207704_11113004 Ga0207704_111130041 136
1153 3300025940 Ga0207691_10087278 Ga0207691_100872782 136
1154 3300025941 Ga0207711_10247974 Ga0207711_102479742 136
1155 3300025941 Ga0207711_10779840 Ga0207711_107798401 136
1156 3300025942 Ga0207689_10005313 Ga0207689_100053134 136
1157 3300025942 Ga0207689_10050739 Ga0207689_100507394 136
1158 3300025942 Ga0207689_10243978 Ga0207689_102439782 136
1159 3300025942 Ga0207689_10345518 Ga0207689_103455182 136
1160 3300025960 Ga0207651_10349436 Ga0207651_103494362 136
1161 3300025960 Ga0207651_10716595 Ga0207651_107165951 136
1162 3300025961 Ga0207712_10010774 Ga0207712_100107743 136
1163 3300025961 Ga0207712_10965912 Ga0207712_109659122 136
1164 3300025981 Ga0207640_10627008 Ga0207640_106270082 136
1165 3300025986 Ga0207658_10897990 Ga0207658_108979902 136
1166 3300026023 Ga0207677_10055043 Ga0207677_100550432 136
1167 3300026075 Ga0207708_10082472 Ga0207708_100824723 136
1168 3300026089 Ga0207648_10287725 Ga0207648_102877252 136
1169 3300026089 Ga0207648_10947492 Ga0207648_109474922 136
1170 3300026095 Ga0207676_10125677 Ga0207676_101256773 136
1171 3300026118 Ga0207675_100001706 Ga0207675_10000170616 136
1172 3300026118 Ga0207675_100745543 Ga0207675_1007455432 136
1173 3300026142 Ga0207698_10296651 Ga0207698_102966512 136
1174 3300028380 Ga0268265_12220993 Ga0268265_122209931 136
1175 3300028381 Ga0268264_10028208 Ga0268264_100282085 136
1176 3300028381 Ga0268264_10106264 Ga0268264_101062643 136
1177 3300028381 Ga0268264_10306400 Ga0268264_103064002 136
1178 3300028381 Ga0268264_11365871 Ga0268264_113658712 136
1179 3300031548 Ga0307408_101746367 Ga0307408_1017463671 136
1180 3300031901 Ga0307406_11837362 Ga0307406_118373622 136
1181 3300034818 Ga0373950_0122176 Ga0373950_0122176_16_426 136
1182 3300035115 Ga0373941_0043415 Ga0373941_0043415_416_826 136
1183 3300037418 Ga0395900_0751864 Ga0395900_0751864_43_462 136
1184 3300038996 Ga0242420_004336 Ga0242420_004336_1559_1972 136
1185 3300042876 Ga0451577_0098434 Ga0451577_0098434_1982_2395 136
1186 3300045051 Ga0451576_0168952 Ga0451576_0168952_28_441 136
1187 3300045051 Ga0451576_0419454 Ga0451576_0419454_98_535 136
1188 3300046525 Ga0495663_0000171 Ga0495663_0000171_15654_16073 136
1189 3300046537 Ga0495598_0004493 Ga0495598_0004493_1919_2338 136
1190 3300046539 Ga0495621_0000156 Ga0495621_0000156_8902_9321 136
1191 3300047320 Ga0495672_0042128 Ga0495672_0042128_1887_2303 136
1192 3300050507 nmdc:mga05p37_159731_c1 nmdc:mga05p37_159731_c1_1831_2250 136
1193 3300050507 nmdc:mga05p37_35981_c1 nmdc:mga05p37_35981_c1_4131_4547 136
1194 3300050507 nmdc:mga05p37_525869_c1 nmdc:mga05p37_525869_c1_655_1071 136
1195 3300050511 nmdc:mga08y16_150695_c1 nmdc:mga08y16_150695_c1_682_1098 136
1196 3300050512 nmdc:mga0n895_492370_c1 nmdc:mga0n895_492370_c1_288_701 136
1197 3300050513 nmdc:mga0rr50_1060741_c1 nmdc:mga0rr50_1060741_c1_187_603 136
1198 3300050515 nmdc:mga0a205_365824_c1 nmdc:mga0a205_365824_c1_19_432 136
1199 3300050515 nmdc:mga0a205_79533_c1 nmdc:mga0a205_79533_c1_542_958 136
1200 3300005295 Ga0065707_10599063 Ga0065707_105990631 137
1201 3300005329 Ga0070683_100079253 Ga0070683_1000792532 137
1202 3300005330 Ga0070690_100001096 Ga0070690_10000109611 137
1203 3300005331 Ga0070670_100728023 Ga0070670_1007280232 137
1204 3300005333 Ga0070677_10509903 Ga0070677_105099032 137
1205 3300005334 Ga0068869_100411652 Ga0068869_1004116522 137
1206 3300005335 Ga0070666_10057618 Ga0070666_100576183 137
1207 3300005336 Ga0070680_100009427 Ga0070680_1000094272 137
1208 3300005336 Ga0070680_100903137 Ga0070680_1009031372 137
1209 3300005337 Ga0070682_100000114 Ga0070682_10000011414 137
1210 3300005339 Ga0070660_100388404 Ga0070660_1003884042 137
1211 3300005343 Ga0070687_100374877 Ga0070687_1003748772 137
1212 3300005354 Ga0070675_100725113 Ga0070675_1007251132 137
1213 3300005355 Ga0070671_100015270 Ga0070671_1000152702 137
1214 3300005365 Ga0070688_100875189 Ga0070688_1008751891 137
1215 3300005366 Ga0070659_100004261 Ga0070659_1000042615 137
1216 3300005438 Ga0070701_10050026 Ga0070701_100500263 137
1217 3300005440 Ga0070705_100308450 Ga0070705_1003084502 137
1218 3300005445 Ga0070708_100155893 Ga0070708_1001558932 137
1219 3300005445 Ga0070708_100514397 Ga0070708_1005143972 137
1220 3300005445 Ga0070708_101357092 Ga0070708_1013570921 137
1221 3300005457 Ga0070662_100105429 Ga0070662_1001054293 137
1222 3300005457 Ga0070662_100808255 Ga0070662_1008082552 137
1223 3300005458 Ga0070681_10001112 Ga0070681_1000111214 137
1224 3300005466 Ga0070685_10172886 Ga0070685_101728862 137
1225 3300005467 Ga0070706_100046836 Ga0070706_1000468365 137
1226 3300005467 Ga0070706_100422387 Ga0070706_1004223871 137
1227 3300005471 Ga0070698_100277520 Ga0070698_1002775202 137
1228 3300005471 Ga0070698_100738795 Ga0070698_1007387951 137
1229 3300005471 Ga0070698_100912261 Ga0070698_1009122612 137
1230 3300005471 Ga0070698_101164434 Ga0070698_1011644342 137
1231 3300005471 Ga0070698_101946629 Ga0070698_1019466291 137
1232 3300005518 Ga0070699_100018592 Ga0070699_1000185926 137
1233 3300005518 Ga0070699_100054078 Ga0070699_1000540784 137
1234 3300005518 Ga0070699_100133686 Ga0070699_1001336861 137
1235 3300005518 Ga0070699_100228535 Ga0070699_1002285352 137
1236 3300005530 Ga0070679_100997029 Ga0070679_1009970292 137
1237 3300005536 Ga0070697_100000067 Ga0070697_10000006764 137
1238 3300005536 Ga0070697_100452752 Ga0070697_1004527521 137
1239 3300005539 Ga0068853_100003126 Ga0068853_10000312612 137
1240 3300005539 Ga0068853_100036593 Ga0068853_1000365935 137
1241 3300005545 Ga0070695_100805101 Ga0070695_1008051011 137
1242 3300005546 Ga0070696_100039578 Ga0070696_1000395783 137
1243 3300005546 Ga0070696_100116560 Ga0070696_1001165602 137
1244 3300005546 Ga0070696_100242300 Ga0070696_1002423002 137
1245 3300005549 Ga0070704_100409274 Ga0070704_1004092741 137
1246 3300005549 Ga0070704_100438727 Ga0070704_1004387272 137
1247 3300005564 Ga0070664_100001032 Ga0070664_10000103214 137
1248 3300005564 Ga0070664_100709155 Ga0070664_1007091551 137
1249 3300005577 Ga0068857_100004297 Ga0068857_10000429710 137
1250 3300005614 Ga0068856_100015548 Ga0068856_1000155486 137
1251 3300005618 Ga0068864_100010047 Ga0068864_1000100475 137
1252 3300005618 Ga0068864_100248328 Ga0068864_1002483282 137
1253 3300005618 Ga0068864_101022680 Ga0068864_1010226802 137
1254 3300005719 Ga0068861_100048605 Ga0068861_1000486052 137
1255 3300005834 Ga0068851_10389269 Ga0068851_103892692 137
1256 3300005841 Ga0068863_100004782 Ga0068863_10000478215 137
1257 3300005841 Ga0068863_100565134 Ga0068863_1005651341 137
1258 3300005842 Ga0068858_101110274 Ga0068858_1011102742 137
1259 3300005843 Ga0068860_100322134 Ga0068860_1003221342 137
1260 3300005844 Ga0068862_100006215 Ga0068862_1000062155 137
1261 3300006173 Ga0070716_100000009 Ga0070716_10000000963 137
1262 3300006173 Ga0070716_100094470 Ga0070716_1000944703 137
1263 3300006844 Ga0075428_100495580 Ga0075428_1004955802 137
1264 3300006852 Ga0075433_10098556 Ga0075433_100985564 137
1265 3300006852 Ga0075433_11344705 Ga0075433_113447052 137
1266 3300006871 Ga0075434_100105220 Ga0075434_1001052202 137
1267 3300006880 Ga0075429_100125522 Ga0075429_1001255221 137
1268 3300006880 Ga0075429_101130242 Ga0075429_1011302421 137
1269 3300006881 Ga0068865_100168946 Ga0068865_1001689462 137
1270 3300006914 Ga0075436_100877631 Ga0075436_1008776311 137
1271 3300007265 Ga0099794_10006326 Ga0099794_100063263 137
1272 3300009093 Ga0105240_10693986 Ga0105240_106939862 137
1273 3300009098 Ga0105245_10968746 Ga0105245_109687462 137
1274 3300009147 Ga0114129_10062002 Ga0114129_100620025 137
1275 3300009147 Ga0114129_10707111 Ga0114129_107071111 137
1276 3300009148 Ga0105243_10011797 Ga0105243_100117975 137
1277 3300009148 Ga0105243_10066317 Ga0105243_100663171 137
1278 3300009545 Ga0105237_10321835 Ga0105237_103218351 137
1279 3300009545 Ga0105237_10731699 Ga0105237_107316992 137
1280 3300009553 Ga0105249_10040998 Ga0105249_100409984 137
1281 3300009553 Ga0105249_10251176 Ga0105249_102511762 137
1282 3300009553 Ga0105249_10531418 Ga0105249_105314182 137
1283 3300009553 Ga0105249_11902687 Ga0105249_119026872 137
1284 3300010375 Ga0105239_10619985 Ga0105239_106199852 137
1285 3300013100 Ga0157373_10120400 Ga0157373_101204002 137
1286 3300013296 Ga0157374_11025008 Ga0157374_110250082 137
1287 3300013297 Ga0157378_10058073 Ga0157378_100580732 137
1288 3300013297 Ga0157378_10102017 Ga0157378_101020172 137
1289 3300013297 Ga0157378_10536525 Ga0157378_105365252 137
1290 3300013306 Ga0163162_10037023 Ga0163162_100370235 137
1291 3300013306 Ga0163162_10393000 Ga0163162_103930003 137
1292 3300013307 Ga0157372_10836998 Ga0157372_108369981 137
1293 3300013308 Ga0157375_11454625 Ga0157375_114546251 137
1294 3300014325 Ga0163163_10039944 Ga0163163_100399442 137
1295 3300014325 Ga0163163_10062161 Ga0163163_100621613 137
1296 3300014325 Ga0163163_10067219 Ga0163163_100672192 137
1297 3300014326 Ga0157380_10004587 Ga0157380_100045872 137
1298 3300014968 Ga0157379_10063103 Ga0157379_100631032 137
1299 3300017792 Ga0163161_10002484 Ga0163161_1000248411 137
1300 3300025903 Ga0207680_10102402 Ga0207680_101024021 137
1301 3300025908 Ga0207643_10900803 Ga0207643_109008032 137
1302 3300025910 Ga0207684_10025841 Ga0207684_100258412 137
1303 3300025917 Ga0207660_10255940 Ga0207660_102559402 137
1304 3300025917 Ga0207660_10814598 Ga0207660_108145982 137
1305 3300025919 Ga0207657_10075506 Ga0207657_100755064 137
1306 3300025920 Ga0207649_10029516 Ga0207649_100295162 137
1307 3300025921 Ga0207652_10500078 Ga0207652_105000782 137
1308 3300025923 Ga0207681_10143441 Ga0207681_101434411 137
1309 3300025925 Ga0207650_10713383 Ga0207650_107133832 137
1310 3300025926 Ga0207659_10929774 Ga0207659_109297742 137
1311 3300025931 Ga0207644_10017866 Ga0207644_100178663 137
1312 3300025932 Ga0207690_10178671 Ga0207690_101786712 137
1313 3300025933 Ga0207706_10194242 Ga0207706_101942423 137
1314 3300025933 Ga0207706_10215332 Ga0207706_102153323 137
1315 3300025938 Ga0207704_10050767 Ga0207704_100507672 137
1316 3300025939 Ga0207665_10000001 Ga0207665_1000000181 137
1317 3300025939 Ga0207665_10501507 Ga0207665_105015072 137
1318 3300025942 Ga0207689_10601331 Ga0207689_106013312 137
1319 3300025945 Ga0207679_10255059 Ga0207679_102550592 137
1320 3300025960 Ga0207651_10158450 Ga0207651_101584501 137
1321 3300025961 Ga0207712_10220796 Ga0207712_102207963 137
1322 3300025961 Ga0207712_10711319 Ga0207712_107113192 137
1323 3300026041 Ga0207639_10242229 Ga0207639_102422293 137
1324 3300026041 Ga0207639_10374288 Ga0207639_103742883 137
1325 3300026078 Ga0207702_10018048 Ga0207702_100180484 137
1326 3300026095 Ga0207676_10022816 Ga0207676_100228162 137
1327 3300026095 Ga0207676_10224846 Ga0207676_102248462 137
1328 3300026116 Ga0207674_10002176 Ga0207674_1000217614 137
1329 3300026118 Ga0207675_100247050 Ga0207675_1002470503 137
1330 3300028380 Ga0268265_10015510 Ga0268265_100155106 137
1331 3300031456 Ga0307513_10274505 Ga0307513_102745052 137
1332 3300031731 Ga0307405_11281862 Ga0307405_112818622 137
1333 3300032002 Ga0307416_100374598 Ga0307416_1003745982 137
1334 3300037418 Ga0395900_0557211 Ga0395900_0557211_457_879 137
1335 3300038443 Ga0395901_0084146 Ga0395901_0084146_2681_3103 137
1336 3300038443 Ga0395901_0139221 Ga0395901_0139221_1022_1441 137
1337 3300038443 Ga0395901_0335357 Ga0395901_0335357_967_1389 137
1338 3300042012 Ga0439455_0078069 Ga0439455_0078069_403_822 137
1339 3300042126 Ga0450888_025740 Ga0450888_025740_30_449 137
1340 3300042156 Ga0439446_0006193 Ga0439446_0006193_2557_2976 137
1341 3300042439 Ga0439464_0056902 Ga0439464_0056902_212_631 137
1342 3300048906 Ga0496103_0221328 Ga0496103_0221328_547_966 137
1343 3300048907 Ga0496104_0025481 Ga0496104_0025481_2479_2898 137
1344 3300048909 Ga0496106_0418119 Ga0496106_0418119_357_776 137
1345 3300048910 Ga0496107_0357441 Ga0496107_0357441_448_867 137
1346 3300048911 Ga0496108_0306252 Ga0496108_0306252_239_658 137
1347 3300048913 Ga0496110_0138311 Ga0496110_0138311_161_580 137
1348 3300048916 Ga0496113_0697777 Ga0496113_0697777_96_515 137
1349 3300050507 nmdc:mga05p37_187097_c1 nmdc:mga05p37_187097_c1_1345_1758 137
1350 3300050508 nmdc:mga09592_443668_c1 nmdc:mga09592_443668_c1_581_1000 137
1351 3300050512 nmdc:mga0n895_1177662_c1 nmdc:mga0n895_1177662_c1_232_651 137
1352 3300050512 nmdc:mga0n895_195125_c1 nmdc:mga0n895_195125_c1_1539_1958 137
1353 3300050515 nmdc:mga0a205_14553_c1 nmdc:mga0a205_14553_c1_1952_2365 137
1354 3300003203 JGI25406J46586_10127752 JGI25406J46586_101277521 138
1355 3300005289 Ga0065704_10006287 Ga0065704_100062872 138
1356 3300005295 Ga0065707_10018597 Ga0065707_100185973 138
1357 3300005295 Ga0065707_10173317 Ga0065707_101733173 138
1358 3300005295 Ga0065707_10399617 Ga0065707_103996172 138
1359 3300005330 Ga0070690_100076702 Ga0070690_1000767022 138
1360 3300005331 Ga0070670_100266476 Ga0070670_1002664761 138
1361 3300005334 Ga0068869_100020229 Ga0068869_1000202293 138
1362 3300005334 Ga0068869_100020557 Ga0068869_1000205572 138
1363 3300005334 Ga0068869_100706658 Ga0068869_1007066582 138
1364 3300005345 Ga0070692_10622606 Ga0070692_106226062 138
1365 3300005354 Ga0070675_100219934 Ga0070675_1002199342 138
1366 3300005364 Ga0070673_100905026 Ga0070673_1009050261 138
1367 3300005440 Ga0070705_100163664 Ga0070705_1001636642 138
1368 3300005440 Ga0070705_100267747 Ga0070705_1002677471 138
1369 3300005441 Ga0070700_100089442 Ga0070700_1000894422 138
1370 3300005441 Ga0070700_100995779 Ga0070700_1009957791 138
1371 3300005441 Ga0070700_101881491 Ga0070700_1018814911 138
1372 3300005444 Ga0070694_100010512 Ga0070694_1000105124 138
1373 3300005444 Ga0070694_100106356 Ga0070694_1001063562 138
1374 3300005459 Ga0068867_101310539 Ga0068867_1013105391 138
1375 3300005467 Ga0070706_100003795 Ga0070706_1000037954 138
1376 3300005471 Ga0070698_100005354 Ga0070698_10000535410 138
1377 3300005471 Ga0070698_100017479 Ga0070698_1000174795 138
1378 3300005536 Ga0070697_100004607 Ga0070697_1000046073 138
1379 3300005543 Ga0070672_101527773 Ga0070672_1015277731 138
1380 3300005545 Ga0070695_101050673 Ga0070695_1010506731 138
1381 3300005546 Ga0070696_100078855 Ga0070696_1000788552 138
1382 3300005546 Ga0070696_100637333 Ga0070696_1006373331 138
1383 3300005546 Ga0070696_100800768 Ga0070696_1008007681 138
1384 3300005546 Ga0070696_101210089 Ga0070696_1012100891 138
1385 3300005547 Ga0070693_100031651 Ga0070693_1000316513 138
1386 3300005547 Ga0070693_100220745 Ga0070693_1002207452 138
1387 3300005547 Ga0070693_100353174 Ga0070693_1003531742 138
1388 3300005549 Ga0070704_100338199 Ga0070704_1003381992 138
1389 3300005549 Ga0070704_100373322 Ga0070704_1003733222 138
1390 3300005549 Ga0070704_101310354 Ga0070704_1013103541 138
1391 3300005563 Ga0068855_100928028 Ga0068855_1009280281 138
1392 3300005564 Ga0070664_100284337 Ga0070664_1002843372 138
1393 3300005564 Ga0070664_101086865 Ga0070664_1010868651 138
1394 3300005564 Ga0070664_101373688 Ga0070664_1013736882 138
1395 3300005617 Ga0068859_100818085 Ga0068859_1008180852 138
1396 3300005618 Ga0068864_101628447 Ga0068864_1016284471 138
1397 3300005844 Ga0068862_100709215 Ga0068862_1007092152 138
1398 3300005985 Ga0081539_10001579 Ga0081539_1000157929 138
1399 3300006173 Ga0070716_100078393 Ga0070716_1000783932 138
1400 3300006852 Ga0075433_10068289 Ga0075433_100682893 138
1401 3300006852 Ga0075433_10309958 Ga0075433_103099583 138
1402 3300006852 Ga0075433_10364142 Ga0075433_103641422 138
1403 3300006871 Ga0075434_100841746 Ga0075434_1008417462 138
1404 3300006931 Ga0097620_100818080 Ga0097620_1008180802 138
1405 3300009148 Ga0105243_10072857 Ga0105243_100728572 138
1406 3300009148 Ga0105243_10182122 Ga0105243_101821222 138
1407 3300009174 Ga0105241_10022857 Ga0105241_100228571 138
1408 3300009174 Ga0105241_10626576 Ga0105241_106265761 138
1409 3300009176 Ga0105242_10474857 Ga0105242_104748572 138
1410 3300009176 Ga0105242_11348169 Ga0105242_113481691 138
1411 3300009176 Ga0105242_11354017 Ga0105242_113540172 138
1412 3300009177 Ga0105248_11579460 Ga0105248_115794602 138
1413 3300009177 Ga0105248_11591190 Ga0105248_115911902 138
1414 3300011119 Ga0105246_10680900 Ga0105246_106809002 138
1415 3300013100 Ga0157373_10072255 Ga0157373_100722554 138
1416 3300013297 Ga0157378_10322381 Ga0157378_103223812 138
1417 3300013306 Ga0163162_10283735 Ga0163162_102837353 138
1418 3300013307 Ga0157372_11786441 Ga0157372_117864411 138
1419 3300014325 Ga0163163_10305737 Ga0163163_103057372 138
1420 3300014325 Ga0163163_10522263 Ga0163163_105222632 138
1421 3300014497 Ga0182008_10116048 Ga0182008_101160482 138
1422 3300014745 Ga0157377_11095875 Ga0157377_110958751 138
1423 3300015262 Ga0182007_10055981 Ga0182007_100559813 138
1424 3300025905 Ga0207685_10000020 Ga0207685_10000020123 138
1425 3300025910 Ga0207684_10008048 Ga0207684_100080488 138
1426 3300025911 Ga0207654_10021845 Ga0207654_100218454 138
1427 3300025912 Ga0207707_10408162 Ga0207707_104081622 138
1428 3300025918 Ga0207662_10670415 Ga0207662_106704152 138
1429 3300025922 Ga0207646_11439668 Ga0207646_114396682 138
1430 3300025925 Ga0207650_10426282 Ga0207650_104262822 138
1431 3300025926 Ga0207659_10136404 Ga0207659_101364042 138
1432 3300025934 Ga0207686_10438387 Ga0207686_104383872 138
1433 3300025935 Ga0207709_10081217 Ga0207709_100812171 138
1434 3300025939 Ga0207665_10132372 Ga0207665_101323723 138
1435 3300025939 Ga0207665_10153203 Ga0207665_101532032 138
1436 3300025941 Ga0207711_10193066 Ga0207711_101930662 138
1437 3300025942 Ga0207689_10033815 Ga0207689_100338152 138
1438 3300025942 Ga0207689_10051969 Ga0207689_100519692 138
1439 3300025942 Ga0207689_10288218 Ga0207689_102882182 138
1440 3300025945 Ga0207679_10172782 Ga0207679_101727822 138
1441 3300026075 Ga0207708_10054953 Ga0207708_100549532 138
1442 3300026075 Ga0207708_10473429 Ga0207708_104734291 138
1443 3300026075 Ga0207708_11569390 Ga0207708_115693902 138
1444 3300026118 Ga0207675_102206068 Ga0207675_1022060681 138
1445 3300026121 Ga0207683_10765723 Ga0207683_107657232 138
1446 3300031456 Ga0307513_10411337 Ga0307513_104113372 138
1447 3300031548 Ga0307408_100104908 Ga0307408_1001049082 138
1448 3300031731 Ga0307405_10072733 Ga0307405_100727333 138
1449 3300031852 Ga0307410_11496875 Ga0307410_114968751 138
1450 3300031903 Ga0307407_10065534 Ga0307407_100655342 138
1451 3300032002 Ga0307416_101136514 Ga0307416_1011365142 138
1452 3300032004 Ga0307414_10182125 Ga0307414_101821253 138
1453 3300032005 Ga0307411_10660129 Ga0307411_106601291 138
1454 3300032126 Ga0307415_100019501 Ga0307415_1000195012 138
1455 3300032126 Ga0307415_100399579 Ga0307415_1003995792 138
1456 3300038996 Ga0242420_114969 Ga0242420_114969_86_508 138
1457 3300046512 Ga0495610_0037199 Ga0495610_0037199_343_774 138
1458 3300046537 Ga0495598_0359937 Ga0495598_0359937_120_551 138
1459 3300046616 Ga0495668_0064066 Ga0495668_0064066_891_1322 138
1460 3300047318 Ga0495636_0049807 Ga0495636_0049807_1294_1731 138
1461 3300047447 Ga0495685_077112 Ga0495685_077112_179_610 138
1462 3300048907 Ga0496104_0198785 Ga0496104_0198785_113_529 138
1463 3300048907 Ga0496104_0336176 Ga0496104_0336176_744_1160 138
1464 3300048911 Ga0496108_0058081 Ga0496108_0058081_769_1185 138
1465 3300048913 Ga0496110_0439049 Ga0496110_0439049_674_1090 138
1466 3300048914 Ga0496111_0585179 Ga0496111_0585179_391_807 138
1467 3300048915 Ga0496112_0236884 Ga0496112_0236884_694_1110 138
1468 3300049515 Ga0501292_000790 Ga0501292_000790_837_1253 138
1469 3300049515 Ga0501292_004622 Ga0501292_004622_174_617 138
1470 3300049519 Ga0501296_001574 Ga0501296_001574_1714_2130 138
1471 3300049520 Ga0501297_006690 Ga0501297_006690_357_773 138
1472 3300049521 Ga0501298_000241 Ga0501298_000241_3943_4359 138
1473 3300049521 Ga0501298_030892 Ga0501298_030892_332_775 138
1474 3300049522 Ga0501299_001065 Ga0501299_001065_1800_2216 138
1475 3300049526 Ga0501303_008931 Ga0501303_008931_163_606 138
1476 3300049652 Ga0501202_067366 Ga0501202_067366_365_781 138
1477 3300049660 Ga0501216_001852 Ga0501216_001852_1717_2133 138
1478 3300049661 Ga0501217_005198 Ga0501217_005198_249_665 138
1479 3300049661 Ga0501217_020959 Ga0501217_020959_189_632 138
1480 3300049664 Ga0501224_015643 Ga0501224_015643_353_796 138
1481 3300049669 Ga0501235_046659 Ga0501235_046659_161_577 138
1482 3300049669 Ga0501235_103557 Ga0501235_103557_104_547 138
1483 3300049675 Ga0501243_001824 Ga0501243_001824_237_653 138
1484 3300049678 Ga0501248_020163 Ga0501248_020163_72_515 138
1485 3300049680 Ga0501250_048359 Ga0501250_048359_71_487 138
1486 3300049688 Ga0501259_016453 Ga0501259_016453_14_457 138
1487 3300049690 Ga0501261_021432 Ga0501261_021432_277_693 138
1488 3300049704 Ga0501221_018693 Ga0501221_018693_847_1290 138
1489 3300049705 Ga0501225_0013302 Ga0501225_0013302_171_614 138
1490 3300049705 Ga0501225_0016071 Ga0501225_0016071_1348_1764 138
1491 3300049765 Ga0501268_070125 Ga0501268_070125_45_488 138
1492 3300049769 Ga0501272_004539 Ga0501272_004539_266_709 138
1493 3300049772 Ga0501275_031772 Ga0501275_031772_166_609 138
1494 3300049775 Ga0501279_013185 Ga0501279_013185_126_569 138
1495 3300049779 Ga0501283_000377 Ga0501283_000377_3484_3900 138
1496 3300049779 Ga0501283_001846 Ga0501283_001846_18_461 138
1497 3300049850 Ga0501204_048049 Ga0501204_048049_107_550 138
1498 3300049851 Ga0501212_002665 Ga0501212_002665_547_963 138
1499 3300050512 nmdc:mga0n895_419330_c1 nmdc:mga0n895_419330_c1_507_923 138
1500 3300050514 nmdc:mga08x19_478595_c1 nmdc:mga08x19_478595_c1_235_651 138
1501 3300050515 nmdc:mga0a205_221865_c1 nmdc:mga0a205_221865_c1_1108_1524 138
1502 3300050515 nmdc:mga0a205_463965_c1 nmdc:mga0a205_463965_c1_129_545 138
1503 3300000531 CNBas_1000099 CNBas_10000992 139
1504 3300005290 Ga0065712_10001969 Ga0065712_100019696 139
1505 3300005293 Ga0065715_10004257 Ga0065715_100042575 139
1506 3300005293 Ga0065715_10098523 Ga0065715_100985232 139
1507 3300005293 Ga0065715_10173224 Ga0065715_101732242 139
1508 3300005293 Ga0065715_10199617 Ga0065715_101996172 139
1509 3300005330 Ga0070690_100054302 Ga0070690_1000543021 139
1510 3300005331 Ga0070670_100001040 Ga0070670_1000010404 139
1511 3300005331 Ga0070670_100106464 Ga0070670_1001064642 139
1512 3300005334 Ga0068869_100008540 Ga0068869_1000085403 139
1513 3300005338 Ga0068868_100058339 Ga0068868_1000583392 139
1514 3300005340 Ga0070689_100008455 Ga0070689_1000084558 139
1515 3300005340 Ga0070689_100455143 Ga0070689_1004551431 139
1516 3300005341 Ga0070691_10493324 Ga0070691_104933242 139
1517 3300005343 Ga0070687_100051400 Ga0070687_1000514002 139
1518 3300005344 Ga0070661_101807308 Ga0070661_1018073081 139
1519 3300005353 Ga0070669_100010550 Ga0070669_1000105502 139
1520 3300005353 Ga0070669_100215814 Ga0070669_1002158142 139
1521 3300005354 Ga0070675_100148639 Ga0070675_1001486393 139
1522 3300005355 Ga0070671_100040270 Ga0070671_1000402701 139
1523 3300005364 Ga0070673_100157691 Ga0070673_1001576912 139
1524 3300005364 Ga0070673_100192820 Ga0070673_1001928202 139
1525 3300005364 Ga0070673_100401517 Ga0070673_1004015172 139
1526 3300005438 Ga0070701_10170363 Ga0070701_101703632 139
1527 3300005444 Ga0070694_100048971 Ga0070694_1000489714 139
1528 3300005444 Ga0070694_100225127 Ga0070694_1002251272 139
1529 3300005456 Ga0070678_100034036 Ga0070678_1000340362 139
1530 3300005457 Ga0070662_100438500 Ga0070662_1004385002 139
1531 3300005458 Ga0070681_10002318 Ga0070681_1000231811 139
1532 3300005459 Ga0068867_100014412 Ga0068867_1000144125 139
1533 3300005518 Ga0070699_100007696 Ga0070699_1000076967 139
1534 3300005518 Ga0070699_100553469 Ga0070699_1005534692 139
1535 3300005543 Ga0070672_101028988 Ga0070672_1010289882 139
1536 3300005544 Ga0070686_100003700 Ga0070686_1000037009 139
1537 3300005544 Ga0070686_100240668 Ga0070686_1002406681 139
1538 3300005545 Ga0070695_101346962 Ga0070695_1013469621 139
1539 3300005547 Ga0070693_100223508 Ga0070693_1002235082 139
1540 3300005549 Ga0070704_100013265 Ga0070704_1000132652 139
1541 3300005549 Ga0070704_101293653 Ga0070704_1012936531 139
1542 3300005564 Ga0070664_100514407 Ga0070664_1005144072 139
1543 3300005564 Ga0070664_101373420 Ga0070664_1013734202 139
1544 3300005578 Ga0068854_100298402 Ga0068854_1002984023 139
1545 3300005614 Ga0068856_100907324 Ga0068856_1009073242 139
1546 3300005615 Ga0070702_101357921 Ga0070702_1013579211 139
1547 3300005616 Ga0068852_102516591 Ga0068852_1025165912 139
1548 3300005617 Ga0068859_100065591 Ga0068859_1000655915 139
1549 3300005617 Ga0068859_100705542 Ga0068859_1007055422 139
1550 3300005618 Ga0068864_100251706 Ga0068864_1002517063 139
1551 3300005618 Ga0068864_100970709 Ga0068864_1009707092 139
1552 3300005718 Ga0068866_10761773 Ga0068866_107617731 139
1553 3300005719 Ga0068861_100162462 Ga0068861_1001624622 139
1554 3300005719 Ga0068861_100422401 Ga0068861_1004224012 139
1555 3300005841 Ga0068863_100732956 Ga0068863_1007329562 139
1556 3300005842 Ga0068858_100043731 Ga0068858_1000437315 139
1557 3300005843 Ga0068860_100458266 Ga0068860_1004582662 139
1558 3300005844 Ga0068862_100030627 Ga0068862_1000306272 139
1559 3300006237 Ga0097621_100005455 Ga0097621_1000054558 139
1560 3300006358 Ga0068871_100012016 Ga0068871_1000120168 139
1561 3300006881 Ga0068865_100008775 Ga0068865_1000087756 139
1562 3300006931 Ga0097620_100065597 Ga0097620_1000655971 139
1563 3300006931 Ga0097620_100705541 Ga0097620_1007055412 139
1564 3300009092 Ga0105250_10088759 Ga0105250_100887592 139
1565 3300009098 Ga0105245_10094033 Ga0105245_100940332 139
1566 3300009174 Ga0105241_10957807 Ga0105241_109578071 139
1567 3300009176 Ga0105242_10165728 Ga0105242_101657282 139
1568 3300009176 Ga0105242_10258618 Ga0105242_102586181 139
1569 3300009176 Ga0105242_10497431 Ga0105242_104974312 139
1570 3300009177 Ga0105248_10027794 Ga0105248_100277944 139
1571 3300009553 Ga0105249_10420922 Ga0105249_104209222 139
1572 3300010375 Ga0105239_10814171 Ga0105239_108141711 139
1573 3300011119 Ga0105246_10281191 Ga0105246_102811911 139
1574 3300011119 Ga0105246_10706463 Ga0105246_107064631 139
1575 3300013296 Ga0157374_10157907 Ga0157374_101579071 139
1576 3300013297 Ga0157378_10008939 Ga0157378_100089395 139
1577 3300013297 Ga0157378_10088964 Ga0157378_100889644 139
1578 3300013306 Ga0163162_11272983 Ga0163162_112729832 139
1579 3300013308 Ga0157375_10472937 Ga0157375_104729372 139
1580 3300014325 Ga0163163_11172833 Ga0163163_111728332 139
1581 3300014326 Ga0157380_10064316 Ga0157380_100643163 139
1582 3300014326 Ga0157380_10067362 Ga0157380_100673622 139
1583 3300014745 Ga0157377_10090425 Ga0157377_100904253 139
1584 3300014969 Ga0157376_10053347 Ga0157376_100533475 139
1585 3300025899 Ga0207642_10690851 Ga0207642_106908512 139
1586 3300025901 Ga0207688_10174282 Ga0207688_101742821 139
1587 3300025904 Ga0207647_10048150 Ga0207647_100481503 139
1588 3300025912 Ga0207707_10002535 Ga0207707_1000253511 139
1589 3300025918 Ga0207662_10183865 Ga0207662_101838653 139
1590 3300025920 Ga0207649_11318412 Ga0207649_113184121 139
1591 3300025923 Ga0207681_10003629 Ga0207681_100036295 139
1592 3300025925 Ga0207650_10000890 Ga0207650_1000089019 139
1593 3300025925 Ga0207650_10084053 Ga0207650_100840533 139
1594 3300025926 Ga0207659_10445546 Ga0207659_104455461 139
1595 3300025927 Ga0207687_10152692 Ga0207687_101526923 139
1596 3300025927 Ga0207687_10696560 Ga0207687_106965602 139
1597 3300025927 Ga0207687_10721981 Ga0207687_107219812 139
1598 3300025927 Ga0207687_11071540 Ga0207687_110715402 139
1599 3300025934 Ga0207686_10126538 Ga0207686_101265382 139
1600 3300025934 Ga0207686_10358533 Ga0207686_103585331 139
1601 3300025935 Ga0207709_10002207 Ga0207709_100022077 139
1602 3300025935 Ga0207709_10588451 Ga0207709_105884512 139
1603 3300025936 Ga0207670_10345063 Ga0207670_103450631 139
1604 3300025936 Ga0207670_10434920 Ga0207670_104349202 139
1605 3300025940 Ga0207691_10008014 Ga0207691_100080146 139
1606 3300025942 Ga0207689_10002507 Ga0207689_1000250712 139
1607 3300025945 Ga0207679_11232765 Ga0207679_112327651 139
1608 3300025960 Ga0207651_10666329 Ga0207651_106663292 139
1609 3300025961 Ga0207712_10228662 Ga0207712_102286622 139
1610 3300026035 Ga0207703_10327072 Ga0207703_103270722 139
1611 3300026089 Ga0207648_10007657 Ga0207648_100076578 139
1612 3300026089 Ga0207648_10112325 Ga0207648_101123253 139
1613 3300026095 Ga0207676_10538282 Ga0207676_105382822 139
1614 3300026095 Ga0207676_10728913 Ga0207676_107289131 139
1615 3300026118 Ga0207675_100032877 Ga0207675_1000328775 139
1616 3300026118 Ga0207675_100230470 Ga0207675_1002304702 139
1617 3300026118 Ga0207675_100974190 Ga0207675_1009741902 139
1618 3300026142 Ga0207698_11601646 Ga0207698_116016461 139
1619 3300028380 Ga0268265_10085532 Ga0268265_100855322 139
1620 3300028381 Ga0268264_10198856 Ga0268264_101988561 139
1621 3300035092 Ga0373952_0110218 Ga0373952_0110218_297_716 139
1622 3300038698 Ga0242419_002104 Ga0242419_002104_697_1116 139
1623 3300038996 Ga0242420_037852 Ga0242420_037852_393_812 139
1624 3300039437 Ga0436365_0228365 Ga0436365_0228365_5251_5685 139
1625 3300048909 Ga0496106_0120172 Ga0496106_0120172_1454_1873 139
1626 3300048910 Ga0496107_0490031 Ga0496107_0490031_183_602 139
1627 3300048911 Ga0496108_0108156 Ga0496108_0108156_362_781 139
1628 3300053153 Ga0500616_0003347 Ga0500616_0003347_11444_11893 139

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08211

dCMP_cyt_deam_2

Cytidine and deoxycytidylate deaminase zinc-binding region

1

82

0.87

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

3

108

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d30-assembly1.cif.gz_A crystal structure of cytidine deaminase cdd-2 (ba4525) from bacillus anthracis at 2.40a resolution 0.9676 7 125
1ux1-assembly1.cif.gz_D bacillus subtilis cytidine deaminase with a cys53his and an arg56gln substitution 0.9641 4 131
1ux0-assembly1.cif.gz_B-2 bacillus subtilis cytidine deaminase with an arg56 - gln substitution 0.9602 4 130
1jtk-assembly1.cif.gz_A crystal structure of cytidine deaminase from bacillus subtilis in complex with the inhibitor tetrahydrodeoxyuridine 0.9596 4 131
3dmo-assembly1.cif.gz_C 1.6 a crystal structure of cytidine deaminase from burkholderia pseudomallei 0.9528 7 126
ID Description Score Start End Superfamily
1r5tD00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9495 5 126 3.40.140.10
af_A0A1D8PMQ1_5_145_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9463 1 131 3.40.140.10
af_Q2FY04_3_129_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9371 6 127 3.40.140.10
af_F1QSJ0_1_133_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9357 7 133 3.40.140.10
af_Q4DCG1_17_164_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9178 1 126 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A7C6A9V7-F1-model_v4 Cytidine deaminase (EC 3.5.4.5) (Cytidine aminohydrolase) 0.9725 7 126 GO:0004126
GO:0005829
GO:0008270
GO:0009972
GO:0042802
AF-A0A2V5JFK7-F1-model_v4 Cytidine deaminase (EC 3.5.4.5) (Cytidine aminohydrolase) 0.972 8 123 GO:0004126
GO:0005829
GO:0008270
GO:0009972
GO:0042802
AF-A0A2V7WNS3-F1-model_v4 Cytidine deaminase 0.971 9 111 GO:0004126
GO:0005829
GO:0008270
GO:0009972
GO:0042802
AF-A0A5S5AUG5-F1-model_v4 Cytidine deaminase (EC 3.5.4.5) (Cytidine aminohydrolase) 0.9693 4 127 GO:0004126
GO:0005829
GO:0008270
GO:0009972
GO:0042802
AF-A0A3M1EYQ5-F1-model_v4 Cytidine deaminase (EC 3.5.4.5) (Cytidine aminohydrolase) 0.9685 7 134 GO:0004126
GO:0005829
GO:0008270
GO:0009972
GO:0042802

Feature Viewer

pLDDT pTM Quality
90.28 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map