F495104
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1626 | 401 | 3252 | 381 |
Family's Representative Sequence
| Representative Sequence | 3300046472|Ga0495580_0052397|Ga0495580_0052397_327_1520 |
| Length | 388 |
| Sequence | MSKARVLVGTRKGAFILTSDGKREKWDVSGPHFAGWEMYHLKGSPADPNRIYASQTSGWFGQIIQRSDDGGKTWIQPGTPPKAASNKFVYDASAETGKPLTTHQFYDGTQHPWEFKRVWHLEPSLTDPDTVYAGVEDAAIFRSTDGGENWKELPGLRGHGTGPKWQPGAGGMCLHTIILDPSSRTPETQRMWIAISAAGAFRTDDGGKSWKPINRGLRSQYIPDPTAEIGHCVHHVAMNPKRPGVLFMQKHWDVMRSDDAGDNWKEISGNLPTDFGFVIDVHAHEPETIYVVPIKSDSEHYVHEGKLRVYRSRTGGNEWEALTKGLPQKDCYVNVLRDAMAIDSLDKCGVYFGTTGGQVYCSADAGDSWNPIVRDLPAVLSVEVQTLG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 125 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 126 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 127 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 128 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 129 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 208 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 209 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 210 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 211 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 213 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 214 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 215 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 216 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 218 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 219 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 220 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 222 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 223 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 224 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 225 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 226 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 227 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 228 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 229 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 230 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 231 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 232 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 233 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 234 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 238 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 239 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 240 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 241 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 244 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 245 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 246 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 247 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 250 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 251 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 252 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 254 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 256 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 257 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 258 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 259 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 260 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 261 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 262 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 263 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 264 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 265 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 266 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 267 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 268 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 269 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 270 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 271 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 272 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 273 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 274 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 275 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 317 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 318 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 319 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 320 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 321 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 322 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 325 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 326 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 327 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 328 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 329 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 330 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 331 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 332 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 333 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 334 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 335 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 336 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 337 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 338 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 339 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 364 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 365 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 366 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 367 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 368 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 369 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 370 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 371 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 372 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 373 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 378 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 379 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 380 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 381 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 382 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 397 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 401 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.2 |
| Metatranscriptomes | 0.74 |
| Isolates | 0.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.06 |
| Nodule | 0 |
| Rhizoplane | 3.38 |
| Rhizosphere | 96.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495580_0052397 | 3300046472 | Bacteria | 2882 |
| 2 | JGI24751J29686_10000120 | 3300002459 | Bacteria | 39900 |
| 3 | Ga0058862_12620782 | 3300004803 | Bacteria | 1470 |
| 4 | Ga0065714_10064428 | 3300005288 | Bacteria | 144890 |
| 5 | Ga0065704_10001277 | 3300005289 | Bacteria | 9704 |
| 6 | Ga0065704_10108277 | 3300005289 | Bacteria | 2033 |
| 7 | Ga0065712_10000115 | 3300005290 | Bacteria | 144502 |
| 8 | Ga0065712_10069774 | 3300005290 | Bacteria | 6727 |
| 9 | Ga0065712_10070131 | 3300005290 | Bacteria | 6302 |
| 10 | Ga0065712_10083698 | 3300005290 | Unclassified | 2817 |
| 11 | Ga0065715_10000647 | 3300005293 | Bacteria | 14365 |
| 12 | Ga0065715_10015359 | 3300005293 | Bacteria | 5108 |
| 13 | Ga0065715_10089908 | 3300005293 | Bacteria | 8159 |
| 14 | Ga0065715_10090909 | 3300005293 | Bacteria | 6321 |
| 15 | Ga0065715_10100101 | 3300005293 | Bacteria | 3337 |
| 16 | Ga0065715_10107769 | 3300005293 | Bacteria | 2754 |
| 17 | Ga0065707_10001190 | 3300005295 | Bacteria | 10559 |
| 18 | Ga0065707_10008524 | 3300005295 | Bacteria | 2161 |
| 19 | Ga0065707_10085301 | 3300005295 | Bacteria | 6272 |
| 20 | Ga0065707_10103437 | 3300005295 | Bacteria | 2748 |
| 21 | Ga0065707_10108824 | 3300005295 | Bacteria | 2494 |
| 22 | Ga0065707_10130174 | 3300005295 | Bacteria | 1934 |
| 23 | Ga0070658_10001545 | 3300005327 | Bacteria | 19509 |
| 24 | Ga0070658_10021430 | 3300005327 | Bacteria | 5179 |
| 25 | Ga0070658_10149331 | 3300005327 | Bacteria | 1956 |
| 26 | Ga0070676_10011613 | 3300005328 | Bacteria | 4789 |
| 27 | Ga0070683_100005437 | 3300005329 | Bacteria | 10641 |
| 28 | Ga0070683_100006023 | 3300005329 | Bacteria | 10164 |
| 29 | Ga0070683_100021720 | 3300005329 | Bacteria | 5731 |
| 30 | Ga0070683_100052420 | 3300005329 | Bacteria | 3779 |
| 31 | Ga0070690_100007430 | 3300005330 | Bacteria | 6279 |
| 32 | Ga0070690_100125050 | 3300005330 | Bacteria | 1730 |
| 33 | Ga0070670_100000043 | 3300005331 | Bacteria | 141622 |
| 34 | Ga0070670_100004607 | 3300005331 | Bacteria | 11566 |
| 35 | Ga0070670_100004867 | 3300005331 | Bacteria | 11295 |
| 36 | Ga0070670_100006424 | 3300005331 | Bacteria | 9948 |
| 37 | Ga0070670_100246265 | 3300005331 | Bacteria | 1556 |
| 38 | Ga0068869_100036220 | 3300005334 | Bacteria | 3502 |
| 39 | Ga0068869_100151332 | 3300005334 | Bacteria | 1800 |
| 40 | Ga0070666_10001198 | 3300005335 | Bacteria | 15683 |
| 41 | Ga0070666_10011769 | 3300005335 | Bacteria | 5501 |
| 42 | Ga0070666_10012869 | 3300005335 | Bacteria | 5291 |
| 43 | Ga0070666_10021795 | 3300005335 | Bacteria | 4154 |
| 44 | Ga0070666_10024561 | 3300005335 | Bacteria | 3927 |
| 45 | Ga0070666_10034466 | 3300005335 | Bacteria | 3355 |
| 46 | Ga0070666_10147081 | 3300005335 | Bacteria | 1643 |
| 47 | Ga0070680_100004112 | 3300005336 | Bacteria | 10899 |
| 48 | Ga0070680_100005517 | 3300005336 | Bacteria | 9572 |
| 49 | Ga0070680_100016220 | 3300005336 | Bacteria | 5859 |
| 50 | Ga0070680_100056506 | 3300005336 | Bacteria | 3208 |
| 51 | Ga0070680_100135609 | 3300005336 | Bacteria | 2062 |
| 52 | Ga0070680_100176906 | 3300005336 | Bacteria | 1796 |
| 53 | Ga0070682_100029484 | 3300005337 | Bacteria | 3304 |
| 54 | Ga0070682_100037579 | 3300005337 | Bacteria | 2965 |
| 55 | Ga0068868_100006584 | 3300005338 | Bacteria | 8234 |
| 56 | Ga0068868_100010972 | 3300005338 | Bacteria | 6582 |
| 57 | Ga0068868_100019019 | 3300005338 | Bacteria | 5142 |
| 58 | Ga0068868_100019429 | 3300005338 | Bacteria | 5091 |
| 59 | Ga0068868_100019499 | 3300005338 | Bacteria | 5082 |
| 60 | Ga0068868_100026589 | 3300005338 | Bacteria | 4412 |
| 61 | Ga0068868_100027582 | 3300005338 | Bacteria | 4333 |
| 62 | Ga0068868_100040288 | 3300005338 | Bacteria | 3635 |
| 63 | Ga0068868_100064561 | 3300005338 | Bacteria | 2906 |
| 64 | Ga0068868_100065695 | 3300005338 | Bacteria | 2882 |
| 65 | Ga0070660_100016969 | 3300005339 | Bacteria | 5300 |
| 66 | Ga0070660_100030187 | 3300005339 | Bacteria | 4065 |
| 67 | Ga0070660_100048794 | 3300005339 | Bacteria | 3252 |
| 68 | Ga0070689_100092330 | 3300005340 | Bacteria | 2388 |
| 69 | Ga0070691_10020523 | 3300005341 | Bacteria | 3053 |
| 70 | Ga0070691_10024587 | 3300005341 | Bacteria | 2800 |
| 71 | Ga0070687_100003020 | 3300005343 | Bacteria | 6470 |
| 72 | Ga0070687_100006473 | 3300005343 | Bacteria | 4803 |
| 73 | Ga0070661_100002573 | 3300005344 | Bacteria | 12433 |
| 74 | Ga0070661_100010832 | 3300005344 | Bacteria | 6348 |
| 75 | Ga0070661_100011851 | 3300005344 | Bacteria | 6082 |
| 76 | Ga0070692_10000274 | 3300005345 | Bacteria | 14462 |
| 77 | Ga0070692_10012877 | 3300005345 | Bacteria | 3885 |
| 78 | Ga0070692_10016597 | 3300005345 | Bacteria | 3503 |
| 79 | Ga0070692_10096097 | 3300005345 | Bacteria | 1618 |
| 80 | Ga0070668_100018117 | 3300005347 | Bacteria | 5283 |
| 81 | Ga0070668_100025873 | 3300005347 | Bacteria | 4450 |
| 82 | Ga0070669_100015211 | 3300005353 | Bacteria | 5480 |
| 83 | Ga0070669_100019108 | 3300005353 | Bacteria | 4898 |
| 84 | Ga0070669_100032301 | 3300005353 | Bacteria | 3781 |
| 85 | Ga0070675_100016132 | 3300005354 | Bacteria | 5922 |
| 86 | Ga0070675_100027542 | 3300005354 | Bacteria | 4567 |
| 87 | Ga0070675_100053952 | 3300005354 | Bacteria | 3306 |
| 88 | Ga0070675_100352603 | 3300005354 | Bacteria | 1305 |
| 89 | Ga0070671_100001359 | 3300005355 | Bacteria | 18333 |
| 90 | Ga0070671_100007649 | 3300005355 | Bacteria | 8640 |
| 91 | Ga0070671_100009235 | 3300005355 | Bacteria | 7920 |
| 92 | Ga0070671_100027814 | 3300005355 | Bacteria | 4655 |
| 93 | Ga0070671_100054230 | 3300005355 | Bacteria | 3333 |
| 94 | Ga0070671_100065467 | 3300005355 | Bacteria | 3027 |
| 95 | Ga0070673_100021354 | 3300005364 | Bacteria | 4692 |
| 96 | Ga0070673_100043035 | 3300005364 | Bacteria | 3486 |
| 97 | Ga0070673_100055557 | 3300005364 | Unclassified | 3120 |
| 98 | Ga0070659_100009587 | 3300005366 | Bacteria | 7117 |
| 99 | Ga0070659_100019729 | 3300005366 | Bacteria | 5115 |
| 100 | Ga0070659_100024456 | 3300005366 | Bacteria | 4630 |
| 101 | Ga0070659_100151602 | 3300005366 | Bacteria | 1891 |
| 102 | Ga0070667_100013915 | 3300005367 | Bacteria | 6652 |
| 103 | Ga0070667_100025250 | 3300005367 | Bacteria | 4939 |
| 104 | Ga0070667_100109883 | 3300005367 | Bacteria | 2390 |
| 105 | Ga0070667_100122466 | 3300005367 | Bacteria | 2263 |
| 106 | Ga0070703_10000391 | 3300005406 | Bacteria | 18426 |
| 107 | Ga0070703_10000622 | 3300005406 | Bacteria | 12543 |
| 108 | Ga0070709_10000133 | 3300005434 | Bacteria | 49469 |
| 109 | Ga0070709_10000540 | 3300005434 | Bacteria | 22135 |
| 110 | Ga0070709_10022027 | 3300005434 | Bacteria | 3721 |
| 111 | Ga0070709_10057008 | 3300005434 | Bacteria | 2473 |
| 112 | Ga0070709_10094370 | 3300005434 | Bacteria | 1979 |
| 113 | Ga0070709_10141399 | 3300005434 | Bacteria | 1654 |
| 114 | Ga0070709_10203260 | 3300005434 | Bacteria | 1404 |
| 115 | Ga0070714_100000040 | 3300005435 | Bacteria | 119253 |
| 116 | Ga0070714_100002222 | 3300005435 | Bacteria | 14300 |
| 117 | Ga0070714_100006753 | 3300005435 | Bacteria | 8893 |
| 118 | Ga0070714_100091889 | 3300005435 | Bacteria | 2660 |
| 119 | Ga0070714_100141105 | 3300005435 | Bacteria | 2163 |
| 120 | Ga0070713_100000909 | 3300005436 | Bacteria | 18927 |
| 121 | Ga0070713_100001436 | 3300005436 | Bacteria | 15282 |
| 122 | Ga0070713_100005469 | 3300005436 | Bacteria | 8686 |
| 123 | Ga0070713_100088597 | 3300005436 | Bacteria | 2656 |
| 124 | Ga0070713_100097108 | 3300005436 | Bacteria | 2545 |
| 125 | Ga0070713_100098878 | 3300005436 | Bacteria | 2524 |
| 126 | Ga0070713_100112095 | 3300005436 | Bacteria | 2380 |
| 127 | Ga0070713_100127285 | 3300005436 | Bacteria | 2242 |
| 128 | Ga0070713_100129883 | 3300005436 | Bacteria | 2220 |
| 129 | Ga0070713_100208371 | 3300005436 | Bacteria | 1769 |
| 130 | Ga0070713_100243603 | 3300005436 | Bacteria | 1638 |
| 131 | Ga0070710_10006691 | 3300005437 | Bacteria | 5552 |
| 132 | Ga0070710_10100160 | 3300005437 | Bacteria | 1724 |
| 133 | Ga0070701_10029524 | 3300005438 | Bacteria | 2706 |
| 134 | Ga0070701_10050502 | 3300005438 | Bacteria | 2154 |
| 135 | Ga0070711_100000291 | 3300005439 | Bacteria | 26041 |
| 136 | Ga0070711_100010503 | 3300005439 | Bacteria | 5734 |
| 137 | Ga0070711_100010753 | 3300005439 | Bacteria | 5674 |
| 138 | Ga0070711_100017806 | 3300005439 | Bacteria | 4527 |
| 139 | Ga0070711_100036114 | 3300005439 | Bacteria | 3310 |
| 140 | Ga0070711_100072428 | 3300005439 | Bacteria | 2431 |
| 141 | Ga0070711_100149909 | 3300005439 | Bacteria | 1758 |
| 142 | Ga0070705_100000159 | 3300005440 | Bacteria | 39496 |
| 143 | Ga0070705_100001456 | 3300005440 | Bacteria | 12510 |
| 144 | Ga0070705_100014997 | 3300005440 | Bacteria | 3998 |
| 145 | Ga0070705_100021022 | 3300005440 | Bacteria | 3465 |
| 146 | Ga0070700_100013133 | 3300005441 | Bacteria | 4646 |
| 147 | Ga0070700_100093396 | 3300005441 | Bacteria | 1968 |
| 148 | Ga0070694_100007383 | 3300005444 | Bacteria | 6702 |
| 149 | Ga0070694_100020047 | 3300005444 | Bacteria | 4258 |
| 150 | Ga0070694_100023289 | 3300005444 | Bacteria | 3980 |
| 151 | Ga0070708_100000882 | 3300005445 | Bacteria | 22663 |
| 152 | Ga0070708_100001890 | 3300005445 | Bacteria | 16085 |
| 153 | Ga0070708_100002244 | 3300005445 | Bacteria | 14935 |
| 154 | Ga0070708_100005972 | 3300005445 | Bacteria | 9678 |
| 155 | Ga0070708_100028679 | 3300005445 | Bacteria | 4793 |
| 156 | Ga0070708_100032515 | 3300005445 | Bacteria | 4526 |
| 157 | Ga0070708_100056548 | 3300005445 | Bacteria | 3490 |
| 158 | Ga0070708_100085405 | 3300005445 | Bacteria | 2864 |
| 159 | Ga0070708_100087124 | 3300005445 | Bacteria | 2837 |
| 160 | Ga0070708_100138847 | 3300005445 | Bacteria | 2253 |
| 161 | Ga0070708_100336098 | 3300005445 | Bacteria | 1423 |
| 162 | Ga0070708_100449585 | 3300005445 | Bacteria | 1215 |
| 163 | Ga0070663_100007044 | 3300005455 | Bacteria | 6814 |
| 164 | Ga0070663_100013151 | 3300005455 | Bacteria | 5263 |
| 165 | Ga0070663_100042560 | 3300005455 | Bacteria | 3192 |
| 166 | Ga0070663_100125892 | 3300005455 | Bacteria | 1941 |
| 167 | Ga0070663_100249906 | 3300005455 | Bacteria | 1403 |
| 168 | Ga0070678_100082180 | 3300005456 | Bacteria | 2445 |
| 169 | Ga0070678_100088089 | 3300005456 | Bacteria | 2372 |
| 170 | Ga0070678_100209024 | 3300005456 | Bacteria | 1616 |
| 171 | Ga0070662_100005158 | 3300005457 | Bacteria | 8331 |
| 172 | Ga0070662_100008021 | 3300005457 | Bacteria | 6870 |
| 173 | Ga0070662_100013657 | 3300005457 | Bacteria | 5407 |
| 174 | Ga0070662_100114778 | 3300005457 | Bacteria | 2056 |
| 175 | Ga0070681_10000336 | 3300005458 | Bacteria | 38138 |
| 176 | Ga0070681_10000522 | 3300005458 | Bacteria | 31464 |
| 177 | Ga0070681_10002898 | 3300005458 | Bacteria | 15861 |
| 178 | Ga0070681_10008460 | 3300005458 | Bacteria | 10070 |
| 179 | Ga0070681_10016966 | 3300005458 | Bacteria | 7275 |
| 180 | Ga0070681_10025629 | 3300005458 | Bacteria | 5931 |
| 181 | Ga0070681_10169158 | 3300005458 | Bacteria | 2108 |
| 182 | Ga0068867_100005074 | 3300005459 | Bacteria | 9298 |
| 183 | Ga0068867_100030585 | 3300005459 | Bacteria | 3883 |
| 184 | Ga0070685_10002868 | 3300005466 | Bacteria | 8816 |
| 185 | Ga0070706_100001280 | 3300005467 | Bacteria | 26834 |
| 186 | Ga0070706_100001585 | 3300005467 | Bacteria | 23707 |
| 187 | Ga0070706_100001656 | 3300005467 | Bacteria | 23195 |
| 188 | Ga0070706_100002927 | 3300005467 | Bacteria | 16986 |
| 189 | Ga0070706_100007958 | 3300005467 | Bacteria | 9894 |
| 190 | Ga0070706_100008623 | 3300005467 | Bacteria | 9501 |
| 191 | Ga0070706_100013267 | 3300005467 | Bacteria | 7621 |
| 192 | Ga0070706_100055938 | 3300005467 | Bacteria | 3641 |
| 193 | Ga0070706_100158953 | 3300005467 | Bacteria | 2110 |
| 194 | Ga0070706_100160090 | 3300005467 | Bacteria | 2102 |
| 195 | Ga0070706_100161830 | 3300005467 | Bacteria | 2090 |
| 196 | Ga0070706_100199811 | 3300005467 | Bacteria | 1868 |
| 197 | Ga0070706_100199877 | 3300005467 | Bacteria | 1867 |
| 198 | Ga0070706_100321104 | 3300005467 | Bacteria | 1444 |
| 199 | Ga0070707_100000896 | 3300005468 | Bacteria | 29593 |
| 200 | Ga0070707_100001006 | 3300005468 | Bacteria | 27918 |
| 201 | Ga0070707_100016371 | 3300005468 | Bacteria | 6957 |
| 202 | Ga0070707_100020107 | 3300005468 | Bacteria | 6296 |
| 203 | Ga0070707_100035574 | 3300005468 | Bacteria | 4751 |
| 204 | Ga0070707_100114366 | 3300005468 | Bacteria | 2618 |
| 205 | Ga0070707_100170388 | 3300005468 | Bacteria | 2122 |
| 206 | Ga0070707_100279189 | 3300005468 | Bacteria | 1623 |
| 207 | Ga0070707_100305263 | 3300005468 | Bacteria | 1547 |
| 208 | Ga0070698_100000547 | 3300005471 | Bacteria | 40166 |
| 209 | Ga0070698_100000807 | 3300005471 | Bacteria | 34196 |
| 210 | Ga0070698_100000903 | 3300005471 | Bacteria | 32615 |
| 211 | Ga0070698_100010100 | 3300005471 | Bacteria | 10083 |
| 212 | Ga0070698_100013422 | 3300005471 | Bacteria | 8672 |
| 213 | Ga0070698_100025018 | 3300005471 | Bacteria | 6223 |
| 214 | Ga0070698_100048951 | 3300005471 | Bacteria | 4317 |
| 215 | Ga0070698_100067349 | 3300005471 | Bacteria | 3601 |
| 216 | Ga0070699_100000009 | 3300005518 | Bacteria | 272902 |
| 217 | Ga0070699_100000604 | 3300005518 | Bacteria | 33879 |
| 218 | Ga0070699_100003267 | 3300005518 | Bacteria | 14346 |
| 219 | Ga0070699_100009092 | 3300005518 | Bacteria | 8614 |
| 220 | Ga0070699_100009322 | 3300005518 | Bacteria | 8501 |
| 221 | Ga0070699_100049756 | 3300005518 | Bacteria | 3627 |
| 222 | Ga0070699_100123226 | 3300005518 | Bacteria | 2280 |
| 223 | Ga0070679_100000256 | 3300005530 | Bacteria | 44524 |
| 224 | Ga0070679_100018782 | 3300005530 | Bacteria | 6712 |
| 225 | Ga0070679_100031254 | 3300005530 | Bacteria | 5258 |
| 226 | Ga0070679_100034588 | 3300005530 | Bacteria | 5008 |
| 227 | Ga0070679_100041167 | 3300005530 | Bacteria | 4599 |
| 228 | Ga0070679_100041412 | 3300005530 | Bacteria | 4584 |
| 229 | Ga0070679_100053396 | 3300005530 | Bacteria | 4023 |
| 230 | Ga0070679_100111371 | 3300005530 | Bacteria | 2723 |
| 231 | Ga0070679_100165213 | 3300005530 | Bacteria | 2187 |
| 232 | Ga0070684_100002736 | 3300005535 | Bacteria | 13041 |
| 233 | Ga0070684_100006313 | 3300005535 | Bacteria | 9159 |
| 234 | Ga0070684_100008389 | 3300005535 | Bacteria | 8072 |
| 235 | Ga0070684_100009079 | 3300005535 | Bacteria | 7815 |
| 236 | Ga0070684_100010849 | 3300005535 | Bacteria | 7239 |
| 237 | Ga0070684_100058920 | 3300005535 | Bacteria | 3357 |
| 238 | Ga0070684_100099411 | 3300005535 | Bacteria | 2597 |
| 239 | Ga0070684_100135393 | 3300005535 | Bacteria | 2225 |
| 240 | Ga0070684_100153548 | 3300005535 | Bacteria | 2087 |
| 241 | Ga0070697_100000104 | 3300005536 | Bacteria | 66905 |
| 242 | Ga0070697_100000654 | 3300005536 | Bacteria | 26101 |
| 243 | Ga0070697_100001122 | 3300005536 | Bacteria | 20239 |
| 244 | Ga0070697_100001492 | 3300005536 | Bacteria | 17798 |
| 245 | Ga0070697_100001710 | 3300005536 | Bacteria | 16768 |
| 246 | Ga0070697_100002461 | 3300005536 | Bacteria | 14253 |
| 247 | Ga0070697_100004546 | 3300005536 | Bacteria | 10668 |
| 248 | Ga0070697_100007091 | 3300005536 | Bacteria | 8719 |
| 249 | Ga0070697_100029678 | 3300005536 | Bacteria | 4386 |
| 250 | Ga0070697_100083597 | 3300005536 | Bacteria | 2632 |
| 251 | Ga0070697_100264259 | 3300005536 | Bacteria | 1474 |
| 252 | Ga0068853_100000048 | 3300005539 | Bacteria | 93122 |
| 253 | Ga0068853_100010594 | 3300005539 | Bacteria | 7456 |
| 254 | Ga0068853_100031804 | 3300005539 | Bacteria | 4466 |
| 255 | Ga0068853_100147430 | 3300005539 | Bacteria | 2116 |
| 256 | Ga0068853_100302300 | 3300005539 | Unclassified | 1479 |
| 257 | Ga0070672_100006886 | 3300005543 | Bacteria | 7682 |
| 258 | Ga0070672_100031427 | 3300005543 | Bacteria | 3996 |
| 259 | Ga0070686_100003256 | 3300005544 | Bacteria | 8885 |
| 260 | Ga0070695_100001346 | 3300005545 | Bacteria | 13619 |
| 261 | Ga0070695_100004778 | 3300005545 | Bacteria | 7973 |
| 262 | Ga0070695_100007323 | 3300005545 | Bacteria | 6541 |
| 263 | Ga0070695_100024981 | 3300005545 | Bacteria | 3685 |
| 264 | Ga0070695_100034966 | 3300005545 | Bacteria | 3155 |
| 265 | Ga0070695_100083952 | 3300005545 | Bacteria | 2112 |
| 266 | Ga0070695_100095846 | 3300005545 | Bacteria | 1989 |
| 267 | Ga0070695_100191524 | 3300005545 | Bacteria | 1456 |
| 268 | Ga0070696_100002232 | 3300005546 | Bacteria | 12773 |
| 269 | Ga0070696_100002792 | 3300005546 | Bacteria | 11590 |
| 270 | Ga0070696_100019685 | 3300005546 | Bacteria | 4572 |
| 271 | Ga0070696_100031087 | 3300005546 | Bacteria | 3658 |
| 272 | Ga0070696_100036974 | 3300005546 | Bacteria | 3368 |
| 273 | Ga0070696_100066576 | 3300005546 | Bacteria | 2526 |
| 274 | Ga0070696_100104869 | 3300005546 | Bacteria | 2030 |
| 275 | Ga0070696_100135433 | 3300005546 | Bacteria | 1795 |
| 276 | Ga0070696_100148078 | 3300005546 | Bacteria | 1721 |
| 277 | Ga0070693_100000295 | 3300005547 | Bacteria | 23286 |
| 278 | Ga0070693_100000381 | 3300005547 | Bacteria | 20152 |
| 279 | Ga0070693_100025235 | 3300005547 | Bacteria | 3197 |
| 280 | Ga0070693_100028799 | 3300005547 | Bacteria | 3023 |
| 281 | Ga0070693_100044046 | 3300005547 | Bacteria | 2523 |
| 282 | Ga0070693_100142302 | 3300005547 | Bacteria | 1511 |
| 283 | Ga0070665_100011924 | 3300005548 | Bacteria | 8776 |
| 284 | Ga0070665_100022857 | 3300005548 | Bacteria | 6296 |
| 285 | Ga0070665_100035962 | 3300005548 | Bacteria | 4982 |
| 286 | Ga0070665_100062233 | 3300005548 | Bacteria | 3742 |
| 287 | Ga0070665_100175372 | 3300005548 | Bacteria | 2144 |
| 288 | Ga0070704_100002299 | 3300005549 | Bacteria | 10686 |
| 289 | Ga0070704_100006994 | 3300005549 | Bacteria | 6692 |
| 290 | Ga0070704_100045581 | 3300005549 | Bacteria | 3052 |
| 291 | Ga0070704_100045905 | 3300005549 | Bacteria | 3042 |
| 292 | Ga0070704_100180525 | 3300005549 | Bacteria | 1688 |
| 293 | Ga0068855_100003334 | 3300005563 | Bacteria | 19648 |
| 294 | Ga0068855_100003436 | 3300005563 | Bacteria | 19376 |
| 295 | Ga0068855_100005200 | 3300005563 | Bacteria | 15871 |
| 296 | Ga0068855_100013025 | 3300005563 | Bacteria | 10033 |
| 297 | Ga0068855_100013917 | 3300005563 | Bacteria | 9702 |
| 298 | Ga0068855_100014525 | 3300005563 | Bacteria | 9484 |
| 299 | Ga0068855_100015210 | 3300005563 | Bacteria | 9265 |
| 300 | Ga0068855_100019296 | 3300005563 | Bacteria | 8194 |
| 301 | Ga0068855_100022704 | 3300005563 | Bacteria | 7518 |
| 302 | Ga0068855_100039422 | 3300005563 | Bacteria | 5608 |
| 303 | Ga0068855_100082460 | 3300005563 | Bacteria | 3727 |
| 304 | Ga0068855_100085385 | 3300005563 | Bacteria | 3652 |
| 305 | Ga0068855_100121979 | 3300005563 | Unclassified | 2983 |
| 306 | Ga0068855_100149173 | 3300005563 | Bacteria | 2659 |
| 307 | Ga0070664_100001644 | 3300005564 | Bacteria | 17900 |
| 308 | Ga0070664_100009100 | 3300005564 | Bacteria | 8061 |
| 309 | Ga0068857_100010222 | 3300005577 | Bacteria | 8156 |
| 310 | Ga0068857_100012067 | 3300005577 | Bacteria | 7513 |
| 311 | Ga0068857_100024622 | 3300005577 | Bacteria | 5301 |
| 312 | Ga0068857_100161237 | 3300005577 | Bacteria | 2035 |
| 313 | Ga0068857_100177778 | 3300005577 | Bacteria | 1936 |
| 314 | Ga0068854_100009566 | 3300005578 | Bacteria | 6256 |
| 315 | Ga0068854_100012318 | 3300005578 | Bacteria | 5596 |
| 316 | Ga0068854_100028579 | 3300005578 | Bacteria | 3854 |
| 317 | Ga0068854_100039895 | 3300005578 | Bacteria | 3310 |
| 318 | Ga0068856_100001110 | 3300005614 | Bacteria | 28423 |
| 319 | Ga0068856_100001672 | 3300005614 | Bacteria | 23230 |
| 320 | Ga0068856_100004082 | 3300005614 | Bacteria | 14600 |
| 321 | Ga0068856_100006502 | 3300005614 | Bacteria | 11462 |
| 322 | Ga0068856_100009067 | 3300005614 | Bacteria | 9680 |
| 323 | Ga0068856_100024476 | 3300005614 | Bacteria | 5879 |
| 324 | Ga0068856_100025967 | 3300005614 | Bacteria | 5712 |
| 325 | Ga0068856_100056710 | 3300005614 | Bacteria | 3866 |
| 326 | Ga0068856_100092273 | 3300005614 | Bacteria | 3013 |
| 327 | Ga0068856_100152232 | 3300005614 | Bacteria | 2322 |
| 328 | Ga0068856_100234289 | 3300005614 | Bacteria | 1851 |
| 329 | Ga0070702_100020512 | 3300005615 | Bacteria | 3464 |
| 330 | Ga0070702_100097040 | 3300005615 | Bacteria | 1800 |
| 331 | Ga0068852_100000076 | 3300005616 | Bacteria | 69262 |
| 332 | Ga0068852_100000105 | 3300005616 | Bacteria | 55996 |
| 333 | Ga0068852_100011445 | 3300005616 | Bacteria | 6680 |
| 334 | Ga0068852_100034465 | 3300005616 | Bacteria | 4212 |
| 335 | Ga0068852_100082145 | 3300005616 | Bacteria | 2862 |
| 336 | Ga0068852_100102967 | 3300005616 | Bacteria | 2581 |
| 337 | Ga0068852_100175153 | 3300005616 | Bacteria | 2014 |
| 338 | Ga0068852_100241018 | 3300005616 | Bacteria | 1728 |
| 339 | Ga0068859_100009430 | 3300005617 | Bacteria | 9861 |
| 340 | Ga0068859_100022464 | 3300005617 | Bacteria | 6325 |
| 341 | Ga0068859_100044802 | 3300005617 | Bacteria | 4445 |
| 342 | Ga0068859_100055512 | 3300005617 | Bacteria | 3986 |
| 343 | Ga0068859_100138393 | 3300005617 | Bacteria | 2508 |
| 344 | Ga0068859_100160234 | 3300005617 | Bacteria | 2329 |
| 345 | Ga0068859_100384249 | 3300005617 | Bacteria | 1499 |
| 346 | Ga0068864_100004375 | 3300005618 | Bacteria | 11597 |
| 347 | Ga0068864_100250619 | 3300005618 | Bacteria | 1644 |
| 348 | Ga0068866_10043888 | 3300005718 | Bacteria | 2234 |
| 349 | Ga0068861_100004428 | 3300005719 | Bacteria | 9421 |
| 350 | Ga0068861_100024430 | 3300005719 | Bacteria | 4370 |
| 351 | Ga0068861_100046094 | 3300005719 | Bacteria | 3286 |
| 352 | Ga0068851_10019624 | 3300005834 | Bacteria | 3267 |
| 353 | Ga0068851_10027451 | 3300005834 | Bacteria | 2806 |
| 354 | Ga0068851_10028472 | 3300005834 | Bacteria | 2761 |
| 355 | Ga0068851_10067541 | 3300005834 | Bacteria | 1844 |
| 356 | Ga0068870_10028644 | 3300005840 | Unclassified | 2798 |
| 357 | Ga0068863_100002808 | 3300005841 | Bacteria | 17254 |
| 358 | Ga0068863_100010405 | 3300005841 | Bacteria | 9041 |
| 359 | Ga0068863_100010788 | 3300005841 | Bacteria | 8864 |
| 360 | Ga0068863_100016382 | 3300005841 | Bacteria | 7110 |
| 361 | Ga0068863_100016745 | 3300005841 | Bacteria | 7033 |
| 362 | Ga0068863_100029528 | 3300005841 | Bacteria | 5233 |
| 363 | Ga0068863_100042105 | 3300005841 | Bacteria | 4340 |
| 364 | Ga0068863_100087969 | 3300005841 | Bacteria | 2944 |
| 365 | Ga0068863_100162830 | 3300005841 | Bacteria | 2138 |
| 366 | Ga0068863_100218812 | 3300005841 | Bacteria | 1834 |
| 367 | Ga0068858_100001937 | 3300005842 | Bacteria | 21103 |
| 368 | Ga0068858_100009186 | 3300005842 | Bacteria | 9447 |
| 369 | Ga0068858_100017354 | 3300005842 | Bacteria | 6752 |
| 370 | Ga0068858_100031330 | 3300005842 | Bacteria | 4938 |
| 371 | Ga0068858_100034200 | 3300005842 | Bacteria | 4713 |
| 372 | Ga0068858_100053428 | 3300005842 | Bacteria | 3737 |
| 373 | Ga0068858_100086412 | 3300005842 | Unclassified | 2917 |
| 374 | Ga0068858_100217559 | 3300005842 | Bacteria | 1809 |
| 375 | Ga0068858_100277817 | 3300005842 | Bacteria | 1594 |
| 376 | Ga0068860_100000881 | 3300005843 | Bacteria | 33318 |
| 377 | Ga0068860_100009680 | 3300005843 | Bacteria | 9573 |
| 378 | Ga0068860_100016293 | 3300005843 | Bacteria | 7248 |
| 379 | Ga0068860_100021636 | 3300005843 | Bacteria | 6226 |
| 380 | Ga0068860_100043455 | 3300005843 | Bacteria | 4287 |
| 381 | Ga0068860_100079747 | 3300005843 | Bacteria | 3113 |
| 382 | Ga0068860_100080476 | 3300005843 | Bacteria | 3098 |
| 383 | Ga0068860_100113580 | 3300005843 | Bacteria | 2590 |
| 384 | Ga0068860_100130784 | 3300005843 | Bacteria | 2408 |
| 385 | Ga0068860_100251048 | 3300005843 | Bacteria | 1723 |
| 386 | Ga0068860_100280619 | 3300005843 | Bacteria | 1628 |
| 387 | Ga0068862_100033428 | 3300005844 | Bacteria | 4347 |
| 388 | Ga0068862_100138832 | 3300005844 | Bacteria | 2156 |
| 389 | Ga0081455_10001038 | 3300005937 | Bacteria | 35067 |
| 390 | Ga0081538_10006544 | 3300005981 | Bacteria | 10233 |
| 391 | Ga0070717_10002115 | 3300006028 | Bacteria | 13932 |
| 392 | Ga0070717_10003229 | 3300006028 | Bacteria | 11641 |
| 393 | Ga0070717_10003449 | 3300006028 | Bacteria | 11316 |
| 394 | Ga0070717_10015357 | 3300006028 | Bacteria | 5914 |
| 395 | Ga0070717_10017383 | 3300006028 | Bacteria | 5597 |
| 396 | Ga0070717_10036763 | 3300006028 | Bacteria | 3973 |
| 397 | Ga0070717_10039715 | 3300006028 | Bacteria | 3830 |
| 398 | Ga0070717_10041538 | 3300006028 | Bacteria | 3749 |
| 399 | Ga0070717_10050970 | 3300006028 | Bacteria | 3404 |
| 400 | Ga0070717_10064131 | 3300006028 | Bacteria | 3051 |
| 401 | Ga0070717_10072899 | 3300006028 | Bacteria | 2868 |
| 402 | Ga0070717_10109998 | 3300006028 | Bacteria | 2349 |
| 403 | Ga0070715_10001646 | 3300006163 | Bacteria | 6617 |
| 404 | Ga0070716_100000236 | 3300006173 | Bacteria | 22090 |
| 405 | Ga0070716_100001167 | 3300006173 | Bacteria | 11586 |
| 406 | Ga0070716_100011110 | 3300006173 | Bacteria | 4531 |
| 407 | Ga0070716_100054039 | 3300006173 | Bacteria | 2293 |
| 408 | Ga0070716_100104423 | 3300006173 | Bacteria | 1744 |
| 409 | Ga0070712_100000105 | 3300006175 | Bacteria | 43144 |
| 410 | Ga0070712_100001546 | 3300006175 | Bacteria | 14064 |
| 411 | Ga0070712_100015943 | 3300006175 | Bacteria | 4847 |
| 412 | Ga0070712_100024893 | 3300006175 | Bacteria | 3972 |
| 413 | Ga0097621_100000400 | 3300006237 | Bacteria | 30201 |
| 414 | Ga0097621_100000984 | 3300006237 | Bacteria | 20000 |
| 415 | Ga0097621_100001784 | 3300006237 | Bacteria | 14761 |
| 416 | Ga0097621_100004225 | 3300006237 | Bacteria | 9974 |
| 417 | Ga0097621_100006110 | 3300006237 | Bacteria | 8525 |
| 418 | Ga0097621_100011269 | 3300006237 | Bacteria | 6582 |
| 419 | Ga0097621_100027791 | 3300006237 | Bacteria | 4452 |
| 420 | Ga0097621_100078491 | 3300006237 | Bacteria | 2743 |
| 421 | Ga0068871_100001709 | 3300006358 | Bacteria | 14760 |
| 422 | Ga0068871_100004841 | 3300006358 | Bacteria | 9408 |
| 423 | Ga0068871_100008533 | 3300006358 | Bacteria | 7365 |
| 424 | Ga0068871_100020248 | 3300006358 | Bacteria | 5094 |
| 425 | Ga0068871_100020342 | 3300006358 | Bacteria | 5083 |
| 426 | Ga0068871_100023304 | 3300006358 | Bacteria | 4786 |
| 427 | Ga0068871_100079058 | 3300006358 | Bacteria | 2720 |
| 428 | Ga0075428_100089457 | 3300006844 | Bacteria | 3358 |
| 429 | Ga0075428_100246947 | 3300006844 | Bacteria | 1924 |
| 430 | Ga0075428_100254929 | 3300006844 | Bacteria | 1890 |
| 431 | Ga0075428_100255809 | 3300006844 | Bacteria | 1886 |
| 432 | Ga0075430_100002760 | 3300006846 | Bacteria | 14668 |
| 433 | Ga0075430_100005178 | 3300006846 | Bacteria | 10983 |
| 434 | Ga0075430_100049326 | 3300006846 | Bacteria | 3553 |
| 435 | Ga0075431_100109862 | 3300006847 | Bacteria | 2846 |
| 436 | Ga0075431_100197239 | 3300006847 | Bacteria | 2061 |
| 437 | Ga0075431_100240746 | 3300006847 | Bacteria | 1841 |
| 438 | Ga0075433_10000563 | 3300006852 | Bacteria | 24441 |
| 439 | Ga0075433_10017113 | 3300006852 | Bacteria | 5996 |
| 440 | Ga0075433_10041458 | 3300006852 | Bacteria | 3989 |
| 441 | Ga0075433_10045871 | 3300006852 | Bacteria | 3800 |
| 442 | Ga0075433_10051085 | 3300006852 | Bacteria | 3600 |
| 443 | Ga0075433_10093016 | 3300006852 | Bacteria | 2667 |
| 444 | Ga0075434_100001285 | 3300006871 | Bacteria | 20928 |
| 445 | Ga0075434_100002609 | 3300006871 | Bacteria | 15896 |
| 446 | Ga0075434_100020031 | 3300006871 | Bacteria | 6479 |
| 447 | Ga0075434_100044985 | 3300006871 | Bacteria | 4379 |
| 448 | Ga0075434_100052335 | 3300006871 | Bacteria | 4057 |
| 449 | Ga0075434_100064564 | 3300006871 | Bacteria | 3645 |
| 450 | Ga0075434_100101495 | 3300006871 | Bacteria | 2884 |
| 451 | Ga0075434_100125576 | 3300006871 | Bacteria | 2583 |
| 452 | Ga0075434_100279699 | 3300006871 | Bacteria | 1688 |
| 453 | Ga0075429_100306994 | 3300006880 | Bacteria | 1389 |
| 454 | Ga0068865_100013501 | 3300006881 | Bacteria | 5163 |
| 455 | Ga0075436_100000959 | 3300006914 | Bacteria | 19345 |
| 456 | Ga0075436_100001837 | 3300006914 | Bacteria | 14550 |
| 457 | Ga0075436_100003181 | 3300006914 | Bacteria | 11261 |
| 458 | Ga0075436_100004475 | 3300006914 | Bacteria | 9587 |
| 459 | Ga0075436_100009826 | 3300006914 | Bacteria | 6544 |
| 460 | Ga0075436_100018074 | 3300006914 | Bacteria | 4828 |
| 461 | Ga0075436_100022158 | 3300006914 | Bacteria | 4363 |
| 462 | Ga0075436_100060930 | 3300006914 | Bacteria | 2607 |
| 463 | Ga0075436_100088038 | 3300006914 | Unclassified | 2157 |
| 464 | Ga0075436_100173497 | 3300006914 | Bacteria | 1522 |
| 465 | Ga0097620_100009431 | 3300006931 | Bacteria | 9861 |
| 466 | Ga0097620_100022465 | 3300006931 | Bacteria | 6325 |
| 467 | Ga0097620_100044802 | 3300006931 | Bacteria | 4445 |
| 468 | Ga0097620_100055512 | 3300006931 | Bacteria | 3986 |
| 469 | Ga0097620_100138389 | 3300006931 | Bacteria | 2508 |
| 470 | Ga0097620_100160238 | 3300006931 | Bacteria | 2329 |
| 471 | Ga0097620_100384269 | 3300006931 | Bacteria | 1499 |
| 472 | Ga0075435_100000779 | 3300007076 | Bacteria | 19795 |
| 473 | Ga0075435_100002645 | 3300007076 | Bacteria | 11937 |
| 474 | Ga0075435_100033693 | 3300007076 | Bacteria | 4052 |
| 475 | Ga0075435_100039941 | 3300007076 | Bacteria | 3746 |
| 476 | Ga0075435_100055552 | 3300007076 | Bacteria | 3198 |
| 477 | Ga0075435_100105245 | 3300007076 | Bacteria | 2342 |
| 478 | Ga0075435_100137478 | 3300007076 | Bacteria | 2048 |
| 479 | Ga0075435_100186860 | 3300007076 | Bacteria | 1753 |
| 480 | Ga0099794_10008388 | 3300007265 | Bacteria | 4290 |
| 481 | Ga0099794_10019208 | 3300007265 | Bacteria | 3075 |
| 482 | Ga0099794_10029914 | 3300007265 | Bacteria | 2540 |
| 483 | Ga0099794_10090371 | 3300007265 | Bacteria | 1519 |
| 484 | Ga0105240_10001448 | 3300009093 | Bacteria | 40535 |
| 485 | Ga0105240_10001620 | 3300009093 | Bacteria | 38182 |
| 486 | Ga0105240_10006110 | 3300009093 | Bacteria | 17764 |
| 487 | Ga0105240_10006333 | 3300009093 | Bacteria | 17422 |
| 488 | Ga0105240_10006426 | 3300009093 | Bacteria | 17277 |
| 489 | Ga0105240_10007803 | 3300009093 | Bacteria | 15461 |
| 490 | Ga0105240_10011214 | 3300009093 | Bacteria | 12501 |
| 491 | Ga0105240_10017209 | 3300009093 | Bacteria | 9751 |
| 492 | Ga0105240_10025536 | 3300009093 | Bacteria | 7762 |
| 493 | Ga0105240_10026822 | 3300009093 | Bacteria | 7555 |
| 494 | Ga0105240_10054911 | 3300009093 | Bacteria | 4990 |
| 495 | Ga0105240_10055314 | 3300009093 | Bacteria | 4968 |
| 496 | Ga0105240_10095116 | 3300009093 | Bacteria | 3633 |
| 497 | Ga0105240_10097494 | 3300009093 | Bacteria | 3582 |
| 498 | Ga0105240_10128047 | 3300009093 | Bacteria | 3048 |
| 499 | Ga0105240_10391135 | 3300009093 | Bacteria | 1568 |
| 500 | Ga0105240_10451436 | 3300009093 | Bacteria | 1438 |
| 501 | Ga0105240_10496000 | 3300009093 | Bacteria | 1359 |
| 502 | Ga0111539_10000151 | 3300009094 | Bacteria | 79134 |
| 503 | Ga0111539_10033805 | 3300009094 | Bacteria | 6206 |
| 504 | Ga0111539_10108587 | 3300009094 | Bacteria | 3256 |
| 505 | Ga0111539_10109061 | 3300009094 | Bacteria | 3249 |
| 506 | Ga0111539_10170580 | 3300009094 | Bacteria | 2542 |
| 507 | Ga0111539_10249425 | 3300009094 | Bacteria | 2067 |
| 508 | Ga0105245_10009530 | 3300009098 | Bacteria | 8467 |
| 509 | Ga0105245_10032820 | 3300009098 | Bacteria | 4598 |
| 510 | Ga0105245_10046608 | 3300009098 | Bacteria | 3873 |
| 511 | Ga0105245_10085246 | 3300009098 | Bacteria | 2895 |
| 512 | Ga0105245_10143894 | 3300009098 | Bacteria | 2248 |
| 513 | Ga0105245_10144044 | 3300009098 | Bacteria | 2247 |
| 514 | Ga0105245_10168440 | 3300009098 | Bacteria | 2084 |
| 515 | Ga0105247_10000394 | 3300009101 | Bacteria | 37073 |
| 516 | Ga0105247_10001592 | 3300009101 | Bacteria | 16074 |
| 517 | Ga0105247_10054418 | 3300009101 | Bacteria | 2469 |
| 518 | Ga0114129_10007132 | 3300009147 | Bacteria | 15905 |
| 519 | Ga0114129_10063374 | 3300009147 | Bacteria | 5162 |
| 520 | Ga0114129_10087750 | 3300009147 | Bacteria | 4313 |
| 521 | Ga0114129_10122616 | 3300009147 | Bacteria | 3576 |
| 522 | Ga0114129_10163228 | 3300009147 | Bacteria | 3042 |
| 523 | Ga0114129_10441059 | 3300009147 | Bacteria | 1709 |
| 524 | Ga0105241_10000080 | 3300009174 | Bacteria | 71562 |
| 525 | Ga0105241_10000150 | 3300009174 | Bacteria | 49793 |
| 526 | Ga0105241_10002039 | 3300009174 | Bacteria | 15278 |
| 527 | Ga0105241_10004901 | 3300009174 | Bacteria | 9872 |
| 528 | Ga0105241_10022035 | 3300009174 | Bacteria | 4716 |
| 529 | Ga0105241_10043870 | 3300009174 | Bacteria | 3387 |
| 530 | Ga0105241_10053370 | 3300009174 | Bacteria | 3090 |
| 531 | Ga0105242_10015791 | 3300009176 | Bacteria | 5866 |
| 532 | Ga0105242_10035268 | 3300009176 | Bacteria | 4012 |
| 533 | Ga0105242_10244660 | 3300009176 | Bacteria | 1614 |
| 534 | Ga0105248_10027649 | 3300009177 | Bacteria | 6317 |
| 535 | Ga0105248_10033900 | 3300009177 | Bacteria | 5705 |
| 536 | Ga0105248_10035586 | 3300009177 | Bacteria | 5571 |
| 537 | Ga0105248_10049924 | 3300009177 | Bacteria | 4691 |
| 538 | Ga0105248_10099339 | 3300009177 | Bacteria | 3280 |
| 539 | Ga0105248_10140835 | 3300009177 | Bacteria | 2721 |
| 540 | Ga0105248_10588155 | 3300009177 | Bacteria | 1256 |
| 541 | Ga0105237_10011188 | 3300009545 | Bacteria | 9509 |
| 542 | Ga0105237_10013299 | 3300009545 | Bacteria | 8632 |
| 543 | Ga0105237_10020861 | 3300009545 | Bacteria | 6746 |
| 544 | Ga0105237_10115783 | 3300009545 | Bacteria | 2674 |
| 545 | Ga0105237_10280157 | 3300009545 | Bacteria | 1670 |
| 546 | Ga0105238_10000251 | 3300009551 | Bacteria | 59944 |
| 547 | Ga0105238_10000626 | 3300009551 | Bacteria | 37164 |
| 548 | Ga0105238_10001286 | 3300009551 | Bacteria | 25199 |
| 549 | Ga0105238_10003297 | 3300009551 | Bacteria | 16117 |
| 550 | Ga0105238_10007223 | 3300009551 | Bacteria | 11117 |
| 551 | Ga0105238_10009744 | 3300009551 | Bacteria | 9621 |
| 552 | Ga0105238_10050341 | 3300009551 | Bacteria | 4193 |
| 553 | Ga0105238_10064035 | 3300009551 | Bacteria | 3677 |
| 554 | Ga0105238_10154354 | 3300009551 | Bacteria | 2271 |
| 555 | Ga0105238_10236350 | 3300009551 | Bacteria | 1805 |
| 556 | Ga0105249_10008398 | 3300009553 | Bacteria | 8996 |
| 557 | Ga0105249_10017760 | 3300009553 | Bacteria | 6319 |
| 558 | Ga0105249_10031035 | 3300009553 | Bacteria | 4831 |
| 559 | Ga0105249_10127250 | 3300009553 | Bacteria | 2427 |
| 560 | Ga0105239_10000725 | 3300010375 | Bacteria | 46872 |
| 561 | Ga0105239_10005068 | 3300010375 | Bacteria | 15560 |
| 562 | Ga0105239_10014776 | 3300010375 | Bacteria | 8659 |
| 563 | Ga0105239_10018911 | 3300010375 | Bacteria | 7612 |
| 564 | Ga0105239_10039362 | 3300010375 | Bacteria | 5181 |
| 565 | Ga0105239_10047351 | 3300010375 | Bacteria | 4712 |
| 566 | Ga0105239_10066337 | 3300010375 | Bacteria | 3965 |
| 567 | Ga0105239_10121476 | 3300010375 | Bacteria | 2901 |
| 568 | Ga0105239_10193972 | 3300010375 | Bacteria | 2274 |
| 569 | Ga0105239_10225652 | 3300010375 | Bacteria | 2101 |
| 570 | Ga0105239_10328878 | 3300010375 | Bacteria | 1724 |
| 571 | Ga0105246_10001271 | 3300011119 | Bacteria | 14813 |
| 572 | Ga0105246_10005117 | 3300011119 | Bacteria | 7978 |
| 573 | Ga0105246_10032403 | 3300011119 | Bacteria | 3466 |
| 574 | Ga0157370_10000128 | 3300013104 | Bacteria | 90605 |
| 575 | Ga0157370_10019183 | 3300013104 | Bacteria | 6873 |
| 576 | Ga0157370_10039216 | 3300013104 | Bacteria | 4578 |
| 577 | Ga0157370_10072367 | 3300013104 | Bacteria | 3253 |
| 578 | Ga0157370_10158509 | 3300013104 | Bacteria | 2106 |
| 579 | Ga0157369_10000175 | 3300013105 | Bacteria | 90148 |
| 580 | Ga0157369_10000369 | 3300013105 | Bacteria | 59934 |
| 581 | Ga0157369_10000674 | 3300013105 | Bacteria | 44019 |
| 582 | Ga0157369_10004534 | 3300013105 | Bacteria | 16345 |
| 583 | Ga0157369_10007069 | 3300013105 | Bacteria | 12943 |
| 584 | Ga0157369_10007975 | 3300013105 | Bacteria | 12168 |
| 585 | Ga0157369_10009288 | 3300013105 | Bacteria | 11248 |
| 586 | Ga0157369_10014642 | 3300013105 | Bacteria | 8848 |
| 587 | Ga0157369_10015993 | 3300013105 | Bacteria | 8443 |
| 588 | Ga0157369_10028006 | 3300013105 | Bacteria | 6240 |
| 589 | Ga0157369_10046255 | 3300013105 | Bacteria | 4730 |
| 590 | Ga0157369_10064150 | 3300013105 | Bacteria | 3956 |
| 591 | Ga0157369_10114236 | 3300013105 | Bacteria | 2868 |
| 592 | Ga0157369_10194031 | 3300013105 | Bacteria | 2133 |
| 593 | Ga0157369_10300410 | 3300013105 | Bacteria | 1670 |
| 594 | Ga0157374_10000602 | 3300013296 | Bacteria | 31865 |
| 595 | Ga0157374_10001525 | 3300013296 | Bacteria | 19503 |
| 596 | Ga0157374_10001646 | 3300013296 | Bacteria | 18713 |
| 597 | Ga0157374_10002071 | 3300013296 | Bacteria | 16878 |
| 598 | Ga0157374_10002950 | 3300013296 | Bacteria | 14245 |
| 599 | Ga0157374_10003041 | 3300013296 | Bacteria | 14064 |
| 600 | Ga0157374_10003910 | 3300013296 | Bacteria | 12512 |
| 601 | Ga0157374_10009297 | 3300013296 | Bacteria | 8429 |
| 602 | Ga0157374_10014614 | 3300013296 | Bacteria | 6871 |
| 603 | Ga0157374_10023724 | 3300013296 | Bacteria | 5492 |
| 604 | Ga0157374_10036094 | 3300013296 | Bacteria | 4526 |
| 605 | Ga0157374_10065099 | 3300013296 | Bacteria | 3423 |
| 606 | Ga0157374_10070419 | 3300013296 | Bacteria | 3295 |
| 607 | Ga0157374_10083456 | 3300013296 | Bacteria | 3036 |
| 608 | Ga0157374_10124646 | 3300013296 | Bacteria | 2489 |
| 609 | Ga0157374_10265979 | 3300013296 | Bacteria | 1690 |
| 610 | Ga0157378_10000634 | 3300013297 | Bacteria | 32985 |
| 611 | Ga0157378_10000855 | 3300013297 | Bacteria | 28249 |
| 612 | Ga0157378_10002021 | 3300013297 | Bacteria | 18141 |
| 613 | Ga0157378_10002951 | 3300013297 | Bacteria | 15127 |
| 614 | Ga0157378_10003530 | 3300013297 | Bacteria | 13864 |
| 615 | Ga0157378_10003951 | 3300013297 | Bacteria | 13100 |
| 616 | Ga0157378_10005796 | 3300013297 | Bacteria | 10827 |
| 617 | Ga0157378_10014270 | 3300013297 | Bacteria | 6955 |
| 618 | Ga0157378_10026495 | 3300013297 | Bacteria | 5111 |
| 619 | Ga0157378_10032477 | 3300013297 | Bacteria | 4612 |
| 620 | Ga0157378_10066009 | 3300013297 | Bacteria | 3240 |
| 621 | Ga0157378_10074184 | 3300013297 | Bacteria | 3061 |
| 622 | Ga0157378_10080058 | 3300013297 | Bacteria | 2951 |
| 623 | Ga0157378_10094881 | 3300013297 | Bacteria | 2716 |
| 624 | Ga0163162_10001837 | 3300013306 | Bacteria | 19975 |
| 625 | Ga0163162_10015388 | 3300013306 | Bacteria | 7473 |
| 626 | Ga0163162_10020331 | 3300013306 | Bacteria | 6522 |
| 627 | Ga0163162_10023107 | 3300013306 | Bacteria | 6134 |
| 628 | Ga0163162_10025561 | 3300013306 | Bacteria | 5836 |
| 629 | Ga0163162_10029925 | 3300013306 | Bacteria | 5391 |
| 630 | Ga0163162_10084808 | 3300013306 | Bacteria | 3244 |
| 631 | Ga0163162_10090108 | 3300013306 | Bacteria | 3148 |
| 632 | Ga0163162_10123313 | 3300013306 | Bacteria | 2696 |
| 633 | Ga0163162_10189956 | 3300013306 | Bacteria | 2181 |
| 634 | Ga0157372_10000068 | 3300013307 | Bacteria | 111270 |
| 635 | Ga0157372_10000098 | 3300013307 | Bacteria | 90215 |
| 636 | Ga0157372_10000659 | 3300013307 | Bacteria | 37935 |
| 637 | Ga0157372_10001167 | 3300013307 | Bacteria | 28410 |
| 638 | Ga0157372_10002379 | 3300013307 | Bacteria | 20352 |
| 639 | Ga0157372_10003102 | 3300013307 | Bacteria | 17901 |
| 640 | Ga0157372_10004180 | 3300013307 | Bacteria | 15457 |
| 641 | Ga0157372_10005485 | 3300013307 | Bacteria | 13479 |
| 642 | Ga0157372_10005777 | 3300013307 | Bacteria | 13181 |
| 643 | Ga0157372_10025530 | 3300013307 | Bacteria | 6427 |
| 644 | Ga0157372_10026177 | 3300013307 | Bacteria | 6347 |
| 645 | Ga0157372_10034488 | 3300013307 | Bacteria | 5563 |
| 646 | Ga0157372_10036378 | 3300013307 | Bacteria | 5426 |
| 647 | Ga0157372_10057463 | 3300013307 | Bacteria | 4349 |
| 648 | Ga0157372_10066951 | 3300013307 | Bacteria | 4035 |
| 649 | Ga0157372_10073287 | 3300013307 | Bacteria | 3860 |
| 650 | Ga0157372_10091737 | 3300013307 | Bacteria | 3455 |
| 651 | Ga0157372_10092940 | 3300013307 | Bacteria | 3432 |
| 652 | Ga0157372_10103945 | 3300013307 | Bacteria | 3246 |
| 653 | Ga0157372_10119701 | 3300013307 | Bacteria | 3023 |
| 654 | Ga0157372_10125482 | 3300013307 | Bacteria | 2951 |
| 655 | Ga0157372_10184284 | 3300013307 | Bacteria | 2417 |
| 656 | Ga0157375_10018336 | 3300013308 | Bacteria | 6346 |
| 657 | Ga0157375_10038800 | 3300013308 | Bacteria | 4576 |
| 658 | Ga0157375_10040299 | 3300013308 | Bacteria | 4502 |
| 659 | Ga0157375_10053347 | 3300013308 | Bacteria | 3978 |
| 660 | Ga0157375_10323044 | 3300013308 | Bacteria | 1708 |
| 661 | Ga0163163_10000308 | 3300014325 | Bacteria | 48146 |
| 662 | Ga0163163_10004578 | 3300014325 | Bacteria | 11806 |
| 663 | Ga0163163_10012149 | 3300014325 | Bacteria | 7834 |
| 664 | Ga0163163_10027159 | 3300014325 | Bacteria | 5480 |
| 665 | Ga0163163_10041120 | 3300014325 | Bacteria | 4519 |
| 666 | Ga0163163_10051150 | 3300014325 | Bacteria | 4073 |
| 667 | Ga0163163_10155317 | 3300014325 | Bacteria | 2332 |
| 668 | Ga0163163_10240078 | 3300014325 | Bacteria | 1862 |
| 669 | Ga0157379_10051616 | 3300014968 | Bacteria | 3673 |
| 670 | Ga0157379_10107913 | 3300014968 | Bacteria | 2499 |
| 671 | Ga0157379_10171547 | 3300014968 | Bacteria | 1958 |
| 672 | Ga0157376_10000041 | 3300014969 | Bacteria | 120988 |
| 673 | Ga0157376_10001192 | 3300014969 | Bacteria | 17158 |
| 674 | Ga0157376_10004212 | 3300014969 | Bacteria | 9982 |
| 675 | Ga0157376_10019021 | 3300014969 | Bacteria | 5283 |
| 676 | Ga0157376_10035752 | 3300014969 | Bacteria | 4020 |
| 677 | Ga0157376_10076714 | 3300014969 | Bacteria | 2856 |
| 678 | Ga0206356_10154399 | 3300020070 | Bacteria | 2900 |
| 679 | Ga0213873_10001020 | 3300021358 | Bacteria | 4548 |
| 680 | Ga0213871_10001563 | 3300021441 | Bacteria | 3887 |
| 681 | Ga0213871_10023463 | 3300021441 | Bacteria | 1553 |
| 682 | Ga0224570_100051 | 3300022730 | Bacteria | 6090 |
| 683 | Ga0224572_1001234 | 3300024225 | Bacteria | 3678 |
| 684 | Ga0228598_1000169 | 3300024227 | Bacteria | 11469 |
| 685 | Ga0228598_1000528 | 3300024227 | Bacteria | 7976 |
| 686 | Ga0207697_10002784 | 3300025315 | Bacteria | 8914 |
| 687 | Ga0207697_10003372 | 3300025315 | Bacteria | 7931 |
| 688 | Ga0207697_10005868 | 3300025315 | Bacteria | 5641 |
| 689 | Ga0207697_10006400 | 3300025315 | Bacteria | 5332 |
| 690 | Ga0207697_10024591 | 3300025315 | Bacteria | 2465 |
| 691 | Ga0207656_10006657 | 3300025321 | Bacteria | 4172 |
| 692 | Ga0207656_10029474 | 3300025321 | Bacteria | 2261 |
| 693 | Ga0207656_10039267 | 3300025321 | Bacteria | 2001 |
| 694 | Ga0207653_10000081 | 3300025885 | Bacteria | 69110 |
| 695 | Ga0207653_10000107 | 3300025885 | Bacteria | 59076 |
| 696 | Ga0207653_10000386 | 3300025885 | Bacteria | 20016 |
| 697 | Ga0207653_10003362 | 3300025885 | Bacteria | 5048 |
| 698 | Ga0207653_10005402 | 3300025885 | Bacteria | 3996 |
| 699 | Ga0207653_10006333 | 3300025885 | Bacteria | 3692 |
| 700 | Ga0207653_10008942 | 3300025885 | Bacteria | 3126 |
| 701 | Ga0207653_10011509 | 3300025885 | Bacteria | 2760 |
| 702 | Ga0207642_10049324 | 3300025899 | Bacteria | 1892 |
| 703 | Ga0207642_10069656 | 3300025899 | Bacteria | 1669 |
| 704 | Ga0207710_10001603 | 3300025900 | Bacteria | 11070 |
| 705 | Ga0207710_10002034 | 3300025900 | Bacteria | 9616 |
| 706 | Ga0207710_10020144 | 3300025900 | Bacteria | 2850 |
| 707 | Ga0207688_10008152 | 3300025901 | Bacteria | 5694 |
| 708 | Ga0207680_10068403 | 3300025903 | Bacteria | 2191 |
| 709 | Ga0207680_10078873 | 3300025903 | Bacteria | 2063 |
| 710 | Ga0207680_10099890 | 3300025903 | Bacteria | 1863 |
| 711 | Ga0207685_10001742 | 3300025905 | Bacteria | 4728 |
| 712 | Ga0207685_10043273 | 3300025905 | Bacteria | 1696 |
| 713 | Ga0207699_10000137 | 3300025906 | Bacteria | 49548 |
| 714 | Ga0207699_10001136 | 3300025906 | Bacteria | 12600 |
| 715 | Ga0207699_10017588 | 3300025906 | Bacteria | 3767 |
| 716 | Ga0207699_10071431 | 3300025906 | Bacteria | 2123 |
| 717 | Ga0207699_10092270 | 3300025906 | Bacteria | 1903 |
| 718 | Ga0207699_10097257 | 3300025906 | Bacteria | 1860 |
| 719 | Ga0207699_10111597 | 3300025906 | Bacteria | 1753 |
| 720 | Ga0207699_10186938 | 3300025906 | Bacteria | 1396 |
| 721 | Ga0207699_10194459 | 3300025906 | Bacteria | 1371 |
| 722 | Ga0207645_10001830 | 3300025907 | Bacteria | 17145 |
| 723 | Ga0207645_10002865 | 3300025907 | Bacteria | 13362 |
| 724 | Ga0207645_10006746 | 3300025907 | Bacteria | 8199 |
| 725 | Ga0207645_10015775 | 3300025907 | Bacteria | 5009 |
| 726 | Ga0207705_10004304 | 3300025909 | Bacteria | 10777 |
| 727 | Ga0207705_10203831 | 3300025909 | Bacteria | 1499 |
| 728 | Ga0207705_10292935 | 3300025909 | Bacteria | 1247 |
| 729 | Ga0207684_10000161 | 3300025910 | Bacteria | 114989 |
| 730 | Ga0207684_10000236 | 3300025910 | Bacteria | 83977 |
| 731 | Ga0207684_10000768 | 3300025910 | Bacteria | 37301 |
| 732 | Ga0207684_10003969 | 3300025910 | Bacteria | 14166 |
| 733 | Ga0207684_10004721 | 3300025910 | Bacteria | 12779 |
| 734 | Ga0207684_10007415 | 3300025910 | Bacteria | 9875 |
| 735 | Ga0207684_10009366 | 3300025910 | Bacteria | 8653 |
| 736 | Ga0207684_10020611 | 3300025910 | Bacteria | 5633 |
| 737 | Ga0207684_10036911 | 3300025910 | Bacteria | 4147 |
| 738 | Ga0207684_10039136 | 3300025910 | Bacteria | 4024 |
| 739 | Ga0207684_10065414 | 3300025910 | Bacteria | 3087 |
| 740 | Ga0207684_10129262 | 3300025910 | Bacteria | 2168 |
| 741 | Ga0207654_10000180 | 3300025911 | Bacteria | 39043 |
| 742 | Ga0207654_10000548 | 3300025911 | Bacteria | 21477 |
| 743 | Ga0207654_10001207 | 3300025911 | Bacteria | 13830 |
| 744 | Ga0207654_10002654 | 3300025911 | Bacteria | 9078 |
| 745 | Ga0207654_10014094 | 3300025911 | Bacteria | 4125 |
| 746 | Ga0207654_10157432 | 3300025911 | Bacteria | 1464 |
| 747 | Ga0207707_10000190 | 3300025912 | Bacteria | 64802 |
| 748 | Ga0207707_10000298 | 3300025912 | Bacteria | 52211 |
| 749 | Ga0207707_10000766 | 3300025912 | Bacteria | 31578 |
| 750 | Ga0207707_10006111 | 3300025912 | Bacteria | 10527 |
| 751 | Ga0207707_10019589 | 3300025912 | Bacteria | 5905 |
| 752 | Ga0207707_10042156 | 3300025912 | Bacteria | 3985 |
| 753 | Ga0207707_10048844 | 3300025912 | Bacteria | 3686 |
| 754 | Ga0207707_10223151 | 3300025912 | Bacteria | 1640 |
| 755 | Ga0207695_10000047 | 3300025913 | Bacteria | 422459 |
| 756 | Ga0207695_10000150 | 3300025913 | Bacteria | 207099 |
| 757 | Ga0207695_10000162 | 3300025913 | Bacteria | 198155 |
| 758 | Ga0207695_10000474 | 3300025913 | Bacteria | 87178 |
| 759 | Ga0207695_10001894 | 3300025913 | Bacteria | 32659 |
| 760 | Ga0207695_10001900 | 3300025913 | Bacteria | 32599 |
| 761 | Ga0207695_10002040 | 3300025913 | Bacteria | 30959 |
| 762 | Ga0207695_10004291 | 3300025913 | Bacteria | 19545 |
| 763 | Ga0207695_10009043 | 3300025913 | Bacteria | 12380 |
| 764 | Ga0207695_10011870 | 3300025913 | Bacteria | 10500 |
| 765 | Ga0207695_10021258 | 3300025913 | Bacteria | 7410 |
| 766 | Ga0207695_10024140 | 3300025913 | Bacteria | 6849 |
| 767 | Ga0207695_10065312 | 3300025913 | Bacteria | 3741 |
| 768 | Ga0207695_10125451 | 3300025913 | Bacteria | 2530 |
| 769 | Ga0207695_10182285 | 3300025913 | Bacteria | 2020 |
| 770 | Ga0207695_10227648 | 3300025913 | Bacteria | 1770 |
| 771 | Ga0207695_10315621 | 3300025913 | Bacteria | 1453 |
| 772 | Ga0207671_10000155 | 3300025914 | Bacteria | 106931 |
| 773 | Ga0207671_10000894 | 3300025914 | Bacteria | 37708 |
| 774 | Ga0207671_10001417 | 3300025914 | Bacteria | 27842 |
| 775 | Ga0207671_10046009 | 3300025914 | Bacteria | 3228 |
| 776 | Ga0207671_10090656 | 3300025914 | Bacteria | 2303 |
| 777 | Ga0207671_10092693 | 3300025914 | Bacteria | 2278 |
| 778 | Ga0207671_10247483 | 3300025914 | Bacteria | 1401 |
| 779 | Ga0207693_10000016 | 3300025915 | Bacteria | 145892 |
| 780 | Ga0207693_10000065 | 3300025915 | Bacteria | 91476 |
| 781 | Ga0207693_10000777 | 3300025915 | Bacteria | 28620 |
| 782 | Ga0207693_10000812 | 3300025915 | Bacteria | 27865 |
| 783 | Ga0207693_10008215 | 3300025915 | Bacteria | 8549 |
| 784 | Ga0207693_10028082 | 3300025915 | Bacteria | 4446 |
| 785 | Ga0207693_10031092 | 3300025915 | Bacteria | 4218 |
| 786 | Ga0207693_10043122 | 3300025915 | Bacteria | 3551 |
| 787 | Ga0207693_10043174 | 3300025915 | Bacteria | 3548 |
| 788 | Ga0207693_10054152 | 3300025915 | Bacteria | 3148 |
| 789 | Ga0207693_10058107 | 3300025915 | Bacteria | 3030 |
| 790 | Ga0207693_10115788 | 3300025915 | Bacteria | 2105 |
| 791 | Ga0207663_10000007 | 3300025916 | Bacteria | 208566 |
| 792 | Ga0207663_10004549 | 3300025916 | Bacteria | 6909 |
| 793 | Ga0207663_10005767 | 3300025916 | Bacteria | 6270 |
| 794 | Ga0207663_10016071 | 3300025916 | Bacteria | 4142 |
| 795 | Ga0207663_10020937 | 3300025916 | Bacteria | 3713 |
| 796 | Ga0207663_10082400 | 3300025916 | Bacteria | 2110 |
| 797 | Ga0207663_10095904 | 3300025916 | Bacteria | 1980 |
| 798 | Ga0207663_10179199 | 3300025916 | Bacteria | 1512 |
| 799 | Ga0207660_10000117 | 3300025917 | Bacteria | 46029 |
| 800 | Ga0207660_10001691 | 3300025917 | Bacteria | 14787 |
| 801 | Ga0207660_10042653 | 3300025917 | Bacteria | 3185 |
| 802 | Ga0207660_10048029 | 3300025917 | Bacteria | 3020 |
| 803 | Ga0207660_10096144 | 3300025917 | Bacteria | 2205 |
| 804 | Ga0207660_10196521 | 3300025917 | Bacteria | 1573 |
| 805 | Ga0207660_10212296 | 3300025917 | Bacteria | 1516 |
| 806 | Ga0207660_10213233 | 3300025917 | Bacteria | 1513 |
| 807 | Ga0207660_10302663 | 3300025917 | Bacteria | 1273 |
| 808 | Ga0207662_10028035 | 3300025918 | Bacteria | 3253 |
| 809 | Ga0207662_10103932 | 3300025918 | Bacteria | 1763 |
| 810 | Ga0207657_10021358 | 3300025919 | Bacteria | 6095 |
| 811 | Ga0207657_10033636 | 3300025919 | Bacteria | 4618 |
| 812 | Ga0207657_10043307 | 3300025919 | Bacteria | 3966 |
| 813 | Ga0207657_10045562 | 3300025919 | Bacteria | 3848 |
| 814 | Ga0207657_10175883 | 3300025919 | Bacteria | 1732 |
| 815 | Ga0207649_10001760 | 3300025920 | Bacteria | 12425 |
| 816 | Ga0207649_10005074 | 3300025920 | Bacteria | 7118 |
| 817 | Ga0207649_10005520 | 3300025920 | Bacteria | 6848 |
| 818 | Ga0207649_10037715 | 3300025920 | Bacteria | 2921 |
| 819 | Ga0207652_10000028 | 3300025921 | Bacteria | 150429 |
| 820 | Ga0207652_10009201 | 3300025921 | Bacteria | 7952 |
| 821 | Ga0207652_10151457 | 3300025921 | Bacteria | 2077 |
| 822 | Ga0207652_10237841 | 3300025921 | Bacteria | 1641 |
| 823 | Ga0207646_10000012 | 3300025922 | Bacteria | 367049 |
| 824 | Ga0207646_10000014 | 3300025922 | Bacteria | 345047 |
| 825 | Ga0207646_10000880 | 3300025922 | Bacteria | 38839 |
| 826 | Ga0207646_10004919 | 3300025922 | Bacteria | 14289 |
| 827 | Ga0207646_10010635 | 3300025922 | Bacteria | 8961 |
| 828 | Ga0207646_10017978 | 3300025922 | Bacteria | 6603 |
| 829 | Ga0207646_10049482 | 3300025922 | Bacteria | 3764 |
| 830 | Ga0207646_10127328 | 3300025922 | Bacteria | 2290 |
| 831 | Ga0207646_10203589 | 3300025922 | Bacteria | 1788 |
| 832 | Ga0207646_10215294 | 3300025922 | Bacteria | 1735 |
| 833 | Ga0207646_10238694 | 3300025922 | Bacteria | 1642 |
| 834 | Ga0207681_10008159 | 3300025923 | Bacteria | 6401 |
| 835 | Ga0207681_10035812 | 3300025923 | Bacteria | 3272 |
| 836 | Ga0207694_10000142 | 3300025924 | Bacteria | 74189 |
| 837 | Ga0207694_10000146 | 3300025924 | Bacteria | 72706 |
| 838 | Ga0207694_10001250 | 3300025924 | Bacteria | 21954 |
| 839 | Ga0207694_10002693 | 3300025924 | Bacteria | 14365 |
| 840 | Ga0207694_10009282 | 3300025924 | Bacteria | 7422 |
| 841 | Ga0207694_10010358 | 3300025924 | Bacteria | 7028 |
| 842 | Ga0207694_10050540 | 3300025924 | Bacteria | 3220 |
| 843 | Ga0207694_10125355 | 3300025924 | Bacteria | 2054 |
| 844 | Ga0207694_10142321 | 3300025924 | Bacteria | 1929 |
| 845 | Ga0207650_10000009 | 3300025925 | Bacteria | 483583 |
| 846 | Ga0207650_10002938 | 3300025925 | Bacteria | 11756 |
| 847 | Ga0207650_10008266 | 3300025925 | Bacteria | 7104 |
| 848 | Ga0207650_10049649 | 3300025925 | Bacteria | 3099 |
| 849 | Ga0207650_10147725 | 3300025925 | Bacteria | 1853 |
| 850 | Ga0207650_10183591 | 3300025925 | Bacteria | 1668 |
| 851 | Ga0207659_10021721 | 3300025926 | Bacteria | 4266 |
| 852 | Ga0207659_10023201 | 3300025926 | Bacteria | 4138 |
| 853 | Ga0207659_10109868 | 3300025926 | Bacteria | 2094 |
| 854 | Ga0207687_10002949 | 3300025927 | Bacteria | 11543 |
| 855 | Ga0207687_10005869 | 3300025927 | Bacteria | 8120 |
| 856 | Ga0207687_10012150 | 3300025927 | Bacteria | 5632 |
| 857 | Ga0207687_10023707 | 3300025927 | Bacteria | 4093 |
| 858 | Ga0207687_10039715 | 3300025927 | Bacteria | 3223 |
| 859 | Ga0207687_10092709 | 3300025927 | Bacteria | 2206 |
| 860 | Ga0207687_10140123 | 3300025927 | Bacteria | 1834 |
| 861 | Ga0207687_10239494 | 3300025927 | Bacteria | 1437 |
| 862 | Ga0207700_10000249 | 3300025928 | Bacteria | 32162 |
| 863 | Ga0207700_10005659 | 3300025928 | Bacteria | 7499 |
| 864 | Ga0207700_10013298 | 3300025928 | Bacteria | 5348 |
| 865 | Ga0207700_10031842 | 3300025928 | Bacteria | 3752 |
| 866 | Ga0207700_10046680 | 3300025928 | Bacteria | 3205 |
| 867 | Ga0207700_10087042 | 3300025928 | Bacteria | 2456 |
| 868 | Ga0207700_10104291 | 3300025928 | Bacteria | 2268 |
| 869 | Ga0207700_10110509 | 3300025928 | Bacteria | 2211 |
| 870 | Ga0207700_10142967 | 3300025928 | Bacteria | 1968 |
| 871 | Ga0207664_10000029 | 3300025929 | Bacteria | 183815 |
| 872 | Ga0207664_10005745 | 3300025929 | Bacteria | 8486 |
| 873 | Ga0207664_10025183 | 3300025929 | Bacteria | 4478 |
| 874 | Ga0207664_10052622 | 3300025929 | Bacteria | 3220 |
| 875 | Ga0207664_10118330 | 3300025929 | Bacteria | 2213 |
| 876 | Ga0207664_10259785 | 3300025929 | Bacteria | 1518 |
| 877 | Ga0207664_10383790 | 3300025929 | Bacteria | 1247 |
| 878 | Ga0207644_10018151 | 3300025931 | Bacteria | 4757 |
| 879 | Ga0207644_10047216 | 3300025931 | Bacteria | 3071 |
| 880 | Ga0207690_10122155 | 3300025932 | Bacteria | 1893 |
| 881 | Ga0207706_10001735 | 3300025933 | Bacteria | 21441 |
| 882 | Ga0207706_10008234 | 3300025933 | Bacteria | 9621 |
| 883 | Ga0207706_10011568 | 3300025933 | Bacteria | 8035 |
| 884 | Ga0207706_10036754 | 3300025933 | Bacteria | 4350 |
| 885 | Ga0207686_10007098 | 3300025934 | Bacteria | 6028 |
| 886 | Ga0207686_10122559 | 3300025934 | Bacteria | 1771 |
| 887 | Ga0207709_10033794 | 3300025935 | Bacteria | 3007 |
| 888 | Ga0207670_10010469 | 3300025936 | Bacteria | 5347 |
| 889 | Ga0207670_10011904 | 3300025936 | Bacteria | 5066 |
| 890 | Ga0207669_10057513 | 3300025937 | Bacteria | 2368 |
| 891 | Ga0207704_10005744 | 3300025938 | Bacteria | 5736 |
| 892 | Ga0207704_10018832 | 3300025938 | Bacteria | 3614 |
| 893 | Ga0207704_10019243 | 3300025938 | Unclassified | 3582 |
| 894 | Ga0207704_10085456 | 3300025938 | Bacteria | 2054 |
| 895 | Ga0207665_10000107 | 3300025939 | Bacteria | 54377 |
| 896 | Ga0207665_10000115 | 3300025939 | Bacteria | 52837 |
| 897 | Ga0207665_10006151 | 3300025939 | Bacteria | 7973 |
| 898 | Ga0207665_10011547 | 3300025939 | Bacteria | 5801 |
| 899 | Ga0207665_10013313 | 3300025939 | Bacteria | 5406 |
| 900 | Ga0207665_10018887 | 3300025939 | Bacteria | 4530 |
| 901 | Ga0207665_10056712 | 3300025939 | Bacteria | 2645 |
| 902 | Ga0207665_10077872 | 3300025939 | Bacteria | 2276 |
| 903 | Ga0207665_10078308 | 3300025939 | Bacteria | 2270 |
| 904 | Ga0207665_10159328 | 3300025939 | Bacteria | 1622 |
| 905 | Ga0207691_10001183 | 3300025940 | Bacteria | 25941 |
| 906 | Ga0207691_10007812 | 3300025940 | Bacteria | 10298 |
| 907 | Ga0207691_10034931 | 3300025940 | Bacteria | 4671 |
| 908 | Ga0207691_10072500 | 3300025940 | Bacteria | 3106 |
| 909 | Ga0207691_10103418 | 3300025940 | Bacteria | 2540 |
| 910 | Ga0207711_10012699 | 3300025941 | Bacteria | 6996 |
| 911 | Ga0207711_10075155 | 3300025941 | Bacteria | 2940 |
| 912 | Ga0207711_10098700 | 3300025941 | Bacteria | 2581 |
| 913 | Ga0207711_10099190 | 3300025941 | Bacteria | 2574 |
| 914 | Ga0207711_10107388 | 3300025941 | Bacteria | 2478 |
| 915 | Ga0207711_10121126 | 3300025941 | Bacteria | 2336 |
| 916 | Ga0207711_10160979 | 3300025941 | Bacteria | 2031 |
| 917 | Ga0207689_10023387 | 3300025942 | Bacteria | 5187 |
| 918 | Ga0207689_10027588 | 3300025942 | Bacteria | 4751 |
| 919 | Ga0207689_10033576 | 3300025942 | Bacteria | 4263 |
| 920 | Ga0207689_10051707 | 3300025942 | Bacteria | 3387 |
| 921 | Ga0207689_10056964 | 3300025942 | Bacteria | 3215 |
| 922 | Ga0207689_10059021 | 3300025942 | Bacteria | 3156 |
| 923 | Ga0207689_10187239 | 3300025942 | Bacteria | 1707 |
| 924 | Ga0207661_10005695 | 3300025944 | Bacteria | 8788 |
| 925 | Ga0207661_10007197 | 3300025944 | Bacteria | 7906 |
| 926 | Ga0207661_10012611 | 3300025944 | Bacteria | 6151 |
| 927 | Ga0207661_10034334 | 3300025944 | Bacteria | 3943 |
| 928 | Ga0207661_10041428 | 3300025944 | Bacteria | 3626 |
| 929 | Ga0207661_10188446 | 3300025944 | Bacteria | 1807 |
| 930 | Ga0207679_10002619 | 3300025945 | Bacteria | 11095 |
| 931 | Ga0207667_10000900 | 3300025949 | Bacteria | 37930 |
| 932 | Ga0207667_10003139 | 3300025949 | Bacteria | 20454 |
| 933 | Ga0207667_10003680 | 3300025949 | Bacteria | 18901 |
| 934 | Ga0207667_10009576 | 3300025949 | Bacteria | 11400 |
| 935 | Ga0207667_10011340 | 3300025949 | Bacteria | 10365 |
| 936 | Ga0207667_10013112 | 3300025949 | Bacteria | 9513 |
| 937 | Ga0207667_10020778 | 3300025949 | Bacteria | 7293 |
| 938 | Ga0207667_10028534 | 3300025949 | Bacteria | 6061 |
| 939 | Ga0207667_10040048 | 3300025949 | Bacteria | 4989 |
| 940 | Ga0207667_10060479 | 3300025949 | Bacteria | 3964 |
| 941 | Ga0207667_10175414 | 3300025949 | Bacteria | 2202 |
| 942 | Ga0207667_10237178 | 3300025949 | Bacteria | 1867 |
| 943 | Ga0207667_10383675 | 3300025949 | Bacteria | 1431 |
| 944 | Ga0207712_10031248 | 3300025961 | Bacteria | 3585 |
| 945 | Ga0207712_10065405 | 3300025961 | Bacteria | 2595 |
| 946 | Ga0207712_10142931 | 3300025961 | Bacteria | 1839 |
| 947 | Ga0207712_10181640 | 3300025961 | Bacteria | 1653 |
| 948 | Ga0207668_10007215 | 3300025972 | Bacteria | 6600 |
| 949 | Ga0207668_10029996 | 3300025972 | Bacteria | 3570 |
| 950 | Ga0207640_10018350 | 3300025981 | Bacteria | 4110 |
| 951 | Ga0207640_10083305 | 3300025981 | Bacteria | 2192 |
| 952 | Ga0207640_10124867 | 3300025981 | Bacteria | 1851 |
| 953 | Ga0207640_10126774 | 3300025981 | Bacteria | 1839 |
| 954 | Ga0207640_10191687 | 3300025981 | Bacteria | 1541 |
| 955 | Ga0207640_10248335 | 3300025981 | Bacteria | 1379 |
| 956 | Ga0207658_10020950 | 3300025986 | Bacteria | 4531 |
| 957 | Ga0207658_10021723 | 3300025986 | Bacteria | 4459 |
| 958 | Ga0207658_10097652 | 3300025986 | Bacteria | 2294 |
| 959 | Ga0207658_10105019 | 3300025986 | Bacteria | 2221 |
| 960 | Ga0207658_10380438 | 3300025986 | Bacteria | 1236 |
| 961 | Ga0207677_10000782 | 3300026023 | Bacteria | 18219 |
| 962 | Ga0207677_10004076 | 3300026023 | Bacteria | 7809 |
| 963 | Ga0207677_10014586 | 3300026023 | Bacteria | 4595 |
| 964 | Ga0207677_10020052 | 3300026023 | Bacteria | 4051 |
| 965 | Ga0207677_10028891 | 3300026023 | Bacteria | 3515 |
| 966 | Ga0207677_10043914 | 3300026023 | Bacteria | 2974 |
| 967 | Ga0207677_10065677 | 3300026023 | Bacteria | 2533 |
| 968 | Ga0207677_10100680 | 3300026023 | Bacteria | 2125 |
| 969 | Ga0207703_10003901 | 3300026035 | Bacteria | 12382 |
| 970 | Ga0207703_10020759 | 3300026035 | Bacteria | 5140 |
| 971 | Ga0207703_10042321 | 3300026035 | Bacteria | 3654 |
| 972 | Ga0207703_10069296 | 3300026035 | Bacteria | 2908 |
| 973 | Ga0207703_10110581 | 3300026035 | Bacteria | 2344 |
| 974 | Ga0207703_10128400 | 3300026035 | Bacteria | 2186 |
| 975 | Ga0207703_10272339 | 3300026035 | Bacteria | 1534 |
| 976 | Ga0207639_10000098 | 3300026041 | Bacteria | 73865 |
| 977 | Ga0207639_10168926 | 3300026041 | Bacteria | 1850 |
| 978 | Ga0207639_10242664 | 3300026041 | Bacteria | 1567 |
| 979 | Ga0207678_10000337 | 3300026067 | Bacteria | 42242 |
| 980 | Ga0207678_10015004 | 3300026067 | Bacteria | 6816 |
| 981 | Ga0207678_10026533 | 3300026067 | Bacteria | 5053 |
| 982 | Ga0207678_10116710 | 3300026067 | Bacteria | 2277 |
| 983 | Ga0207678_10227803 | 3300026067 | Bacteria | 1596 |
| 984 | Ga0207708_10000366 | 3300026075 | Bacteria | 35298 |
| 985 | Ga0207708_10013327 | 3300026075 | Bacteria | 6141 |
| 986 | Ga0207708_10016142 | 3300026075 | Bacteria | 5610 |
| 987 | Ga0207708_10115441 | 3300026075 | Bacteria | 2088 |
| 988 | Ga0207708_10116580 | 3300026075 | Bacteria | 2078 |
| 989 | Ga0207702_10000926 | 3300026078 | Bacteria | 30268 |
| 990 | Ga0207702_10001220 | 3300026078 | Bacteria | 26059 |
| 991 | Ga0207702_10004275 | 3300026078 | Bacteria | 12746 |
| 992 | Ga0207702_10004419 | 3300026078 | Bacteria | 12499 |
| 993 | Ga0207702_10007182 | 3300026078 | Bacteria | 9532 |
| 994 | Ga0207702_10018691 | 3300026078 | Bacteria | 5733 |
| 995 | Ga0207702_10019311 | 3300026078 | Bacteria | 5639 |
| 996 | Ga0207702_10068332 | 3300026078 | Bacteria | 3052 |
| 997 | Ga0207702_10126619 | 3300026078 | Bacteria | 2294 |
| 998 | Ga0207702_10222875 | 3300026078 | Bacteria | 1758 |
| 999 | Ga0207702_10236560 | 3300026078 | Bacteria | 1709 |
| 1000 | Ga0207702_10240291 | 3300026078 | Bacteria | 1696 |
| 1001 | Ga0207641_10002695 | 3300026088 | Bacteria | 16208 |
| 1002 | Ga0207641_10003181 | 3300026088 | Bacteria | 14697 |
| 1003 | Ga0207641_10008851 | 3300026088 | Bacteria | 8312 |
| 1004 | Ga0207641_10018864 | 3300026088 | Bacteria | 5658 |
| 1005 | Ga0207641_10041073 | 3300026088 | Bacteria | 3876 |
| 1006 | Ga0207641_10050785 | 3300026088 | Bacteria | 3510 |
| 1007 | Ga0207641_10070295 | 3300026088 | Bacteria | 3008 |
| 1008 | Ga0207641_10218077 | 3300026088 | Bacteria | 1768 |
| 1009 | Ga0207648_10012183 | 3300026089 | Bacteria | 8055 |
| 1010 | Ga0207648_10013725 | 3300026089 | Bacteria | 7521 |
| 1011 | Ga0207648_10048083 | 3300026089 | Bacteria | 3736 |
| 1012 | Ga0207648_10157934 | 3300026089 | Bacteria | 2002 |
| 1013 | Ga0207676_10006298 | 3300026095 | Bacteria | 8382 |
| 1014 | Ga0207676_10007056 | 3300026095 | Bacteria | 7961 |
| 1015 | Ga0207676_10017626 | 3300026095 | Bacteria | 5178 |
| 1016 | Ga0207676_10078521 | 3300026095 | Bacteria | 2674 |
| 1017 | Ga0207676_10334556 | 3300026095 | Bacteria | 1395 |
| 1018 | Ga0207674_10001827 | 3300026116 | Bacteria | 27162 |
| 1019 | Ga0207674_10001977 | 3300026116 | Bacteria | 25960 |
| 1020 | Ga0207674_10003452 | 3300026116 | Bacteria | 19332 |
| 1021 | Ga0207674_10003850 | 3300026116 | Bacteria | 18292 |
| 1022 | Ga0207674_10018736 | 3300026116 | Bacteria | 7513 |
| 1023 | Ga0207674_10020820 | 3300026116 | Bacteria | 7079 |
| 1024 | Ga0207674_10041619 | 3300026116 | Bacteria | 4750 |
| 1025 | Ga0207674_10048470 | 3300026116 | Bacteria | 4348 |
| 1026 | Ga0207674_10053136 | 3300026116 | Bacteria | 4130 |
| 1027 | Ga0207674_10068065 | 3300026116 | Bacteria | 3584 |
| 1028 | Ga0207674_10079994 | 3300026116 | Bacteria | 3272 |
| 1029 | Ga0207674_10093088 | 3300026116 | Bacteria | 3003 |
| 1030 | Ga0207674_10179644 | 3300026116 | Bacteria | 2068 |
| 1031 | Ga0207674_10244274 | 3300026116 | Bacteria | 1742 |
| 1032 | Ga0207675_100002429 | 3300026118 | Bacteria | 18455 |
| 1033 | Ga0207675_100036053 | 3300026118 | Bacteria | 4613 |
| 1034 | Ga0207675_100052340 | 3300026118 | Bacteria | 3810 |
| 1035 | Ga0207675_100071479 | 3300026118 | Bacteria | 3244 |
| 1036 | Ga0207675_100147709 | 3300026118 | Bacteria | 2236 |
| 1037 | Ga0207683_10001884 | 3300026121 | Bacteria | 18560 |
| 1038 | Ga0207683_10004963 | 3300026121 | Bacteria | 11440 |
| 1039 | Ga0207683_10030494 | 3300026121 | Bacteria | 4672 |
| 1040 | Ga0207683_10144986 | 3300026121 | Bacteria | 2141 |
| 1041 | Ga0207698_10000031 | 3300026142 | Bacteria | 113280 |
| 1042 | Ga0207698_10000241 | 3300026142 | Bacteria | 33787 |
| 1043 | Ga0207698_10002673 | 3300026142 | Bacteria | 10600 |
| 1044 | Ga0207698_10046018 | 3300026142 | Bacteria | 3291 |
| 1045 | Ga0207698_10057186 | 3300026142 | Bacteria | 3016 |
| 1046 | Ga0207698_10171993 | 3300026142 | Bacteria | 1909 |
| 1047 | Ga0207698_10192918 | 3300026142 | Bacteria | 1817 |
| 1048 | Ga0207698_10195581 | 3300026142 | Bacteria | 1806 |
| 1049 | Ga0209967_1002658 | 3300027364 | Bacteria | 2325 |
| 1050 | Ga0209588_1001413 | 3300027671 | Bacteria | 6260 |
| 1051 | Ga0209588_1004921 | 3300027671 | Bacteria | 3798 |
| 1052 | Ga0209588_1007796 | 3300027671 | Bacteria | 3162 |
| 1053 | Ga0209974_10000168 | 3300027876 | Bacteria | 20024 |
| 1054 | Ga0209974_10002473 | 3300027876 | Bacteria | 6686 |
| 1055 | Ga0207428_10000643 | 3300027907 | Bacteria | 41046 |
| 1056 | Ga0207428_10030722 | 3300027907 | Bacteria | 4439 |
| 1057 | Ga0207428_10038616 | 3300027907 | Bacteria | 3881 |
| 1058 | Ga0207428_10081579 | 3300027907 | Bacteria | 2525 |
| 1059 | Ga0207428_10090798 | 3300027907 | Bacteria | 2372 |
| 1060 | Ga0265356_1000062 | 3300028017 | Bacteria | 17622 |
| 1061 | Ga0268266_10013494 | 3300028379 | Bacteria | 7033 |
| 1062 | Ga0268266_10022900 | 3300028379 | Bacteria | 5316 |
| 1063 | Ga0268266_10121088 | 3300028379 | Bacteria | 2329 |
| 1064 | Ga0268265_10019225 | 3300028380 | Bacteria | 4744 |
| 1065 | Ga0268265_10022177 | 3300028380 | Bacteria | 4458 |
| 1066 | Ga0268265_10054238 | 3300028380 | Bacteria | 3041 |
| 1067 | Ga0268265_10089816 | 3300028380 | Bacteria | 2452 |
| 1068 | Ga0268265_10093588 | 3300028380 | Bacteria | 2408 |
| 1069 | Ga0268264_10002705 | 3300028381 | Bacteria | 15468 |
| 1070 | Ga0268264_10014751 | 3300028381 | Bacteria | 6418 |
| 1071 | Ga0268264_10033230 | 3300028381 | Bacteria | 4236 |
| 1072 | Ga0268264_10042385 | 3300028381 | Bacteria | 3768 |
| 1073 | Ga0268264_10058296 | 3300028381 | Bacteria | 3233 |
| 1074 | Ga0268264_10070984 | 3300028381 | Unclassified | 2949 |
| 1075 | Ga0268264_10088537 | 3300028381 | Bacteria | 2665 |
| 1076 | Ga0268264_10126854 | 3300028381 | Bacteria | 2256 |
| 1077 | Ga0268264_10367769 | 3300028381 | Bacteria | 1373 |
| 1078 | Ga0265338_10000141 | 3300028800 | Bacteria | 133058 |
| 1079 | Ga0265338_10000927 | 3300028800 | Bacteria | 49486 |
| 1080 | Ga0265338_10002893 | 3300028800 | Bacteria | 25011 |
| 1081 | Ga0265338_10004929 | 3300028800 | Bacteria | 17729 |
| 1082 | Ga0265338_10012507 | 3300028800 | Bacteria | 9671 |
| 1083 | Ga0265338_10040125 | 3300028800 | Bacteria | 4401 |
| 1084 | Ga0265338_10080555 | 3300028800 | Bacteria | 2735 |
| 1085 | Ga0265338_10117213 | 3300028800 | Bacteria | 2131 |
| 1086 | Ga0265762_1000249 | 3300030760 | Bacteria | 8825 |
| 1087 | Ga0265762_1001195 | 3300030760 | Bacteria | 4715 |
| 1088 | Ga0265762_1002545 | 3300030760 | Bacteria | 3284 |
| 1089 | Ga0265770_1009612 | 3300030878 | Bacteria | 1394 |
| 1090 | Ga0265765_1000845 | 3300030879 | Bacteria | 2645 |
| 1091 | Ga0265760_10000280 | 3300031090 | Bacteria | 13818 |
| 1092 | Ga0265760_10000461 | 3300031090 | Bacteria | 11493 |
| 1093 | Ga0265760_10000654 | 3300031090 | Bacteria | 9835 |
| 1094 | Ga0265760_10020761 | 3300031090 | Bacteria | 1897 |
| 1095 | Ga0265330_10000211 | 3300031235 | Bacteria | 45210 |
| 1096 | Ga0265330_10055177 | 3300031235 | Bacteria | 1736 |
| 1097 | Ga0265330_10064162 | 3300031235 | Bacteria | 1596 |
| 1098 | Ga0265332_10034873 | 3300031238 | Bacteria | 2187 |
| 1099 | Ga0265332_10034968 | 3300031238 | Bacteria | 2183 |
| 1100 | Ga0265328_10001124 | 3300031239 | Bacteria | 12350 |
| 1101 | Ga0265325_10000148 | 3300031241 | Bacteria | 49593 |
| 1102 | Ga0265325_10000434 | 3300031241 | Bacteria | 30035 |
| 1103 | Ga0265325_10003694 | 3300031241 | Bacteria | 9902 |
| 1104 | Ga0265340_10003970 | 3300031247 | Bacteria | 8320 |
| 1105 | Ga0265340_10008771 | 3300031247 | Bacteria | 5450 |
| 1106 | Ga0265340_10009210 | 3300031247 | Bacteria | 5306 |
| 1107 | Ga0265340_10038002 | 3300031247 | Bacteria | 2383 |
| 1108 | Ga0265340_10042249 | 3300031247 | Bacteria | 2239 |
| 1109 | Ga0265340_10048470 | 3300031247 | Bacteria | 2065 |
| 1110 | Ga0265339_10000332 | 3300031249 | Bacteria | 38100 |
| 1111 | Ga0265339_10001013 | 3300031249 | Bacteria | 21374 |
| 1112 | Ga0265339_10007699 | 3300031249 | Bacteria | 6929 |
| 1113 | Ga0265339_10014386 | 3300031249 | Bacteria | 4769 |
| 1114 | Ga0265339_10018085 | 3300031249 | Bacteria | 4161 |
| 1115 | Ga0265339_10021602 | 3300031249 | Bacteria | 3741 |
| 1116 | Ga0265339_10021726 | 3300031249 | Bacteria | 3727 |
| 1117 | Ga0265339_10036967 | 3300031249 | Bacteria | 2730 |
| 1118 | Ga0265339_10060021 | 3300031249 | Bacteria | 2050 |
| 1119 | Ga0265331_10009626 | 3300031250 | Bacteria | 5412 |
| 1120 | Ga0265327_10025253 | 3300031251 | Bacteria | 3469 |
| 1121 | Ga0265316_10000552 | 3300031344 | Bacteria | 42074 |
| 1122 | Ga0265316_10000779 | 3300031344 | Bacteria | 35184 |
| 1123 | Ga0265316_10001755 | 3300031344 | Bacteria | 22947 |
| 1124 | Ga0265316_10014893 | 3300031344 | Bacteria | 6821 |
| 1125 | Ga0265316_10020667 | 3300031344 | Bacteria | 5598 |
| 1126 | Ga0265316_10055960 | 3300031344 | Bacteria | 3083 |
| 1127 | Ga0265316_10072258 | 3300031344 | Bacteria | 2658 |
| 1128 | Ga0265316_10092111 | 3300031344 | Bacteria | 2311 |
| 1129 | Ga0265316_10127550 | 3300031344 | Bacteria | 1918 |
| 1130 | Ga0265316_10278873 | 3300031344 | Bacteria | 1222 |
| 1131 | Ga0307408_100010223 | 3300031548 | Bacteria | 6191 |
| 1132 | Ga0307408_100037833 | 3300031548 | Bacteria | 3401 |
| 1133 | Ga0265313_10002928 | 3300031595 | Bacteria | 14255 |
| 1134 | Ga0265313_10009779 | 3300031595 | Bacteria | 6178 |
| 1135 | Ga0265313_10015902 | 3300031595 | Bacteria | 4353 |
| 1136 | Ga0265313_10023016 | 3300031595 | Bacteria | 3364 |
| 1137 | Ga0265313_10025245 | 3300031595 | Bacteria | 3155 |
| 1138 | Ga0265314_10000033 | 3300031711 | Bacteria | 254594 |
| 1139 | Ga0265314_10001011 | 3300031711 | Bacteria | 32906 |
| 1140 | Ga0265314_10001761 | 3300031711 | Bacteria | 23372 |
| 1141 | Ga0265314_10033608 | 3300031711 | Bacteria | 3757 |
| 1142 | Ga0265314_10054010 | 3300031711 | Bacteria | 2783 |
| 1143 | Ga0265342_10000652 | 3300031712 | Bacteria | 36426 |
| 1144 | Ga0265342_10001096 | 3300031712 | Bacteria | 26037 |
| 1145 | Ga0265342_10006451 | 3300031712 | Bacteria | 8734 |
| 1146 | Ga0265342_10010429 | 3300031712 | Bacteria | 6446 |
| 1147 | Ga0265342_10038615 | 3300031712 | Bacteria | 2906 |
| 1148 | Ga0265342_10081310 | 3300031712 | Bacteria | 1871 |
| 1149 | Ga0316576_10003943 | 3300031727 | Bacteria | 8810 |
| 1150 | Ga0316578_10033392 | 3300031728 | Bacteria | 2947 |
| 1151 | Ga0307405_10031942 | 3300031731 | Bacteria | 3106 |
| 1152 | Ga0307405_10174508 | 3300031731 | Bacteria | 1537 |
| 1153 | Ga0307413_10020600 | 3300031824 | Bacteria | 3512 |
| 1154 | Ga0307410_10030803 | 3300031852 | Bacteria | 3433 |
| 1155 | Ga0307406_10003699 | 3300031901 | Bacteria | 8328 |
| 1156 | Ga0307406_10271810 | 3300031901 | Bacteria | 1288 |
| 1157 | Ga0307407_10008386 | 3300031903 | Bacteria | 4738 |
| 1158 | Ga0307407_10042159 | 3300031903 | Bacteria | 2557 |
| 1159 | Ga0307412_10233289 | 3300031911 | Bacteria | 1418 |
| 1160 | Ga0307409_100030373 | 3300031995 | Bacteria | 3881 |
| 1161 | Ga0307409_100041323 | 3300031995 | Bacteria | 3443 |
| 1162 | Ga0307416_100042805 | 3300032002 | Bacteria | 3539 |
| 1163 | Ga0307416_100129602 | 3300032002 | Bacteria | 2267 |
| 1164 | Ga0307416_100270249 | 3300032002 | Bacteria | 1668 |
| 1165 | Ga0307414_10013696 | 3300032004 | Bacteria | 4837 |
| 1166 | Ga0307414_10101533 | 3300032004 | Bacteria | 2166 |
| 1167 | Ga0307411_10010437 | 3300032005 | Bacteria | 4952 |
| 1168 | Ga0307411_10057321 | 3300032005 | Bacteria | 2572 |
| 1169 | Ga0307415_100006252 | 3300032126 | Bacteria | 6397 |
| 1170 | Ga0307415_100102544 | 3300032126 | Bacteria | 2102 |
| 1171 | Ga0316583_10007962 | 3300032133 | Bacteria | 3821 |
| 1172 | Ga0316580_10001623 | 3300032139 | Bacteria | 5949 |
| 1173 | Ga0373926_0044172 | 3300035083 | Bacteria | 1596 |
| 1174 | Ga0373934_0042813 | 3300035086 | Bacteria | 1789 |
| 1175 | Ga0373934_0073469 | 3300035086 | Bacteria | 1369 |
| 1176 | Ga0373951_0001056 | 3300035091 | Bacteria | 7400 |
| 1177 | Ga0373923_0000184 | 3300035111 | Bacteria | 12589 |
| 1178 | Ga0373936_0000418 | 3300035113 | Bacteria | 14323 |
| 1179 | Ga0373939_0022184 | 3300035114 | Bacteria | 1747 |
| 1180 | Ga0373945_0007864 | 3300035116 | Bacteria | 3460 |
| 1181 | Ga0373945_0007889 | 3300035116 | Bacteria | 3455 |
| 1182 | Ga0373953_0006078 | 3300035117 | Bacteria | 3959 |
| 1183 | Ga0373953_0063768 | 3300035117 | Bacteria | 1510 |
| 1184 | Ga0373954_0049493 | 3300035118 | Bacteria | 1970 |
| 1185 | Ga0373956_0030851 | 3300035119 | Bacteria | 2345 |
| 1186 | Ga0373956_0038529 | 3300035119 | Bacteria | 2115 |
| 1187 | Ga0373956_0088251 | 3300035119 | Bacteria | 1429 |
| 1188 | Ga0373943_0000388 | 3300035170 | Bacteria | 18471 |
| 1189 | Ga0373943_0035063 | 3300035170 | Bacteria | 2396 |
| 1190 | Ga0373943_0044578 | 3300035170 | Bacteria | 2159 |
| 1191 | Ga0373943_0067209 | 3300035170 | Bacteria | 1807 |
| 1192 | Ga0373943_0073718 | 3300035170 | Bacteria | 1734 |
| 1193 | Ga0373943_0094000 | 3300035170 | Bacteria | 1557 |
| 1194 | Ga0373943_0135322 | 3300035170 | Bacteria | 1323 |
| 1195 | Ga0373946_0001568 | 3300035171 | Bacteria | 7964 |
| 1196 | Ga0373955_0001776 | 3300035172 | Bacteria | 9254 |
| 1197 | Ga0373955_0018552 | 3300035172 | Bacteria | 3462 |
| 1198 | Ga0373955_0042350 | 3300035172 | Bacteria | 2444 |
| 1199 | Ga0316574_0009261 | 3300035398 | Bacteria | 5508 |
| 1200 | Ga0316574_0019303 | 3300035398 | Bacteria | 4019 |
| 1201 | Ga0373931_0001031 | 3300035691 | Bacteria | 11776 |
| 1202 | Ga0373931_0045547 | 3300035691 | Unclassified | 2317 |
| 1203 | Ga0373931_0046010 | 3300035691 | Bacteria | 2306 |
| 1204 | Ga0373935_0001450 | 3300035692 | Bacteria | 13154 |
| 1205 | Ga0373935_0013760 | 3300035692 | Bacteria | 4886 |
| 1206 | Ga0373935_0093295 | 3300035692 | Bacteria | 1974 |
| 1207 | Ga0373927_0000193 | 3300035695 | Bacteria | 48831 |
| 1208 | Ga0373927_0032925 | 3300035695 | Bacteria | 3374 |
| 1209 | Ga0373927_0043042 | 3300035695 | Bacteria | 2925 |
| 1210 | Ga0373927_0044529 | 3300035695 | Bacteria | 2871 |
| 1211 | Ga0373933_0000058 | 3300035724 | Bacteria | 66002 |
| 1212 | Ga0373933_0000737 | 3300035724 | Bacteria | 20016 |
| 1213 | Ga0373933_0021118 | 3300035724 | Bacteria | 3695 |
| 1214 | Ga0373933_0046033 | 3300035724 | Bacteria | 2589 |
| 1215 | Ga0373933_0083472 | 3300035724 | Bacteria | 1962 |
| 1216 | Ga0373933_0106673 | 3300035724 | Bacteria | 1743 |
| 1217 | Ga0373947_0000117 | 3300035725 | Bacteria | 39819 |
| 1218 | Ga0373947_0021077 | 3300035725 | Bacteria | 3770 |
| 1219 | Ga0373947_0022364 | 3300035725 | Bacteria | 3667 |
| 1220 | Ga0373947_0040633 | 3300035725 | Bacteria | 2771 |
| 1221 | Ga0373947_0043952 | 3300035725 | Bacteria | 2669 |
| 1222 | Ga0373937_0000008 | 3300036401 | Bacteria | 170075 |
| 1223 | Ga0373937_0003409 | 3300036401 | Bacteria | 13339 |
| 1224 | Ga0373937_0012458 | 3300036401 | Bacteria | 7482 |
| 1225 | Ga0373937_0034946 | 3300036401 | Bacteria | 4572 |
| 1226 | Ga0373937_0081885 | 3300036401 | Bacteria | 2986 |
| 1227 | Ga0373937_0106746 | 3300036401 | Bacteria | 2603 |
| 1228 | Ga0373937_0126691 | 3300036401 | Bacteria | 2383 |
| 1229 | Ga0373937_0154098 | 3300036401 | Bacteria | 2153 |
| 1230 | Ga0373937_0170272 | 3300036401 | Bacteria | 2044 |
| 1231 | Ga0373937_0193039 | 3300036401 | Bacteria | 1914 |
| 1232 | Ga0373937_0206521 | 3300036401 | Bacteria | 1847 |
| 1233 | Ga0373937_0278126 | 3300036401 | Bacteria | 1580 |
| 1234 | Ga0316584_0014918 | 3300036712 | Bacteria | 5549 |
| 1235 | Ga0373925_0001745 | 3300037068 | Bacteria | 18199 |
| 1236 | Ga0373925_0008635 | 3300037068 | Bacteria | 7422 |
| 1237 | Ga0373925_0011926 | 3300037068 | Bacteria | 6290 |
| 1238 | Ga0373925_0023979 | 3300037068 | Bacteria | 4451 |
| 1239 | Ga0373925_0034376 | 3300037068 | Bacteria | 3735 |
| 1240 | Ga0373925_0060548 | 3300037068 | Bacteria | 2843 |
| 1241 | Ga0373925_0088280 | 3300037068 | Bacteria | 2368 |
| 1242 | Ga0373925_0230564 | 3300037068 | Bacteria | 1480 |
| 1243 | Ga0395898_0106277 | 3300037466 | Bacteria | 2692 |
| 1244 | Ga0395898_0195194 | 3300037466 | Bacteria | 1934 |
| 1245 | Ga0395905_0130836 | 3300037471 | Bacteria | 2360 |
| 1246 | Ga0395905_0135282 | 3300037471 | Bacteria | 2318 |
| 1247 | Ga0316581_0002005 | 3300037588 | Bacteria | 4779 |
| 1248 | Ga0436365_0353713 | 3300039437 | Bacteria | 52594 |
| 1249 | Ga0436365_1476328 | 3300039437 | Bacteria | 212791 |
| 1250 | Ga0436360_0617446 | 3300039438 | Bacteria | 33837 |
| 1251 | Ga0436362_0458373 | 3300039453 | Unclassified | 2829 |
| 1252 | Ga0436362_0512278 | 3300039453 | Bacteria | 1914 |
| 1253 | Ga0436362_0797770 | 3300039453 | Bacteria | 2869 |
| 1254 | Ga0436362_0816102 | 3300039453 | Bacteria | 7468 |
| 1255 | Ga0439448_0007809 | 3300042005 | Bacteria | 3110 |
| 1256 | Ga0439450_014126 | 3300042008 | Bacteria | 1615 |
| 1257 | Ga0439452_007895 | 3300042010 | Bacteria | 3227 |
| 1258 | Ga0451577_0000536 | 3300042876 | Bacteria | 62369 |
| 1259 | Ga0451577_0079207 | 3300042876 | Bacteria | 2929 |
| 1260 | Ga0451577_0192726 | 3300042876 | Bacteria | 1839 |
| 1261 | Ga0451577_0194677 | 3300042876 | Bacteria | 1829 |
| 1262 | Ga0453683_0002287 | 3300044673 | Bacteria | 15107 |
| 1263 | Ga0453683_0031893 | 3300044673 | Bacteria | 3327 |
| 1264 | Ga0453683_0070013 | 3300044673 | Bacteria | 2194 |
| 1265 | Ga0453683_0201662 | 3300044673 | Bacteria | 1263 |
| 1266 | Ga0466966_0157301 | 3300044684 | Bacteria | 1384 |
| 1267 | Ga0466961_0121811 | 3300044693 | Unclassified | 1637 |
| 1268 | Ga0466963_0102257 | 3300044694 | Bacteria | 1962 |
| 1269 | Ga0466963_0128438 | 3300044694 | Unclassified | 1749 |
| 1270 | Ga0466964_0031788 | 3300044706 | Bacteria | 2095 |
| 1271 | Ga0453684_0001218 | 3300044712 | Bacteria | 78994 |
| 1272 | Ga0453684_0009087 | 3300044712 | Bacteria | 17521 |
| 1273 | Ga0453684_0106774 | 3300044712 | Bacteria | 3411 |
| 1274 | Ga0466957_0127024 | 3300044842 | Unclassified | 1630 |
| 1275 | Ga0451576_0003135 | 3300045051 | Bacteria | 23150 |
| 1276 | Ga0451576_0004776 | 3300045051 | Bacteria | 17369 |
| 1277 | Ga0451576_0009653 | 3300045051 | Bacteria | 11165 |
| 1278 | Ga0451576_0010166 | 3300045051 | Bacteria | 10826 |
| 1279 | Ga0451576_0069182 | 3300045051 | Bacteria | 3673 |
| 1280 | Ga0451576_0086627 | 3300045051 | Bacteria | 3258 |
| 1281 | Ga0451576_0116015 | 3300045051 | Bacteria | 2788 |
| 1282 | Ga0451576_0184541 | 3300045051 | Bacteria | 2178 |
| 1283 | Ga0451576_0334275 | 3300045051 | Bacteria | 1586 |
| 1284 | Ga0466958_0153917 | 3300045836 | Bacteria | 1451 |
| 1285 | Ga0466967_0001417 | 3300045976 | Bacteria | 13881 |
| 1286 | Ga0466967_0003508 | 3300045976 | Bacteria | 10250 |
| 1287 | Ga0466967_0019296 | 3300045976 | Bacteria | 5478 |
| 1288 | Ga0466967_0035386 | 3300045976 | Bacteria | 4251 |
| 1289 | Ga0466967_0265490 | 3300045976 | Bacteria | 1643 |
| 1290 | Ga0466967_0281137 | 3300045976 | Bacteria | 1597 |
| 1291 | Ga0495592_0075346 | 3300046454 | Bacteria | 2450 |
| 1292 | Ga0495603_0067174 | 3300046455 | Bacteria | 2111 |
| 1293 | Ga0495629_0021546 | 3300046459 | Bacteria | 4599 |
| 1294 | Ga0495629_0044195 | 3300046459 | Bacteria | 3127 |
| 1295 | Ga0495629_0088773 | 3300046459 | Bacteria | 2157 |
| 1296 | Ga0495641_0029455 | 3300046461 | Bacteria | 2645 |
| 1297 | Ga0495651_0000024 | 3300046462 | Bacteria | 113645 |
| 1298 | Ga0495651_0002507 | 3300046462 | Bacteria | 14206 |
| 1299 | Ga0495650_0001419 | 3300046471 | Bacteria | 23297 |
| 1300 | Ga0495580_0000153 | 3300046472 | Bacteria | 50277 |
| 1301 | Ga0495580_0000774 | 3300046472 | Bacteria | 27522 |
| 1302 | Ga0495580_0002914 | 3300046472 | Bacteria | 14695 |
| 1303 | Ga0495580_0004498 | 3300046472 | Bacteria | 11709 |
| 1304 | Ga0495580_0006320 | 3300046472 | Bacteria | 9674 |
| 1305 | Ga0495580_0010846 | 3300046472 | Bacteria | 7071 |
| 1306 | Ga0495580_0017569 | 3300046472 | Bacteria | 5345 |
| 1307 | Ga0495580_0037076 | 3300046472 | Bacteria | 3500 |
| 1308 | Ga0495580_0042025 | 3300046472 | Bacteria | 3258 |
| 1309 | Ga0495580_0068070 | 3300046472 | Bacteria | 2490 |
| 1310 | Ga0495580_0102850 | 3300046472 | Bacteria | 1986 |
| 1311 | Ga0495580_0105188 | 3300046472 | Bacteria | 1961 |
| 1312 | Ga0495580_0231626 | 3300046472 | Bacteria | 1268 |
| 1313 | Ga0495582_0000192 | 3300046473 | Bacteria | 33815 |
| 1314 | Ga0495582_0000877 | 3300046473 | Bacteria | 16673 |
| 1315 | Ga0495582_0007583 | 3300046473 | Bacteria | 6002 |
| 1316 | Ga0495582_0018131 | 3300046473 | Bacteria | 3851 |
| 1317 | Ga0495664_0052555 | 3300046477 | Bacteria | 2422 |
| 1318 | Ga0495594_0059594 | 3300046499 | Unclassified | 2111 |
| 1319 | Ga0495608_0076936 | 3300046511 | Bacteria | 2172 |
| 1320 | Ga0495608_0168568 | 3300046511 | Bacteria | 1389 |
| 1321 | Ga0495618_0081865 | 3300046514 | Bacteria | 2062 |
| 1322 | Ga0495630_0004232 | 3300046517 | Bacteria | 10056 |
| 1323 | Ga0495630_0020041 | 3300046517 | Bacteria | 4925 |
| 1324 | Ga0495630_0090456 | 3300046517 | Bacteria | 2312 |
| 1325 | Ga0495630_0240789 | 3300046517 | Bacteria | 1382 |
| 1326 | Ga0495666_0035843 | 3300046526 | Unclassified | 2416 |
| 1327 | Ga0495666_0047978 | 3300046526 | Bacteria | 2057 |
| 1328 | Ga0495666_0057832 | 3300046526 | Bacteria | 1856 |
| 1329 | Ga0495652_0122361 | 3300046529 | Bacteria | 2073 |
| 1330 | Ga0495665_0002336 | 3300046531 | Bacteria | 10243 |
| 1331 | Ga0495665_0015688 | 3300046531 | Bacteria | 4078 |
| 1332 | Ga0495665_0077755 | 3300046531 | Bacteria | 1746 |
| 1333 | Ga0495640_0030801 | 3300046533 | Bacteria | 3837 |
| 1334 | Ga0495586_0012381 | 3300046535 | Bacteria | 4524 |
| 1335 | Ga0495586_0027225 | 3300046535 | Bacteria | 3059 |
| 1336 | Ga0495587_0000047 | 3300046536 | Bacteria | 105516 |
| 1337 | Ga0495587_0010043 | 3300046536 | Bacteria | 6045 |
| 1338 | Ga0495587_0010519 | 3300046536 | Bacteria | 5884 |
| 1339 | Ga0495587_0051661 | 3300046536 | Bacteria | 2429 |
| 1340 | Ga0495645_0002646 | 3300046543 | Bacteria | 12185 |
| 1341 | Ga0495645_0072355 | 3300046543 | Bacteria | 2484 |
| 1342 | Ga0495645_0084085 | 3300046543 | Bacteria | 2279 |
| 1343 | Ga0495667_0007600 | 3300046559 | Bacteria | 7357 |
| 1344 | Ga0495667_0055408 | 3300046559 | Bacteria | 2608 |
| 1345 | Ga0495656_0014256 | 3300046615 | Bacteria | 2977 |
| 1346 | Ga0495634_0145530 | 3300046642 | Bacteria | 1501 |
| 1347 | Ga0495625_0017649 | 3300046660 | Bacteria | 5585 |
| 1348 | Ga0495657_0074510 | 3300046675 | Bacteria | 2209 |
| 1349 | Ga0495657_0130593 | 3300046675 | Bacteria | 1574 |
| 1350 | Ga0495657_0148663 | 3300046675 | Bacteria | 1456 |
| 1351 | Ga0495623_0063488 | 3300046679 | Bacteria | 2312 |
| 1352 | Ga0495647_0006349 | 3300046681 | Bacteria | 3911 |
| 1353 | Ga0495658_0013373 | 3300046683 | Bacteria | 4176 |
| 1354 | Ga0495658_0131942 | 3300046683 | Bacteria | 1521 |
| 1355 | Ga0495613_0060132 | 3300046689 | Bacteria | 2783 |
| 1356 | Ga0495624_0019529 | 3300046690 | Bacteria | 4521 |
| 1357 | Ga0495624_0071395 | 3300046690 | Unclassified | 2160 |
| 1358 | Ga0495600_0071156 | 3300046809 | Bacteria | 2273 |
| 1359 | Ga0495581_0024295 | 3300047315 | Bacteria | 3512 |
| 1360 | Ga0495581_0139416 | 3300047315 | Bacteria | 1414 |
| 1361 | Ga0495604_0009125 | 3300047317 | Bacteria | 7848 |
| 1362 | Ga0495604_0097000 | 3300047317 | Bacteria | 2175 |
| 1363 | Ga0495604_0137156 | 3300047317 | Bacteria | 1752 |
| 1364 | Ga0495604_0172100 | 3300047317 | Bacteria | 1522 |
| 1365 | Ga0495674_0064441 | 3300047319 | Bacteria | 3186 |
| 1366 | Ga0495674_0095346 | 3300047319 | Bacteria | 2537 |
| 1367 | Ga0495674_0096556 | 3300047319 | Bacteria | 2519 |
| 1368 | Ga0495674_0112359 | 3300047319 | Bacteria | 2308 |
| 1369 | Ga0495674_0209967 | 3300047319 | Bacteria | 1613 |
| 1370 | Ga0495680_0000749 | 3300047322 | Bacteria | 36388 |
| 1371 | Ga0495680_0022613 | 3300047322 | Bacteria | 5237 |
| 1372 | Ga0495683_0039558 | 3300047323 | Bacteria | 2383 |
| 1373 | Ga0495675_0000370 | 3300047444 | Bacteria | 31077 |
| 1374 | Ga0495675_0003195 | 3300047444 | Bacteria | 9854 |
| 1375 | Ga0495675_0006137 | 3300047444 | Bacteria | 7360 |
| 1376 | Ga0495675_0008673 | 3300047444 | Bacteria | 6306 |
| 1377 | Ga0495684_0017250 | 3300047471 | Bacteria | 5558 |
| 1378 | Ga0495684_0028476 | 3300047471 | Bacteria | 4289 |
| 1379 | Ga0495602_0000026 | 3300048088 | Bacteria | 148063 |
| 1380 | Ga0495602_0008201 | 3300048088 | Bacteria | 10913 |
| 1381 | Ga0495602_0072908 | 3300048088 | Bacteria | 2925 |
| 1382 | Ga0495614_0119500 | 3300048089 | Bacteria | 1161 |
| 1383 | Ga0496100_0020457 | 3300048903 | Bacteria | 3968 |
| 1384 | Ga0496100_0042270 | 3300048903 | Bacteria | 2911 |
| 1385 | Ga0496101_0017382 | 3300048904 | Bacteria | 4879 |
| 1386 | Ga0496101_0055793 | 3300048904 | Bacteria | 2855 |
| 1387 | Ga0496101_0082390 | 3300048904 | Unclassified | 2381 |
| 1388 | Ga0496102_0214703 | 3300048905 | Bacteria | 1813 |
| 1389 | Ga0496103_0090378 | 3300048906 | Bacteria | 1932 |
| 1390 | Ga0496103_0097059 | 3300048906 | Bacteria | 1863 |
| 1391 | Ga0496103_0111820 | 3300048906 | Bacteria | 1736 |
| 1392 | Ga0496104_0054906 | 3300048907 | Bacteria | 3766 |
| 1393 | Ga0496104_0068119 | 3300048907 | Bacteria | 3382 |
| 1394 | Ga0496104_0073009 | 3300048907 | Bacteria | 3264 |
| 1395 | Ga0496104_0155840 | 3300048907 | Bacteria | 2191 |
| 1396 | Ga0496104_0252184 | 3300048907 | Bacteria | 1677 |
| 1397 | Ga0496104_0276781 | 3300048907 | Bacteria | 1591 |
| 1398 | Ga0496105_0086016 | 3300048908 | Bacteria | 2598 |
| 1399 | Ga0496105_0087624 | 3300048908 | Bacteria | 2572 |
| 1400 | Ga0496105_0099060 | 3300048908 | Bacteria | 2407 |
| 1401 | Ga0496105_0207526 | 3300048908 | Bacteria | 1598 |
| 1402 | Ga0496106_0038755 | 3300048909 | Bacteria | 3568 |
| 1403 | Ga0496106_0053387 | 3300048909 | Bacteria | 3052 |
| 1404 | Ga0496106_0061497 | 3300048909 | Bacteria | 2849 |
| 1405 | Ga0496107_0007445 | 3300048910 | Bacteria | 7547 |
| 1406 | Ga0496107_0021957 | 3300048910 | Bacteria | 4509 |
| 1407 | Ga0496107_0154221 | 3300048910 | Bacteria | 1700 |
| 1408 | Ga0496107_0217014 | 3300048910 | Unclassified | 1423 |
| 1409 | Ga0496108_0045295 | 3300048911 | Bacteria | 3674 |
| 1410 | Ga0496109_0011491 | 3300048912 | Bacteria | 7615 |
| 1411 | Ga0496109_0143414 | 3300048912 | Bacteria | 2234 |
| 1412 | Ga0496110_0054349 | 3300048913 | Bacteria | 3522 |
| 1413 | Ga0496110_0358538 | 3300048913 | Bacteria | 1329 |
| 1414 | Ga0496111_0282470 | 3300048914 | Bacteria | 1231 |
| 1415 | Ga0496112_0003396 | 3300048915 | Bacteria | 13150 |
| 1416 | Ga0496112_0005165 | 3300048915 | Bacteria | 11219 |
| 1417 | Ga0496112_0019019 | 3300048915 | Bacteria | 6475 |
| 1418 | Ga0496112_0054818 | 3300048915 | Bacteria | 3918 |
| 1419 | Ga0496112_0059366 | 3300048915 | Unclassified | 3769 |
| 1420 | Ga0496112_0094583 | 3300048915 | Bacteria | 2959 |
| 1421 | Ga0496112_0112959 | 3300048915 | Bacteria | 2687 |
| 1422 | Ga0496112_0139270 | 3300048915 | Bacteria | 2396 |
| 1423 | Ga0496112_0146180 | 3300048915 | Bacteria | 2332 |
| 1424 | Ga0496112_0205131 | 3300048915 | Bacteria | 1929 |
| 1425 | Ga0496113_0027773 | 3300048916 | Bacteria | 4061 |
| 1426 | Ga0496113_0213188 | 3300048916 | Bacteria | 1538 |
| 1427 | Ga0496114_0004599 | 3300048917 | Bacteria | 10718 |
| 1428 | Ga0496114_0020901 | 3300048917 | Bacteria | 5317 |
| 1429 | Ga0496114_0022030 | 3300048917 | Bacteria | 5188 |
| 1430 | Ga0496114_0023558 | 3300048917 | Bacteria | 5025 |
| 1431 | Ga0496114_0099938 | 3300048917 | Bacteria | 2475 |
| 1432 | Ga0496115_0009902 | 3300048918 | Bacteria | 7100 |
| 1433 | Ga0496115_0011052 | 3300048918 | Bacteria | 6763 |
| 1434 | Ga0496115_0020023 | 3300048918 | Bacteria | 5155 |
| 1435 | Ga0496115_0042487 | 3300048918 | Bacteria | 3621 |
| 1436 | Ga0496115_0086838 | 3300048918 | Bacteria | 2552 |
| 1437 | Ga0496115_0298547 | 3300048918 | Bacteria | 1320 |
| 1438 | Ga0496119_0070238 | 3300048922 | Bacteria | 2055 |
| 1439 | Ga0496119_0107710 | 3300048922 | Bacteria | 1553 |
| 1440 | Ga0496126_0000187 | 3300048929 | Bacteria | 139670 |
| 1441 | Ga0496126_0104925 | 3300048929 | Bacteria | 2469 |
| 1442 | Ga0501290_001149 | 3300049513 | Bacteria | 3717 |
| 1443 | Ga0501291_000266 | 3300049514 | Bacteria | 6458 |
| 1444 | Ga0501293_000057 | 3300049516 | Bacteria | 6893 |
| 1445 | Ga0501294_000272 | 3300049517 | Bacteria | 6349 |
| 1446 | Ga0501296_000249 | 3300049519 | Bacteria | 5586 |
| 1447 | Ga0501298_000404 | 3300049521 | Bacteria | 5862 |
| 1448 | Ga0501300_000773 | 3300049523 | Bacteria | 4842 |
| 1449 | Ga0501031_0038437 | 3300049568 | Bacteria | 3123 |
| 1450 | Ga0501031_0066148 | 3300049568 | Bacteria | 2355 |
| 1451 | Ga0501032_0015454 | 3300049569 | Bacteria | 5383 |
| 1452 | Ga0501033_0061105 | 3300049570 | Bacteria | 2777 |
| 1453 | Ga0501033_0107861 | 3300049570 | Bacteria | 2028 |
| 1454 | Ga0501036_0001893 | 3300049572 | Bacteria | 16268 |
| 1455 | Ga0501036_0030043 | 3300049572 | Bacteria | 4591 |
| 1456 | Ga0501036_0058543 | 3300049572 | Bacteria | 3264 |
| 1457 | Ga0501036_0153401 | 3300049572 | Bacteria | 1943 |
| 1458 | Ga0501037_0007971 | 3300049573 | Bacteria | 7763 |
| 1459 | Ga0501037_0119505 | 3300049573 | Bacteria | 1895 |
| 1460 | Ga0501038_0004726 | 3300049574 | Bacteria | 12668 |
| 1461 | Ga0501038_0006830 | 3300049574 | Bacteria | 10543 |
| 1462 | Ga0501038_0022090 | 3300049574 | Bacteria | 5704 |
| 1463 | Ga0501038_0069200 | 3300049574 | Bacteria | 2998 |
| 1464 | Ga0501039_0044377 | 3300049575 | Bacteria | 3433 |
| 1465 | Ga0501040_0001593 | 3300049576 | Bacteria | 14460 |
| 1466 | Ga0501040_0057762 | 3300049576 | Bacteria | 2664 |
| 1467 | Ga0501041_0003041 | 3300049577 | Bacteria | 9621 |
| 1468 | Ga0501041_0007098 | 3300049577 | Bacteria | 6568 |
| 1469 | Ga0501042_0012537 | 3300049578 | Bacteria | 5744 |
| 1470 | Ga0501042_0013777 | 3300049578 | Bacteria | 5508 |
| 1471 | Ga0501042_0065521 | 3300049578 | Bacteria | 2596 |
| 1472 | Ga0501043_0015738 | 3300049579 | Bacteria | 5930 |
| 1473 | Ga0501043_0021451 | 3300049579 | Bacteria | 5064 |
| 1474 | Ga0501043_0037467 | 3300049579 | Bacteria | 3814 |
| 1475 | Ga0501043_0211594 | 3300049579 | Bacteria | 1502 |
| 1476 | Ga0501046_0000055 | 3300049580 | Bacteria | 129853 |
| 1477 | Ga0501046_0005343 | 3300049580 | Bacteria | 11489 |
| 1478 | Ga0501046_0006405 | 3300049580 | Bacteria | 10437 |
| 1479 | Ga0501046_0207888 | 3300049580 | Bacteria | 1454 |
| 1480 | Ga0501047_0005669 | 3300049581 | Bacteria | 11754 |
| 1481 | Ga0501047_0075799 | 3300049581 | Bacteria | 3236 |
| 1482 | Ga0501047_0078369 | 3300049581 | Bacteria | 3178 |
| 1483 | Ga0501047_0107733 | 3300049581 | Bacteria | 2668 |
| 1484 | Ga0501048_0008402 | 3300049582 | Bacteria | 7807 |
| 1485 | Ga0501048_0028583 | 3300049582 | Bacteria | 4047 |
| 1486 | Ga0501067_0017997 | 3300049583 | Bacteria | 3912 |
| 1487 | Ga0501069_0006872 | 3300049585 | Bacteria | 5951 |
| 1488 | Ga0501069_0007391 | 3300049585 | Bacteria | 5765 |
| 1489 | Ga0501069_0165560 | 3300049585 | Bacteria | 1274 |
| 1490 | Ga0501070_0010742 | 3300049586 | Bacteria | 7736 |
| 1491 | Ga0501070_0031318 | 3300049586 | Bacteria | 4456 |
| 1492 | Ga0501071_0007897 | 3300049587 | Bacteria | 7015 |
| 1493 | Ga0501072_0000458 | 3300049588 | Bacteria | 29495 |
| 1494 | Ga0501072_0003614 | 3300049588 | Bacteria | 11639 |
| 1495 | Ga0501072_0062772 | 3300049588 | Bacteria | 2930 |
| 1496 | Ga0501072_0083176 | 3300049588 | Bacteria | 2537 |
| 1497 | Ga0501073_0002801 | 3300049589 | Bacteria | 13058 |
| 1498 | Ga0501073_0022772 | 3300049589 | Bacteria | 4507 |
| 1499 | Ga0501073_0111939 | 3300049589 | Bacteria | 1893 |
| 1500 | Ga0501074_0040296 | 3300049590 | Bacteria | 3384 |
| 1501 | Ga0501074_0059935 | 3300049590 | Bacteria | 2741 |
| 1502 | Ga0501074_0138096 | 3300049590 | Bacteria | 1744 |
| 1503 | Ga0501074_0170755 | 3300049590 | Bacteria | 1552 |
| 1504 | Ga0501075_0013585 | 3300049591 | Bacteria | 5814 |
| 1505 | Ga0501075_0081014 | 3300049591 | Bacteria | 2457 |
| 1506 | Ga0501075_0096283 | 3300049591 | Bacteria | 2246 |
| 1507 | Ga0501075_0264418 | 3300049591 | Bacteria | 1311 |
| 1508 | Ga0501076_0014603 | 3300049592 | Bacteria | 5920 |
| 1509 | Ga0501076_0032193 | 3300049592 | Bacteria | 4092 |
| 1510 | Ga0501076_0056253 | 3300049592 | Bacteria | 3122 |
| 1511 | Ga0501076_0099074 | 3300049592 | Bacteria | 2348 |
| 1512 | Ga0501077_0000195 | 3300049593 | Bacteria | 34941 |
| 1513 | Ga0501198_000904 | 3300049649 | Bacteria | 3749 |
| 1514 | Ga0501202_007764 | 3300049652 | Bacteria | 1944 |
| 1515 | Ga0501202_008031 | 3300049652 | Bacteria | 1918 |
| 1516 | Ga0501209_000572 | 3300049656 | Bacteria | 4547 |
| 1517 | Ga0501217_000668 | 3300049661 | Bacteria | 5822 |
| 1518 | Ga0501223_014720 | 3300049663 | Bacteria | 1551 |
| 1519 | Ga0501230_001806 | 3300049667 | Bacteria | 2624 |
| 1520 | Ga0501243_000326 | 3300049675 | Bacteria | 6186 |
| 1521 | Ga0501261_007431 | 3300049690 | Bacteria | 1407 |
| 1522 | Ga0501225_0002114 | 3300049705 | Bacteria | 6160 |
| 1523 | Ga0501245_002004 | 3300049708 | Bacteria | 2693 |
| 1524 | Ga0501079_0000550 | 3300049741 | Bacteria | 24508 |
| 1525 | Ga0501079_0018991 | 3300049741 | Bacteria | 5252 |
| 1526 | Ga0501079_0028985 | 3300049741 | Bacteria | 4250 |
| 1527 | Ga0501079_0054032 | 3300049741 | Bacteria | 3098 |
| 1528 | Ga0501079_0206789 | 3300049741 | Bacteria | 1533 |
| 1529 | Ga0501080_0002277 | 3300049742 | Bacteria | 16706 |
| 1530 | Ga0501080_0026919 | 3300049742 | Bacteria | 5347 |
| 1531 | Ga0501080_0039009 | 3300049742 | Bacteria | 4432 |
| 1532 | Ga0501080_0068470 | 3300049742 | Bacteria | 3302 |
| 1533 | Ga0501081_0000417 | 3300049743 | Bacteria | 23491 |
| 1534 | Ga0501081_0043664 | 3300049743 | Bacteria | 3075 |
| 1535 | Ga0501081_0077480 | 3300049743 | Bacteria | 2323 |
| 1536 | Ga0501083_0000415 | 3300049744 | Bacteria | 27273 |
| 1537 | Ga0501083_0071568 | 3300049744 | Bacteria | 2305 |
| 1538 | Ga0501265_001777 | 3300049762 | Bacteria | 2445 |
| 1539 | Ga0501274_000148 | 3300049771 | Bacteria | 4370 |
| 1540 | Ga0501278_000640 | 3300049774 | Bacteria | 2671 |
| 1541 | Ga0501279_000060 | 3300049775 | Bacteria | 19728 |
| 1542 | Ga0501283_000297 | 3300049779 | Bacteria | 6557 |
| 1543 | Ga0501035_0045766 | 3300049822 | Bacteria | 3935 |
| 1544 | Ga0501035_0055713 | 3300049822 | Bacteria | 3529 |
| 1545 | Ga0501035_0147942 | 3300049822 | Bacteria | 2039 |
| 1546 | Ga0501044_0000720 | 3300049823 | Bacteria | 39907 |
| 1547 | Ga0501044_0086419 | 3300049823 | Bacteria | 3168 |
| 1548 | Ga0501044_0211444 | 3300049823 | Bacteria | 1894 |
| 1549 | Ga0501045_0004294 | 3300049824 | Bacteria | 9831 |
| 1550 | Ga0501045_0049878 | 3300049824 | Bacteria | 3053 |
| 1551 | nmdc:mga05p37_110773_c1 | 3300050507 | Bacteria | 3377 |
| 1552 | nmdc:mga05p37_22094_c1 | 3300050507 | Bacteria | 7712 |
| 1553 | nmdc:mga05p37_31814_c1 | 3300050507 | Bacteria | 6447 |
| 1554 | nmdc:mga05p37_318989_c1 | 3300050507 | Bacteria | 1840 |
| 1555 | nmdc:mga05p37_67664_c1 | 3300050507 | Bacteria | 4394 |
| 1556 | nmdc:mga09592_162246_c1 | 3300050508 | Bacteria | 1931 |
| 1557 | nmdc:mga09592_210439_c1 | 3300050508 | Bacteria | 1685 |
| 1558 | nmdc:mga09592_39570_c1 | 3300050508 | Bacteria | 3961 |
| 1559 | nmdc:mga0qj67_129173_c1 | 3300050509 | Bacteria | 2046 |
| 1560 | nmdc:mga06r32_390567_c1 | 3300050510 | Bacteria | 1374 |
| 1561 | nmdc:mga06r32_56647_c1 | 3300050510 | Bacteria | 3763 |
| 1562 | nmdc:mga08y16_426966_c1 | 3300050511 | Bacteria | 1354 |
| 1563 | nmdc:mga08y16_444532_c1 | 3300050511 | Unclassified | 1323 |
| 1564 | nmdc:mga08y16_47842_c1 | 3300050511 | Unclassified | 4476 |
| 1565 | nmdc:mga08y16_61917_c1 | 3300050511 | Bacteria | 3908 |
| 1566 | nmdc:mga08y16_80937_c1 | 3300050511 | Bacteria | 3386 |
| 1567 | nmdc:mga0n895_1283_c1 | 3300050512 | Bacteria | 18569 |
| 1568 | nmdc:mga0n895_1782_c1 | 3300050512 | Bacteria | 16333 |
| 1569 | nmdc:mga0n895_17833_c1 | 3300050512 | Bacteria | 6554 |
| 1570 | nmdc:mga0n895_20298_c1 | 3300050512 | Bacteria | 6194 |
| 1571 | nmdc:mga0n895_22776_c1 | 3300050512 | Bacteria | 5876 |
| 1572 | nmdc:mga0n895_39946_c1 | 3300050512 | Bacteria | 4557 |
| 1573 | nmdc:mga0n895_40814_c1 | 3300050512 | Bacteria | 4509 |
| 1574 | nmdc:mga0n895_56938_c1 | 3300050512 | Bacteria | 3853 |
| 1575 | nmdc:mga0n895_69768_c1 | 3300050512 | Bacteria | 3483 |
| 1576 | nmdc:mga0n895_80690_c1 | 3300050512 | Bacteria | 3241 |
| 1577 | nmdc:mga0rr50_106659_c1 | 3300050513 | Bacteria | 2211 |
| 1578 | nmdc:mga0rr50_112416_c1 | 3300050513 | Bacteria | 2157 |
| 1579 | nmdc:mga0rr50_201255_c1 | 3300050513 | Bacteria | 1636 |
| 1580 | nmdc:mga0rr50_2470_c1 | 3300050513 | Bacteria | 10442 |
| 1581 | nmdc:mga0rr50_33482_c1 | 3300050513 | Bacteria | 2350 |
| 1582 | nmdc:mga0rr50_51759_c1 | 3300050513 | Bacteria | 3049 |
| 1583 | nmdc:mga0rr50_7612_c1 | 3300050513 | Bacteria | 6696 |
| 1584 | nmdc:mga0rr50_86288_c1 | 3300050513 | Bacteria | 2434 |
| 1585 | nmdc:mga08x19_12911_c1 | 3300050514 | Bacteria | 5041 |
| 1586 | nmdc:mga08x19_20359_c1 | 3300050514 | Bacteria | 4084 |
| 1587 | nmdc:mga08x19_214358_c1 | 3300050514 | Bacteria | 1322 |
| 1588 | nmdc:mga08x19_2378_c1 | 3300050514 | Bacteria | 11402 |
| 1589 | nmdc:mga08x19_24954_c1 | 3300050514 | Bacteria | 3721 |
| 1590 | nmdc:mga08x19_257_c1 | 3300050514 | Bacteria | 40329 |
| 1591 | nmdc:mga08x19_2_c1 | 3300050514 | Bacteria | 741277 |
| 1592 | nmdc:mga08x19_44105_c1 | 3300050514 | Bacteria | 2846 |
| 1593 | nmdc:mga08x19_4513_c1 | 3300050514 | Bacteria | 8249 |
| 1594 | nmdc:mga08x19_7143_c1 | 3300050514 | Bacteria | 6631 |
| 1595 | nmdc:mga08x19_77457_c1 | 3300050514 | Bacteria | 2178 |
| 1596 | nmdc:mga08x19_80877_c1 | 3300050514 | Unclassified | 2133 |
| 1597 | nmdc:mga08x19_82168_c1 | 3300050514 | Bacteria | 2116 |
| 1598 | nmdc:mga0a205_10909_c1 | 3300050515 | Bacteria | 8359 |
| 1599 | nmdc:mga0a205_112610_c1 | 3300050515 | Bacteria | 2620 |
| 1600 | nmdc:mga0a205_13056_c1 | 3300050515 | Bacteria | 7713 |
| 1601 | nmdc:mga0a205_13350_c1 | 3300050515 | Bacteria | 7643 |
| 1602 | nmdc:mga0a205_147129_c1 | 3300050515 | Bacteria | 2256 |
| 1603 | nmdc:mga0a205_174942_c1 | 3300050515 | Bacteria | 2042 |
| 1604 | nmdc:mga0a205_202732_c1 | 3300050515 | Bacteria | 1874 |
| 1605 | nmdc:mga0a205_258516_c1 | 3300050515 | Bacteria | 1619 |
| 1606 | nmdc:mga0a205_32680_c1 | 3300050515 | Bacteria | 4988 |
| 1607 | nmdc:mga0a205_46899_c1 | 3300050515 | Bacteria | 4168 |
| 1608 | nmdc:mga0a205_60747_c1 | 3300050515 | Bacteria | 3650 |
| 1609 | nmdc:mga0a205_81965_c1 | 3300050515 | Bacteria | 3116 |
| 1610 | Ga0495601_0005334 | 3300053077 | Bacteria | 7487 |
| 1611 | Ga0495601_0015724 | 3300053077 | Bacteria | 4577 |
| 1612 | Ga0495619_0105599 | 3300053085 | Bacteria | 1920 |
| 1613 | Ga0495619_0122555 | 3300053085 | Bacteria | 1783 |
| 1614 | Ga0500616_0002047 | 3300053153 | Bacteria | 17744 |
| 1615 | Ga0501084_0001686 | 3300054114 | Bacteria | 17565 |
| 1616 | Ga0501084_0029733 | 3300054114 | Bacteria | 4571 |
| 1617 | Ga0501084_0067667 | 3300054114 | Bacteria | 2989 |
| 1618 | Ga0501084_0077293 | 3300054114 | Bacteria | 2791 |
| 1619 | Ga0501084_0117244 | 3300054114 | Bacteria | 2239 |
| 1620 | Ga0587111_0021976 | 3300060346 | Bacteria | 1235 |
| 1621 | Ga0501082_0006761 | 3300060353 | Bacteria | 9912 |
| 1622 | Ga0501082_0096896 | 3300060353 | Bacteria | 2550 |
| 1623 | Ga0501082_0310080 | 3300060353 | Bacteria | 1374 |
| 1624 | Ga0530510_0008140 | 3300061734 | Bacteria | 7314 |
| 1625 | Ga0530510_0041403 | 3300061734 | Bacteria | 3326 |
| 1626 | 2884219316 | 2884215851 | Bacteria | 4554841 |
| 1627 | Ga0495580_0052397 | |||
| 1628 | JGI24751J29686_10000120 | |||
| 1629 | Ga0058862_12620782 | |||
| 1630 | Ga0065714_10064428 | |||
| 1631 | Ga0065704_10001277 | |||
| 1632 | Ga0065704_10108277 | |||
| 1633 | Ga0065712_10000115 | |||
| 1634 | Ga0065712_10069774 | |||
| 1635 | Ga0065712_10070131 | |||
| 1636 | Ga0065712_10083698 | |||
| 1637 | Ga0065715_10000647 | |||
| 1638 | Ga0065715_10015359 | |||
| 1639 | Ga0065715_10089908 | |||
| 1640 | Ga0065715_10090909 | |||
| 1641 | Ga0065715_10100101 | |||
| 1642 | Ga0065715_10107769 | |||
| 1643 | Ga0065707_10001190 | |||
| 1644 | Ga0065707_10008524 | |||
| 1645 | Ga0065707_10085301 | |||
| 1646 | Ga0065707_10103437 | |||
| 1647 | Ga0065707_10108824 | |||
| 1648 | Ga0065707_10130174 | |||
| 1649 | Ga0070658_10001545 | |||
| 1650 | Ga0070658_10021430 | |||
| 1651 | Ga0070658_10149331 | |||
| 1652 | Ga0070676_10011613 | |||
| 1653 | Ga0070683_100005437 | |||
| 1654 | Ga0070683_100006023 | |||
| 1655 | Ga0070683_100021720 | |||
| 1656 | Ga0070683_100052420 | |||
| 1657 | Ga0070690_100007430 | |||
| 1658 | Ga0070690_100125050 | |||
| 1659 | Ga0070670_100000043 | |||
| 1660 | Ga0070670_100004607 | |||
| 1661 | Ga0070670_100004867 | |||
| 1662 | Ga0070670_100006424 | |||
| 1663 | Ga0070670_100246265 | |||
| 1664 | Ga0068869_100036220 | |||
| 1665 | Ga0068869_100151332 | |||
| 1666 | Ga0070666_10001198 | |||
| 1667 | Ga0070666_10011769 | |||
| 1668 | Ga0070666_10012869 | |||
| 1669 | Ga0070666_10021795 | |||
| 1670 | Ga0070666_10024561 | |||
| 1671 | Ga0070666_10034466 | |||
| 1672 | Ga0070666_10147081 | |||
| 1673 | Ga0070680_100004112 | |||
| 1674 | Ga0070680_100005517 | |||
| 1675 | Ga0070680_100016220 | |||
| 1676 | Ga0070680_100056506 | |||
| 1677 | Ga0070680_100135609 | |||
| 1678 | Ga0070680_100176906 | |||
| 1679 | Ga0070682_100029484 | |||
| 1680 | Ga0070682_100037579 | |||
| 1681 | Ga0068868_100006584 | |||
| 1682 | Ga0068868_100010972 | |||
| 1683 | Ga0068868_100019019 | |||
| 1684 | Ga0068868_100019429 | |||
| 1685 | Ga0068868_100019499 | |||
| 1686 | Ga0068868_100026589 | |||
| 1687 | Ga0068868_100027582 | |||
| 1688 | Ga0068868_100040288 | |||
| 1689 | Ga0068868_100064561 | |||
| 1690 | Ga0068868_100065695 | |||
| 1691 | Ga0070660_100016969 | |||
| 1692 | Ga0070660_100030187 | |||
| 1693 | Ga0070660_100048794 | |||
| 1694 | Ga0070689_100092330 | |||
| 1695 | Ga0070691_10020523 | |||
| 1696 | Ga0070691_10024587 | |||
| 1697 | Ga0070687_100003020 | |||
| 1698 | Ga0070687_100006473 | |||
| 1699 | Ga0070661_100002573 | |||
| 1700 | Ga0070661_100010832 | |||
| 1701 | Ga0070661_100011851 | |||
| 1702 | Ga0070692_10000274 | |||
| 1703 | Ga0070692_10012877 | |||
| 1704 | Ga0070692_10016597 | |||
| 1705 | Ga0070692_10096097 | |||
| 1706 | Ga0070668_100018117 | |||
| 1707 | Ga0070668_100025873 | |||
| 1708 | Ga0070669_100015211 | |||
| 1709 | Ga0070669_100019108 | |||
| 1710 | Ga0070669_100032301 | |||
| 1711 | Ga0070675_100016132 | |||
| 1712 | Ga0070675_100027542 | |||
| 1713 | Ga0070675_100053952 | |||
| 1714 | Ga0070675_100352603 | |||
| 1715 | Ga0070671_100001359 | |||
| 1716 | Ga0070671_100007649 | |||
| 1717 | Ga0070671_100009235 | |||
| 1718 | Ga0070671_100027814 | |||
| 1719 | Ga0070671_100054230 | |||
| 1720 | Ga0070671_100065467 | |||
| 1721 | Ga0070673_100021354 | |||
| 1722 | Ga0070673_100043035 | |||
| 1723 | Ga0070673_100055557 | |||
| 1724 | Ga0070659_100009587 | |||
| 1725 | Ga0070659_100019729 | |||
| 1726 | Ga0070659_100024456 | |||
| 1727 | Ga0070659_100151602 | |||
| 1728 | Ga0070667_100013915 | |||
| 1729 | Ga0070667_100025250 | |||
| 1730 | Ga0070667_100109883 | |||
| 1731 | Ga0070667_100122466 | |||
| 1732 | Ga0070703_10000391 | |||
| 1733 | Ga0070703_10000622 | |||
| 1734 | Ga0070709_10000133 | |||
| 1735 | Ga0070709_10000540 | |||
| 1736 | Ga0070709_10022027 | |||
| 1737 | Ga0070709_10057008 | |||
| 1738 | Ga0070709_10094370 | |||
| 1739 | Ga0070709_10141399 | |||
| 1740 | Ga0070709_10203260 | |||
| 1741 | Ga0070714_100000040 | |||
| 1742 | Ga0070714_100002222 | |||
| 1743 | Ga0070714_100006753 | |||
| 1744 | Ga0070714_100091889 | |||
| 1745 | Ga0070714_100141105 | |||
| 1746 | Ga0070713_100000909 | |||
| 1747 | Ga0070713_100001436 | |||
| 1748 | Ga0070713_100005469 | |||
| 1749 | Ga0070713_100088597 | |||
| 1750 | Ga0070713_100097108 | |||
| 1751 | Ga0070713_100098878 | |||
| 1752 | Ga0070713_100112095 | |||
| 1753 | Ga0070713_100127285 | |||
| 1754 | Ga0070713_100129883 | |||
| 1755 | Ga0070713_100208371 | |||
| 1756 | Ga0070713_100243603 | |||
| 1757 | Ga0070710_10006691 | |||
| 1758 | Ga0070710_10100160 | |||
| 1759 | Ga0070701_10029524 | |||
| 1760 | Ga0070701_10050502 | |||
| 1761 | Ga0070711_100000291 | |||
| 1762 | Ga0070711_100010503 | |||
| 1763 | Ga0070711_100010753 | |||
| 1764 | Ga0070711_100017806 | |||
| 1765 | Ga0070711_100036114 | |||
| 1766 | Ga0070711_100072428 | |||
| 1767 | Ga0070711_100149909 | |||
| 1768 | Ga0070705_100000159 | |||
| 1769 | Ga0070705_100001456 | |||
| 1770 | Ga0070705_100014997 | |||
| 1771 | Ga0070705_100021022 | |||
| 1772 | Ga0070700_100013133 | |||
| 1773 | Ga0070700_100093396 | |||
| 1774 | Ga0070694_100007383 | |||
| 1775 | Ga0070694_100020047 | |||
| 1776 | Ga0070694_100023289 | |||
| 1777 | Ga0070708_100000882 | |||
| 1778 | Ga0070708_100001890 | |||
| 1779 | Ga0070708_100002244 | |||
| 1780 | Ga0070708_100005972 | |||
| 1781 | Ga0070708_100028679 | |||
| 1782 | Ga0070708_100032515 | |||
| 1783 | Ga0070708_100056548 | |||
| 1784 | Ga0070708_100085405 | |||
| 1785 | Ga0070708_100087124 | |||
| 1786 | Ga0070708_100138847 | |||
| 1787 | Ga0070708_100336098 | |||
| 1788 | Ga0070708_100449585 | |||
| 1789 | Ga0070663_100007044 | |||
| 1790 | Ga0070663_100013151 | |||
| 1791 | Ga0070663_100042560 | |||
| 1792 | Ga0070663_100125892 | |||
| 1793 | Ga0070663_100249906 | |||
| 1794 | Ga0070678_100082180 | |||
| 1795 | Ga0070678_100088089 | |||
| 1796 | Ga0070678_100209024 | |||
| 1797 | Ga0070662_100005158 | |||
| 1798 | Ga0070662_100008021 | |||
| 1799 | Ga0070662_100013657 | |||
| 1800 | Ga0070662_100114778 | |||
| 1801 | Ga0070681_10000336 | |||
| 1802 | Ga0070681_10000522 | |||
| 1803 | Ga0070681_10002898 | |||
| 1804 | Ga0070681_10008460 | |||
| 1805 | Ga0070681_10016966 | |||
| 1806 | Ga0070681_10025629 | |||
| 1807 | Ga0070681_10169158 | |||
| 1808 | Ga0068867_100005074 | |||
| 1809 | Ga0068867_100030585 | |||
| 1810 | Ga0070685_10002868 | |||
| 1811 | Ga0070706_100001280 | |||
| 1812 | Ga0070706_100001585 | |||
| 1813 | Ga0070706_100001656 | |||
| 1814 | Ga0070706_100002927 | |||
| 1815 | Ga0070706_100007958 | |||
| 1816 | Ga0070706_100008623 | |||
| 1817 | Ga0070706_100013267 | |||
| 1818 | Ga0070706_100055938 | |||
| 1819 | Ga0070706_100158953 | |||
| 1820 | Ga0070706_100160090 | |||
| 1821 | Ga0070706_100161830 | |||
| 1822 | Ga0070706_100199811 | |||
| 1823 | Ga0070706_100199877 | |||
| 1824 | Ga0070706_100321104 | |||
| 1825 | Ga0070707_100000896 | |||
| 1826 | Ga0070707_100001006 | |||
| 1827 | Ga0070707_100016371 | |||
| 1828 | Ga0070707_100020107 | |||
| 1829 | Ga0070707_100035574 | |||
| 1830 | Ga0070707_100114366 | |||
| 1831 | Ga0070707_100170388 | |||
| 1832 | Ga0070707_100279189 | |||
| 1833 | Ga0070707_100305263 | |||
| 1834 | Ga0070698_100000547 | |||
| 1835 | Ga0070698_100000807 | |||
| 1836 | Ga0070698_100000903 | |||
| 1837 | Ga0070698_100010100 | |||
| 1838 | Ga0070698_100013422 | |||
| 1839 | Ga0070698_100025018 | |||
| 1840 | Ga0070698_100048951 | |||
| 1841 | Ga0070698_100067349 | |||
| 1842 | Ga0070699_100000009 | |||
| 1843 | Ga0070699_100000604 | |||
| 1844 | Ga0070699_100003267 | |||
| 1845 | Ga0070699_100009092 | |||
| 1846 | Ga0070699_100009322 | |||
| 1847 | Ga0070699_100049756 | |||
| 1848 | Ga0070699_100123226 | |||
| 1849 | Ga0070679_100000256 | |||
| 1850 | Ga0070679_100018782 | |||
| 1851 | Ga0070679_100031254 | |||
| 1852 | Ga0070679_100034588 | |||
| 1853 | Ga0070679_100041167 | |||
| 1854 | Ga0070679_100041412 | |||
| 1855 | Ga0070679_100053396 | |||
| 1856 | Ga0070679_100111371 | |||
| 1857 | Ga0070679_100165213 | |||
| 1858 | Ga0070684_100002736 | |||
| 1859 | Ga0070684_100006313 | |||
| 1860 | Ga0070684_100008389 | |||
| 1861 | Ga0070684_100009079 | |||
| 1862 | Ga0070684_100010849 | |||
| 1863 | Ga0070684_100058920 | |||
| 1864 | Ga0070684_100099411 | |||
| 1865 | Ga0070684_100135393 | |||
| 1866 | Ga0070684_100153548 | |||
| 1867 | Ga0070697_100000104 | |||
| 1868 | Ga0070697_100000654 | |||
| 1869 | Ga0070697_100001122 | |||
| 1870 | Ga0070697_100001492 | |||
| 1871 | Ga0070697_100001710 | |||
| 1872 | Ga0070697_100002461 | |||
| 1873 | Ga0070697_100004546 | |||
| 1874 | Ga0070697_100007091 | |||
| 1875 | Ga0070697_100029678 | |||
| 1876 | Ga0070697_100083597 | |||
| 1877 | Ga0070697_100264259 | |||
| 1878 | Ga0068853_100000048 | |||
| 1879 | Ga0068853_100010594 | |||
| 1880 | Ga0068853_100031804 | |||
| 1881 | Ga0068853_100147430 | |||
| 1882 | Ga0068853_100302300 | |||
| 1883 | Ga0070672_100006886 | |||
| 1884 | Ga0070672_100031427 | |||
| 1885 | Ga0070686_100003256 | |||
| 1886 | Ga0070695_100001346 | |||
| 1887 | Ga0070695_100004778 | |||
| 1888 | Ga0070695_100007323 | |||
| 1889 | Ga0070695_100024981 | |||
| 1890 | Ga0070695_100034966 | |||
| 1891 | Ga0070695_100083952 | |||
| 1892 | Ga0070695_100095846 | |||
| 1893 | Ga0070695_100191524 | |||
| 1894 | Ga0070696_100002232 | |||
| 1895 | Ga0070696_100002792 | |||
| 1896 | Ga0070696_100019685 | |||
| 1897 | Ga0070696_100031087 | |||
| 1898 | Ga0070696_100036974 | |||
| 1899 | Ga0070696_100066576 | |||
| 1900 | Ga0070696_100104869 | |||
| 1901 | Ga0070696_100135433 | |||
| 1902 | Ga0070696_100148078 | |||
| 1903 | Ga0070693_100000295 | |||
| 1904 | Ga0070693_100000381 | |||
| 1905 | Ga0070693_100025235 | |||
| 1906 | Ga0070693_100028799 | |||
| 1907 | Ga0070693_100044046 | |||
| 1908 | Ga0070693_100142302 | |||
| 1909 | Ga0070665_100011924 | |||
| 1910 | Ga0070665_100022857 | |||
| 1911 | Ga0070665_100035962 | |||
| 1912 | Ga0070665_100062233 | |||
| 1913 | Ga0070665_100175372 | |||
| 1914 | Ga0070704_100002299 | |||
| 1915 | Ga0070704_100006994 | |||
| 1916 | Ga0070704_100045581 | |||
| 1917 | Ga0070704_100045905 | |||
| 1918 | Ga0070704_100180525 | |||
| 1919 | Ga0068855_100003334 | |||
| 1920 | Ga0068855_100003436 | |||
| 1921 | Ga0068855_100005200 | |||
| 1922 | Ga0068855_100013025 | |||
| 1923 | Ga0068855_100013917 | |||
| 1924 | Ga0068855_100014525 | |||
| 1925 | Ga0068855_100015210 | |||
| 1926 | Ga0068855_100019296 | |||
| 1927 | Ga0068855_100022704 | |||
| 1928 | Ga0068855_100039422 | |||
| 1929 | Ga0068855_100082460 | |||
| 1930 | Ga0068855_100085385 | |||
| 1931 | Ga0068855_100121979 | |||
| 1932 | Ga0068855_100149173 | |||
| 1933 | Ga0070664_100001644 | |||
| 1934 | Ga0070664_100009100 | |||
| 1935 | Ga0068857_100010222 | |||
| 1936 | Ga0068857_100012067 | |||
| 1937 | Ga0068857_100024622 | |||
| 1938 | Ga0068857_100161237 | |||
| 1939 | Ga0068857_100177778 | |||
| 1940 | Ga0068854_100009566 | |||
| 1941 | Ga0068854_100012318 | |||
| 1942 | Ga0068854_100028579 | |||
| 1943 | Ga0068854_100039895 | |||
| 1944 | Ga0068856_100001110 | |||
| 1945 | Ga0068856_100001672 | |||
| 1946 | Ga0068856_100004082 | |||
| 1947 | Ga0068856_100006502 | |||
| 1948 | Ga0068856_100009067 | |||
| 1949 | Ga0068856_100024476 | |||
| 1950 | Ga0068856_100025967 | |||
| 1951 | Ga0068856_100056710 | |||
| 1952 | Ga0068856_100092273 | |||
| 1953 | Ga0068856_100152232 | |||
| 1954 | Ga0068856_100234289 | |||
| 1955 | Ga0070702_100020512 | |||
| 1956 | Ga0070702_100097040 | |||
| 1957 | Ga0068852_100000076 | |||
| 1958 | Ga0068852_100000105 | |||
| 1959 | Ga0068852_100011445 | |||
| 1960 | Ga0068852_100034465 | |||
| 1961 | Ga0068852_100082145 | |||
| 1962 | Ga0068852_100102967 | |||
| 1963 | Ga0068852_100175153 | |||
| 1964 | Ga0068852_100241018 | |||
| 1965 | Ga0068859_100009430 | |||
| 1966 | Ga0068859_100022464 | |||
| 1967 | Ga0068859_100044802 | |||
| 1968 | Ga0068859_100055512 | |||
| 1969 | Ga0068859_100138393 | |||
| 1970 | Ga0068859_100160234 | |||
| 1971 | Ga0068859_100384249 | |||
| 1972 | Ga0068864_100004375 | |||
| 1973 | Ga0068864_100250619 | |||
| 1974 | Ga0068866_10043888 | |||
| 1975 | Ga0068861_100004428 | |||
| 1976 | Ga0068861_100024430 | |||
| 1977 | Ga0068861_100046094 | |||
| 1978 | Ga0068851_10019624 | |||
| 1979 | Ga0068851_10027451 | |||
| 1980 | Ga0068851_10028472 | |||
| 1981 | Ga0068851_10067541 | |||
| 1982 | Ga0068870_10028644 | |||
| 1983 | Ga0068863_100002808 | |||
| 1984 | Ga0068863_100010405 | |||
| 1985 | Ga0068863_100010788 | |||
| 1986 | Ga0068863_100016382 | |||
| 1987 | Ga0068863_100016745 | |||
| 1988 | Ga0068863_100029528 | |||
| 1989 | Ga0068863_100042105 | |||
| 1990 | Ga0068863_100087969 | |||
| 1991 | Ga0068863_100162830 | |||
| 1992 | Ga0068863_100218812 | |||
| 1993 | Ga0068858_100001937 | |||
| 1994 | Ga0068858_100009186 | |||
| 1995 | Ga0068858_100017354 | |||
| 1996 | Ga0068858_100031330 | |||
| 1997 | Ga0068858_100034200 | |||
| 1998 | Ga0068858_100053428 | |||
| 1999 | Ga0068858_100086412 | |||
| 2000 | Ga0068858_100217559 | |||
| 2001 | Ga0068858_100277817 | |||
| 2002 | Ga0068860_100000881 | |||
| 2003 | Ga0068860_100009680 | |||
| 2004 | Ga0068860_100016293 | |||
| 2005 | Ga0068860_100021636 | |||
| 2006 | Ga0068860_100043455 | |||
| 2007 | Ga0068860_100079747 | |||
| 2008 | Ga0068860_100080476 | |||
| 2009 | Ga0068860_100113580 | |||
| 2010 | Ga0068860_100130784 | |||
| 2011 | Ga0068860_100251048 | |||
| 2012 | Ga0068860_100280619 | |||
| 2013 | Ga0068862_100033428 | |||
| 2014 | Ga0068862_100138832 | |||
| 2015 | Ga0081455_10001038 | |||
| 2016 | Ga0081538_10006544 | |||
| 2017 | Ga0070717_10002115 | |||
| 2018 | Ga0070717_10003229 | |||
| 2019 | Ga0070717_10003449 | |||
| 2020 | Ga0070717_10015357 | |||
| 2021 | Ga0070717_10017383 | |||
| 2022 | Ga0070717_10036763 | |||
| 2023 | Ga0070717_10039715 | |||
| 2024 | Ga0070717_10041538 | |||
| 2025 | Ga0070717_10050970 | |||
| 2026 | Ga0070717_10064131 | |||
| 2027 | Ga0070717_10072899 | |||
| 2028 | Ga0070717_10109998 | |||
| 2029 | Ga0070715_10001646 | |||
| 2030 | Ga0070716_100000236 | |||
| 2031 | Ga0070716_100001167 | |||
| 2032 | Ga0070716_100011110 | |||
| 2033 | Ga0070716_100054039 | |||
| 2034 | Ga0070716_100104423 | |||
| 2035 | Ga0070712_100000105 | |||
| 2036 | Ga0070712_100001546 | |||
| 2037 | Ga0070712_100015943 | |||
| 2038 | Ga0070712_100024893 | |||
| 2039 | Ga0097621_100000400 | |||
| 2040 | Ga0097621_100000984 | |||
| 2041 | Ga0097621_100001784 | |||
| 2042 | Ga0097621_100004225 | |||
| 2043 | Ga0097621_100006110 | |||
| 2044 | Ga0097621_100011269 | |||
| 2045 | Ga0097621_100027791 | |||
| 2046 | Ga0097621_100078491 | |||
| 2047 | Ga0068871_100001709 | |||
| 2048 | Ga0068871_100004841 | |||
| 2049 | Ga0068871_100008533 | |||
| 2050 | Ga0068871_100020248 | |||
| 2051 | Ga0068871_100020342 | |||
| 2052 | Ga0068871_100023304 | |||
| 2053 | Ga0068871_100079058 | |||
| 2054 | Ga0075428_100089457 | |||
| 2055 | Ga0075428_100246947 | |||
| 2056 | Ga0075428_100254929 | |||
| 2057 | Ga0075428_100255809 | |||
| 2058 | Ga0075430_100002760 | |||
| 2059 | Ga0075430_100005178 | |||
| 2060 | Ga0075430_100049326 | |||
| 2061 | Ga0075431_100109862 | |||
| 2062 | Ga0075431_100197239 | |||
| 2063 | Ga0075431_100240746 | |||
| 2064 | Ga0075433_10000563 | |||
| 2065 | Ga0075433_10017113 | |||
| 2066 | Ga0075433_10041458 | |||
| 2067 | Ga0075433_10045871 | |||
| 2068 | Ga0075433_10051085 | |||
| 2069 | Ga0075433_10093016 | |||
| 2070 | Ga0075434_100001285 | |||
| 2071 | Ga0075434_100002609 | |||
| 2072 | Ga0075434_100020031 | |||
| 2073 | Ga0075434_100044985 | |||
| 2074 | Ga0075434_100052335 | |||
| 2075 | Ga0075434_100064564 | |||
| 2076 | Ga0075434_100101495 | |||
| 2077 | Ga0075434_100125576 | |||
| 2078 | Ga0075434_100279699 | |||
| 2079 | Ga0075429_100306994 | |||
| 2080 | Ga0068865_100013501 | |||
| 2081 | Ga0075436_100000959 | |||
| 2082 | Ga0075436_100001837 | |||
| 2083 | Ga0075436_100003181 | |||
| 2084 | Ga0075436_100004475 | |||
| 2085 | Ga0075436_100009826 | |||
| 2086 | Ga0075436_100018074 | |||
| 2087 | Ga0075436_100022158 | |||
| 2088 | Ga0075436_100060930 | |||
| 2089 | Ga0075436_100088038 | |||
| 2090 | Ga0075436_100173497 | |||
| 2091 | Ga0097620_100009431 | |||
| 2092 | Ga0097620_100022465 | |||
| 2093 | Ga0097620_100044802 | |||
| 2094 | Ga0097620_100055512 | |||
| 2095 | Ga0097620_100138389 | |||
| 2096 | Ga0097620_100160238 | |||
| 2097 | Ga0097620_100384269 | |||
| 2098 | Ga0075435_100000779 | |||
| 2099 | Ga0075435_100002645 | |||
| 2100 | Ga0075435_100033693 | |||
| 2101 | Ga0075435_100039941 | |||
| 2102 | Ga0075435_100055552 | |||
| 2103 | Ga0075435_100105245 | |||
| 2104 | Ga0075435_100137478 | |||
| 2105 | Ga0075435_100186860 | |||
| 2106 | Ga0099794_10008388 | |||
| 2107 | Ga0099794_10019208 | |||
| 2108 | Ga0099794_10029914 | |||
| 2109 | Ga0099794_10090371 | |||
| 2110 | Ga0105240_10001448 | |||
| 2111 | Ga0105240_10001620 | |||
| 2112 | Ga0105240_10006110 | |||
| 2113 | Ga0105240_10006333 | |||
| 2114 | Ga0105240_10006426 | |||
| 2115 | Ga0105240_10007803 | |||
| 2116 | Ga0105240_10011214 | |||
| 2117 | Ga0105240_10017209 | |||
| 2118 | Ga0105240_10025536 | |||
| 2119 | Ga0105240_10026822 | |||
| 2120 | Ga0105240_10054911 | |||
| 2121 | Ga0105240_10055314 | |||
| 2122 | Ga0105240_10095116 | |||
| 2123 | Ga0105240_10097494 | |||
| 2124 | Ga0105240_10128047 | |||
| 2125 | Ga0105240_10391135 | |||
| 2126 | Ga0105240_10451436 | |||
| 2127 | Ga0105240_10496000 | |||
| 2128 | Ga0111539_10000151 | |||
| 2129 | Ga0111539_10033805 | |||
| 2130 | Ga0111539_10108587 | |||
| 2131 | Ga0111539_10109061 | |||
| 2132 | Ga0111539_10170580 | |||
| 2133 | Ga0111539_10249425 | |||
| 2134 | Ga0105245_10009530 | |||
| 2135 | Ga0105245_10032820 | |||
| 2136 | Ga0105245_10046608 | |||
| 2137 | Ga0105245_10085246 | |||
| 2138 | Ga0105245_10143894 | |||
| 2139 | Ga0105245_10144044 | |||
| 2140 | Ga0105245_10168440 | |||
| 2141 | Ga0105247_10000394 | |||
| 2142 | Ga0105247_10001592 | |||
| 2143 | Ga0105247_10054418 | |||
| 2144 | Ga0114129_10007132 | |||
| 2145 | Ga0114129_10063374 | |||
| 2146 | Ga0114129_10087750 | |||
| 2147 | Ga0114129_10122616 | |||
| 2148 | Ga0114129_10163228 | |||
| 2149 | Ga0114129_10441059 | |||
| 2150 | Ga0105241_10000080 | |||
| 2151 | Ga0105241_10000150 | |||
| 2152 | Ga0105241_10002039 | |||
| 2153 | Ga0105241_10004901 | |||
| 2154 | Ga0105241_10022035 | |||
| 2155 | Ga0105241_10043870 | |||
| 2156 | Ga0105241_10053370 | |||
| 2157 | Ga0105242_10015791 | |||
| 2158 | Ga0105242_10035268 | |||
| 2159 | Ga0105242_10244660 | |||
| 2160 | Ga0105248_10027649 | |||
| 2161 | Ga0105248_10033900 | |||
| 2162 | Ga0105248_10035586 | |||
| 2163 | Ga0105248_10049924 | |||
| 2164 | Ga0105248_10099339 | |||
| 2165 | Ga0105248_10140835 | |||
| 2166 | Ga0105248_10588155 | |||
| 2167 | Ga0105237_10011188 | |||
| 2168 | Ga0105237_10013299 | |||
| 2169 | Ga0105237_10020861 | |||
| 2170 | Ga0105237_10115783 | |||
| 2171 | Ga0105237_10280157 | |||
| 2172 | Ga0105238_10000251 | |||
| 2173 | Ga0105238_10000626 | |||
| 2174 | Ga0105238_10001286 | |||
| 2175 | Ga0105238_10003297 | |||
| 2176 | Ga0105238_10007223 | |||
| 2177 | Ga0105238_10009744 | |||
| 2178 | Ga0105238_10050341 | |||
| 2179 | Ga0105238_10064035 | |||
| 2180 | Ga0105238_10154354 | |||
| 2181 | Ga0105238_10236350 | |||
| 2182 | Ga0105249_10008398 | |||
| 2183 | Ga0105249_10017760 | |||
| 2184 | Ga0105249_10031035 | |||
| 2185 | Ga0105249_10127250 | |||
| 2186 | Ga0105239_10000725 | |||
| 2187 | Ga0105239_10005068 | |||
| 2188 | Ga0105239_10014776 | |||
| 2189 | Ga0105239_10018911 | |||
| 2190 | Ga0105239_10039362 | |||
| 2191 | Ga0105239_10047351 | |||
| 2192 | Ga0105239_10066337 | |||
| 2193 | Ga0105239_10121476 | |||
| 2194 | Ga0105239_10193972 | |||
| 2195 | Ga0105239_10225652 | |||
| 2196 | Ga0105239_10328878 | |||
| 2197 | Ga0105246_10001271 | |||
| 2198 | Ga0105246_10005117 | |||
| 2199 | Ga0105246_10032403 | |||
| 2200 | Ga0157370_10000128 | |||
| 2201 | Ga0157370_10019183 | |||
| 2202 | Ga0157370_10039216 | |||
| 2203 | Ga0157370_10072367 | |||
| 2204 | Ga0157370_10158509 | |||
| 2205 | Ga0157369_10000175 | |||
| 2206 | Ga0157369_10000369 | |||
| 2207 | Ga0157369_10000674 | |||
| 2208 | Ga0157369_10004534 | |||
| 2209 | Ga0157369_10007069 | |||
| 2210 | Ga0157369_10007975 | |||
| 2211 | Ga0157369_10009288 | |||
| 2212 | Ga0157369_10014642 | |||
| 2213 | Ga0157369_10015993 | |||
| 2214 | Ga0157369_10028006 | |||
| 2215 | Ga0157369_10046255 | |||
| 2216 | Ga0157369_10064150 | |||
| 2217 | Ga0157369_10114236 | |||
| 2218 | Ga0157369_10194031 | |||
| 2219 | Ga0157369_10300410 | |||
| 2220 | Ga0157374_10000602 | |||
| 2221 | Ga0157374_10001525 | |||
| 2222 | Ga0157374_10001646 | |||
| 2223 | Ga0157374_10002071 | |||
| 2224 | Ga0157374_10002950 | |||
| 2225 | Ga0157374_10003041 | |||
| 2226 | Ga0157374_10003910 | |||
| 2227 | Ga0157374_10009297 | |||
| 2228 | Ga0157374_10014614 | |||
| 2229 | Ga0157374_10023724 | |||
| 2230 | Ga0157374_10036094 | |||
| 2231 | Ga0157374_10065099 | |||
| 2232 | Ga0157374_10070419 | |||
| 2233 | Ga0157374_10083456 | |||
| 2234 | Ga0157374_10124646 | |||
| 2235 | Ga0157374_10265979 | |||
| 2236 | Ga0157378_10000634 | |||
| 2237 | Ga0157378_10000855 | |||
| 2238 | Ga0157378_10002021 | |||
| 2239 | Ga0157378_10002951 | |||
| 2240 | Ga0157378_10003530 | |||
| 2241 | Ga0157378_10003951 | |||
| 2242 | Ga0157378_10005796 | |||
| 2243 | Ga0157378_10014270 | |||
| 2244 | Ga0157378_10026495 | |||
| 2245 | Ga0157378_10032477 | |||
| 2246 | Ga0157378_10066009 | |||
| 2247 | Ga0157378_10074184 | |||
| 2248 | Ga0157378_10080058 | |||
| 2249 | Ga0157378_10094881 | |||
| 2250 | Ga0163162_10001837 | |||
| 2251 | Ga0163162_10015388 | |||
| 2252 | Ga0163162_10020331 | |||
| 2253 | Ga0163162_10023107 | |||
| 2254 | Ga0163162_10025561 | |||
| 2255 | Ga0163162_10029925 | |||
| 2256 | Ga0163162_10084808 | |||
| 2257 | Ga0163162_10090108 | |||
| 2258 | Ga0163162_10123313 | |||
| 2259 | Ga0163162_10189956 | |||
| 2260 | Ga0157372_10000068 | |||
| 2261 | Ga0157372_10000098 | |||
| 2262 | Ga0157372_10000659 | |||
| 2263 | Ga0157372_10001167 | |||
| 2264 | Ga0157372_10002379 | |||
| 2265 | Ga0157372_10003102 | |||
| 2266 | Ga0157372_10004180 | |||
| 2267 | Ga0157372_10005485 | |||
| 2268 | Ga0157372_10005777 | |||
| 2269 | Ga0157372_10025530 | |||
| 2270 | Ga0157372_10026177 | |||
| 2271 | Ga0157372_10034488 | |||
| 2272 | Ga0157372_10036378 | |||
| 2273 | Ga0157372_10057463 | |||
| 2274 | Ga0157372_10066951 | |||
| 2275 | Ga0157372_10073287 | |||
| 2276 | Ga0157372_10091737 | |||
| 2277 | Ga0157372_10092940 | |||
| 2278 | Ga0157372_10103945 | |||
| 2279 | Ga0157372_10119701 | |||
| 2280 | Ga0157372_10125482 | |||
| 2281 | Ga0157372_10184284 | |||
| 2282 | Ga0157375_10018336 | |||
| 2283 | Ga0157375_10038800 | |||
| 2284 | Ga0157375_10040299 | |||
| 2285 | Ga0157375_10053347 | |||
| 2286 | Ga0157375_10323044 | |||
| 2287 | Ga0163163_10000308 | |||
| 2288 | Ga0163163_10004578 | |||
| 2289 | Ga0163163_10012149 | |||
| 2290 | Ga0163163_10027159 | |||
| 2291 | Ga0163163_10041120 | |||
| 2292 | Ga0163163_10051150 | |||
| 2293 | Ga0163163_10155317 | |||
| 2294 | Ga0163163_10240078 | |||
| 2295 | Ga0157379_10051616 | |||
| 2296 | Ga0157379_10107913 | |||
| 2297 | Ga0157379_10171547 | |||
| 2298 | Ga0157376_10000041 | |||
| 2299 | Ga0157376_10001192 | |||
| 2300 | Ga0157376_10004212 | |||
| 2301 | Ga0157376_10019021 | |||
| 2302 | Ga0157376_10035752 | |||
| 2303 | Ga0157376_10076714 | |||
| 2304 | Ga0206356_10154399 | |||
| 2305 | Ga0213873_10001020 | |||
| 2306 | Ga0213871_10001563 | |||
| 2307 | Ga0213871_10023463 | |||
| 2308 | Ga0224570_100051 | |||
| 2309 | Ga0224572_1001234 | |||
| 2310 | Ga0228598_1000169 | |||
| 2311 | Ga0228598_1000528 | |||
| 2312 | Ga0207697_10002784 | |||
| 2313 | Ga0207697_10003372 | |||
| 2314 | Ga0207697_10005868 | |||
| 2315 | Ga0207697_10006400 | |||
| 2316 | Ga0207697_10024591 | |||
| 2317 | Ga0207656_10006657 | |||
| 2318 | Ga0207656_10029474 | |||
| 2319 | Ga0207656_10039267 | |||
| 2320 | Ga0207653_10000081 | |||
| 2321 | Ga0207653_10000107 | |||
| 2322 | Ga0207653_10000386 | |||
| 2323 | Ga0207653_10003362 | |||
| 2324 | Ga0207653_10005402 | |||
| 2325 | Ga0207653_10006333 | |||
| 2326 | Ga0207653_10008942 | |||
| 2327 | Ga0207653_10011509 | |||
| 2328 | Ga0207642_10049324 | |||
| 2329 | Ga0207642_10069656 | |||
| 2330 | Ga0207710_10001603 | |||
| 2331 | Ga0207710_10002034 | |||
| 2332 | Ga0207710_10020144 | |||
| 2333 | Ga0207688_10008152 | |||
| 2334 | Ga0207680_10068403 | |||
| 2335 | Ga0207680_10078873 | |||
| 2336 | Ga0207680_10099890 | |||
| 2337 | Ga0207685_10001742 | |||
| 2338 | Ga0207685_10043273 | |||
| 2339 | Ga0207699_10000137 | |||
| 2340 | Ga0207699_10001136 | |||
| 2341 | Ga0207699_10017588 | |||
| 2342 | Ga0207699_10071431 | |||
| 2343 | Ga0207699_10092270 | |||
| 2344 | Ga0207699_10097257 | |||
| 2345 | Ga0207699_10111597 | |||
| 2346 | Ga0207699_10186938 | |||
| 2347 | Ga0207699_10194459 | |||
| 2348 | Ga0207645_10001830 | |||
| 2349 | Ga0207645_10002865 | |||
| 2350 | Ga0207645_10006746 | |||
| 2351 | Ga0207645_10015775 | |||
| 2352 | Ga0207705_10004304 | |||
| 2353 | Ga0207705_10203831 | |||
| 2354 | Ga0207705_10292935 | |||
| 2355 | Ga0207684_10000161 | |||
| 2356 | Ga0207684_10000236 | |||
| 2357 | Ga0207684_10000768 | |||
| 2358 | Ga0207684_10003969 | |||
| 2359 | Ga0207684_10004721 | |||
| 2360 | Ga0207684_10007415 | |||
| 2361 | Ga0207684_10009366 | |||
| 2362 | Ga0207684_10020611 | |||
| 2363 | Ga0207684_10036911 | |||
| 2364 | Ga0207684_10039136 | |||
| 2365 | Ga0207684_10065414 | |||
| 2366 | Ga0207684_10129262 | |||
| 2367 | Ga0207654_10000180 | |||
| 2368 | Ga0207654_10000548 | |||
| 2369 | Ga0207654_10001207 | |||
| 2370 | Ga0207654_10002654 | |||
| 2371 | Ga0207654_10014094 | |||
| 2372 | Ga0207654_10157432 | |||
| 2373 | Ga0207707_10000190 | |||
| 2374 | Ga0207707_10000298 | |||
| 2375 | Ga0207707_10000766 | |||
| 2376 | Ga0207707_10006111 | |||
| 2377 | Ga0207707_10019589 | |||
| 2378 | Ga0207707_10042156 | |||
| 2379 | Ga0207707_10048844 | |||
| 2380 | Ga0207707_10223151 | |||
| 2381 | Ga0207695_10000047 | |||
| 2382 | Ga0207695_10000150 | |||
| 2383 | Ga0207695_10000162 | |||
| 2384 | Ga0207695_10000474 | |||
| 2385 | Ga0207695_10001894 | |||
| 2386 | Ga0207695_10001900 | |||
| 2387 | Ga0207695_10002040 | |||
| 2388 | Ga0207695_10004291 | |||
| 2389 | Ga0207695_10009043 | |||
| 2390 | Ga0207695_10011870 | |||
| 2391 | Ga0207695_10021258 | |||
| 2392 | Ga0207695_10024140 | |||
| 2393 | Ga0207695_10065312 | |||
| 2394 | Ga0207695_10125451 | |||
| 2395 | Ga0207695_10182285 | |||
| 2396 | Ga0207695_10227648 | |||
| 2397 | Ga0207695_10315621 | |||
| 2398 | Ga0207671_10000155 | |||
| 2399 | Ga0207671_10000894 | |||
| 2400 | Ga0207671_10001417 | |||
| 2401 | Ga0207671_10046009 | |||
| 2402 | Ga0207671_10090656 | |||
| 2403 | Ga0207671_10092693 | |||
| 2404 | Ga0207671_10247483 | |||
| 2405 | Ga0207693_10000016 | |||
| 2406 | Ga0207693_10000065 | |||
| 2407 | Ga0207693_10000777 | |||
| 2408 | Ga0207693_10000812 | |||
| 2409 | Ga0207693_10008215 | |||
| 2410 | Ga0207693_10028082 | |||
| 2411 | Ga0207693_10031092 | |||
| 2412 | Ga0207693_10043122 | |||
| 2413 | Ga0207693_10043174 | |||
| 2414 | Ga0207693_10054152 | |||
| 2415 | Ga0207693_10058107 | |||
| 2416 | Ga0207693_10115788 | |||
| 2417 | Ga0207663_10000007 | |||
| 2418 | Ga0207663_10004549 | |||
| 2419 | Ga0207663_10005767 | |||
| 2420 | Ga0207663_10016071 | |||
| 2421 | Ga0207663_10020937 | |||
| 2422 | Ga0207663_10082400 | |||
| 2423 | Ga0207663_10095904 | |||
| 2424 | Ga0207663_10179199 | |||
| 2425 | Ga0207660_10000117 | |||
| 2426 | Ga0207660_10001691 | |||
| 2427 | Ga0207660_10042653 | |||
| 2428 | Ga0207660_10048029 | |||
| 2429 | Ga0207660_10096144 | |||
| 2430 | Ga0207660_10196521 | |||
| 2431 | Ga0207660_10212296 | |||
| 2432 | Ga0207660_10213233 | |||
| 2433 | Ga0207660_10302663 | |||
| 2434 | Ga0207662_10028035 | |||
| 2435 | Ga0207662_10103932 | |||
| 2436 | Ga0207657_10021358 | |||
| 2437 | Ga0207657_10033636 | |||
| 2438 | Ga0207657_10043307 | |||
| 2439 | Ga0207657_10045562 | |||
| 2440 | Ga0207657_10175883 | |||
| 2441 | Ga0207649_10001760 | |||
| 2442 | Ga0207649_10005074 | |||
| 2443 | Ga0207649_10005520 | |||
| 2444 | Ga0207649_10037715 | |||
| 2445 | Ga0207652_10000028 | |||
| 2446 | Ga0207652_10009201 | |||
| 2447 | Ga0207652_10151457 | |||
| 2448 | Ga0207652_10237841 | |||
| 2449 | Ga0207646_10000012 | |||
| 2450 | Ga0207646_10000014 | |||
| 2451 | Ga0207646_10000880 | |||
| 2452 | Ga0207646_10004919 | |||
| 2453 | Ga0207646_10010635 | |||
| 2454 | Ga0207646_10017978 | |||
| 2455 | Ga0207646_10049482 | |||
| 2456 | Ga0207646_10127328 | |||
| 2457 | Ga0207646_10203589 | |||
| 2458 | Ga0207646_10215294 | |||
| 2459 | Ga0207646_10238694 | |||
| 2460 | Ga0207681_10008159 | |||
| 2461 | Ga0207681_10035812 | |||
| 2462 | Ga0207694_10000142 | |||
| 2463 | Ga0207694_10000146 | |||
| 2464 | Ga0207694_10001250 | |||
| 2465 | Ga0207694_10002693 | |||
| 2466 | Ga0207694_10009282 | |||
| 2467 | Ga0207694_10010358 | |||
| 2468 | Ga0207694_10050540 | |||
| 2469 | Ga0207694_10125355 | |||
| 2470 | Ga0207694_10142321 | |||
| 2471 | Ga0207650_10000009 | |||
| 2472 | Ga0207650_10002938 | |||
| 2473 | Ga0207650_10008266 | |||
| 2474 | Ga0207650_10049649 | |||
| 2475 | Ga0207650_10147725 | |||
| 2476 | Ga0207650_10183591 | |||
| 2477 | Ga0207659_10021721 | |||
| 2478 | Ga0207659_10023201 | |||
| 2479 | Ga0207659_10109868 | |||
| 2480 | Ga0207687_10002949 | |||
| 2481 | Ga0207687_10005869 | |||
| 2482 | Ga0207687_10012150 | |||
| 2483 | Ga0207687_10023707 | |||
| 2484 | Ga0207687_10039715 | |||
| 2485 | Ga0207687_10092709 | |||
| 2486 | Ga0207687_10140123 | |||
| 2487 | Ga0207687_10239494 | |||
| 2488 | Ga0207700_10000249 | |||
| 2489 | Ga0207700_10005659 | |||
| 2490 | Ga0207700_10013298 | |||
| 2491 | Ga0207700_10031842 | |||
| 2492 | Ga0207700_10046680 | |||
| 2493 | Ga0207700_10087042 | |||
| 2494 | Ga0207700_10104291 | |||
| 2495 | Ga0207700_10110509 | |||
| 2496 | Ga0207700_10142967 | |||
| 2497 | Ga0207664_10000029 | |||
| 2498 | Ga0207664_10005745 | |||
| 2499 | Ga0207664_10025183 | |||
| 2500 | Ga0207664_10052622 | |||
| 2501 | Ga0207664_10118330 | |||
| 2502 | Ga0207664_10259785 | |||
| 2503 | Ga0207664_10383790 | |||
| 2504 | Ga0207644_10018151 | |||
| 2505 | Ga0207644_10047216 | |||
| 2506 | Ga0207690_10122155 | |||
| 2507 | Ga0207706_10001735 | |||
| 2508 | Ga0207706_10008234 | |||
| 2509 | Ga0207706_10011568 | |||
| 2510 | Ga0207706_10036754 | |||
| 2511 | Ga0207686_10007098 | |||
| 2512 | Ga0207686_10122559 | |||
| 2513 | Ga0207709_10033794 | |||
| 2514 | Ga0207670_10010469 | |||
| 2515 | Ga0207670_10011904 | |||
| 2516 | Ga0207669_10057513 | |||
| 2517 | Ga0207704_10005744 | |||
| 2518 | Ga0207704_10018832 | |||
| 2519 | Ga0207704_10019243 | |||
| 2520 | Ga0207704_10085456 | |||
| 2521 | Ga0207665_10000107 | |||
| 2522 | Ga0207665_10000115 | |||
| 2523 | Ga0207665_10006151 | |||
| 2524 | Ga0207665_10011547 | |||
| 2525 | Ga0207665_10013313 | |||
| 2526 | Ga0207665_10018887 | |||
| 2527 | Ga0207665_10056712 | |||
| 2528 | Ga0207665_10077872 | |||
| 2529 | Ga0207665_10078308 | |||
| 2530 | Ga0207665_10159328 | |||
| 2531 | Ga0207691_10001183 | |||
| 2532 | Ga0207691_10007812 | |||
| 2533 | Ga0207691_10034931 | |||
| 2534 | Ga0207691_10072500 | |||
| 2535 | Ga0207691_10103418 | |||
| 2536 | Ga0207711_10012699 | |||
| 2537 | Ga0207711_10075155 | |||
| 2538 | Ga0207711_10098700 | |||
| 2539 | Ga0207711_10099190 | |||
| 2540 | Ga0207711_10107388 | |||
| 2541 | Ga0207711_10121126 | |||
| 2542 | Ga0207711_10160979 | |||
| 2543 | Ga0207689_10023387 | |||
| 2544 | Ga0207689_10027588 | |||
| 2545 | Ga0207689_10033576 | |||
| 2546 | Ga0207689_10051707 | |||
| 2547 | Ga0207689_10056964 | |||
| 2548 | Ga0207689_10059021 | |||
| 2549 | Ga0207689_10187239 | |||
| 2550 | Ga0207661_10005695 | |||
| 2551 | Ga0207661_10007197 | |||
| 2552 | Ga0207661_10012611 | |||
| 2553 | Ga0207661_10034334 | |||
| 2554 | Ga0207661_10041428 | |||
| 2555 | Ga0207661_10188446 | |||
| 2556 | Ga0207679_10002619 | |||
| 2557 | Ga0207667_10000900 | |||
| 2558 | Ga0207667_10003139 | |||
| 2559 | Ga0207667_10003680 | |||
| 2560 | Ga0207667_10009576 | |||
| 2561 | Ga0207667_10011340 | |||
| 2562 | Ga0207667_10013112 | |||
| 2563 | Ga0207667_10020778 | |||
| 2564 | Ga0207667_10028534 | |||
| 2565 | Ga0207667_10040048 | |||
| 2566 | Ga0207667_10060479 | |||
| 2567 | Ga0207667_10175414 | |||
| 2568 | Ga0207667_10237178 | |||
| 2569 | Ga0207667_10383675 | |||
| 2570 | Ga0207712_10031248 | |||
| 2571 | Ga0207712_10065405 | |||
| 2572 | Ga0207712_10142931 | |||
| 2573 | Ga0207712_10181640 | |||
| 2574 | Ga0207668_10007215 | |||
| 2575 | Ga0207668_10029996 | |||
| 2576 | Ga0207640_10018350 | |||
| 2577 | Ga0207640_10083305 | |||
| 2578 | Ga0207640_10124867 | |||
| 2579 | Ga0207640_10126774 | |||
| 2580 | Ga0207640_10191687 | |||
| 2581 | Ga0207640_10248335 | |||
| 2582 | Ga0207658_10020950 | |||
| 2583 | Ga0207658_10021723 | |||
| 2584 | Ga0207658_10097652 | |||
| 2585 | Ga0207658_10105019 | |||
| 2586 | Ga0207658_10380438 | |||
| 2587 | Ga0207677_10000782 | |||
| 2588 | Ga0207677_10004076 | |||
| 2589 | Ga0207677_10014586 | |||
| 2590 | Ga0207677_10020052 | |||
| 2591 | Ga0207677_10028891 | |||
| 2592 | Ga0207677_10043914 | |||
| 2593 | Ga0207677_10065677 | |||
| 2594 | Ga0207677_10100680 | |||
| 2595 | Ga0207703_10003901 | |||
| 2596 | Ga0207703_10020759 | |||
| 2597 | Ga0207703_10042321 | |||
| 2598 | Ga0207703_10069296 | |||
| 2599 | Ga0207703_10110581 | |||
| 2600 | Ga0207703_10128400 | |||
| 2601 | Ga0207703_10272339 | |||
| 2602 | Ga0207639_10000098 | |||
| 2603 | Ga0207639_10168926 | |||
| 2604 | Ga0207639_10242664 | |||
| 2605 | Ga0207678_10000337 | |||
| 2606 | Ga0207678_10015004 | |||
| 2607 | Ga0207678_10026533 | |||
| 2608 | Ga0207678_10116710 | |||
| 2609 | Ga0207678_10227803 | |||
| 2610 | Ga0207708_10000366 | |||
| 2611 | Ga0207708_10013327 | |||
| 2612 | Ga0207708_10016142 | |||
| 2613 | Ga0207708_10115441 | |||
| 2614 | Ga0207708_10116580 | |||
| 2615 | Ga0207702_10000926 | |||
| 2616 | Ga0207702_10001220 | |||
| 2617 | Ga0207702_10004275 | |||
| 2618 | Ga0207702_10004419 | |||
| 2619 | Ga0207702_10007182 | |||
| 2620 | Ga0207702_10018691 | |||
| 2621 | Ga0207702_10019311 | |||
| 2622 | Ga0207702_10068332 | |||
| 2623 | Ga0207702_10126619 | |||
| 2624 | Ga0207702_10222875 | |||
| 2625 | Ga0207702_10236560 | |||
| 2626 | Ga0207702_10240291 | |||
| 2627 | Ga0207641_10002695 | |||
| 2628 | Ga0207641_10003181 | |||
| 2629 | Ga0207641_10008851 | |||
| 2630 | Ga0207641_10018864 | |||
| 2631 | Ga0207641_10041073 | |||
| 2632 | Ga0207641_10050785 | |||
| 2633 | Ga0207641_10070295 | |||
| 2634 | Ga0207641_10218077 | |||
| 2635 | Ga0207648_10012183 | |||
| 2636 | Ga0207648_10013725 | |||
| 2637 | Ga0207648_10048083 | |||
| 2638 | Ga0207648_10157934 | |||
| 2639 | Ga0207676_10006298 | |||
| 2640 | Ga0207676_10007056 | |||
| 2641 | Ga0207676_10017626 | |||
| 2642 | Ga0207676_10078521 | |||
| 2643 | Ga0207676_10334556 | |||
| 2644 | Ga0207674_10001827 | |||
| 2645 | Ga0207674_10001977 | |||
| 2646 | Ga0207674_10003452 | |||
| 2647 | Ga0207674_10003850 | |||
| 2648 | Ga0207674_10018736 | |||
| 2649 | Ga0207674_10020820 | |||
| 2650 | Ga0207674_10041619 | |||
| 2651 | Ga0207674_10048470 | |||
| 2652 | Ga0207674_10053136 | |||
| 2653 | Ga0207674_10068065 | |||
| 2654 | Ga0207674_10079994 | |||
| 2655 | Ga0207674_10093088 | |||
| 2656 | Ga0207674_10179644 | |||
| 2657 | Ga0207674_10244274 | |||
| 2658 | Ga0207675_100002429 | |||
| 2659 | Ga0207675_100036053 | |||
| 2660 | Ga0207675_100052340 | |||
| 2661 | Ga0207675_100071479 | |||
| 2662 | Ga0207675_100147709 | |||
| 2663 | Ga0207683_10001884 | |||
| 2664 | Ga0207683_10004963 | |||
| 2665 | Ga0207683_10030494 | |||
| 2666 | Ga0207683_10144986 | |||
| 2667 | Ga0207698_10000031 | |||
| 2668 | Ga0207698_10000241 | |||
| 2669 | Ga0207698_10002673 | |||
| 2670 | Ga0207698_10046018 | |||
| 2671 | Ga0207698_10057186 | |||
| 2672 | Ga0207698_10171993 | |||
| 2673 | Ga0207698_10192918 | |||
| 2674 | Ga0207698_10195581 | |||
| 2675 | Ga0209967_1002658 | |||
| 2676 | Ga0209588_1001413 | |||
| 2677 | Ga0209588_1004921 | |||
| 2678 | Ga0209588_1007796 | |||
| 2679 | Ga0209974_10000168 | |||
| 2680 | Ga0209974_10002473 | |||
| 2681 | Ga0207428_10000643 | |||
| 2682 | Ga0207428_10030722 | |||
| 2683 | Ga0207428_10038616 | |||
| 2684 | Ga0207428_10081579 | |||
| 2685 | Ga0207428_10090798 | |||
| 2686 | Ga0265356_1000062 | |||
| 2687 | Ga0268266_10013494 | |||
| 2688 | Ga0268266_10022900 | |||
| 2689 | Ga0268266_10121088 | |||
| 2690 | Ga0268265_10019225 | |||
| 2691 | Ga0268265_10022177 | |||
| 2692 | Ga0268265_10054238 | |||
| 2693 | Ga0268265_10089816 | |||
| 2694 | Ga0268265_10093588 | |||
| 2695 | Ga0268264_10002705 | |||
| 2696 | Ga0268264_10014751 | |||
| 2697 | Ga0268264_10033230 | |||
| 2698 | Ga0268264_10042385 | |||
| 2699 | Ga0268264_10058296 | |||
| 2700 | Ga0268264_10070984 | |||
| 2701 | Ga0268264_10088537 | |||
| 2702 | Ga0268264_10126854 | |||
| 2703 | Ga0268264_10367769 | |||
| 2704 | Ga0265338_10000141 | |||
| 2705 | Ga0265338_10000927 | |||
| 2706 | Ga0265338_10002893 | |||
| 2707 | Ga0265338_10004929 | |||
| 2708 | Ga0265338_10012507 | |||
| 2709 | Ga0265338_10040125 | |||
| 2710 | Ga0265338_10080555 | |||
| 2711 | Ga0265338_10117213 | |||
| 2712 | Ga0265762_1000249 | |||
| 2713 | Ga0265762_1001195 | |||
| 2714 | Ga0265762_1002545 | |||
| 2715 | Ga0265770_1009612 | |||
| 2716 | Ga0265765_1000845 | |||
| 2717 | Ga0265760_10000280 | |||
| 2718 | Ga0265760_10000461 | |||
| 2719 | Ga0265760_10000654 | |||
| 2720 | Ga0265760_10020761 | |||
| 2721 | Ga0265330_10000211 | |||
| 2722 | Ga0265330_10055177 | |||
| 2723 | Ga0265330_10064162 | |||
| 2724 | Ga0265332_10034873 | |||
| 2725 | Ga0265332_10034968 | |||
| 2726 | Ga0265328_10001124 | |||
| 2727 | Ga0265325_10000148 | |||
| 2728 | Ga0265325_10000434 | |||
| 2729 | Ga0265325_10003694 | |||
| 2730 | Ga0265340_10003970 | |||
| 2731 | Ga0265340_10008771 | |||
| 2732 | Ga0265340_10009210 | |||
| 2733 | Ga0265340_10038002 | |||
| 2734 | Ga0265340_10042249 | |||
| 2735 | Ga0265340_10048470 | |||
| 2736 | Ga0265339_10000332 | |||
| 2737 | Ga0265339_10001013 | |||
| 2738 | Ga0265339_10007699 | |||
| 2739 | Ga0265339_10014386 | |||
| 2740 | Ga0265339_10018085 | |||
| 2741 | Ga0265339_10021602 | |||
| 2742 | Ga0265339_10021726 | |||
| 2743 | Ga0265339_10036967 | |||
| 2744 | Ga0265339_10060021 | |||
| 2745 | Ga0265331_10009626 | |||
| 2746 | Ga0265327_10025253 | |||
| 2747 | Ga0265316_10000552 | |||
| 2748 | Ga0265316_10000779 | |||
| 2749 | Ga0265316_10001755 | |||
| 2750 | Ga0265316_10014893 | |||
| 2751 | Ga0265316_10020667 | |||
| 2752 | Ga0265316_10055960 | |||
| 2753 | Ga0265316_10072258 | |||
| 2754 | Ga0265316_10092111 | |||
| 2755 | Ga0265316_10127550 | |||
| 2756 | Ga0265316_10278873 | |||
| 2757 | Ga0307408_100010223 | |||
| 2758 | Ga0307408_100037833 | |||
| 2759 | Ga0265313_10002928 | |||
| 2760 | Ga0265313_10009779 | |||
| 2761 | Ga0265313_10015902 | |||
| 2762 | Ga0265313_10023016 | |||
| 2763 | Ga0265313_10025245 | |||
| 2764 | Ga0265314_10000033 | |||
| 2765 | Ga0265314_10001011 | |||
| 2766 | Ga0265314_10001761 | |||
| 2767 | Ga0265314_10033608 | |||
| 2768 | Ga0265314_10054010 | |||
| 2769 | Ga0265342_10000652 | |||
| 2770 | Ga0265342_10001096 | |||
| 2771 | Ga0265342_10006451 | |||
| 2772 | Ga0265342_10010429 | |||
| 2773 | Ga0265342_10038615 | |||
| 2774 | Ga0265342_10081310 | |||
| 2775 | Ga0316576_10003943 | |||
| 2776 | Ga0316578_10033392 | |||
| 2777 | Ga0307405_10031942 | |||
| 2778 | Ga0307405_10174508 | |||
| 2779 | Ga0307413_10020600 | |||
| 2780 | Ga0307410_10030803 | |||
| 2781 | Ga0307406_10003699 | |||
| 2782 | Ga0307406_10271810 | |||
| 2783 | Ga0307407_10008386 | |||
| 2784 | Ga0307407_10042159 | |||
| 2785 | Ga0307412_10233289 | |||
| 2786 | Ga0307409_100030373 | |||
| 2787 | Ga0307409_100041323 | |||
| 2788 | Ga0307416_100042805 | |||
| 2789 | Ga0307416_100129602 | |||
| 2790 | Ga0307416_100270249 | |||
| 2791 | Ga0307414_10013696 | |||
| 2792 | Ga0307414_10101533 | |||
| 2793 | Ga0307411_10010437 | |||
| 2794 | Ga0307411_10057321 | |||
| 2795 | Ga0307415_100006252 | |||
| 2796 | Ga0307415_100102544 | |||
| 2797 | Ga0316583_10007962 | |||
| 2798 | Ga0316580_10001623 | |||
| 2799 | Ga0373926_0044172 | |||
| 2800 | Ga0373934_0042813 | |||
| 2801 | Ga0373934_0073469 | |||
| 2802 | Ga0373951_0001056 | |||
| 2803 | Ga0373923_0000184 | |||
| 2804 | Ga0373936_0000418 | |||
| 2805 | Ga0373939_0022184 | |||
| 2806 | Ga0373945_0007864 | |||
| 2807 | Ga0373945_0007889 | |||
| 2808 | Ga0373953_0006078 | |||
| 2809 | Ga0373953_0063768 | |||
| 2810 | Ga0373954_0049493 | |||
| 2811 | Ga0373956_0030851 | |||
| 2812 | Ga0373956_0038529 | |||
| 2813 | Ga0373956_0088251 | |||
| 2814 | Ga0373943_0000388 | |||
| 2815 | Ga0373943_0035063 | |||
| 2816 | Ga0373943_0044578 | |||
| 2817 | Ga0373943_0067209 | |||
| 2818 | Ga0373943_0073718 | |||
| 2819 | Ga0373943_0094000 | |||
| 2820 | Ga0373943_0135322 | |||
| 2821 | Ga0373946_0001568 | |||
| 2822 | Ga0373955_0001776 | |||
| 2823 | Ga0373955_0018552 | |||
| 2824 | Ga0373955_0042350 | |||
| 2825 | Ga0316574_0009261 | |||
| 2826 | Ga0316574_0019303 | |||
| 2827 | Ga0373931_0001031 | |||
| 2828 | Ga0373931_0045547 | |||
| 2829 | Ga0373931_0046010 | |||
| 2830 | Ga0373935_0001450 | |||
| 2831 | Ga0373935_0013760 | |||
| 2832 | Ga0373935_0093295 | |||
| 2833 | Ga0373927_0000193 | |||
| 2834 | Ga0373927_0032925 | |||
| 2835 | Ga0373927_0043042 | |||
| 2836 | Ga0373927_0044529 | |||
| 2837 | Ga0373933_0000058 | |||
| 2838 | Ga0373933_0000737 | |||
| 2839 | Ga0373933_0021118 | |||
| 2840 | Ga0373933_0046033 | |||
| 2841 | Ga0373933_0083472 | |||
| 2842 | Ga0373933_0106673 | |||
| 2843 | Ga0373947_0000117 | |||
| 2844 | Ga0373947_0021077 | |||
| 2845 | Ga0373947_0022364 | |||
| 2846 | Ga0373947_0040633 | |||
| 2847 | Ga0373947_0043952 | |||
| 2848 | Ga0373937_0000008 | |||
| 2849 | Ga0373937_0003409 | |||
| 2850 | Ga0373937_0012458 | |||
| 2851 | Ga0373937_0034946 | |||
| 2852 | Ga0373937_0081885 | |||
| 2853 | Ga0373937_0106746 | |||
| 2854 | Ga0373937_0126691 | |||
| 2855 | Ga0373937_0154098 | |||
| 2856 | Ga0373937_0170272 | |||
| 2857 | Ga0373937_0193039 | |||
| 2858 | Ga0373937_0206521 | |||
| 2859 | Ga0373937_0278126 | |||
| 2860 | Ga0316584_0014918 | |||
| 2861 | Ga0373925_0001745 | |||
| 2862 | Ga0373925_0008635 | |||
| 2863 | Ga0373925_0011926 | |||
| 2864 | Ga0373925_0023979 | |||
| 2865 | Ga0373925_0034376 | |||
| 2866 | Ga0373925_0060548 | |||
| 2867 | Ga0373925_0088280 | |||
| 2868 | Ga0373925_0230564 | |||
| 2869 | Ga0395898_0106277 | |||
| 2870 | Ga0395898_0195194 | |||
| 2871 | Ga0395905_0130836 | |||
| 2872 | Ga0395905_0135282 | |||
| 2873 | Ga0316581_0002005 | |||
| 2874 | Ga0436365_0353713 | |||
| 2875 | Ga0436365_1476328 | |||
| 2876 | Ga0436360_0617446 | |||
| 2877 | Ga0436362_0458373 | |||
| 2878 | Ga0436362_0512278 | |||
| 2879 | Ga0436362_0797770 | |||
| 2880 | Ga0436362_0816102 | |||
| 2881 | Ga0439448_0007809 | |||
| 2882 | Ga0439450_014126 | |||
| 2883 | Ga0439452_007895 | |||
| 2884 | Ga0451577_0000536 | |||
| 2885 | Ga0451577_0079207 | |||
| 2886 | Ga0451577_0192726 | |||
| 2887 | Ga0451577_0194677 | |||
| 2888 | Ga0453683_0002287 | |||
| 2889 | Ga0453683_0031893 | |||
| 2890 | Ga0453683_0070013 | |||
| 2891 | Ga0453683_0201662 | |||
| 2892 | Ga0466966_0157301 | |||
| 2893 | Ga0466961_0121811 | |||
| 2894 | Ga0466963_0102257 | |||
| 2895 | Ga0466963_0128438 | |||
| 2896 | Ga0466964_0031788 | |||
| 2897 | Ga0453684_0001218 | |||
| 2898 | Ga0453684_0009087 | |||
| 2899 | Ga0453684_0106774 | |||
| 2900 | Ga0466957_0127024 | |||
| 2901 | Ga0451576_0003135 | |||
| 2902 | Ga0451576_0004776 | |||
| 2903 | Ga0451576_0009653 | |||
| 2904 | Ga0451576_0010166 | |||
| 2905 | Ga0451576_0069182 | |||
| 2906 | Ga0451576_0086627 | |||
| 2907 | Ga0451576_0116015 | |||
| 2908 | Ga0451576_0184541 | |||
| 2909 | Ga0451576_0334275 | |||
| 2910 | Ga0466958_0153917 | |||
| 2911 | Ga0466967_0001417 | |||
| 2912 | Ga0466967_0003508 | |||
| 2913 | Ga0466967_0019296 | |||
| 2914 | Ga0466967_0035386 | |||
| 2915 | Ga0466967_0265490 | |||
| 2916 | Ga0466967_0281137 | |||
| 2917 | Ga0495592_0075346 | |||
| 2918 | Ga0495603_0067174 | |||
| 2919 | Ga0495629_0021546 | |||
| 2920 | Ga0495629_0044195 | |||
| 2921 | Ga0495629_0088773 | |||
| 2922 | Ga0495641_0029455 | |||
| 2923 | Ga0495651_0000024 | |||
| 2924 | Ga0495651_0002507 | |||
| 2925 | Ga0495650_0001419 | |||
| 2926 | Ga0495580_0000153 | |||
| 2927 | Ga0495580_0000774 | |||
| 2928 | Ga0495580_0002914 | |||
| 2929 | Ga0495580_0004498 | |||
| 2930 | Ga0495580_0006320 | |||
| 2931 | Ga0495580_0010846 | |||
| 2932 | Ga0495580_0017569 | |||
| 2933 | Ga0495580_0037076 | |||
| 2934 | Ga0495580_0042025 | |||
| 2935 | Ga0495580_0068070 | |||
| 2936 | Ga0495580_0102850 | |||
| 2937 | Ga0495580_0105188 | |||
| 2938 | Ga0495580_0231626 | |||
| 2939 | Ga0495582_0000192 | |||
| 2940 | Ga0495582_0000877 | |||
| 2941 | Ga0495582_0007583 | |||
| 2942 | Ga0495582_0018131 | |||
| 2943 | Ga0495664_0052555 | |||
| 2944 | Ga0495594_0059594 | |||
| 2945 | Ga0495608_0076936 | |||
| 2946 | Ga0495608_0168568 | |||
| 2947 | Ga0495618_0081865 | |||
| 2948 | Ga0495630_0004232 | |||
| 2949 | Ga0495630_0020041 | |||
| 2950 | Ga0495630_0090456 | |||
| 2951 | Ga0495630_0240789 | |||
| 2952 | Ga0495666_0035843 | |||
| 2953 | Ga0495666_0047978 | |||
| 2954 | Ga0495666_0057832 | |||
| 2955 | Ga0495652_0122361 | |||
| 2956 | Ga0495665_0002336 | |||
| 2957 | Ga0495665_0015688 | |||
| 2958 | Ga0495665_0077755 | |||
| 2959 | Ga0495640_0030801 | |||
| 2960 | Ga0495586_0012381 | |||
| 2961 | Ga0495586_0027225 | |||
| 2962 | Ga0495587_0000047 | |||
| 2963 | Ga0495587_0010043 | |||
| 2964 | Ga0495587_0010519 | |||
| 2965 | Ga0495587_0051661 | |||
| 2966 | Ga0495645_0002646 | |||
| 2967 | Ga0495645_0072355 | |||
| 2968 | Ga0495645_0084085 | |||
| 2969 | Ga0495667_0007600 | |||
| 2970 | Ga0495667_0055408 | |||
| 2971 | Ga0495656_0014256 | |||
| 2972 | Ga0495634_0145530 | |||
| 2973 | Ga0495625_0017649 | |||
| 2974 | Ga0495657_0074510 | |||
| 2975 | Ga0495657_0130593 | |||
| 2976 | Ga0495657_0148663 | |||
| 2977 | Ga0495623_0063488 | |||
| 2978 | Ga0495647_0006349 | |||
| 2979 | Ga0495658_0013373 | |||
| 2980 | Ga0495658_0131942 | |||
| 2981 | Ga0495613_0060132 | |||
| 2982 | Ga0495624_0019529 | |||
| 2983 | Ga0495624_0071395 | |||
| 2984 | Ga0495600_0071156 | |||
| 2985 | Ga0495581_0024295 | |||
| 2986 | Ga0495581_0139416 | |||
| 2987 | Ga0495604_0009125 | |||
| 2988 | Ga0495604_0097000 | |||
| 2989 | Ga0495604_0137156 | |||
| 2990 | Ga0495604_0172100 | |||
| 2991 | Ga0495674_0064441 | |||
| 2992 | Ga0495674_0095346 | |||
| 2993 | Ga0495674_0096556 | |||
| 2994 | Ga0495674_0112359 | |||
| 2995 | Ga0495674_0209967 | |||
| 2996 | Ga0495680_0000749 | |||
| 2997 | Ga0495680_0022613 | |||
| 2998 | Ga0495683_0039558 | |||
| 2999 | Ga0495675_0000370 | |||
| 3000 | Ga0495675_0003195 | |||
| 3001 | Ga0495675_0006137 | |||
| 3002 | Ga0495675_0008673 | |||
| 3003 | Ga0495684_0017250 | |||
| 3004 | Ga0495684_0028476 | |||
| 3005 | Ga0495602_0000026 | |||
| 3006 | Ga0495602_0008201 | |||
| 3007 | Ga0495602_0072908 | |||
| 3008 | Ga0495614_0119500 | |||
| 3009 | Ga0496100_0020457 | |||
| 3010 | Ga0496100_0042270 | |||
| 3011 | Ga0496101_0017382 | |||
| 3012 | Ga0496101_0055793 | |||
| 3013 | Ga0496101_0082390 | |||
| 3014 | Ga0496102_0214703 | |||
| 3015 | Ga0496103_0090378 | |||
| 3016 | Ga0496103_0097059 | |||
| 3017 | Ga0496103_0111820 | |||
| 3018 | Ga0496104_0054906 | |||
| 3019 | Ga0496104_0068119 | |||
| 3020 | Ga0496104_0073009 | |||
| 3021 | Ga0496104_0155840 | |||
| 3022 | Ga0496104_0252184 | |||
| 3023 | Ga0496104_0276781 | |||
| 3024 | Ga0496105_0086016 | |||
| 3025 | Ga0496105_0087624 | |||
| 3026 | Ga0496105_0099060 | |||
| 3027 | Ga0496105_0207526 | |||
| 3028 | Ga0496106_0038755 | |||
| 3029 | Ga0496106_0053387 | |||
| 3030 | Ga0496106_0061497 | |||
| 3031 | Ga0496107_0007445 | |||
| 3032 | Ga0496107_0021957 | |||
| 3033 | Ga0496107_0154221 | |||
| 3034 | Ga0496107_0217014 | |||
| 3035 | Ga0496108_0045295 | |||
| 3036 | Ga0496109_0011491 | |||
| 3037 | Ga0496109_0143414 | |||
| 3038 | Ga0496110_0054349 | |||
| 3039 | Ga0496110_0358538 | |||
| 3040 | Ga0496111_0282470 | |||
| 3041 | Ga0496112_0003396 | |||
| 3042 | Ga0496112_0005165 | |||
| 3043 | Ga0496112_0019019 | |||
| 3044 | Ga0496112_0054818 | |||
| 3045 | Ga0496112_0059366 | |||
| 3046 | Ga0496112_0094583 | |||
| 3047 | Ga0496112_0112959 | |||
| 3048 | Ga0496112_0139270 | |||
| 3049 | Ga0496112_0146180 | |||
| 3050 | Ga0496112_0205131 | |||
| 3051 | Ga0496113_0027773 | |||
| 3052 | Ga0496113_0213188 | |||
| 3053 | Ga0496114_0004599 | |||
| 3054 | Ga0496114_0020901 | |||
| 3055 | Ga0496114_0022030 | |||
| 3056 | Ga0496114_0023558 | |||
| 3057 | Ga0496114_0099938 | |||
| 3058 | Ga0496115_0009902 | |||
| 3059 | Ga0496115_0011052 | |||
| 3060 | Ga0496115_0020023 | |||
| 3061 | Ga0496115_0042487 | |||
| 3062 | Ga0496115_0086838 | |||
| 3063 | Ga0496115_0298547 | |||
| 3064 | Ga0496119_0070238 | |||
| 3065 | Ga0496119_0107710 | |||
| 3066 | Ga0496126_0000187 | |||
| 3067 | Ga0496126_0104925 | |||
| 3068 | Ga0501290_001149 | |||
| 3069 | Ga0501291_000266 | |||
| 3070 | Ga0501293_000057 | |||
| 3071 | Ga0501294_000272 | |||
| 3072 | Ga0501296_000249 | |||
| 3073 | Ga0501298_000404 | |||
| 3074 | Ga0501300_000773 | |||
| 3075 | Ga0501031_0038437 | |||
| 3076 | Ga0501031_0066148 | |||
| 3077 | Ga0501032_0015454 | |||
| 3078 | Ga0501033_0061105 | |||
| 3079 | Ga0501033_0107861 | |||
| 3080 | Ga0501036_0001893 | |||
| 3081 | Ga0501036_0030043 | |||
| 3082 | Ga0501036_0058543 | |||
| 3083 | Ga0501036_0153401 | |||
| 3084 | Ga0501037_0007971 | |||
| 3085 | Ga0501037_0119505 | |||
| 3086 | Ga0501038_0004726 | |||
| 3087 | Ga0501038_0006830 | |||
| 3088 | Ga0501038_0022090 | |||
| 3089 | Ga0501038_0069200 | |||
| 3090 | Ga0501039_0044377 | |||
| 3091 | Ga0501040_0001593 | |||
| 3092 | Ga0501040_0057762 | |||
| 3093 | Ga0501041_0003041 | |||
| 3094 | Ga0501041_0007098 | |||
| 3095 | Ga0501042_0012537 | |||
| 3096 | Ga0501042_0013777 | |||
| 3097 | Ga0501042_0065521 | |||
| 3098 | Ga0501043_0015738 | |||
| 3099 | Ga0501043_0021451 | |||
| 3100 | Ga0501043_0037467 | |||
| 3101 | Ga0501043_0211594 | |||
| 3102 | Ga0501046_0000055 | |||
| 3103 | Ga0501046_0005343 | |||
| 3104 | Ga0501046_0006405 | |||
| 3105 | Ga0501046_0207888 | |||
| 3106 | Ga0501047_0005669 | |||
| 3107 | Ga0501047_0075799 | |||
| 3108 | Ga0501047_0078369 | |||
| 3109 | Ga0501047_0107733 | |||
| 3110 | Ga0501048_0008402 | |||
| 3111 | Ga0501048_0028583 | |||
| 3112 | Ga0501067_0017997 | |||
| 3113 | Ga0501069_0006872 | |||
| 3114 | Ga0501069_0007391 | |||
| 3115 | Ga0501069_0165560 | |||
| 3116 | Ga0501070_0010742 | |||
| 3117 | Ga0501070_0031318 | |||
| 3118 | Ga0501071_0007897 | |||
| 3119 | Ga0501072_0000458 | |||
| 3120 | Ga0501072_0003614 | |||
| 3121 | Ga0501072_0062772 | |||
| 3122 | Ga0501072_0083176 | |||
| 3123 | Ga0501073_0002801 | |||
| 3124 | Ga0501073_0022772 | |||
| 3125 | Ga0501073_0111939 | |||
| 3126 | Ga0501074_0040296 | |||
| 3127 | Ga0501074_0059935 | |||
| 3128 | Ga0501074_0138096 | |||
| 3129 | Ga0501074_0170755 | |||
| 3130 | Ga0501075_0013585 | |||
| 3131 | Ga0501075_0081014 | |||
| 3132 | Ga0501075_0096283 | |||
| 3133 | Ga0501075_0264418 | |||
| 3134 | Ga0501076_0014603 | |||
| 3135 | Ga0501076_0032193 | |||
| 3136 | Ga0501076_0056253 | |||
| 3137 | Ga0501076_0099074 | |||
| 3138 | Ga0501077_0000195 | |||
| 3139 | Ga0501198_000904 | |||
| 3140 | Ga0501202_007764 | |||
| 3141 | Ga0501202_008031 | |||
| 3142 | Ga0501209_000572 | |||
| 3143 | Ga0501217_000668 | |||
| 3144 | Ga0501223_014720 | |||
| 3145 | Ga0501230_001806 | |||
| 3146 | Ga0501243_000326 | |||
| 3147 | Ga0501261_007431 | |||
| 3148 | Ga0501225_0002114 | |||
| 3149 | Ga0501245_002004 | |||
| 3150 | Ga0501079_0000550 | |||
| 3151 | Ga0501079_0018991 | |||
| 3152 | Ga0501079_0028985 | |||
| 3153 | Ga0501079_0054032 | |||
| 3154 | Ga0501079_0206789 | |||
| 3155 | Ga0501080_0002277 | |||
| 3156 | Ga0501080_0026919 | |||
| 3157 | Ga0501080_0039009 | |||
| 3158 | Ga0501080_0068470 | |||
| 3159 | Ga0501081_0000417 | |||
| 3160 | Ga0501081_0043664 | |||
| 3161 | Ga0501081_0077480 | |||
| 3162 | Ga0501083_0000415 | |||
| 3163 | Ga0501083_0071568 | |||
| 3164 | Ga0501265_001777 | |||
| 3165 | Ga0501274_000148 | |||
| 3166 | Ga0501278_000640 | |||
| 3167 | Ga0501279_000060 | |||
| 3168 | Ga0501283_000297 | |||
| 3169 | Ga0501035_0045766 | |||
| 3170 | Ga0501035_0055713 | |||
| 3171 | Ga0501035_0147942 | |||
| 3172 | Ga0501044_0000720 | |||
| 3173 | Ga0501044_0086419 | |||
| 3174 | Ga0501044_0211444 | |||
| 3175 | Ga0501045_0004294 | |||
| 3176 | Ga0501045_0049878 | |||
| 3177 | nmdc:mga05p37_110773_c1 | |||
| 3178 | nmdc:mga05p37_22094_c1 | |||
| 3179 | nmdc:mga05p37_31814_c1 | |||
| 3180 | nmdc:mga05p37_318989_c1 | |||
| 3181 | nmdc:mga05p37_67664_c1 | |||
| 3182 | nmdc:mga09592_162246_c1 | |||
| 3183 | nmdc:mga09592_210439_c1 | |||
| 3184 | nmdc:mga09592_39570_c1 | |||
| 3185 | nmdc:mga0qj67_129173_c1 | |||
| 3186 | nmdc:mga06r32_390567_c1 | |||
| 3187 | nmdc:mga06r32_56647_c1 | |||
| 3188 | nmdc:mga08y16_426966_c1 | |||
| 3189 | nmdc:mga08y16_444532_c1 | |||
| 3190 | nmdc:mga08y16_47842_c1 | |||
| 3191 | nmdc:mga08y16_61917_c1 | |||
| 3192 | nmdc:mga08y16_80937_c1 | |||
| 3193 | nmdc:mga0n895_1283_c1 | |||
| 3194 | nmdc:mga0n895_1782_c1 | |||
| 3195 | nmdc:mga0n895_17833_c1 | |||
| 3196 | nmdc:mga0n895_20298_c1 | |||
| 3197 | nmdc:mga0n895_22776_c1 | |||
| 3198 | nmdc:mga0n895_39946_c1 | |||
| 3199 | nmdc:mga0n895_40814_c1 | |||
| 3200 | nmdc:mga0n895_56938_c1 | |||
| 3201 | nmdc:mga0n895_69768_c1 | |||
| 3202 | nmdc:mga0n895_80690_c1 | |||
| 3203 | nmdc:mga0rr50_106659_c1 | |||
| 3204 | nmdc:mga0rr50_112416_c1 | |||
| 3205 | nmdc:mga0rr50_201255_c1 | |||
| 3206 | nmdc:mga0rr50_2470_c1 | |||
| 3207 | nmdc:mga0rr50_33482_c1 | |||
| 3208 | nmdc:mga0rr50_51759_c1 | |||
| 3209 | nmdc:mga0rr50_7612_c1 | |||
| 3210 | nmdc:mga0rr50_86288_c1 | |||
| 3211 | nmdc:mga08x19_12911_c1 | |||
| 3212 | nmdc:mga08x19_20359_c1 | |||
| 3213 | nmdc:mga08x19_214358_c1 | |||
| 3214 | nmdc:mga08x19_2378_c1 | |||
| 3215 | nmdc:mga08x19_24954_c1 | |||
| 3216 | nmdc:mga08x19_257_c1 | |||
| 3217 | nmdc:mga08x19_2_c1 | |||
| 3218 | nmdc:mga08x19_44105_c1 | |||
| 3219 | nmdc:mga08x19_4513_c1 | |||
| 3220 | nmdc:mga08x19_7143_c1 | |||
| 3221 | nmdc:mga08x19_77457_c1 | |||
| 3222 | nmdc:mga08x19_80877_c1 | |||
| 3223 | nmdc:mga08x19_82168_c1 | |||
| 3224 | nmdc:mga0a205_10909_c1 | |||
| 3225 | nmdc:mga0a205_112610_c1 | |||
| 3226 | nmdc:mga0a205_13056_c1 | |||
| 3227 | nmdc:mga0a205_13350_c1 | |||
| 3228 | nmdc:mga0a205_147129_c1 | |||
| 3229 | nmdc:mga0a205_174942_c1 | |||
| 3230 | nmdc:mga0a205_202732_c1 | |||
| 3231 | nmdc:mga0a205_258516_c1 | |||
| 3232 | nmdc:mga0a205_32680_c1 | |||
| 3233 | nmdc:mga0a205_46899_c1 | |||
| 3234 | nmdc:mga0a205_60747_c1 | |||
| 3235 | nmdc:mga0a205_81965_c1 | |||
| 3236 | Ga0495601_0005334 | |||
| 3237 | Ga0495601_0015724 | |||
| 3238 | Ga0495619_0105599 | |||
| 3239 | Ga0495619_0122555 | |||
| 3240 | Ga0500616_0002047 | |||
| 3241 | Ga0501084_0001686 | |||
| 3242 | Ga0501084_0029733 | |||
| 3243 | Ga0501084_0067667 | |||
| 3244 | Ga0501084_0077293 | |||
| 3245 | Ga0501084_0117244 | |||
| 3246 | Ga0587111_0021976 | |||
| 3247 | Ga0501082_0006761 | |||
| 3248 | Ga0501082_0096896 | |||
| 3249 | Ga0501082_0310080 | |||
| 3250 | Ga0530510_0008140 | |||
| 3251 | Ga0530510_0041403 | |||
| 3252 | 2884219316 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3b7f-assembly1.cif.gz_A | crystal structure of a putative glycosyl hydrolase with bnr repeats (reut_b4987) from ralstonia eutropha jmp134 at 2.20 a resolution | 0.8223 | 2 | 370 |
| 3b7f-assembly1.cif.gz_A | crystal structure of a putative glycosyl hydrolase with bnr repeats (reut_b4987) from ralstonia eutropha jmp134 at 2.20 a resolution | 0.8032 | 2 | 370 |
| 8cyi-assembly1.cif.gz_B | cryo-em structures and computational analysis for enhanced potency in mta-synergic inhibition of human protein arginine methyltransferase 5 | 0.7427 | 5 | 298 |
| 5h1m-assembly1.cif.gz_A | crystal structure of wd40 repeat domains of gemin5 in complex with m7g | 0.7114 | 6 | 362 |
| 8dvl-assembly1.cif.gz_A | crystal structure of lrp6 e3e4 in complex with disulfide constrained peptide e3.18 | 0.6998 | 3 | 370 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3b7fA00 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8106 | 1 | 370 | 2.130.10.10 |
| 3b7fA00 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7957 | 1 | 370 | 2.130.10.10 |
| af_Q4E4S0_27_142_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7473 | 124 | 211 | 2.130.10.10 |
| af_Q9U0J4_14_145_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7437 | 129 | 201 | 2.130.10.10 |
| af_Q6NLV4_278_422_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7404 | 22 | 232 | 2.130.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838S5Q7-F1-model_v4 | Exo-alpha-sialidase | 0.9744 | 1 | 272 |
GO:0000272
GO:0010411 GO:0016798 |
| AF-A0A2V8B9L8-F1-model_v4 | Exo-alpha-sialidase | 0.9733 | 1 | 255 |
GO:0000272
GO:0010411 GO:0016798 |
| AF-A0A535EHK9-F1-model_v4 | Exo-alpha-sialidase | 0.9716 | 1 | 325 |
GO:0000272
GO:0010411 GO:0016798 |
| AF-A0A838S5Q7-F1-model_v4 | Exo-alpha-sialidase | 0.9705 | 1 | 272 |
GO:0000272
GO:0010411 GO:0016798 |
| AF-A0A2V8B9L8-F1-model_v4 | Exo-alpha-sialidase | 0.9692 | 1 | 255 |
GO:0000272
GO:0010411 GO:0016798 |