F495100

General Info

Members Datasets Scaffolds Average Seq Length
1625 636 3244 190

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0015615|Ga0495668_0015615_2273_2848
Length 186
Sequence MGVSLTKGGNVSLTKEAPNLTAVVVGLGWDARSTTGAAFDLDASAIGAGSNKKVLSDQHFIFFNNLRSPDGSIEHKGDNTDGEEQIDVNLAAVPAEIESVVFPVSIYDAEARSQSFGQVRNAYIRVVDKANGNELARYDLSEDASTETAMVFGELYRNGAEWKFRAIGQGYASGLAGIARDYGVNV

Samples

Sample ID Description Type Environment
1 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
13 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
14 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
92 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
93 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
122 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
123 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
124 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
129 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
134 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
194 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
199 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
200 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
201 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
202 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
203 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
204 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
205 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
206 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
207 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
208 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
209 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
210 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
211 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
212 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
213 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
214 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
215 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
216 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
217 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
218 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
219 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
220 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
221 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
225 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
226 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
227 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
228 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
229 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
230 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
231 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
232 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
233 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
234 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
235 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
236 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
237 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
238 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
239 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
240 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
241 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
242 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
243 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
244 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
245 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
246 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
247 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
248 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
249 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
250 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
251 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
252 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
253 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
254 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
255 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
256 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
257 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
258 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
259 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
260 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
261 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
262 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
263 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
264 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
265 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
266 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
267 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
268 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
269 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
270 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
271 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
272 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
273 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
274 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
275 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
276 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
277 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
278 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
279 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
280 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
281 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
282 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
283 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
284 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
285 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
286 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
287 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
288 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
289 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
290 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
291 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
292 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
293 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
294 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
297 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
298 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
299 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
300 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
301 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
302 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
303 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
304 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
305 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
306 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
307 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
308 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
309 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
310 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
311 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
312 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
313 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
314 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
315 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
316 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
317 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
318 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
319 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
320 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
321 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
322 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
323 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
324 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
325 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
326 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
327 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
328 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
329 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
330 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
331 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
332 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
333 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
334 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
335 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
336 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
337 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
338 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
339 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
340 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
341 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
342 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
343 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
344 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
345 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
346 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
347 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
348 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
349 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
350 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
351 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
352 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
353 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
354 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
355 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
356 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
357 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
358 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
359 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
360 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
361 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
362 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
363 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
364 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
365 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
366 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
367 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
368 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
369 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
370 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
371 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
372 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
373 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
374 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
375 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
376 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
381 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
382 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
383 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
401 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
402 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
403 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
406 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
407 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
408 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
409 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
410 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
411 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
412 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
413 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
414 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
415 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
416 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
417 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
418 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
419 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
420 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
421 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
424 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
425 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
426 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
427 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
428 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
429 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
430 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
431 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
432 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
433 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
434 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
435 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
436 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
437 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
438 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
439 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
440 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
441 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
442 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
443 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
444 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
445 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
446 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
447 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
448 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
449 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
450 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
451 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
452 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
453 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
454 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
455 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
456 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
457 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
458 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
459 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
460 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
461 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
462 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
463 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
464 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
465 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
466 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
467 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
468 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
469 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
470 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
471 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
472 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
473 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
484 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
488 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
489 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
490 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
493 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
494 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
495 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
496 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
497 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
498 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
499 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
500 2506783011 Frankia datiscae Dg1 Isolate Nodule
501 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
502 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
503 2517572101 Frankia sp. DC12 Isolate Nodule
504 2527291627 Frankia casuarinae Thr Isolate Nodule
505 2527291629 Frankia sp. BMG5.23 Isolate Nodule
506 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
507 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
508 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
509 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
510 2576861822 Frankia sp. CeD Isolate Nodule
511 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
512 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
513 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
514 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
515 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
516 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
517 2619618881 Frankia sp. ACN1ag Isolate Unclassified
518 2619619003 Frankia sp. CpI1-P Isolate Nodule
519 2626541554 Frankia sp. AvcI.1 Isolate Nodule
520 2643221548 Streptomyces sp. Root55 Isolate Unclassified
521 2643221578 Streptomyces sp. Root63 Isolate Unclassified
522 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
523 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
524 2643221647 Streptomyces sp. Root369 Isolate Unclassified
525 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
526 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
527 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
528 2643221692 Nocardia sp. Root136 Isolate Unclassified
529 2643221714 Streptomyces sp. Root264 Isolate Unclassified
530 2671180195 Frankia sp. CcI49 Isolate Nodule
531 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
532 2684623036 Frankia sp. CgIM4 Isolate Nodule
533 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
534 2710264753 Frankia sp. KB5 Isolate Nodule
535 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
536 2738541305 Nocardioides sp. CF167 Isolate Unclassified
537 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
538 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
539 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
540 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
541 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
542 2773857922 Frankia sp. CcI49 Isolate Nodule
543 2773857924 Frankia sp. CgIS1 Isolate Nodule
544 2773857933 Frankia sp. BMG5.30 Isolate Nodule
545 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
546 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
547 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
548 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
549 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
550 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
551 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
552 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
553 2808606448 Streptomyces sp. 193411 Isolate Unclassified
554 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
555 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
556 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
557 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
558 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
559 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
560 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
561 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
562 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
563 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
564 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
565 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
566 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
567 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
568 2862574272 Streptomyces sp. AcE210 Isolate Nodule
569 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
570 2867369537 Streptomyces sp. Z26 Isolate Unclassified
571 2867428634 Streptomyces sp. RP5T Isolate Unclassified
572 2867475112 Streptomyces sp. TM32 Isolate Unclassified
573 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
574 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
575 2876601092 Pantoea endophytica 596 Isolate Unclassified
576 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
577 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
578 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
579 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
580 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
581 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
582 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
583 2922554459 Rhodococcus sp. 66b Isolate Unclassified
584 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
585 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
586 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
587 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
588 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
589 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
590 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
591 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
592 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
593 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
594 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
595 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
596 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
597 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
598 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
599 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
600 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
601 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
602 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
603 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
604 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
605 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
606 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
607 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
608 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
609 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
610 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
611 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
612 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
613 637000116 Frankia casuarinae CcI3 Isolate Nodule
614 8002784119 Frankia sp. AgB1.9 Isolate Nodule
615 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
616 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
617 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
618 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
619 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
620 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
621 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
622 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
623 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
624 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
625 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
626 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
627 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
628 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
629 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
630 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
631 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
632 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
633 8054920844 Frankia tisae Agncl-8 Isolate Nodule
634 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
635 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
636 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.71
Metatranscriptomes 3.88
Isolates 13.42

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 6.22
Nodule 2.22
Rhizoplane 2.28
Rhizosphere 78.52
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495668_0015615 3300046616 Bacteria 4430
2 JGI24752J21851_1005213 3300001976 Bacteria 1701
3 JGI24746J21847_1005494 3300001977 Bacteria 1977
4 JGI24739J22299_10044486 3300001989 Bacteria 1462
5 JGI24739J22299_10090812 3300001989 Bacteria 930
6 JGI24739J22299_10114870 3300001989 Bacteria 806
7 JGI24737J22298_10023636 3300001990 Bacteria 1948
8 JGI24737J22298_10046267 3300001990 Bacteria 1328
9 JGI24735J21928_10059706 3300002067 Bacteria 1096
10 JGI24735J21928_10143698 3300002067 Bacteria 688
11 JGI24745J21846_1000821 3300002073 Bacteria 2863
12 Ga0006759J45824_1047778 3300003163 Bacteria 751
13 rootH1_10025025 3300003323 Bacteria 3268
14 rootH1_10074601 3300003323 Bacteria 3717
15 Ga0007409J51694_1031317 3300003575 Bacteria 666
16 Ga0006562J51391_1008428 3300003578 Bacteria 1412
17 Ga0006562J51391_1014226 3300003578 Bacteria 750
18 Ga0006562J51391_1044851 3300003578 Bacteria 931
19 Ga0006562J51391_1091491 3300003578 Bacteria 3460
20 Ga0058692_1045055 3300003856 Bacteria 754
21 Ga0058859_10021593 3300004798 Bacteria 618
22 Ga0058859_10041615 3300004798 Bacteria 787
23 Ga0058859_11618699 3300004798 Bacteria 812
24 Ga0058863_11804279 3300004799 Bacteria 1499
25 Ga0070658_10108910 3300005327 Bacteria 2293
26 Ga0070658_10164490 3300005327 Bacteria 1862
27 Ga0070658_10209982 3300005327 Bacteria 1644
28 Ga0070658_10320719 3300005327 Bacteria 1323
29 Ga0070676_10097261 3300005328 Bacteria 1813
30 Ga0070676_10275126 3300005328 Bacteria 1132
31 Ga0070683_100004077 3300005329 Bacteria 11974
32 Ga0070683_100039853 3300005329 Bacteria 4315
33 Ga0070683_100238239 3300005329 Bacteria 1730
34 Ga0070670_100025437 3300005331 Bacteria 5094
35 Ga0070670_100042397 3300005331 Bacteria 3912
36 Ga0070670_100425012 3300005331 Bacteria 1175
37 Ga0070670_100717527 3300005331 Bacteria 900
38 Ga0068869_100009447 3300005334 Bacteria 6329
39 Ga0068869_100220134 3300005334 Bacteria 1504
40 Ga0068869_100312165 3300005334 Bacteria 1273
41 Ga0068869_100426183 3300005334 Bacteria 1095
42 Ga0070680_100299428 3300005336 Bacteria 1364
43 Ga0070682_100485276 3300005337 Bacteria 954
44 Ga0068868_100036882 3300005338 Bacteria 3787
45 Ga0068868_100786394 3300005338 Bacteria 857
46 Ga0070660_100060224 3300005339 Bacteria 2946
47 Ga0070660_100187998 3300005339 Bacteria 1672
48 Ga0070689_100163911 3300005340 Bacteria 1798
49 Ga0070689_100279056 3300005340 Bacteria 1385
50 Ga0070689_100793755 3300005340 Bacteria 832
51 Ga0070687_100182323 3300005343 Bacteria 1258
52 Ga0070661_100096295 3300005344 Bacteria 2196
53 Ga0070661_100134054 3300005344 Bacteria 1862
54 Ga0070661_100244640 3300005344 Bacteria 1382
55 Ga0070692_10041463 3300005345 Bacteria 2359
56 Ga0070692_10156052 3300005345 Bacteria 1304
57 Ga0070668_100028230 3300005347 Bacteria 4260
58 Ga0070668_100114491 3300005347 Bacteria 2149
59 Ga0070668_100690360 3300005347 Bacteria 899
60 Ga0070675_100000719 3300005354 Bacteria 23032
61 Ga0070675_100006141 3300005354 Bacteria 9209
62 Ga0070675_100040915 3300005354 Bacteria 3785
63 Ga0070671_100143027 3300005355 Bacteria 2019
64 Ga0070673_100323075 3300005364 Bacteria 1364
65 Ga0070688_100012654 3300005365 Bacteria 4733
66 Ga0070688_100151271 3300005365 Bacteria 1587
67 Ga0070659_100001482 3300005366 Bacteria 16896
68 Ga0070659_100029976 3300005366 Bacteria 4207
69 Ga0070659_100032308 3300005366 Bacteria 4058
70 Ga0070659_100056655 3300005366 Bacteria 3090
71 Ga0070667_100000001 3300005367 Bacteria 1108638
72 Ga0070667_100023936 3300005367 Bacteria 5071
73 Ga0070667_100447906 3300005367 Bacteria 1180
74 Ga0070714_100416707 3300005435 Bacteria 1272
75 Ga0070714_100419550 3300005435 Bacteria 1267
76 Ga0070713_100395040 3300005436 Bacteria 1290
77 Ga0070713_100793527 3300005436 Bacteria 907
78 Ga0070710_10171816 3300005437 Bacteria 1351
79 Ga0070701_10322939 3300005438 Bacteria 956
80 Ga0070701_10508305 3300005438 Bacteria 783
81 Ga0070705_100639553 3300005440 Bacteria 828
82 Ga0070700_100023661 3300005441 Bacteria 3595
83 Ga0070700_100091360 3300005441 Bacteria 1987
84 Ga0070700_100392198 3300005441 Bacteria 1041
85 Ga0070694_100373559 3300005444 Bacteria 1110
86 Ga0070663_100074365 3300005455 Bacteria 2481
87 Ga0070663_100074371 3300005455 Bacteria 2481
88 Ga0070678_100042450 3300005456 Bacteria 3232
89 Ga0070662_100073021 3300005457 Bacteria 2534
90 Ga0070662_100284692 3300005457 Bacteria 1338
91 Ga0070681_10683678 3300005458 Bacteria 942
92 Ga0068867_100227300 3300005459 Bacteria 1507
93 Ga0068867_100629740 3300005459 Bacteria 939
94 Ga0070685_10029284 3300005466 Bacteria 3058
95 Ga0070685_10122874 3300005466 Bacteria 1614
96 Ga0070679_100357165 3300005530 Bacteria 1409
97 Ga0070684_100004354 3300005535 Bacteria 10760
98 Ga0070684_100135079 3300005535 Bacteria 2227
99 Ga0070684_100323000 3300005535 Bacteria 1418
100 Ga0070697_100965581 3300005536 Bacteria 757
101 Ga0068853_100095551 3300005539 Bacteria 2621
102 Ga0068853_100363013 3300005539 Bacteria 1349
103 Ga0068853_100663552 3300005539 Bacteria 993
104 Ga0070672_100304539 3300005543 Bacteria 1351
105 Ga0070686_100380929 3300005544 Bacteria 1068
106 Ga0070695_100478951 3300005545 Bacteria 959
107 Ga0070696_101143822 3300005546 Bacteria 656
108 Ga0070693_100180935 3300005547 Bacteria 1357
109 Ga0070693_100391747 3300005547 Bacteria 961
110 Ga0070665_100097682 3300005548 Bacteria 2941
111 Ga0068855_100465629 3300005563 Bacteria 1378
112 Ga0068855_100710501 3300005563 Bacteria 1075
113 Ga0068855_101015936 3300005563 Bacteria 870
114 Ga0070664_100000534 3300005564 Bacteria 29002
115 Ga0070664_100251217 3300005564 Bacteria 1590
116 Ga0068857_100006062 3300005577 Bacteria 10327
117 Ga0068857_100052065 3300005577 Bacteria 3633
118 Ga0068854_100024968 3300005578 Bacteria 4099
119 Ga0068854_100067079 3300005578 Bacteria 2613
120 Ga0068856_101157982 3300005614 Bacteria 790
121 Ga0070702_100012334 3300005615 Bacteria 4278
122 Ga0070702_100070267 3300005615 Bacteria 2066
123 Ga0070702_100419494 3300005615 Bacteria 962
124 Ga0068852_100073756 3300005616 Bacteria 3003
125 Ga0068852_100083527 3300005616 Bacteria 2840
126 Ga0068852_100139131 3300005616 Bacteria 2245
127 Ga0068859_100040519 3300005617 Bacteria 4675
128 Ga0068864_100295816 3300005618 Bacteria 1514
129 Ga0068866_10162112 3300005718 Bacteria 1305
130 Ga0068861_100131217 3300005719 Bacteria 2034
131 Ga0068861_100273477 3300005719 Bacteria 1451
132 Ga0068851_10013396 3300005834 Bacteria 3881
133 Ga0068851_10149827 3300005834 Bacteria 1274
134 Ga0068870_10121332 3300005840 Bacteria 1506
135 Ga0068870_10237029 3300005840 Bacteria 1124
136 Ga0068863_100055152 3300005841 Bacteria 3764
137 Ga0068863_100074641 3300005841 Bacteria 3208
138 Ga0068863_100429971 3300005841 Bacteria 1294
139 Ga0068858_100054214 3300005842 Bacteria 3708
140 Ga0068858_100092010 3300005842 Bacteria 2823
141 Ga0068858_100251581 3300005842 Bacteria 1678
142 Ga0068860_100007310 3300005843 Bacteria 11043
143 Ga0068860_100185974 3300005843 Bacteria 2009
144 Ga0068860_100446110 3300005843 Bacteria 1286
145 Ga0068860_100447221 3300005843 Bacteria 1284
146 Ga0068860_100534679 3300005843 Bacteria 1173
147 Ga0068862_100014723 3300005844 Bacteria 6495
148 Ga0068862_100049913 3300005844 Bacteria 3575
149 Ga0068862_100790066 3300005844 Bacteria 926
150 Ga0081455_10050807 3300005937 Bacteria 3561
151 Ga0081538_10134967 3300005981 Bacteria 1151
152 Ga0081539_10171865 3300005985 Bacteria 1024
153 Ga0070717_10092228 3300006028 Bacteria 2559
154 Ga0070717_10247870 3300006028 Bacteria 1573
155 Ga0070717_10446260 3300006028 Bacteria 1166
156 Ga0075368_10015973 3300006042 Bacteria 2791
157 Ga0075363_100092462 3300006048 Bacteria 1666
158 Ga0075363_100239621 3300006048 Bacteria 1042
159 Ga0075363_100330950 3300006048 Bacteria 887
160 Ga0075364_10032423 3300006051 Bacteria 3358
161 Ga0070712_100226183 3300006175 Bacteria 1483
162 Ga0075367_10000490 3300006178 Bacteria 14834
163 Ga0075367_10017087 3300006178 Bacteria 3976
164 Ga0075367_10125484 3300006178 Bacteria 1584
165 Ga0097621_100379607 3300006237 Bacteria 1262
166 Ga0075370_10046876 3300006353 Bacteria 2447
167 Ga0075370_10108447 3300006353 Bacteria 1611
168 Ga0075428_100443722 3300006844 Bacteria 1390
169 Ga0075428_100734220 3300006844 Bacteria 1051
170 Ga0075434_100389255 3300006871 Bacteria 1415
171 Ga0075429_100516378 3300006880 Bacteria 1047
172 Ga0068865_100032754 3300006881 Bacteria 3475
173 Ga0068865_100114841 3300006881 Bacteria 1992
174 Ga0068865_100466860 3300006881 Bacteria 1046
175 Ga0097620_100040519 3300006931 Bacteria 4675
176 Ga0099826_10104463 3300006948 Bacteria 1701
177 Ga0105251_10028973 3300009011 Bacteria 2793
178 Ga0105244_10003455 3300009036 Bacteria 11260
179 Ga0105250_10057176 3300009092 Bacteria 1565
180 Ga0105250_10075385 3300009092 Bacteria 1365
181 Ga0105250_10271568 3300009092 Bacteria 728
182 Ga0105240_10920876 3300009093 Bacteria 939
183 Ga0105240_11296943 3300009093 Bacteria 768
184 Ga0111539_10004342 3300009094 Bacteria 18562
185 Ga0111539_10013384 3300009094 Bacteria 10255
186 Ga0111539_10069210 3300009094 Bacteria 4167
187 Ga0111539_10088870 3300009094 Bacteria 3630
188 Ga0111539_10433183 3300009094 Bacteria 1531
189 Ga0111539_10671421 3300009094 Bacteria 1207
190 Ga0105245_10015155 3300009098 Bacteria 6716
191 Ga0105245_10022160 3300009098 Bacteria 5578
192 Ga0105245_10034887 3300009098 Bacteria 4463
193 Ga0105245_10229187 3300009098 Bacteria 1796
194 Ga0105247_10024812 3300009101 Bacteria 3614
195 Ga0105247_10396426 3300009101 Bacteria 982
196 Ga0105243_10070234 3300009148 Bacteria 2827
197 Ga0105243_10104325 3300009148 Bacteria 2360
198 Ga0105243_10230613 3300009148 Bacteria 1642
199 Ga0105243_10482648 3300009148 Bacteria 1170
200 Ga0105243_11512363 3300009148 Bacteria 695
201 Ga0105241_10050846 3300009174 Bacteria 3159
202 Ga0105241_10296336 3300009174 Bacteria 1386
203 Ga0105242_10258670 3300009176 Bacteria 1572
204 Ga0105248_10008353 3300009177 Bacteria 11374
205 Ga0105248_10093427 3300009177 Bacteria 3387
206 Ga0105248_10800258 3300009177 Bacteria 1064
207 Ga0105237_10000576 3300009545 Bacteria 51366
208 Ga0105237_10191132 3300009545 Bacteria 2047
209 Ga0105237_10200555 3300009545 Bacteria 1995
210 Ga0105237_10427372 3300009545 Bacteria 1330
211 Ga0105237_11256746 3300009545 Bacteria 747
212 Ga0105238_10052401 3300009551 Bacteria 4102
213 Ga0105238_10256126 3300009551 Bacteria 1729
214 Ga0105238_10258700 3300009551 Bacteria 1720
215 Ga0105238_10408326 3300009551 Bacteria 1352
216 Ga0105249_10060473 3300009553 Bacteria 3475
217 Ga0105249_10092664 3300009553 Bacteria 2829
218 Ga0105249_10866031 3300009553 Bacteria 969
219 Ga0105249_11226414 3300009553 Bacteria 821
220 Ga0105239_10050099 3300010375 Bacteria 4581
221 Ga0105239_10067731 3300010375 Bacteria 3922
222 Ga0105239_10167438 3300010375 Bacteria 2458
223 Ga0105239_10194965 3300010375 Bacteria 2268
224 Ga0105239_10289384 3300010375 Bacteria 1845
225 Ga0105239_10294156 3300010375 Bacteria 1828
226 Ga0105246_10230734 3300011119 Bacteria 1457
227 Ga0157320_1005893 3300012481 Bacteria 832
228 Ga0157371_10275398 3300013102 Bacteria 1215
229 Ga0157369_10269515 3300013105 Bacteria 1774
230 Ga0157374_10137124 3300013296 Bacteria 2373
231 Ga0157374_10245735 3300013296 Bacteria 1760
232 Ga0157378_11551392 3300013297 Bacteria 707
233 Ga0163162_10073356 3300013306 Bacteria 3478
234 Ga0163162_10914871 3300013306 Bacteria 990
235 Ga0163162_11460991 3300013306 Bacteria 778
236 Ga0157375_10393236 3300013308 Bacteria 1553
237 Ga0157375_11102236 3300013308 Bacteria 929
238 Ga0163163_10008177 3300014325 Bacteria 9279
239 Ga0163163_10226676 3300014325 Bacteria 1918
240 Ga0157380_10561381 3300014326 Bacteria 1122
241 Ga0182008_10002234 3300014497 Bacteria 12242
242 Ga0182008_10019441 3300014497 Bacteria 3505
243 Ga0157377_10004764 3300014745 Bacteria 6286
244 Ga0157377_10065456 3300014745 Bacteria 2088
245 Ga0157379_10646569 3300014968 Bacteria 990
246 Ga0157376_10545126 3300014969 Bacteria 1147
247 Ga0182006_1012503 3300015261 Bacteria 3711
248 Ga0182006_1040844 3300015261 Bacteria 1824
249 Ga0182007_10000387 3300015262 Bacteria 27336
250 Ga0182007_10003980 3300015262 Bacteria 6823
251 Ga0182005_1072386 3300015265 Bacteria 947
252 Ga0183367_1004 3300015688 Bacteria 716880
253 Ga0183367_1005 3300015688 Bacteria 652063
254 Ga0163161_10049917 3300017792 Bacteria 3026
255 Ga0163161_10232522 3300017792 Bacteria 1431
256 Ga0197907_10231912 3300020069 Bacteria 623
257 Ga0206356_10376454 3300020070 Bacteria 995
258 Ga0206355_1074018 3300020076 Bacteria 1157
259 Ga0206351_10938024 3300020077 Bacteria 816
260 Ga0206352_11133304 3300020078 Bacteria 828
261 Ga0206350_11440865 3300020080 Bacteria 1267
262 Ga0206353_10188020 3300020082 Bacteria 2063
263 Ga0206353_10403514 3300020082 Bacteria 900
264 Ga0206353_11635929 3300020082 Bacteria 851
265 Ga0213876_10064421 3300021384 Bacteria 1935
266 Ga0224712_10058894 3300022467 Bacteria 1523
267 Ga0224712_10064246 3300022467 Bacteria 1472
268 Ga0224712_10215603 3300022467 Bacteria 877
269 Ga0209758_1015614 3300025297 Bacteria 3917
270 Ga0207426_1002736 3300025302 Bacteria 10695
271 Ga0207426_1007974 3300025302 Bacteria 4355
272 Ga0207656_10041306 3300025321 Bacteria 1959
273 Ga0207656_10185522 3300025321 Bacteria 1000
274 Ga0207696_1033948 3300025711 Bacteria 1527
275 Ga0207696_1051805 3300025711 Bacteria 1171
276 Ga0207655_1003689 3300025728 Bacteria 11283
277 Ga0207713_1017299 3300025735 Bacteria 3623
278 Ga0207642_10216108 3300025899 Bacteria 1068
279 Ga0207710_10000120 3300025900 Bacteria 96124
280 Ga0207710_10000308 3300025900 Bacteria 38668
281 Ga0207710_10060580 3300025900 Bacteria 1716
282 Ga0207688_10019306 3300025901 Bacteria 3712
283 Ga0207688_10053686 3300025901 Bacteria 2260
284 Ga0207680_10151134 3300025903 Bacteria 1548
285 Ga0207680_10262205 3300025903 Bacteria 1196
286 Ga0207647_10048107 3300025904 Bacteria 2649
287 Ga0207647_10061435 3300025904 Bacteria 2293
288 Ga0207647_10239537 3300025904 Bacteria 1042
289 Ga0207645_10026666 3300025907 Bacteria 3733
290 Ga0207645_10104189 3300025907 Bacteria 1832
291 Ga0207643_10002797 3300025908 Bacteria 9418
292 Ga0207643_10016810 3300025908 Bacteria 3991
293 Ga0207643_10161969 3300025908 Bacteria 1346
294 Ga0207643_10282278 3300025908 Bacteria 1030
295 Ga0207705_10112456 3300025909 Bacteria 2013
296 Ga0207705_10113257 3300025909 Bacteria 2006
297 Ga0207705_10529815 3300025909 Bacteria 916
298 Ga0207654_10084989 3300025911 Bacteria 1914
299 Ga0207695_10220111 3300025913 Bacteria 1806
300 Ga0207671_10000532 3300025914 Bacteria 51370
301 Ga0207693_10130426 3300025915 Bacteria 1976
302 Ga0207663_10235680 3300025916 Bacteria 1339
303 Ga0207660_10376801 3300025917 Bacteria 1140
304 Ga0207662_10009099 3300025918 Bacteria 5458
305 Ga0207662_10033911 3300025918 Bacteria 2978
306 Ga0207657_10023477 3300025919 Bacteria 5742
307 Ga0207657_10276173 3300025919 Bacteria 1335
308 Ga0207649_10039626 3300025920 Bacteria 2858
309 Ga0207649_10062430 3300025920 Bacteria 2349
310 Ga0207652_10945645 3300025921 Bacteria 759
311 Ga0207681_10055732 3300025923 Bacteria 2694
312 Ga0207681_10243707 3300025923 Bacteria 1400
313 Ga0207694_10088011 3300025924 Bacteria 2448
314 Ga0207694_10096799 3300025924 Bacteria 2335
315 Ga0207694_10111386 3300025924 Bacteria 2178
316 Ga0207650_10012412 3300025925 Bacteria 5882
317 Ga0207650_10312036 3300025925 Bacteria 1287
318 Ga0207650_10681983 3300025925 Bacteria 867
319 Ga0207659_10006589 3300025926 Bacteria 7129
320 Ga0207659_10010145 3300025926 Bacteria 5907
321 Ga0207687_10065829 3300025927 Bacteria 2574
322 Ga0207687_10107737 3300025927 Bacteria 2062
323 Ga0207687_10163037 3300025927 Bacteria 1713
324 Ga0207687_10213642 3300025927 Bacteria 1515
325 Ga0207700_10090938 3300025928 Bacteria 2410
326 Ga0207700_10695935 3300025928 Bacteria 907
327 Ga0207664_10397059 3300025929 Bacteria 1226
328 Ga0207664_10479639 3300025929 Bacteria 1112
329 Ga0207664_10515910 3300025929 Bacteria 1071
330 Ga0207644_10125643 3300025931 Bacteria 1958
331 Ga0207690_10187122 3300025932 Bacteria 1563
332 Ga0207706_10010700 3300025933 Bacteria 8379
333 Ga0207706_10021431 3300025933 Bacteria 5804
334 Ga0207706_10048412 3300025933 Bacteria 3759
335 Ga0207706_10128176 3300025933 Bacteria 2231
336 Ga0207709_10040905 3300025935 Bacteria 2778
337 Ga0207709_10245860 3300025935 Bacteria 1304
338 Ga0207709_10881203 3300025935 Bacteria 726
339 Ga0207691_10037306 3300025940 Bacteria 4501
340 Ga0207691_10191403 3300025940 Bacteria 1784
341 Ga0207689_10011188 3300025942 Bacteria 7698
342 Ga0207689_10014176 3300025942 Bacteria 6781
343 Ga0207689_10015806 3300025942 Bacteria 6390
344 Ga0207689_10444260 3300025942 Bacteria 1083
345 Ga0207661_10021123 3300025944 Bacteria 4877
346 Ga0207661_10025750 3300025944 Bacteria 4476
347 Ga0207661_10170850 3300025944 Bacteria 1892
348 Ga0207661_10516332 3300025944 Bacteria 1092
349 Ga0207679_10024199 3300025945 Bacteria 4162
350 Ga0207679_10118473 3300025945 Bacteria 2103
351 Ga0207679_10171161 3300025945 Bacteria 1788
352 Ga0207667_10978561 3300025949 Bacteria 834
353 Ga0207651_10035692 3300025960 Bacteria 3237
354 Ga0207651_10039106 3300025960 Bacteria 3125
355 Ga0207712_10078177 3300025961 Bacteria 2400
356 Ga0207712_10128748 3300025961 Bacteria 1926
357 Ga0207712_10239927 3300025961 Bacteria 1459
358 Ga0207668_10023431 3300025972 Bacteria 3968
359 Ga0207668_10126172 3300025972 Bacteria 1946
360 Ga0207640_10470533 3300025981 Bacteria 1040
361 Ga0207658_10000003 3300025986 Bacteria 1151934
362 Ga0207658_10014793 3300025986 Bacteria 5347
363 Ga0207658_10130588 3300025986 Bacteria 2018
364 Ga0207677_10013586 3300026023 Bacteria 4725
365 Ga0207677_10057563 3300026023 Bacteria 2670
366 Ga0207703_10070001 3300026035 Bacteria 2895
367 Ga0207639_10306144 3300026041 Bacteria 1406
368 Ga0207639_10368840 3300026041 Bacteria 1287
369 Ga0207678_10002575 3300026067 Bacteria 16520
370 Ga0207678_10083442 3300026067 Bacteria 2733
371 Ga0207708_10003567 3300026075 Bacteria 11477
372 Ga0207708_10010752 3300026075 Bacteria 6804
373 Ga0207708_10016331 3300026075 Bacteria 5580
374 Ga0207708_10153060 3300026075 Bacteria 1817
375 Ga0207702_10133291 3300026078 Bacteria 2238
376 Ga0207702_11015102 3300026078 Bacteria 823
377 Ga0207641_10417387 3300026088 Bacteria 1291
378 Ga0207641_10589385 3300026088 Bacteria 1087
379 Ga0207648_10026949 3300026089 Bacteria 5104
380 Ga0207648_10028595 3300026089 Bacteria 4942
381 Ga0207674_10006377 3300026116 Bacteria 13887
382 Ga0207674_10025030 3300026116 Bacteria 6371
383 Ga0207675_100002346 3300026118 Bacteria 18746
384 Ga0207675_100036464 3300026118 Bacteria 4587
385 Ga0207675_100159174 3300026118 Bacteria 2153
386 Ga0207683_10240630 3300026121 Bacteria 1651
387 Ga0207683_11008032 3300026121 Bacteria 773
388 Ga0207698_10017898 3300026142 Bacteria 4817
389 Ga0207698_10039859 3300026142 Bacteria 3483
390 Ga0207698_10790698 3300026142 Bacteria 950
391 Ga0209371_1023958 3300027312 Bacteria 1427
392 Ga0209813_10008250 3300027866 Bacteria 2624
393 Ga0207428_10094405 3300027907 Bacteria 2319
394 Ga0207428_10436313 3300027907 Bacteria 956
395 Ga0268266_10026696 3300028379 Bacteria 4913
396 Ga0268266_10612224 3300028379 Bacteria 1047
397 Ga0268265_10962461 3300028380 Bacteria 841
398 Ga0268264_10118484 3300028381 Bacteria 2330
399 Ga0268264_10153517 3300028381 Bacteria 2067
400 Ga0268264_10168067 3300028381 Bacteria 1981
401 Ga0268264_10193809 3300028381 Bacteria 1854
402 Ga0307517_10001523 3300028786 Bacteria 38580
403 Ga0307517_10002113 3300028786 Bacteria 32343
404 Ga0307517_10002268 3300028786 Bacteria 31003
405 Ga0307517_10003190 3300028786 Bacteria 25757
406 Ga0307515_10005593 3300028794 Bacteria 25395
407 Ga0307515_10030929 3300028794 Bacteria 8959
408 Ga0307515_10166506 3300028794 Bacteria 2219
409 Ga0307515_10237050 3300028794 Bacteria 1603
410 Ga0268256_1022483 3300030500 Bacteria 1653
411 Ga0268256_1027206 3300030500 Bacteria 1427
412 Ga0307511_10000262 3300030521 Bacteria 54437
413 Ga0307511_10052075 3300030521 Bacteria 3268
414 Ga0307511_10067295 3300030521 Bacteria 2659
415 Ga0307511_10071760 3300030521 Bacteria 2522
416 Ga0307511_10161841 3300030521 Bacteria 1254
417 Ga0307511_10170822 3300030521 Bacteria 1195
418 Ga0307511_10240991 3300030521 Bacteria 882
419 Ga0307512_10004180 3300030522 Bacteria 16012
420 Ga0307512_10036987 3300030522 Bacteria 4130
421 Ga0307512_10056898 3300030522 Bacteria 3065
422 Ga0307512_10076977 3300030522 Bacteria 2427
423 Ga0307512_10156139 3300030522 Bacteria 1350
424 Ga0265327_10001096 3300031251 Bacteria 37556
425 Ga0265327_10013988 3300031251 Bacteria 5286
426 Ga0307513_10000135 3300031456 Bacteria 103254
427 Ga0307513_10003690 3300031456 Bacteria 20706
428 Ga0307513_10013382 3300031456 Bacteria 10071
429 Ga0307513_10094928 3300031456 Bacteria 3025
430 Ga0307513_10099815 3300031456 Bacteria 2930
431 Ga0307513_10169256 3300031456 Bacteria 2064
432 Ga0307513_10213079 3300031456 Bacteria 1761
433 Ga0307509_10078021 3300031507 Bacteria 3434
434 Ga0307509_10120765 3300031507 Bacteria 2598
435 Ga0307408_100220714 3300031548 Bacteria 1547
436 Ga0307408_100562600 3300031548 Bacteria 1008
437 Ga0307508_10002945 3300031616 Bacteria 17606
438 Ga0307508_10003098 3300031616 Bacteria 17069
439 Ga0307508_10003146 3300031616 Bacteria 16895
440 Ga0307508_10008636 3300031616 Bacteria 9403
441 Ga0307508_10028997 3300031616 Bacteria 5002
442 Ga0307508_10044489 3300031616 Bacteria 3971
443 Ga0307508_10059525 3300031616 Bacteria 3378
444 Ga0307508_10090924 3300031616 Bacteria 2639
445 Ga0307508_10120891 3300031616 Bacteria 2222
446 Ga0307508_10235900 3300031616 Bacteria 1427
447 Ga0307508_10428645 3300031616 Bacteria 914
448 Ga0307514_10005889 3300031649 Bacteria 10814
449 Ga0307514_10039469 3300031649 Bacteria 3729
450 Ga0307514_10078640 3300031649 Bacteria 2448
451 Ga0307514_10172953 3300031649 Bacteria 1406
452 Ga0307514_10215647 3300031649 Bacteria 1184
453 Ga0307516_10034805 3300031730 Bacteria 5057
454 Ga0307516_10068674 3300031730 Bacteria 3412
455 Ga0307516_10102412 3300031730 Bacteria 2678
456 Ga0307516_10110456 3300031730 Bacteria 2553
457 Ga0307516_10382657 3300031730 Bacteria 1068
458 Ga0307516_10456645 3300031730 Bacteria 933
459 Ga0307413_10004008 3300031824 Bacteria 6329
460 Ga0307413_10008993 3300031824 Bacteria 4752
461 Ga0307413_10178883 3300031824 Bacteria 1510
462 Ga0307413_10219042 3300031824 Bacteria 1389
463 Ga0307413_10422565 3300031824 Bacteria 1050
464 Ga0307413_10463870 3300031824 Bacteria 1008
465 Ga0307413_10529441 3300031824 Bacteria 952
466 Ga0307407_10708366 3300031903 Bacteria 759
467 Ga0307407_10868333 3300031903 Bacteria 690
468 Ga0307409_100099917 3300031995 Bacteria 2404
469 Ga0307409_100298276 3300031995 Bacteria 1498
470 Ga0307409_100580366 3300031995 Bacteria 1105
471 Ga0307409_100683338 3300031995 Bacteria 1024
472 Ga0307409_100747990 3300031995 Bacteria 981
473 Ga0307409_101469561 3300031995 Bacteria 709
474 Ga0307416_100133444 3300032002 Bacteria 2241
475 Ga0307416_100330535 3300032002 Bacteria 1531
476 Ga0307416_100387339 3300032002 Bacteria 1430
477 Ga0307416_100621617 3300032002 Bacteria 1162
478 Ga0307416_102072700 3300032002 Bacteria 671
479 Ga0307411_10024481 3300032005 Bacteria 3599
480 Ga0307411_10234445 3300032005 Bacteria 1433
481 Ga0307415_100013814 3300032126 Bacteria 4726
482 Ga0307415_100215679 3300032126 Bacteria 1535
483 Ga0307415_100347063 3300032126 Bacteria 1248
484 Ga0307507_10004394 3300033179 Bacteria 25126
485 Ga0307507_10017950 3300033179 Bacteria 8088
486 Ga0307507_10019844 3300033179 Bacteria 7552
487 Ga0307507_10060005 3300033179 Bacteria 3555
488 Ga0307507_10096125 3300033179 Bacteria 2508
489 Ga0307507_10097007 3300033179 Bacteria 2489
490 Ga0307507_10143892 3300033179 Bacteria 1818
491 Ga0307507_10163188 3300033179 Bacteria 1640
492 Ga0307510_10005436 3300033180 Bacteria 15167
493 Ga0307510_10135431 3300033180 Bacteria 2122
494 Ga0307510_10212189 3300033180 Bacteria 1457
495 Ga0373940_0204944 3300035088 Bacteria 650
496 Ga0373951_0090995 3300035091 Bacteria 801
497 Ga0373952_0096951 3300035092 Bacteria 773
498 Ga0373962_0148504 3300035242 Bacteria 766
499 Ga0395898_0006424 3300037466 Bacteria 12555
500 Ga0395898_0007866 3300037466 Bacteria 11312
501 Ga0395898_0157778 3300037466 Bacteria 2170
502 Ga0395898_0828079 3300037466 Bacteria 865
503 Ga0395901_0090147 3300038443 Bacteria 3209
504 Ga0436365_0241176 3300039437 Bacteria 2689
505 Ga0436365_0402914 3300039437 Bacteria 1912
506 Ga0439436_0000208 3300041404 Bacteria 14124
507 Ga0439439_0003117 3300041406 Bacteria 3619
508 Ga0451793_0500026 3300041452 Bacteria 716
509 Ga0451800_1554937 3300041459 Bacteria 698
510 Ga0451802_0326665 3300041460 Bacteria 1789
511 Ga0451802_0444163 3300041460 Bacteria 1841
512 Ga0451807_2266131 3300041486 Bacteria 1188
513 Ga0451807_2446817 3300041486 Bacteria 777
514 Ga0451833_0081940 3300041491 Bacteria 2153
515 Ga0451833_0163126 3300041491 Bacteria 2544
516 Ga0451835_0504647 3300041492 Bacteria 1593
517 Ga0451837_0073117 3300041494 Bacteria 819
518 Ga0451837_1411785 3300041494 Bacteria 1175
519 Ga0451837_1594594 3300041494 Bacteria 4140
520 Ga0451841_0766413 3300041498 Bacteria 1291
521 Ga0451853_0494340 3300041512 Bacteria 1141
522 Ga0451853_3237062 3300041512 Bacteria 940
523 Ga0451853_3883896 3300041512 Bacteria 1695
524 Ga0451853_3940744 3300041512 Bacteria 1714
525 Ga0439442_037360 3300042002 Bacteria 1017
526 Ga0439448_0001704 3300042005 Bacteria 5790
527 Ga0439449_0021758 3300042007 Bacteria 2400
528 Ga0439455_0001757 3300042012 Bacteria 3759
529 Ga0439455_0004112 3300042012 Bacteria 2855
530 Ga0439457_006866 3300042014 Bacteria 2755
531 Ga0439462_0023614 3300042015 Bacteria 1612
532 Ga0450894_000035 3300042131 Bacteria 19542
533 Ga0450898_004052 3300042134 Bacteria 2141
534 Ga0450899_001604 3300042135 Bacteria 2499
535 Ga0450900_008358 3300042136 Bacteria 1292
536 Ga0450900_041855 3300042136 Bacteria 687
537 Ga0450903_000067 3300042138 Bacteria 20805
538 Ga0450903_000495 3300042138 Bacteria 8255
539 Ga0450906_063339 3300042145 Bacteria 658
540 Ga0439458_0001440 3300042157 Bacteria 5996
541 Ga0439458_0001566 3300042157 Bacteria 5720
542 Ga0450908_004084 3300042184 Bacteria 2821
543 Ga0450901_020493 3300042533 Bacteria 708
544 Ga0439440_0088535 3300042993 Bacteria 828
545 Ga0466969_0006677 3300044656 Bacteria 6132
546 Ga0466969_0017088 3300044656 Bacteria 3792
547 Ga0466969_0159346 3300044656 Bacteria 1037
548 Ga0466972_0009190 3300044658 Bacteria 4965
549 Ga0466972_0013383 3300044658 Bacteria 4120
550 Ga0466972_0064413 3300044658 Bacteria 1754
551 Ga0466972_0093850 3300044658 Bacteria 1422
552 Ga0466965_0000073 3300044683 Bacteria 29903
553 Ga0466965_0000929 3300044683 Bacteria 11246
554 Ga0466965_0002548 3300044683 Bacteria 7785
555 Ga0466965_0030028 3300044683 Bacteria 2647
556 Ga0466965_0154330 3300044683 Bacteria 1201
557 Ga0466965_0470787 3300044683 Bacteria 702
558 Ga0466966_0000262 3300044684 Bacteria 35143
559 Ga0466966_0026502 3300044684 Bacteria 3783
560 Ga0466966_0026733 3300044684 Bacteria 3766
561 Ga0466966_0148370 3300044684 Bacteria 1431
562 Ga0466961_0000470 3300044693 Bacteria 25557
563 Ga0466961_0000547 3300044693 Bacteria 23953
564 Ga0466961_0017484 3300044693 Bacteria 4607
565 Ga0466963_0000176 3300044694 Bacteria 26457
566 Ga0466963_0000687 3300044694 Bacteria 16444
567 Ga0466963_0001134 3300044694 Bacteria 13915
568 Ga0466963_0050797 3300044694 Bacteria 2745
569 Ga0466963_0361077 3300044694 Bacteria 1023
570 Ga0466971_0000306 3300044719 Bacteria 18885
571 Ga0466971_0001670 3300044719 Bacteria 9387
572 Ga0466971_0033992 3300044719 Bacteria 2284
573 Ga0466970_0000912 3300044765 Bacteria 14276
574 Ga0466970_0001062 3300044765 Bacteria 13291
575 Ga0466970_0056328 3300044765 Bacteria 2101
576 Ga0466970_0060210 3300044765 Bacteria 2033
577 Ga0466957_0000275 3300044842 Bacteria 24997
578 Ga0466957_0000941 3300044842 Bacteria 14902
579 Ga0466957_0108803 3300044842 Bacteria 1756
580 Ga0466960_0087262 3300044901 Bacteria 1583
581 Ga0466960_0096258 3300044901 Bacteria 1517
582 Ga0466959_0000453 3300045049 Bacteria 23862
583 Ga0466959_0003708 3300045049 Bacteria 10084
584 Ga0466959_0021356 3300045049 Bacteria 4774
585 Ga0466959_0023745 3300045049 Bacteria 4539
586 Ga0466959_0102580 3300045049 Bacteria 2047
587 Ga0466958_0010897 3300045836 Bacteria 5105
588 Ga0466958_0138796 3300045836 Bacteria 1530
589 Ga0466967_0001117 3300045976 Bacteria 14897
590 Ga0466967_0011426 3300045976 Bacteria 6723
591 Ga0466967_0153120 3300045976 Bacteria 2157
592 Ga0466967_0413873 3300045976 Bacteria 1313
593 Ga0466967_0443363 3300045976 Bacteria 1268
594 Ga0466967_0629863 3300045976 Bacteria 1060
595 Ga0466967_1015040 3300045976 Bacteria 826
596 Ga0495617_006202 3300046452 Bacteria 4207
597 Ga0495617_015849 3300046452 Bacteria 2550
598 Ga0495627_033660 3300046453 Bacteria 1605
599 Ga0495627_065245 3300046453 Bacteria 1070
600 Ga0495627_135945 3300046453 Bacteria 690
601 Ga0495592_0003306 3300046454 Bacteria 11552
602 Ga0495592_0012362 3300046454 Bacteria 6484
603 Ga0495592_0018473 3300046454 Bacteria 5303
604 Ga0495592_0020976 3300046454 Bacteria 4969
605 Ga0495592_0023524 3300046454 Bacteria 4686
606 Ga0495592_0023546 3300046454 Bacteria 4684
607 Ga0495603_0001393 3300046455 Bacteria 14053
608 Ga0495603_0002486 3300046455 Bacteria 10845
609 Ga0495603_0004164 3300046455 Bacteria 8620
610 Ga0495603_0007598 3300046455 Bacteria 6522
611 Ga0495603_0020679 3300046455 Bacteria 3986
612 Ga0495603_0079972 3300046455 Bacteria 1915
613 Ga0495603_0185122 3300046455 Bacteria 1204
614 Ga0495603_0306866 3300046455 Bacteria 911
615 Ga0495590_0083700 3300046457 Bacteria 1124
616 Ga0495591_000094 3300046458 Bacteria 101106
617 Ga0495629_0000848 3300046459 Bacteria 24687
618 Ga0495629_0004603 3300046459 Bacteria 10323
619 Ga0495629_0008832 3300046459 Bacteria 7408
620 Ga0495629_0018308 3300046459 Bacteria 5015
621 Ga0495629_0024194 3300046459 Bacteria 4324
622 Ga0495629_0035598 3300046459 Bacteria 3518
623 Ga0495629_0061605 3300046459 Bacteria 2622
624 Ga0495629_0075577 3300046459 Bacteria 2352
625 Ga0495629_0077458 3300046459 Bacteria 2321
626 Ga0495629_0091455 3300046459 Bacteria 2123
627 Ga0495629_0096109 3300046459 Bacteria 2066
628 Ga0495629_0187477 3300046459 Bacteria 1432
629 Ga0495629_0213488 3300046459 Bacteria 1332
630 Ga0495629_0377855 3300046459 Bacteria 964
631 Ga0495629_0584798 3300046459 Bacteria 747
632 Ga0495638_0005393 3300046460 Bacteria 9531
633 Ga0495638_0032165 3300046460 Bacteria 3366
634 Ga0495638_0082670 3300046460 Bacteria 1947
635 Ga0495638_0143053 3300046460 Bacteria 1394
636 Ga0495638_0177710 3300046460 Bacteria 1217
637 Ga0495638_0245901 3300046460 Bacteria 988
638 Ga0495638_0350028 3300046460 Bacteria 780
639 Ga0495641_0023508 3300046461 Bacteria 3059
640 Ga0495641_0092306 3300046461 Bacteria 1353
641 Ga0495641_0293485 3300046461 Bacteria 732
642 Ga0495651_0006989 3300046462 Bacteria 8630
643 Ga0495651_0026835 3300046462 Bacteria 4485
644 Ga0495651_0031705 3300046462 Bacteria 4120
645 Ga0495651_0036030 3300046462 Bacteria 3851
646 Ga0495651_0055044 3300046462 Bacteria 3057
647 Ga0495651_0089808 3300046462 Bacteria 2306
648 Ga0495653_0190683 3300046463 Bacteria 1399
649 Ga0495653_0376492 3300046463 Bacteria 907
650 Ga0495653_0643107 3300046463 Bacteria 648
651 Ga0495650_0047454 3300046471 Bacteria 1796
652 Ga0495580_0193994 3300046472 Bacteria 1400
653 Ga0495582_0073060 3300046473 Bacteria 1898
654 Ga0495605_0006539 3300046474 Bacteria 6688
655 Ga0495605_0007673 3300046474 Bacteria 6115
656 Ga0495605_0011338 3300046474 Bacteria 4977
657 Ga0495605_0140595 3300046474 Bacteria 1083
658 Ga0495639_0033239 3300046475 Bacteria 2303
659 Ga0495639_0057705 3300046475 Bacteria 1774
660 Ga0495662_0001904 3300046476 Bacteria 10478
661 Ga0495662_0004334 3300046476 Bacteria 7132
662 Ga0495662_0009848 3300046476 Bacteria 4694
663 Ga0495662_0236982 3300046476 Bacteria 899
664 Ga0495664_0002699 3300046477 Bacteria 9550
665 Ga0495664_0002878 3300046477 Bacteria 9275
666 Ga0495664_0012354 3300046477 Bacteria 4835
667 Ga0495664_0131730 3300046477 Bacteria 1514
668 Ga0495584_0022909 3300046491 Bacteria 3169
669 Ga0495584_0105762 3300046491 Bacteria 1423
670 Ga0495585_0013453 3300046492 Bacteria 4788
671 Ga0495585_0021887 3300046492 Bacteria 3670
672 Ga0495585_0051822 3300046492 Bacteria 2273
673 Ga0495585_0066101 3300046492 Bacteria 1980
674 Ga0495585_0072244 3300046492 Bacteria 1880
675 Ga0495585_0160445 3300046492 Bacteria 1167
676 Ga0495585_0324310 3300046492 Bacteria 752
677 Ga0495594_0000685 3300046499 Bacteria 17457
678 Ga0495594_0009010 3300046499 Bacteria 5149
679 Ga0495594_0019831 3300046499 Bacteria 3576
680 Ga0495594_0021450 3300046499 Bacteria 3447
681 Ga0495594_0024609 3300046499 Bacteria 3235
682 Ga0495594_0028394 3300046499 Bacteria 3019
683 Ga0495594_0041613 3300046499 Bacteria 2515
684 Ga0495594_0051326 3300046499 Bacteria 2269
685 Ga0495594_0086635 3300046499 Bacteria 1752
686 Ga0495594_0100840 3300046499 Bacteria 1624
687 Ga0495594_0303456 3300046499 Bacteria 909
688 Ga0495596_0018401 3300046500 Bacteria 2880
689 Ga0495607_0032514 3300046501 Bacteria 3183
690 Ga0495607_0047259 3300046501 Bacteria 2522
691 Ga0495607_0061691 3300046501 Bacteria 2129
692 Ga0495607_0080436 3300046501 Bacteria 1792
693 Ga0495607_0143306 3300046501 Bacteria 1230
694 Ga0495583_0012823 3300046506 Bacteria 4715
695 Ga0495606_0005155 3300046507 Bacteria 12661
696 Ga0495608_0015458 3300046511 Bacteria 5293
697 Ga0495608_0110793 3300046511 Bacteria 1765
698 Ga0495610_0070010 3300046512 Bacteria 1640
699 Ga0495610_0109593 3300046512 Bacteria 1225
700 Ga0495610_0186969 3300046512 Bacteria 857
701 Ga0495616_0012817 3300046513 Bacteria 4744
702 Ga0495616_0020515 3300046513 Bacteria 3592
703 Ga0495618_0014678 3300046514 Bacteria 4776
704 Ga0495618_0064186 3300046514 Bacteria 2333
705 Ga0495618_0152149 3300046514 Bacteria 1477
706 Ga0495628_0012816 3300046516 Bacteria 7059
707 Ga0495628_0281649 3300046516 Bacteria 1234
708 Ga0495628_0339778 3300046516 Bacteria 1105
709 Ga0495628_0374533 3300046516 Bacteria 1043
710 Ga0495630_0010329 3300046517 Bacteria 6739
711 Ga0495630_0020817 3300046517 Bacteria 4840
712 Ga0495630_0789217 3300046517 Bacteria 725
713 Ga0495631_0005055 3300046518 Bacteria 6948
714 Ga0495631_0030365 3300046518 Bacteria 2452
715 Ga0495631_0063541 3300046518 Bacteria 1599
716 Ga0495631_0067129 3300046518 Bacteria 1552
717 Ga0495631_0085277 3300046518 Bacteria 1361
718 Ga0495631_0118783 3300046518 Bacteria 1137
719 Ga0495631_0272754 3300046518 Bacteria 720
720 Ga0495632_0014087 3300046519 Bacteria 4537
721 Ga0495632_0022741 3300046519 Bacteria 3356
722 Ga0495632_0024406 3300046519 Bacteria 3212
723 Ga0495637_0067739 3300046520 Bacteria 1448
724 Ga0495637_0122094 3300046520 Bacteria 1001
725 Ga0495643_0001406 3300046522 Bacteria 22332
726 Ga0495643_0002959 3300046522 Bacteria 12865
727 Ga0495643_0004427 3300046522 Bacteria 9829
728 Ga0495643_0006201 3300046522 Bacteria 7932
729 Ga0495643_0035252 3300046522 Bacteria 2756
730 Ga0495643_0287500 3300046522 Bacteria 754
731 Ga0495648_0117119 3300046524 Bacteria 1438
732 Ga0495666_0005365 3300046526 Bacteria 6455
733 Ga0495666_0111637 3300046526 Bacteria 1283
734 Ga0495666_0254626 3300046526 Bacteria 799
735 Ga0495642_0191625 3300046528 Bacteria 890
736 Ga0495652_0012215 3300046529 Bacteria 7754
737 Ga0495652_0020004 3300046529 Bacteria 5954
738 Ga0495652_0057775 3300046529 Bacteria 3288
739 Ga0495652_0073727 3300046529 Bacteria 2841
740 Ga0495652_0332055 3300046529 Bacteria 1095
741 Ga0495652_0624092 3300046529 Bacteria 733
742 Ga0495654_0000078 3300046530 Bacteria 110443
743 Ga0495654_0138917 3300046530 Bacteria 1084
744 Ga0495665_0003250 3300046531 Bacteria 8795
745 Ga0495665_0028375 3300046531 Bacteria 3001
746 Ga0495640_0003633 3300046533 Bacteria 12382
747 Ga0495640_0007170 3300046533 Bacteria 8779
748 Ga0495640_0027497 3300046533 Bacteria 4101
749 Ga0495640_0033607 3300046533 Bacteria 3642
750 Ga0495640_0287746 3300046533 Bacteria 1022
751 Ga0495640_0323714 3300046533 Bacteria 954
752 Ga0495586_0033260 3300046535 Bacteria 2767
753 Ga0495586_0035300 3300046535 Bacteria 2686
754 Ga0495586_0040799 3300046535 Bacteria 2498
755 Ga0495586_0225053 3300046535 Bacteria 1067
756 Ga0495586_0369410 3300046535 Bacteria 825
757 Ga0495587_0004546 3300046536 Bacteria 9114
758 Ga0495587_0004564 3300046536 Bacteria 9091
759 Ga0495609_0039995 3300046538 Bacteria 2110
760 Ga0495609_0143967 3300046538 Bacteria 1016
761 Ga0495609_0201960 3300046538 Bacteria 830
762 Ga0495597_0062253 3300046542 Bacteria 1624
763 Ga0495597_0100882 3300046542 Bacteria 1217
764 Ga0495597_0221749 3300046542 Bacteria 750
765 Ga0495645_0024234 3300046543 Bacteria 4402
766 Ga0495645_0047897 3300046543 Bacteria 3113
767 Ga0495645_0228970 3300046543 Bacteria 1246
768 Ga0495645_0542259 3300046543 Bacteria 722
769 Ga0495622_0005269 3300046557 Bacteria 5996
770 Ga0495622_0022335 3300046557 Bacteria 2948
771 Ga0495622_0026426 3300046557 Bacteria 2710
772 Ga0495622_0041241 3300046557 Bacteria 2146
773 Ga0495622_0095241 3300046557 Bacteria 1366
774 Ga0495633_0015500 3300046558 Bacteria 3952
775 Ga0495633_0031251 3300046558 Bacteria 2583
776 Ga0495633_0052475 3300046558 Bacteria 1921
777 Ga0495633_0052876 3300046558 Bacteria 1912
778 Ga0495667_0005230 3300046559 Bacteria 8773
779 Ga0495667_0016398 3300046559 Bacteria 5007
780 Ga0495667_0131055 3300046559 Bacteria 1617
781 Ga0495667_0428472 3300046559 Bacteria 832
782 Ga0495656_0287706 3300046615 Bacteria 839
783 Ga0495656_0450761 3300046615 Bacteria 678
784 Ga0495668_0013506 3300046616 Bacteria 4814
785 Ga0495668_0013638 3300046616 Bacteria 4785
786 Ga0495634_0004463 3300046642 Bacteria 10979
787 Ga0495634_0005757 3300046642 Bacteria 9463
788 Ga0495634_0010876 3300046642 Bacteria 6648
789 Ga0495634_0018134 3300046642 Bacteria 5014
790 Ga0495634_0021238 3300046642 Bacteria 4591
791 Ga0495634_0041495 3300046642 Bacteria 3124
792 Ga0495611_0023752 3300046648 Bacteria 2662
793 Ga0495611_0028349 3300046648 Bacteria 2451
794 Ga0495611_0039483 3300046648 Bacteria 2101
795 Ga0495611_0098150 3300046648 Bacteria 1358
796 Ga0495611_0137105 3300046648 Bacteria 1142
797 Ga0495611_0174145 3300046648 Bacteria 1005
798 Ga0495625_0003493 3300046660 Bacteria 15586
799 Ga0495625_0024565 3300046660 Bacteria 4584
800 Ga0495625_0093688 3300046660 Bacteria 2073
801 Ga0495625_0285921 3300046660 Bacteria 1059
802 Ga0495635_0000563 3300046663 Bacteria 23671
803 Ga0495635_0004814 3300046663 Bacteria 9386
804 Ga0495635_0017936 3300046663 Bacteria 4943
805 Ga0495635_0041417 3300046663 Bacteria 3181
806 Ga0495635_0052822 3300046663 Bacteria 2799
807 Ga0495661_0113224 3300046665 Bacteria 1509
808 Ga0495661_0114750 3300046665 Bacteria 1496
809 Ga0495661_0149516 3300046665 Bacteria 1263
810 Ga0495661_0161329 3300046665 Bacteria 1203
811 Ga0495661_0292751 3300046665 Bacteria 817
812 Ga0495661_0311454 3300046665 Bacteria 785
813 Ga0495588_0000658 3300046674 Bacteria 15999
814 Ga0495588_0001875 3300046674 Bacteria 8955
815 Ga0495588_0002372 3300046674 Bacteria 8058
816 Ga0495588_0018282 3300046674 Bacteria 3415
817 Ga0495588_0045741 3300046674 Bacteria 2244
818 Ga0495588_0054253 3300046674 Bacteria 2068
819 Ga0495588_0097651 3300046674 Bacteria 1542
820 Ga0495588_0098358 3300046674 Bacteria 1536
821 Ga0495588_0100175 3300046674 Bacteria 1522
822 Ga0495657_0008155 3300046675 Bacteria 8024
823 Ga0495657_0009984 3300046675 Bacteria 7163
824 Ga0495657_0013312 3300046675 Bacteria 6074
825 Ga0495657_0014725 3300046675 Bacteria 5740
826 Ga0495657_0019044 3300046675 Bacteria 4959
827 Ga0495657_0026186 3300046675 Bacteria 4131
828 Ga0495657_0039076 3300046675 Bacteria 3262
829 Ga0495657_0072723 3300046675 Bacteria 2241
830 Ga0495657_0110445 3300046675 Bacteria 1742
831 Ga0495599_0002776 3300046678 Bacteria 10216
832 Ga0495623_0017347 3300046679 Bacteria 4652
833 Ga0495623_0085582 3300046679 Bacteria 1944
834 Ga0495623_0106086 3300046679 Bacteria 1707
835 Ga0495623_0299311 3300046679 Bacteria 889
836 Ga0495646_0000882 3300046680 Bacteria 17025
837 Ga0495646_0041737 3300046680 Bacteria 2817
838 Ga0495646_0348723 3300046680 Bacteria 776
839 Ga0495658_0035415 3300046683 Bacteria 2746
840 Ga0495658_0178902 3300046683 Bacteria 1315
841 Ga0495658_0367951 3300046683 Bacteria 914
842 Ga0495613_0000689 3300046689 Bacteria 26707
843 Ga0495613_0000944 3300046689 Bacteria 22202
844 Ga0495613_0002789 3300046689 Bacteria 13121
845 Ga0495613_0003382 3300046689 Bacteria 11921
846 Ga0495613_0010157 3300046689 Bacteria 6993
847 Ga0495613_0012065 3300046689 Bacteria 6422
848 Ga0495613_0012228 3300046689 Bacteria 6379
849 Ga0495613_0029046 3300046689 Bacteria 4111
850 Ga0495613_0035158 3300046689 Bacteria 3719
851 Ga0495613_0036070 3300046689 Bacteria 3667
852 Ga0495613_0146061 3300046689 Bacteria 1688
853 Ga0495624_0010572 3300046690 Bacteria 6359
854 Ga0495624_0092674 3300046690 Bacteria 1863
855 Ga0495670_0001089 3300046691 Bacteria 13186
856 Ga0495670_0005543 3300046691 Bacteria 6193
857 Ga0495670_0019309 3300046691 Bacteria 3357
858 Ga0495670_0047582 3300046691 Bacteria 2144
859 Ga0495670_0372477 3300046691 Bacteria 770
860 Ga0495671_0015738 3300046692 Bacteria 4046
861 Ga0495671_0020734 3300046692 Bacteria 3461
862 Ga0495671_0077926 3300046692 Bacteria 1625
863 Ga0495671_0372002 3300046692 Bacteria 685
864 Ga0495649_0011409 3300046694 Bacteria 5210
865 Ga0495649_0257898 3300046694 Bacteria 894
866 Ga0495589_0004951 3300046794 Bacteria 7057
867 Ga0495589_0010017 3300046794 Bacteria 4925
868 Ga0495589_0131309 3300046794 Bacteria 1202
869 Ga0495589_0208108 3300046794 Bacteria 921
870 Ga0495589_0212191 3300046794 Bacteria 911
871 Ga0495600_0011193 3300046809 Bacteria 5587
872 Ga0495600_0023168 3300046809 Bacteria 3993
873 Ga0495600_0039428 3300046809 Bacteria 3076
874 Ga0495600_0048000 3300046809 Bacteria 2785
875 Ga0495600_0067624 3300046809 Bacteria 2335
876 Ga0495600_0068092 3300046809 Bacteria 2326
877 Ga0495600_0075333 3300046809 Bacteria 2204
878 Ga0495600_0223029 3300046809 Bacteria 1205
879 Ga0495600_0524975 3300046809 Bacteria 725
880 Ga0495600_0627222 3300046809 Bacteria 651
881 Ga0495660_0032243 3300046810 Bacteria 2942
882 Ga0495660_0075529 3300046810 Bacteria 1777
883 Ga0495660_0078646 3300046810 Bacteria 1733
884 Ga0495581_0004731 3300047315 Bacteria 7857
885 Ga0495581_0046724 3300047315 Bacteria 2502
886 Ga0495581_0079416 3300047315 Bacteria 1899
887 Ga0495581_0107931 3300047315 Bacteria 1618
888 Ga0495581_0159590 3300047315 Bacteria 1318
889 Ga0495581_0223767 3300047315 Bacteria 1100
890 Ga0495604_0000177 3300047317 Bacteria 56559
891 Ga0495604_0003367 3300047317 Bacteria 12746
892 Ga0495604_0004088 3300047317 Bacteria 11597
893 Ga0495604_0019851 3300047317 Bacteria 5376
894 Ga0495604_0039597 3300047317 Bacteria 3704
895 Ga0495604_0071034 3300047317 Bacteria 2634
896 Ga0495604_0076542 3300047317 Bacteria 2516
897 Ga0495636_0040070 3300047318 Bacteria 1941
898 Ga0495636_0040514 3300047318 Bacteria 1931
899 Ga0495674_0034278 3300047319 Bacteria 4591
900 Ga0495674_0202244 3300047319 Bacteria 1647
901 Ga0495674_0426141 3300047319 Bacteria 1068
902 Ga0495676_0001703 3300047321 Bacteria 19187
903 Ga0495676_0002684 3300047321 Bacteria 15938
904 Ga0495676_0003140 3300047321 Bacteria 14944
905 Ga0495676_0010228 3300047321 Bacteria 8517
906 Ga0495676_0017921 3300047321 Bacteria 6250
907 Ga0495676_0018690 3300047321 Bacteria 6112
908 Ga0495676_0022031 3300047321 Bacteria 5552
909 Ga0495676_0023083 3300047321 Bacteria 5403
910 Ga0495676_0034376 3300047321 Bacteria 4255
911 Ga0495676_0195827 3300047321 Bacteria 1407
912 Ga0495676_0211980 3300047321 Bacteria 1339
913 Ga0495680_0009283 3300047322 Bacteria 8861
914 Ga0495680_0172222 3300047322 Bacteria 1567
915 Ga0495683_0013015 3300047323 Bacteria 4357
916 Ga0495683_0052642 3300047323 Bacteria 2031
917 Ga0495683_0202465 3300047323 Bacteria 894
918 Ga0495687_001373 3300047443 Bacteria 22509
919 Ga0495687_003246 3300047443 Bacteria 12000
920 Ga0495687_005687 3300047443 Bacteria 7865
921 Ga0495687_017551 3300047443 Bacteria 3565
922 Ga0495687_077168 3300047443 Bacteria 1316
923 Ga0495687_078302 3300047443 Bacteria 1302
924 Ga0495687_080675 3300047443 Bacteria 1275
925 Ga0495687_126129 3300047443 Bacteria 914
926 Ga0495675_0002820 3300047444 Bacteria 10415
927 Ga0495675_0018072 3300047444 Bacteria 4470
928 Ga0495675_0020811 3300047444 Bacteria 4175
929 Ga0495675_0029988 3300047444 Bacteria 3470
930 Ga0495675_0136786 3300047444 Bacteria 1520
931 Ga0495675_0183725 3300047444 Bacteria 1279
932 Ga0495675_0296879 3300047444 Bacteria 960
933 Ga0495675_0351702 3300047444 Bacteria 866
934 Ga0495675_0420466 3300047444 Bacteria 777
935 Ga0495677_0078679 3300047445 Bacteria 1234
936 Ga0495679_030402 3300047446 Bacteria 1753
937 Ga0495685_000162 3300047447 Bacteria 22500
938 Ga0495685_000439 3300047447 Bacteria 13091
939 Ga0495685_000967 3300047447 Bacteria 8696
940 Ga0495685_002093 3300047447 Bacteria 6203
941 Ga0495685_007237 3300047447 Bacteria 3658
942 Ga0495685_029355 3300047447 Bacteria 1890
943 Ga0495685_094687 3300047447 Bacteria 988
944 Ga0495685_104305 3300047447 Bacteria 935
945 Ga0495685_185862 3300047447 Bacteria 668
946 Ga0495681_0000410 3300047470 Bacteria 33110
947 Ga0495681_0001965 3300047470 Bacteria 15030
948 Ga0495681_0004423 3300047470 Bacteria 9587
949 Ga0495681_0010645 3300047470 Bacteria 5557
950 Ga0495681_0025985 3300047470 Bacteria 3057
951 Ga0495681_0043283 3300047470 Bacteria 2172
952 Ga0495684_0025204 3300047471 Bacteria 4572
953 Ga0495684_0078490 3300047471 Bacteria 2506
954 Ga0495684_0258499 3300047471 Bacteria 1264
955 Ga0495684_0562852 3300047471 Bacteria 774
956 Ga0495686_0008060 3300047472 Bacteria 7801
957 Ga0495686_0017780 3300047472 Bacteria 4785
958 Ga0495686_0027431 3300047472 Bacteria 3718
959 Ga0495686_0145293 3300047472 Bacteria 1396
960 Ga0495686_0309832 3300047472 Bacteria 868
961 Ga0495593_0001603 3300047673 Bacteria 13363
962 Ga0495593_0002856 3300047673 Bacteria 10408
963 Ga0495593_0050415 3300047673 Bacteria 2205
964 Ga0495602_0016479 3300048088 Bacteria 7432
965 Ga0495602_0065869 3300048088 Bacteria 3124
966 Ga0495602_0118111 3300048088 Bacteria 2139
967 Ga0495602_0456700 3300048088 Bacteria 901
968 Ga0495614_0000918 3300048089 Bacteria 12564
969 Ga0495614_0004063 3300048089 Bacteria 6577
970 Ga0495614_0007730 3300048089 Bacteria 4777
971 Ga0495614_0046084 3300048089 Bacteria 1869
972 Ga0495614_0150998 3300048089 Bacteria 1036
973 Ga0495626_0009504 3300048091 Bacteria 5253
974 Ga0496100_0724208 3300048903 Bacteria 777
975 Ga0496101_0169241 3300048904 Bacteria 1679
976 Ga0496101_0592341 3300048904 Bacteria 877
977 Ga0496102_0055630 3300048905 Bacteria 3608
978 Ga0496102_0102413 3300048905 Bacteria 2662
979 Ga0496103_0033755 3300048906 Bacteria 3127
980 Ga0496104_0186281 3300048907 Bacteria 1986
981 Ga0496104_0403489 3300048907 Bacteria 1279
982 Ga0496105_0267987 3300048908 Bacteria 1380
983 Ga0496106_0001704 3300048909 Bacteria 16439
984 Ga0496106_0488473 3300048909 Bacteria 989
985 Ga0496107_0390521 3300048910 Bacteria 1035
986 Ga0496108_0049234 3300048911 Bacteria 3524
987 Ga0496109_0001113 3300048912 Bacteria 22299
988 Ga0496109_0023882 3300048912 Bacteria 5429
989 Ga0496109_0051561 3300048912 Bacteria 3748
990 Ga0496109_0121053 3300048912 Bacteria 2438
991 Ga0496109_0231947 3300048912 Bacteria 1737
992 Ga0496109_0326546 3300048912 Bacteria 1448
993 Ga0496110_0054541 3300048913 Bacteria 3516
994 Ga0496110_0066541 3300048913 Bacteria 3187
995 Ga0496112_0171137 3300048915 Bacteria 2137
996 Ga0496113_0187461 3300048916 Bacteria 1641
997 Ga0496113_0500702 3300048916 Bacteria 975
998 Ga0496113_0656493 3300048916 Bacteria 839
999 Ga0496114_0127717 3300048917 Bacteria 2193
1000 Ga0496115_0503837 3300048918 Bacteria 973
1001 Ga0496118_0080260 3300048921 Bacteria 2297
1002 Ga0496119_0117243 3300048922 Bacteria 1468
1003 Ga0496120_0000365 3300048923 Bacteria 73526
1004 Ga0496121_0000705 3300048924 Bacteria 62174
1005 Ga0496121_0006724 3300048924 Bacteria 14115
1006 Ga0496122_0005418 3300048925 Bacteria 15216
1007 Ga0496123_0040721 3300048926 Bacteria 3231
1008 Ga0496126_0096293 3300048929 Bacteria 2595
1009 Ga0501306_037732 3300049127 Bacteria 740
1010 Ga0501306_055935 3300049127 Bacteria 642
1011 Ga0501310_039625 3300049130 Bacteria 652
1012 Ga0501304_016441 3300049160 Bacteria 700
1013 Ga0501305_054025 3300049161 Bacteria 680
1014 Ga0495678_024008 3300049459 Bacteria 2640
1015 Ga0495678_029142 3300049459 Bacteria 2321
1016 Ga0495682_0017031 3300049460 Bacteria 2748
1017 Ga0495682_0034481 3300049460 Bacteria 1866
1018 Ga0501291_044619 3300049514 Bacteria 790
1019 Ga0501311_052374 3300049527 Bacteria 642
1020 Ga0501314_026889 3300049530 Bacteria 625
1021 Ga0501315_043164 3300049531 Bacteria 688
1022 Ga0501316_048241 3300049532 Bacteria 608
1023 Ga0501318_027489 3300049534 Bacteria 757
1024 Ga0501318_032778 3300049534 Bacteria 714
1025 Ga0501318_049895 3300049534 Bacteria 620
1026 Ga0501321_025524 3300049537 Bacteria 762
1027 Ga0501321_037579 3300049537 Bacteria 670
1028 Ga0501323_016978 3300049539 Bacteria 932
1029 Ga0501031_0001023 3300049568 Bacteria 16953
1030 Ga0501031_0001503 3300049568 Bacteria 14525
1031 Ga0501031_0001677 3300049568 Bacteria 13908
1032 Ga0501031_0005943 3300049568 Bacteria 7961
1033 Ga0501031_0028629 3300049568 Bacteria 3632
1034 Ga0501031_0155120 3300049568 Bacteria 1496
1035 Ga0501031_0163683 3300049568 Bacteria 1454
1036 Ga0501032_0000915 3300049569 Bacteria 23862
1037 Ga0501032_0005078 3300049569 Bacteria 9829
1038 Ga0501032_0007555 3300049569 Bacteria 7938
1039 Ga0501032_0008981 3300049569 Bacteria 7269
1040 Ga0501032_0015456 3300049569 Bacteria 5383
1041 Ga0501032_0033624 3300049569 Bacteria 3512
1042 Ga0501032_0087497 3300049569 Bacteria 2069
1043 Ga0501032_0338718 3300049569 Bacteria 969
1044 Ga0501032_0397429 3300049569 Bacteria 885
1045 Ga0501033_0001038 3300049570 Bacteria 25291
1046 Ga0501033_0007204 3300049570 Bacteria 8680
1047 Ga0501033_0009061 3300049570 Bacteria 7677
1048 Ga0501033_0022971 3300049570 Bacteria 4701
1049 Ga0501033_0052450 3300049570 Bacteria 3022
1050 Ga0501033_0070118 3300049570 Bacteria 2575
1051 Ga0501033_0167251 3300049570 Bacteria 1580
1052 Ga0501033_0168504 3300049570 Bacteria 1573
1053 Ga0501033_0180650 3300049570 Bacteria 1512
1054 Ga0501033_0281625 3300049570 Bacteria 1173
1055 Ga0501033_0295927 3300049570 Bacteria 1140
1056 Ga0501033_0314083 3300049570 Bacteria 1101
1057 Ga0501034_0002021 3300049571 Bacteria 25537
1058 Ga0501034_0006741 3300049571 Bacteria 12296
1059 Ga0501034_0009862 3300049571 Bacteria 9987
1060 Ga0501034_0011799 3300049571 Bacteria 9043
1061 Ga0501034_0013420 3300049571 Bacteria 8432
1062 Ga0501034_0018411 3300049571 Bacteria 7162
1063 Ga0501034_0020012 3300049571 Bacteria 6835
1064 Ga0501034_0040703 3300049571 Bacteria 4703
1065 Ga0501034_0042572 3300049571 Bacteria 4597
1066 Ga0501034_0074676 3300049571 Bacteria 3398
1067 Ga0501034_0547857 3300049571 Bacteria 1066
1068 Ga0501034_1149076 3300049571 Bacteria 656
1069 Ga0501036_0001728 3300049572 Bacteria 16975
1070 Ga0501036_0003039 3300049572 Bacteria 13363
1071 Ga0501036_0003195 3300049572 Bacteria 13083
1072 Ga0501036_0012967 3300049572 Bacteria 6919
1073 Ga0501036_0017577 3300049572 Bacteria 5981
1074 Ga0501036_0024372 3300049572 Bacteria 5099
1075 Ga0501036_0078096 3300049572 Bacteria 2800
1076 Ga0501036_0111691 3300049572 Bacteria 2309
1077 Ga0501036_0241662 3300049572 Bacteria 1514
1078 Ga0501036_0377315 3300049572 Bacteria 1183
1079 Ga0501037_0000823 3300049573 Bacteria 23178
1080 Ga0501037_0001454 3300049573 Bacteria 17404
1081 Ga0501037_0011852 3300049573 Bacteria 6420
1082 Ga0501037_0015772 3300049573 Bacteria 5559
1083 Ga0501037_0026992 3300049573 Bacteria 4243
1084 Ga0501037_0041411 3300049573 Bacteria 3387
1085 Ga0501037_0094396 3300049573 Bacteria 2163
1086 Ga0501037_0107518 3300049573 Bacteria 2010
1087 Ga0501037_0170421 3300049573 Bacteria 1547
1088 Ga0501037_0224601 3300049573 Bacteria 1320
1089 Ga0501037_0550748 3300049573 Bacteria 778
1090 Ga0501038_0000988 3300049574 Bacteria 25564
1091 Ga0501038_0003374 3300049574 Bacteria 14894
1092 Ga0501038_0006805 3300049574 Bacteria 10560
1093 Ga0501038_0011419 3300049574 Bacteria 8106
1094 Ga0501038_0018256 3300049574 Bacteria 6332
1095 Ga0501038_0033410 3300049574 Bacteria 4532
1096 Ga0501038_0034992 3300049574 Bacteria 4413
1097 Ga0501038_0166360 3300049574 Bacteria 1788
1098 Ga0501038_0169347 3300049574 Bacteria 1769
1099 Ga0501038_0262537 3300049574 Bacteria 1364
1100 Ga0501038_0354338 3300049574 Bacteria 1142
1101 Ga0501038_0680462 3300049574 Bacteria 772
1102 Ga0501039_0004713 3300049575 Bacteria 10325
1103 Ga0501039_0030437 3300049575 Bacteria 4162
1104 Ga0501039_0048652 3300049575 Bacteria 3277
1105 Ga0501039_0052460 3300049575 Bacteria 3156
1106 Ga0501039_0062998 3300049575 Bacteria 2873
1107 Ga0501039_0085215 3300049575 Bacteria 2462
1108 Ga0501039_0270591 3300049575 Bacteria 1335
1109 Ga0501039_0364588 3300049575 Bacteria 1135
1110 Ga0501040_0010344 3300049576 Bacteria 6099
1111 Ga0501040_0020613 3300049576 Bacteria 4394
1112 Ga0501040_0027254 3300049576 Bacteria 3845
1113 Ga0501041_0001251 3300049577 Bacteria 13929
1114 Ga0501041_0001328 3300049577 Bacteria 13604
1115 Ga0501041_0028682 3300049577 Bacteria 3357
1116 Ga0501042_0008300 3300049578 Bacteria 6847
1117 Ga0501042_0012241 3300049578 Bacteria 5805
1118 Ga0501042_0013832 3300049578 Bacteria 5496
1119 Ga0501042_0023191 3300049578 Bacteria 4340
1120 Ga0501042_0055951 3300049578 Bacteria 2815
1121 Ga0501042_0057857 3300049578 Bacteria 2766
1122 Ga0501042_0901765 3300049578 Bacteria 644
1123 Ga0501043_0000870 3300049579 Bacteria 26774
1124 Ga0501043_0000941 3300049579 Bacteria 25840
1125 Ga0501043_0009251 3300049579 Bacteria 7741
1126 Ga0501043_0015452 3300049579 Bacteria 5979
1127 Ga0501043_0016524 3300049579 Bacteria 5784
1128 Ga0501043_0016576 3300049579 Bacteria 5774
1129 Ga0501043_0023105 3300049579 Bacteria 4877
1130 Ga0501043_0048623 3300049579 Bacteria 3334
1131 Ga0501043_0060231 3300049579 Bacteria 2980
1132 Ga0501043_0069846 3300049579 Bacteria 2759
1133 Ga0501043_0147684 3300049579 Bacteria 1840
1134 Ga0501043_0172312 3300049579 Bacteria 1688
1135 Ga0501043_0178393 3300049579 Bacteria 1655
1136 Ga0501046_0008006 3300049580 Bacteria 9237
1137 Ga0501046_0014862 3300049580 Bacteria 6553
1138 Ga0501046_0019657 3300049580 Bacteria 5597
1139 Ga0501046_0026133 3300049580 Bacteria 4769
1140 Ga0501046_0029767 3300049580 Bacteria 4437
1141 Ga0501046_0040251 3300049580 Bacteria 3736
1142 Ga0501046_0082510 3300049580 Bacteria 2483
1143 Ga0501046_0137267 3300049580 Bacteria 1852
1144 Ga0501047_0000056 3300049581 Bacteria 143501
1145 Ga0501047_0000075 3300049581 Bacteria 124995
1146 Ga0501047_0000280 3300049581 Bacteria 59132
1147 Ga0501047_0000778 3300049581 Bacteria 33367
1148 Ga0501047_0012542 3300049581 Bacteria 8025
1149 Ga0501047_0014223 3300049581 Bacteria 7563
1150 Ga0501047_0018440 3300049581 Bacteria 6690
1151 Ga0501047_0019492 3300049581 Bacteria 6506
1152 Ga0501047_0034389 3300049581 Bacteria 4893
1153 Ga0501047_0039577 3300049581 Bacteria 4560
1154 Ga0501047_0042679 3300049581 Bacteria 4382
1155 Ga0501047_0044183 3300049581 Bacteria 4304
1156 Ga0501047_0064798 3300049581 Bacteria 3524
1157 Ga0501047_0070452 3300049581 Bacteria 3367
1158 Ga0501047_0077462 3300049581 Bacteria 3198
1159 Ga0501047_0197648 3300049581 Bacteria 1872
1160 Ga0501047_0259630 3300049581 Bacteria 1585
1161 Ga0501047_0698611 3300049581 Bacteria 832
1162 Ga0501047_0755527 3300049581 Bacteria 788
1163 Ga0501048_0003653 3300049582 Bacteria 11719
1164 Ga0501048_0004349 3300049582 Bacteria 10780
1165 Ga0501048_0009856 3300049582 Bacteria 7163
1166 Ga0501048_0019118 3300049582 Bacteria 5031
1167 Ga0501048_0025962 3300049582 Bacteria 4266
1168 Ga0501048_0054156 3300049582 Bacteria 2850
1169 Ga0501048_0312177 3300049582 Bacteria 1119
1170 Ga0501067_0000777 3300049583 Bacteria 17138
1171 Ga0501067_0001336 3300049583 Bacteria 13370
1172 Ga0501067_0002496 3300049583 Bacteria 10166
1173 Ga0501068_0000625 3300049584 Bacteria 18053
1174 Ga0501068_0001060 3300049584 Bacteria 14554
1175 Ga0501068_0001907 3300049584 Bacteria 11089
1176 Ga0501069_0007297 3300049585 Bacteria 5797
1177 Ga0501069_0108348 3300049585 Bacteria 1580
1178 Ga0501070_0002871 3300049586 Bacteria 15008
1179 Ga0501070_0039350 3300049586 Bacteria 3944
1180 Ga0501070_0045144 3300049586 Bacteria 3665
1181 Ga0501070_0058402 3300049586 Bacteria 3198
1182 Ga0501070_0060963 3300049586 Bacteria 3126
1183 Ga0501070_0083801 3300049586 Bacteria 2639
1184 Ga0501070_0479562 3300049586 Bacteria 1000
1185 Ga0501070_0546971 3300049586 Bacteria 927
1186 Ga0501071_0001568 3300049587 Bacteria 13369
1187 Ga0501071_0001769 3300049587 Bacteria 12735
1188 Ga0501071_0002013 3300049587 Bacteria 12158
1189 Ga0501071_0414083 3300049587 Bacteria 1030
1190 Ga0501072_0000945 3300049588 Bacteria 21381
1191 Ga0501072_0002882 3300049588 Bacteria 12933
1192 Ga0501073_0012792 3300049589 Bacteria 6120
1193 Ga0501073_0016315 3300049589 Bacteria 5382
1194 Ga0501073_0033930 3300049589 Bacteria 3632
1195 Ga0501073_0270782 3300049589 Bacteria 1172
1196 Ga0501074_0002531 3300049590 Bacteria 12756
1197 Ga0501074_0005345 3300049590 Bacteria 9231
1198 Ga0501074_0030555 3300049590 Bacteria 3903
1199 Ga0501074_0144448 3300049590 Bacteria 1701
1200 Ga0501074_0452429 3300049590 Bacteria 910
1201 Ga0501075_0354392 3300049591 Bacteria 1118
1202 Ga0501076_0031304 3300049592 Bacteria 4148
1203 Ga0501076_0042982 3300049592 Bacteria 3560
1204 Ga0501076_0305030 3300049592 Bacteria 1305
1205 Ga0501077_0017810 3300049593 Bacteria 4488
1206 Ga0501077_0024007 3300049593 Bacteria 3869
1207 Ga0501077_0064793 3300049593 Bacteria 2318
1208 Ga0501235_027790 3300049669 Bacteria 1270
1209 Ga0501257_064466 3300049686 Bacteria 929
1210 Ga0501079_0024430 3300049741 Bacteria 4636
1211 Ga0501079_0036399 3300049741 Bacteria 3791
1212 Ga0501080_0033549 3300049742 Bacteria 4791
1213 Ga0501080_0058977 3300049742 Bacteria 3572
1214 Ga0501080_0131477 3300049742 Bacteria 2317
1215 Ga0501080_0301538 3300049742 Bacteria 1453
1216 Ga0501080_0990165 3300049742 Bacteria 730
1217 Ga0501083_0003122 3300049744 Bacteria 11522
1218 Ga0501083_0019932 3300049744 Bacteria 4667
1219 Ga0501083_0043858 3300049744 Bacteria 3028
1220 Ga0501083_0230932 3300049744 Bacteria 1205
1221 Ga0501035_0001147 3300049822 Bacteria 27697
1222 Ga0501035_0004811 3300049822 Bacteria 12797
1223 Ga0501035_0009561 3300049822 Bacteria 9014
1224 Ga0501035_0010897 3300049822 Bacteria 8418
1225 Ga0501035_0011412 3300049822 Bacteria 8237
1226 Ga0501035_0012695 3300049822 Bacteria 7783
1227 Ga0501035_0020699 3300049822 Bacteria 6046
1228 Ga0501035_0024019 3300049822 Bacteria 5593
1229 Ga0501035_0029703 3300049822 Bacteria 4985
1230 Ga0501035_0038641 3300049822 Bacteria 4321
1231 Ga0501035_0039002 3300049822 Bacteria 4300
1232 Ga0501035_0039258 3300049822 Bacteria 4284
1233 Ga0501035_0146248 3300049822 Bacteria 2052
1234 Ga0501035_0155730 3300049822 Bacteria 1980
1235 Ga0501035_0214567 3300049822 Bacteria 1645
1236 Ga0501035_0626144 3300049822 Bacteria 874
1237 Ga0501035_1161759 3300049822 Bacteria 600
1238 Ga0501044_0002369 3300049823 Bacteria 21458
1239 Ga0501044_0003629 3300049823 Bacteria 17366
1240 Ga0501044_0005864 3300049823 Bacteria 13606
1241 Ga0501044_0009001 3300049823 Bacteria 10921
1242 Ga0501044_0012223 3300049823 Bacteria 9294
1243 Ga0501044_0016619 3300049823 Bacteria 7899
1244 Ga0501044_0022810 3300049823 Bacteria 6666
1245 Ga0501044_0033562 3300049823 Bacteria 5392
1246 Ga0501044_0050034 3300049823 Bacteria 4313
1247 Ga0501044_0050626 3300049823 Bacteria 4284
1248 Ga0501044_0054717 3300049823 Bacteria 4100
1249 Ga0501044_0080129 3300049823 Bacteria 3307
1250 Ga0501044_0099562 3300049823 Bacteria 2925
1251 Ga0501044_0126185 3300049823 Bacteria 2556
1252 Ga0501044_0126805 3300049823 Bacteria 2549
1253 Ga0501044_0248080 3300049823 Bacteria 1722
1254 Ga0501044_0262391 3300049823 Bacteria 1665
1255 Ga0501044_0270165 3300049823 Bacteria 1636
1256 Ga0501044_0338723 3300049823 Bacteria 1425
1257 Ga0501044_0348867 3300049823 Bacteria 1400
1258 Ga0501044_0507657 3300049823 Bacteria 1106
1259 Ga0501044_0933111 3300049823 Bacteria 742
1260 Ga0501045_0023726 3300049824 Bacteria 4400
1261 Ga0501045_0031069 3300049824 Bacteria 3867
1262 Ga0501045_0057544 3300049824 Bacteria 2844
1263 Ga0501045_0213018 3300049824 Bacteria 1439
1264 Ga0501045_0262205 3300049824 Bacteria 1286
1265 nmdc:mga03n38_13687_c1 3300050490 Bacteria 3089
1266 nmdc:mga03n38_159079_c1 3300050490 Bacteria 1142
1267 nmdc:mga03n38_78328_c1 3300050490 Bacteria 1547
1268 nmdc:mga00v17_26724_c2 3300050491 Bacteria 1050
1269 nmdc:mga00v17_41102_c1 3300050491 Bacteria 2776
1270 nmdc:mga00v17_517641_c1 3300050491 Bacteria 773
1271 nmdc:mga06z11_162486_c1 3300050494 Bacteria 1277
1272 nmdc:mga06z11_903_c1 3300050494 Bacteria 10791
1273 nmdc:mga04h51_9676_c1 3300050495 Bacteria 2623
1274 nmdc:mga07m45_101330_c1 3300050496 Bacteria 1653
1275 nmdc:mga07m45_151869_c1 3300050496 Bacteria 1343
1276 nmdc:mga07m45_259062_c1 3300050496 Bacteria 1012
1277 nmdc:mga09592_846225_c1 3300050508 Bacteria 772
1278 nmdc:mga08y16_154699_c1 3300050511 Bacteria 2383
1279 nmdc:mga08y16_32291_c1 3300050511 Bacteria 5505
1280 nmdc:mga08y16_435128_c1 3300050511 Bacteria 1339
1281 nmdc:mga08y16_628517_c1 3300050511 Bacteria 1080
1282 nmdc:mga08y16_911139_c1 3300050511 Bacteria 865
1283 nmdc:mga08y16_9548_c1 3300050511 Bacteria 10183
1284 nmdc:mga0n895_852226_c1 3300050512 Bacteria 899
1285 nmdc:mga0sz30_334606_c1 3300050516 Bacteria 676
1286 Ga0495601_0003963 3300053077 Bacteria 8526
1287 Ga0495612_0174188 3300053078 Bacteria 943
1288 Ga0500610_0036313 3300053079 Bacteria 2533
1289 Ga0500610_0046147 3300053079 Bacteria 2262
1290 Ga0500610_0158688 3300053079 Bacteria 1127
1291 Ga0495655_0023071 3300053083 Bacteria 1430
1292 Ga0495655_0050485 3300053083 Bacteria 1099
1293 Ga0495655_0157483 3300053083 Bacteria 718
1294 Ga0495619_0155993 3300053085 Bacteria 1575
1295 Ga0500578_0012302 3300053086 Bacteria 5526
1296 Ga0500578_0160956 3300053086 Bacteria 1392
1297 Ga0500643_000132 3300053087 Bacteria 76916
1298 Ga0500644_0116020 3300053088 Bacteria 1037
1299 Ga0500646_0013621 3300053090 Bacteria 2105
1300 Ga0500583_0096220 3300053092 Bacteria 1446
1301 Ga0500583_0273240 3300053092 Bacteria 831
1302 Ga0500566_0012307 3300053094 Bacteria 5037
1303 Ga0500640_021639 3300053095 Bacteria 2775
1304 Ga0500640_095604 3300053095 Bacteria 1236
1305 Ga0500641_0154828 3300053096 Bacteria 989
1306 Ga0500650_0336738 3300053098 Bacteria 662
1307 Ga0500654_050515 3300053099 Bacteria 2244
1308 Ga0500654_079864 3300053099 Bacteria 1532
1309 Ga0500660_027388 3300053100 Bacteria 2997
1310 Ga0500660_129093 3300053100 Bacteria 1032
1311 Ga0500553_054950 3300053101 Bacteria 1893
1312 Ga0500553_138559 3300053101 Bacteria 964
1313 Ga0500560_000196 3300053107 Bacteria 7160
1314 Ga0500560_019942 3300053107 Bacteria 1894
1315 Ga0500569_000083 3300053109 Bacteria 15479
1316 Ga0500569_002256 3300053109 Bacteria 3772
1317 Ga0500569_068123 3300053109 Bacteria 1114
1318 Ga0500572_099043 3300053111 Bacteria 930
1319 Ga0500608_124280 3300053122 Bacteria 1166
1320 Ga0500621_056764 3300053126 Bacteria 1583
1321 Ga0500621_089446 3300053126 Bacteria 1226
1322 Ga0500628_000379 3300053129 Bacteria 8421
1323 Ga0500628_003563 3300053129 Bacteria 2573
1324 Ga0500628_008605 3300053129 Bacteria 1780
1325 Ga0500652_000875 3300053131 Bacteria 9971
1326 Ga0500652_015462 3300053131 Bacteria 2754
1327 Ga0500652_016648 3300053131 Bacteria 2680
1328 Ga0500658_0002463 3300053134 Bacteria 7157
1329 Ga0500658_0004327 3300053134 Bacteria 5322
1330 Ga0500658_0007089 3300053134 Bacteria 4148
1331 Ga0500658_0069850 3300053134 Bacteria 1479
1332 Ga0500559_0180921 3300053136 Bacteria 993
1333 Ga0500561_0002687 3300053137 Bacteria 3018
1334 Ga0500561_0008072 3300053137 Bacteria 2081
1335 Ga0500561_0011160 3300053137 Bacteria 1881
1336 Ga0500573_0017433 3300053140 Bacteria 4089
1337 Ga0500573_0081381 3300053140 Bacteria 1840
1338 Ga0500573_0358265 3300053140 Bacteria 706
1339 Ga0500577_0079106 3300053142 Bacteria 1307
1340 Ga0500577_0081351 3300053142 Bacteria 1292
1341 Ga0500579_010911 3300053143 Bacteria 5805
1342 Ga0500579_030592 3300053143 Bacteria 3455
1343 Ga0500579_082473 3300053143 Bacteria 1789
1344 Ga0500600_0003115 3300053149 Bacteria 9482
1345 Ga0500600_0152721 3300053149 Bacteria 1146
1346 Ga0500600_0204768 3300053149 Bacteria 926
1347 Ga0500604_0003384 3300053151 Bacteria 4289
1348 Ga0500616_0000145 3300053153 Bacteria 120927
1349 Ga0500616_0006393 3300053153 Bacteria 7724
1350 Ga0500616_0010512 3300053153 Bacteria 5534
1351 Ga0500616_0052292 3300053153 Bacteria 2148
1352 Ga0500624_023600 3300053157 Bacteria 1009
1353 Ga0500633_0000640 3300053160 Bacteria 5823
1354 Ga0500633_0000723 3300053160 Bacteria 5607
1355 Ga0500633_0001014 3300053160 Bacteria 4990
1356 Ga0500633_0010752 3300053160 Bacteria 2464
1357 Ga0500634_0000287 3300053161 Bacteria 16181
1358 Ga0500634_0017507 3300053161 Bacteria 3836
1359 Ga0500634_0037432 3300053161 Bacteria 2638
1360 Ga0500634_0194028 3300053161 Bacteria 899
1361 Ga0500636_0337546 3300053177 Bacteria 725
1362 Ga0500656_003712 3300053732 Bacteria 1439
1363 Ga0500656_004175 3300053732 Bacteria 1386
1364 Ga0500587_001407 3300053739 Bacteria 3396
1365 Ga0500587_003016 3300053739 Bacteria 2383
1366 Ga0501084_0014939 3300054114 Bacteria 6437
1367 Ga0501084_0026942 3300054114 Bacteria 4801
1368 Ga0501084_0031626 3300054114 Bacteria 4423
1369 Ga0501084_0699657 3300054114 Bacteria 855
1370 Ga0587084_043046 3300059477 Bacteria 774
1371 Ga0587093_043081 3300059478 Bacteria 691
1372 Ga0587070_058899 3300059491 Bacteria 788
1373 Ga0587073_0081313 3300059492 Bacteria 805
1374 Ga0587073_0084121 3300059492 Bacteria 796
1375 Ga0587077_148079 3300059493 Bacteria 611
1376 Ga0587080_026546 3300059503 Bacteria 984
1377 Ga0587083_0071547 3300059505 Bacteria 806
1378 Ga0587083_0135654 3300059505 Bacteria 650
1379 Ga0587085_072290 3300059506 Bacteria 677
1380 Ga0587090_040640 3300059510 Bacteria 817
1381 Ga0587092_068206 3300059512 Bacteria 679
1382 Ga0587094_063842 3300059513 Bacteria 650
1383 Ga0587098_030565 3300059604 Bacteria 739
1384 Ga0587106_012723 3300059605 Bacteria 1133
1385 Ga0587125_013920 3300059607 Bacteria 874
1386 Ga0587129_011418 3300059608 Bacteria 699
1387 Ga0587113_019802 3300059625 Bacteria 700
1388 Ga0587117_046494 3300059627 Bacteria 708
1389 Ga0587122_019578 3300059628 Bacteria 725
1390 Ga0587128_047102 3300059630 Bacteria 775
1391 Ga0587130_014414 3300059631 Bacteria 807
1392 Ga0587068_038661 3300059641 Bacteria 856
1393 Ga0587072_066147 3300059643 Bacteria 755
1394 Ga0587105_012109 3300059651 Bacteria 673
1395 Ga0587108_015879 3300059653 Bacteria 681
1396 Ga0501082_0000551 3300060353 Bacteria 33339
1397 Ga0501082_0000557 3300060353 Bacteria 33125
1398 Ga0501082_0012099 3300060353 Bacteria 7415
1399 Ga0466962_0001438 3300061719 Bacteria 11099
1400 Ga0466962_0005196 3300061719 Bacteria 6264
1401 Ga0466962_0011051 3300061719 Bacteria 4346
1402 Ga0530510_0030131 3300061734 Bacteria 3896
1403 Ga0530510_0062745 3300061734 Bacteria 2690
1404 Ga0530510_0096285 3300061734 Bacteria 2163
1405 2506867086 2506783011 Bacteria 5323186
1406 2506868377 2506783011 Bacteria 5323186
1407 2511379317 2511231025 Bacteria 5324661
1408 2511436184 2511231035 Bacteria 5341610
1409 2517759554 2517572101 Bacteria 6884336
1410 2528204509 2527291627 Bacteria 5309833
1411 2528212247 2527291629 Bacteria 5267418
1412 2528214879 2527291629 Bacteria 5267418
1413 2546949598 2546825537 Bacteria 5389291
1414 2546949905 2546825537 Bacteria 5389291
1415 2547408202 2547132111 Bacteria 8013147
1416 2554257745 2554235005 Bacteria 6457341
1417 2566991888 2565956761 Bacteria 6601618
1418 2579749036 2576861822 Bacteria 5004595
1419 2579750471 2576861822 Bacteria 5004595
1420 2579856205 2579778521 Bacteria 7624758
1421 2585299239 2582581312 Bacteria 7308206
1422 2585301009 2582581312 Bacteria 7308206
1423 2585308409 2582581313 Bacteria 10042643
1424 2585308894 2582581313 Bacteria 10042643
1425 2585313220 2582581314 Bacteria 11452267
1426 2585313581 2582581314 Bacteria 11452267
1427 2616693265 2616644814 Bacteria 11555299
1428 2616694985 2616644814 Bacteria 11555299
1429 2616899728 2616644941 Bacteria 8510691
1430 2616904567 2616644941 Bacteria 8510691
1431 2619858352 2619618881 Bacteria 7521104
1432 2620349335 2619619003 Bacteria 7619552
1433 2626639187 2626541554 Bacteria 7741902
1434 2643759568 2643221548 Bacteria 8053412
1435 2643765046 2643221548 Bacteria 8053412
1436 2643897640 2643221578 Bacteria 9213798
1437 2643899118 2643221578 Bacteria 9213798
1438 2644017107 2643221601 Bacteria 7493239
1439 2644173932 2643221631 Bacteria 8168043
1440 2644262385 2643221647 Bacteria 10741251
1441 2644268871 2643221647 Bacteria 10741251
1442 2644403301 2643221673 Bacteria 9196637
1443 2644408786 2643221673 Bacteria 9196637
1444 2644437238 2643221678 Bacteria 9540101
1445 2644443503 2643221678 Bacteria 9540101
1446 2644461115 2643221682 Bacteria 6743283
1447 2644463016 2643221682 Bacteria 6743283
1448 2644517112 2643221692 Bacteria 7282860
1449 2644518023 2643221692 Bacteria 7282860
1450 2644628976 2643221714 Bacteria 9015452
1451 2671833853 2671180195 Bacteria 9757215
1452 2671840183 2671180195 Bacteria 9757215
1453 2686536089 2684623035 Bacteria 8032739
1454 2686539087 2684623035 Bacteria 8032739
1455 2686541086 2684623036 Bacteria 5199090
1456 2686542395 2684623036 Bacteria 5199090
1457 2689990328 2687453743 Bacteria 8361025
1458 2689995649 2687453743 Bacteria 8361025
1459 2710602650 2710264753 Bacteria 5455564
1460 2710602827 2710264753 Bacteria 5455564
1461 2731908354 2731639228 Bacteria 4187555
1462 2738869875 2738541305 Bacteria 4910150
1463 2738891744 2738541308 Bacteria 7020677
1464 2739206807 2738543005 Bacteria 5278128
1465 2739365746 2738543034 Bacteria 6084756
1466 2753034848 2751185725 Bacteria 5740550
1467 2753323365 2751185792 Bacteria 5739090
1468 2774852009 2773857922 Bacteria 9757215
1469 2774858339 2773857922 Bacteria 9757215
1470 2774865521 2773857924 Bacteria 5256821
1471 2774865832 2773857924 Bacteria 5256821
1472 2774902759 2773857933 Bacteria 5818019
1473 2774903956 2773857933 Bacteria 5818019
1474 2784588663 2784132148 Bacteria 8627943
1475 2785343189 2784746763 Bacteria 9783172
1476 2785368267 2784746768 Bacteria 10036182
1477 2785369606 2784746768 Bacteria 10036182
1478 2786669266 2786546132 Bacteria 10419719
1479 2786670696 2786546132 Bacteria 10419719
1480 2793982908 2791355406 Bacteria 11364898
1481 2793985453 2791355406 Bacteria 11364898
1482 2804844676 2802429296 Bacteria 7227771
1483 2804846886 2802429296 Bacteria 7227771
1484 2808842139 2808606359 Bacteria 9866990
1485 2808846030 2808606359 Bacteria 9866990
1486 2808846928 2808606359 Bacteria 9866990
1487 2808919499 2808606375 Bacteria 9466072
1488 2808920662 2808606375 Bacteria 9466072
1489 2809232273 2808606448 Bacteria 8656184
1490 2811847941 2808606982 Bacteria 7791042
1491 2811849145 2808606982 Bacteria 7791042
1492 2812357992 2811994879 Bacteria 9313447
1493 2812480436 2811994917 Bacteria 7761064
1494 2816510538 2816332139 Bacteria 9138787
1495 2819693857 2818991463 Bacteria 7948711
1496 2819695499 2818991463 Bacteria 7948711
1497 2819743032 2818991472 Bacteria 10089953
1498 2842892384 2842888712 Bacteria 4279094
1499 2852636559 2852635781 Bacteria 8251373
1500 2852637548 2852635781 Bacteria 8251373
1501 2857485168 2857481737 Bacteria 4761446
1502 2862178684 2862178590 Bacteria 8583590
1503 2862179382 2862178590 Bacteria 8583590
1504 2862182690 2862178590 Bacteria 8583590
1505 2862285752 2862281513 Bacteria 9621493
1506 2862294800 2862290372 Bacteria 7471434
1507 2862295876 2862290372 Bacteria 7471434
1508 2862392604 2862382967 Bacteria 10317375
1509 2862511716 2862507626 Bacteria 9425308
1510 2862579163 2862574272 Bacteria 10567477
1511 2862582616 2862574272 Bacteria 10567477
1512 2863404502 2863404153 Bacteria 9672205
1513 2867371980 2867369537 Bacteria 6501581
1514 2867429517 2867428634 Bacteria 9590268
1515 2867430039 2867428634 Bacteria 9590268
1516 2867431763 2867428634 Bacteria 9590268
1517 2867480820 2867475112 Bacteria 6909112
1518 2873155638 2873151551 Bacteria 8625867
1519 2875393591 2875391855 Bacteria 7600475
1520 2875395623 2875391855 Bacteria 7600475
1521 2876602800 2876601092 Bacteria 5114497
1522 2877676859 2877676314 Bacteria 9512378
1523 2877681022 2877676314 Bacteria 9512378
1524 2877682310 2877676314 Bacteria 9512378
1525 2895887849 2895880812 Bacteria 11255272
1526 2895889504 2895880812 Bacteria 11255272
1527 2904540420 2904535858 Bacteria 6308016
1528 2912716400 2912715099 Bacteria 9460473
1529 2912717754 2912715099 Bacteria 9460473
1530 2912719850 2912715099 Bacteria 9460473
1531 2912725231 2912723979 Bacteria 8557534
1532 2912727018 2912723979 Bacteria 8557534
1533 2912758338 2912757875 Bacteria 7940295
1534 2912760878 2912757875 Bacteria 7940295
1535 2912763343 2912757875 Bacteria 7940295
1536 2919469434 2919468124 Bacteria 9133025
1537 2919474601 2919468124 Bacteria 9133025
1538 2922554524 2922554459 Bacteria 6683962
1539 2935393325 2935390628 Bacteria 7043367
1540 2935393988 2935390628 Bacteria 7043367
1541 2946049917 2946045630 Bacteria 8527308
1542 2946051092 2946045630 Bacteria 8527308
1543 2946067851 2946064051 Bacteria 8957905
1544 2946075993 2946072368 Bacteria 8999607
1545 2947229143 2947224130 Bacteria 9938529
1546 2954007278 2954002825 Bacteria 9173742
1547 2954386130 2954380949 Bacteria 10050426
1548 2954387442 2954380949 Bacteria 10050426
1549 2954675729 2954673503 Bacteria 9685905
1550 2954677020 2954673503 Bacteria 9685905
1551 2954687137 2954682443 Bacteria 9862841
1552 2954688535 2954682443 Bacteria 9862841
1553 2954696768 2954691527 Bacteria 10720516
1554 2954698275 2954691527 Bacteria 10720516
1555 2954703953 2954701450 Bacteria 10834262
1556 2954705370 2954701450 Bacteria 10834262
1557 2954716147 2954711539 Bacteria 10867210
1558 2954717295 2954711539 Bacteria 10867210
1559 2954726089 2954721474 Bacteria 10456478
1560 2954727263 2954721474 Bacteria 10456478
1561 2954734529 2954731030 Bacteria 10243860
1562 2954735720 2954731030 Bacteria 10243860
1563 2954745015 2954740390 Bacteria 10229294
1564 2954746169 2954740390 Bacteria 10229294
1565 2954753426 2954749733 Bacteria 10366972
1566 2954754576 2954749733 Bacteria 10366972
1567 2954765136 2954759201 Bacteria 9358192
1568 2966601738 2966598605 Bacteria 7676064
1569 2966603485 2966598605 Bacteria 7676064
1570 2974319762 2974315732 Bacteria 4602776
1571 2974319871 2974315732 Bacteria 4602776
1572 2984523632 2984523437 Bacteria 4508481
1573 2984523743 2984523437 Bacteria 4508481
1574 2990063184 2990059506 Bacteria 9321252
1575 2990094361 2990088156 Bacteria 6657676
1576 2997454595 2997451912 Bacteria 8492419
1577 2997456344 2997451912 Bacteria 8492419
1578 2997457758 2997451912 Bacteria 8492419
1579 2997600338 2997600082 Bacteria 9896405
1580 2997602213 2997600082 Bacteria 9896405
1581 3006322020 3006321560 Bacteria 8247479
1582 3006325800 3006321560 Bacteria 8247479
1583 3006397744 3006393351 Bacteria 6615579
1584 3006428784 3006425503 Bacteria 6491253
1585 3006487174 3006486233 Bacteria 8157040
1586 3006488570 3006486233 Bacteria 8157040
1587 3006500843 3006493962 Bacteria 8825450
1588 637880386 637000116 Bacteria 5433628
1589 637881003 637000116 Bacteria 5433628
1590 8002784270 8002784119 Bacteria 9788632
1591 8008488608 8008485437 Bacteria 7198341
1592 8008567185 8008558824 Bacteria 10610750
1593 8016736793 8016733728 Bacteria 5274317
1594 8019502026 8019499862 Bacteria 5169538
1595 8023629830 8023623736 Bacteria 8593882
1596 8025416196 8025413630 Bacteria 7014048
1597 8025417844 8025413630 Bacteria 7014048
1598 8025527384 8025524527 Bacteria 7197316
1599 8025536296 8025530807 Bacteria 8495698
1600 8025537924 8025530807 Bacteria 8495698
1601 8033687693 8033684223 Bacteria 6906479
1602 8033687854 8033684223 Bacteria 6906479
1603 8047897777 8047893842 Bacteria 11723082
1604 8047898028 8047893842 Bacteria 11723082
1605 8048137028 8048127548 Bacteria 11053136
1606 8048137315 8048127548 Bacteria 11053136
1607 8048360865 8048356638 Bacteria 11044339
1608 8048361094 8048356638 Bacteria 11044339
1609 8048374763 8048369669 Bacteria 11666822
1610 8048374991 8048369669 Bacteria 11666822
1611 8048383215 8048379754 Bacteria 11877923
1612 8048383459 8048379754 Bacteria 11877923
1613 8048414378 8048406513 Bacteria 8936924
1614 8053953348 8053945823 Bacteria 8962862
1615 8054164964 8054160619 Bacteria 7783213
1616 8054920669 8054913762 Bacteria 7713009
1617 8054921219 8054920844 Bacteria 7068637
1618 8054922918 8054920844 Bacteria 7068637
1619 8055161885 8055157932 Bacteria 6429399
1620 8056449060 8056447290 Bacteria 7680491
1621 8056449461 8056447290 Bacteria 7680491
1622 8056667300 8056667051 Bacteria 6953971
1623 Ga0495668_0015615
1624 JGI24752J21851_1005213
1625 JGI24746J21847_1005494
1626 JGI24739J22299_10044486
1627 JGI24739J22299_10090812
1628 JGI24739J22299_10114870
1629 JGI24737J22298_10023636
1630 JGI24737J22298_10046267
1631 JGI24735J21928_10059706
1632 JGI24735J21928_10143698
1633 JGI24745J21846_1000821
1634 Ga0006759J45824_1047778
1635 rootH1_10025025
1636 rootH1_10074601
1637 Ga0007409J51694_1031317
1638 Ga0006562J51391_1008428
1639 Ga0006562J51391_1014226
1640 Ga0006562J51391_1044851
1641 Ga0006562J51391_1091491
1642 Ga0058692_1045055
1643 Ga0058859_10021593
1644 Ga0058859_10041615
1645 Ga0058859_11618699
1646 Ga0058863_11804279
1647 Ga0070658_10108910
1648 Ga0070658_10164490
1649 Ga0070658_10209982
1650 Ga0070658_10320719
1651 Ga0070676_10097261
1652 Ga0070676_10275126
1653 Ga0070683_100004077
1654 Ga0070683_100039853
1655 Ga0070683_100238239
1656 Ga0070670_100025437
1657 Ga0070670_100042397
1658 Ga0070670_100425012
1659 Ga0070670_100717527
1660 Ga0068869_100009447
1661 Ga0068869_100220134
1662 Ga0068869_100312165
1663 Ga0068869_100426183
1664 Ga0070680_100299428
1665 Ga0070682_100485276
1666 Ga0068868_100036882
1667 Ga0068868_100786394
1668 Ga0070660_100060224
1669 Ga0070660_100187998
1670 Ga0070689_100163911
1671 Ga0070689_100279056
1672 Ga0070689_100793755
1673 Ga0070687_100182323
1674 Ga0070661_100096295
1675 Ga0070661_100134054
1676 Ga0070661_100244640
1677 Ga0070692_10041463
1678 Ga0070692_10156052
1679 Ga0070668_100028230
1680 Ga0070668_100114491
1681 Ga0070668_100690360
1682 Ga0070675_100000719
1683 Ga0070675_100006141
1684 Ga0070675_100040915
1685 Ga0070671_100143027
1686 Ga0070673_100323075
1687 Ga0070688_100012654
1688 Ga0070688_100151271
1689 Ga0070659_100001482
1690 Ga0070659_100029976
1691 Ga0070659_100032308
1692 Ga0070659_100056655
1693 Ga0070667_100000001
1694 Ga0070667_100023936
1695 Ga0070667_100447906
1696 Ga0070714_100416707
1697 Ga0070714_100419550
1698 Ga0070713_100395040
1699 Ga0070713_100793527
1700 Ga0070710_10171816
1701 Ga0070701_10322939
1702 Ga0070701_10508305
1703 Ga0070705_100639553
1704 Ga0070700_100023661
1705 Ga0070700_100091360
1706 Ga0070700_100392198
1707 Ga0070694_100373559
1708 Ga0070663_100074365
1709 Ga0070663_100074371
1710 Ga0070678_100042450
1711 Ga0070662_100073021
1712 Ga0070662_100284692
1713 Ga0070681_10683678
1714 Ga0068867_100227300
1715 Ga0068867_100629740
1716 Ga0070685_10029284
1717 Ga0070685_10122874
1718 Ga0070679_100357165
1719 Ga0070684_100004354
1720 Ga0070684_100135079
1721 Ga0070684_100323000
1722 Ga0070697_100965581
1723 Ga0068853_100095551
1724 Ga0068853_100363013
1725 Ga0068853_100663552
1726 Ga0070672_100304539
1727 Ga0070686_100380929
1728 Ga0070695_100478951
1729 Ga0070696_101143822
1730 Ga0070693_100180935
1731 Ga0070693_100391747
1732 Ga0070665_100097682
1733 Ga0068855_100465629
1734 Ga0068855_100710501
1735 Ga0068855_101015936
1736 Ga0070664_100000534
1737 Ga0070664_100251217
1738 Ga0068857_100006062
1739 Ga0068857_100052065
1740 Ga0068854_100024968
1741 Ga0068854_100067079
1742 Ga0068856_101157982
1743 Ga0070702_100012334
1744 Ga0070702_100070267
1745 Ga0070702_100419494
1746 Ga0068852_100073756
1747 Ga0068852_100083527
1748 Ga0068852_100139131
1749 Ga0068859_100040519
1750 Ga0068864_100295816
1751 Ga0068866_10162112
1752 Ga0068861_100131217
1753 Ga0068861_100273477
1754 Ga0068851_10013396
1755 Ga0068851_10149827
1756 Ga0068870_10121332
1757 Ga0068870_10237029
1758 Ga0068863_100055152
1759 Ga0068863_100074641
1760 Ga0068863_100429971
1761 Ga0068858_100054214
1762 Ga0068858_100092010
1763 Ga0068858_100251581
1764 Ga0068860_100007310
1765 Ga0068860_100185974
1766 Ga0068860_100446110
1767 Ga0068860_100447221
1768 Ga0068860_100534679
1769 Ga0068862_100014723
1770 Ga0068862_100049913
1771 Ga0068862_100790066
1772 Ga0081455_10050807
1773 Ga0081538_10134967
1774 Ga0081539_10171865
1775 Ga0070717_10092228
1776 Ga0070717_10247870
1777 Ga0070717_10446260
1778 Ga0075368_10015973
1779 Ga0075363_100092462
1780 Ga0075363_100239621
1781 Ga0075363_100330950
1782 Ga0075364_10032423
1783 Ga0070712_100226183
1784 Ga0075367_10000490
1785 Ga0075367_10017087
1786 Ga0075367_10125484
1787 Ga0097621_100379607
1788 Ga0075370_10046876
1789 Ga0075370_10108447
1790 Ga0075428_100443722
1791 Ga0075428_100734220
1792 Ga0075434_100389255
1793 Ga0075429_100516378
1794 Ga0068865_100032754
1795 Ga0068865_100114841
1796 Ga0068865_100466860
1797 Ga0097620_100040519
1798 Ga0099826_10104463
1799 Ga0105251_10028973
1800 Ga0105244_10003455
1801 Ga0105250_10057176
1802 Ga0105250_10075385
1803 Ga0105250_10271568
1804 Ga0105240_10920876
1805 Ga0105240_11296943
1806 Ga0111539_10004342
1807 Ga0111539_10013384
1808 Ga0111539_10069210
1809 Ga0111539_10088870
1810 Ga0111539_10433183
1811 Ga0111539_10671421
1812 Ga0105245_10015155
1813 Ga0105245_10022160
1814 Ga0105245_10034887
1815 Ga0105245_10229187
1816 Ga0105247_10024812
1817 Ga0105247_10396426
1818 Ga0105243_10070234
1819 Ga0105243_10104325
1820 Ga0105243_10230613
1821 Ga0105243_10482648
1822 Ga0105243_11512363
1823 Ga0105241_10050846
1824 Ga0105241_10296336
1825 Ga0105242_10258670
1826 Ga0105248_10008353
1827 Ga0105248_10093427
1828 Ga0105248_10800258
1829 Ga0105237_10000576
1830 Ga0105237_10191132
1831 Ga0105237_10200555
1832 Ga0105237_10427372
1833 Ga0105237_11256746
1834 Ga0105238_10052401
1835 Ga0105238_10256126
1836 Ga0105238_10258700
1837 Ga0105238_10408326
1838 Ga0105249_10060473
1839 Ga0105249_10092664
1840 Ga0105249_10866031
1841 Ga0105249_11226414
1842 Ga0105239_10050099
1843 Ga0105239_10067731
1844 Ga0105239_10167438
1845 Ga0105239_10194965
1846 Ga0105239_10289384
1847 Ga0105239_10294156
1848 Ga0105246_10230734
1849 Ga0157320_1005893
1850 Ga0157371_10275398
1851 Ga0157369_10269515
1852 Ga0157374_10137124
1853 Ga0157374_10245735
1854 Ga0157378_11551392
1855 Ga0163162_10073356
1856 Ga0163162_10914871
1857 Ga0163162_11460991
1858 Ga0157375_10393236
1859 Ga0157375_11102236
1860 Ga0163163_10008177
1861 Ga0163163_10226676
1862 Ga0157380_10561381
1863 Ga0182008_10002234
1864 Ga0182008_10019441
1865 Ga0157377_10004764
1866 Ga0157377_10065456
1867 Ga0157379_10646569
1868 Ga0157376_10545126
1869 Ga0182006_1012503
1870 Ga0182006_1040844
1871 Ga0182007_10000387
1872 Ga0182007_10003980
1873 Ga0182005_1072386
1874 Ga0183367_1004
1875 Ga0183367_1005
1876 Ga0163161_10049917
1877 Ga0163161_10232522
1878 Ga0197907_10231912
1879 Ga0206356_10376454
1880 Ga0206355_1074018
1881 Ga0206351_10938024
1882 Ga0206352_11133304
1883 Ga0206350_11440865
1884 Ga0206353_10188020
1885 Ga0206353_10403514
1886 Ga0206353_11635929
1887 Ga0213876_10064421
1888 Ga0224712_10058894
1889 Ga0224712_10064246
1890 Ga0224712_10215603
1891 Ga0209758_1015614
1892 Ga0207426_1002736
1893 Ga0207426_1007974
1894 Ga0207656_10041306
1895 Ga0207656_10185522
1896 Ga0207696_1033948
1897 Ga0207696_1051805
1898 Ga0207655_1003689
1899 Ga0207713_1017299
1900 Ga0207642_10216108
1901 Ga0207710_10000120
1902 Ga0207710_10000308
1903 Ga0207710_10060580
1904 Ga0207688_10019306
1905 Ga0207688_10053686
1906 Ga0207680_10151134
1907 Ga0207680_10262205
1908 Ga0207647_10048107
1909 Ga0207647_10061435
1910 Ga0207647_10239537
1911 Ga0207645_10026666
1912 Ga0207645_10104189
1913 Ga0207643_10002797
1914 Ga0207643_10016810
1915 Ga0207643_10161969
1916 Ga0207643_10282278
1917 Ga0207705_10112456
1918 Ga0207705_10113257
1919 Ga0207705_10529815
1920 Ga0207654_10084989
1921 Ga0207695_10220111
1922 Ga0207671_10000532
1923 Ga0207693_10130426
1924 Ga0207663_10235680
1925 Ga0207660_10376801
1926 Ga0207662_10009099
1927 Ga0207662_10033911
1928 Ga0207657_10023477
1929 Ga0207657_10276173
1930 Ga0207649_10039626
1931 Ga0207649_10062430
1932 Ga0207652_10945645
1933 Ga0207681_10055732
1934 Ga0207681_10243707
1935 Ga0207694_10088011
1936 Ga0207694_10096799
1937 Ga0207694_10111386
1938 Ga0207650_10012412
1939 Ga0207650_10312036
1940 Ga0207650_10681983
1941 Ga0207659_10006589
1942 Ga0207659_10010145
1943 Ga0207687_10065829
1944 Ga0207687_10107737
1945 Ga0207687_10163037
1946 Ga0207687_10213642
1947 Ga0207700_10090938
1948 Ga0207700_10695935
1949 Ga0207664_10397059
1950 Ga0207664_10479639
1951 Ga0207664_10515910
1952 Ga0207644_10125643
1953 Ga0207690_10187122
1954 Ga0207706_10010700
1955 Ga0207706_10021431
1956 Ga0207706_10048412
1957 Ga0207706_10128176
1958 Ga0207709_10040905
1959 Ga0207709_10245860
1960 Ga0207709_10881203
1961 Ga0207691_10037306
1962 Ga0207691_10191403
1963 Ga0207689_10011188
1964 Ga0207689_10014176
1965 Ga0207689_10015806
1966 Ga0207689_10444260
1967 Ga0207661_10021123
1968 Ga0207661_10025750
1969 Ga0207661_10170850
1970 Ga0207661_10516332
1971 Ga0207679_10024199
1972 Ga0207679_10118473
1973 Ga0207679_10171161
1974 Ga0207667_10978561
1975 Ga0207651_10035692
1976 Ga0207651_10039106
1977 Ga0207712_10078177
1978 Ga0207712_10128748
1979 Ga0207712_10239927
1980 Ga0207668_10023431
1981 Ga0207668_10126172
1982 Ga0207640_10470533
1983 Ga0207658_10000003
1984 Ga0207658_10014793
1985 Ga0207658_10130588
1986 Ga0207677_10013586
1987 Ga0207677_10057563
1988 Ga0207703_10070001
1989 Ga0207639_10306144
1990 Ga0207639_10368840
1991 Ga0207678_10002575
1992 Ga0207678_10083442
1993 Ga0207708_10003567
1994 Ga0207708_10010752
1995 Ga0207708_10016331
1996 Ga0207708_10153060
1997 Ga0207702_10133291
1998 Ga0207702_11015102
1999 Ga0207641_10417387
2000 Ga0207641_10589385
2001 Ga0207648_10026949
2002 Ga0207648_10028595
2003 Ga0207674_10006377
2004 Ga0207674_10025030
2005 Ga0207675_100002346
2006 Ga0207675_100036464
2007 Ga0207675_100159174
2008 Ga0207683_10240630
2009 Ga0207683_11008032
2010 Ga0207698_10017898
2011 Ga0207698_10039859
2012 Ga0207698_10790698
2013 Ga0209371_1023958
2014 Ga0209813_10008250
2015 Ga0207428_10094405
2016 Ga0207428_10436313
2017 Ga0268266_10026696
2018 Ga0268266_10612224
2019 Ga0268265_10962461
2020 Ga0268264_10118484
2021 Ga0268264_10153517
2022 Ga0268264_10168067
2023 Ga0268264_10193809
2024 Ga0307517_10001523
2025 Ga0307517_10002113
2026 Ga0307517_10002268
2027 Ga0307517_10003190
2028 Ga0307515_10005593
2029 Ga0307515_10030929
2030 Ga0307515_10166506
2031 Ga0307515_10237050
2032 Ga0268256_1022483
2033 Ga0268256_1027206
2034 Ga0307511_10000262
2035 Ga0307511_10052075
2036 Ga0307511_10067295
2037 Ga0307511_10071760
2038 Ga0307511_10161841
2039 Ga0307511_10170822
2040 Ga0307511_10240991
2041 Ga0307512_10004180
2042 Ga0307512_10036987
2043 Ga0307512_10056898
2044 Ga0307512_10076977
2045 Ga0307512_10156139
2046 Ga0265327_10001096
2047 Ga0265327_10013988
2048 Ga0307513_10000135
2049 Ga0307513_10003690
2050 Ga0307513_10013382
2051 Ga0307513_10094928
2052 Ga0307513_10099815
2053 Ga0307513_10169256
2054 Ga0307513_10213079
2055 Ga0307509_10078021
2056 Ga0307509_10120765
2057 Ga0307408_100220714
2058 Ga0307408_100562600
2059 Ga0307508_10002945
2060 Ga0307508_10003098
2061 Ga0307508_10003146
2062 Ga0307508_10008636
2063 Ga0307508_10028997
2064 Ga0307508_10044489
2065 Ga0307508_10059525
2066 Ga0307508_10090924
2067 Ga0307508_10120891
2068 Ga0307508_10235900
2069 Ga0307508_10428645
2070 Ga0307514_10005889
2071 Ga0307514_10039469
2072 Ga0307514_10078640
2073 Ga0307514_10172953
2074 Ga0307514_10215647
2075 Ga0307516_10034805
2076 Ga0307516_10068674
2077 Ga0307516_10102412
2078 Ga0307516_10110456
2079 Ga0307516_10382657
2080 Ga0307516_10456645
2081 Ga0307413_10004008
2082 Ga0307413_10008993
2083 Ga0307413_10178883
2084 Ga0307413_10219042
2085 Ga0307413_10422565
2086 Ga0307413_10463870
2087 Ga0307413_10529441
2088 Ga0307407_10708366
2089 Ga0307407_10868333
2090 Ga0307409_100099917
2091 Ga0307409_100298276
2092 Ga0307409_100580366
2093 Ga0307409_100683338
2094 Ga0307409_100747990
2095 Ga0307409_101469561
2096 Ga0307416_100133444
2097 Ga0307416_100330535
2098 Ga0307416_100387339
2099 Ga0307416_100621617
2100 Ga0307416_102072700
2101 Ga0307411_10024481
2102 Ga0307411_10234445
2103 Ga0307415_100013814
2104 Ga0307415_100215679
2105 Ga0307415_100347063
2106 Ga0307507_10004394
2107 Ga0307507_10017950
2108 Ga0307507_10019844
2109 Ga0307507_10060005
2110 Ga0307507_10096125
2111 Ga0307507_10097007
2112 Ga0307507_10143892
2113 Ga0307507_10163188
2114 Ga0307510_10005436
2115 Ga0307510_10135431
2116 Ga0307510_10212189
2117 Ga0373940_0204944
2118 Ga0373951_0090995
2119 Ga0373952_0096951
2120 Ga0373962_0148504
2121 Ga0395898_0006424
2122 Ga0395898_0007866
2123 Ga0395898_0157778
2124 Ga0395898_0828079
2125 Ga0395901_0090147
2126 Ga0436365_0241176
2127 Ga0436365_0402914
2128 Ga0439436_0000208
2129 Ga0439439_0003117
2130 Ga0451793_0500026
2131 Ga0451800_1554937
2132 Ga0451802_0326665
2133 Ga0451802_0444163
2134 Ga0451807_2266131
2135 Ga0451807_2446817
2136 Ga0451833_0081940
2137 Ga0451833_0163126
2138 Ga0451835_0504647
2139 Ga0451837_0073117
2140 Ga0451837_1411785
2141 Ga0451837_1594594
2142 Ga0451841_0766413
2143 Ga0451853_0494340
2144 Ga0451853_3237062
2145 Ga0451853_3883896
2146 Ga0451853_3940744
2147 Ga0439442_037360
2148 Ga0439448_0001704
2149 Ga0439449_0021758
2150 Ga0439455_0001757
2151 Ga0439455_0004112
2152 Ga0439457_006866
2153 Ga0439462_0023614
2154 Ga0450894_000035
2155 Ga0450898_004052
2156 Ga0450899_001604
2157 Ga0450900_008358
2158 Ga0450900_041855
2159 Ga0450903_000067
2160 Ga0450903_000495
2161 Ga0450906_063339
2162 Ga0439458_0001440
2163 Ga0439458_0001566
2164 Ga0450908_004084
2165 Ga0450901_020493
2166 Ga0439440_0088535
2167 Ga0466969_0006677
2168 Ga0466969_0017088
2169 Ga0466969_0159346
2170 Ga0466972_0009190
2171 Ga0466972_0013383
2172 Ga0466972_0064413
2173 Ga0466972_0093850
2174 Ga0466965_0000073
2175 Ga0466965_0000929
2176 Ga0466965_0002548
2177 Ga0466965_0030028
2178 Ga0466965_0154330
2179 Ga0466965_0470787
2180 Ga0466966_0000262
2181 Ga0466966_0026502
2182 Ga0466966_0026733
2183 Ga0466966_0148370
2184 Ga0466961_0000470
2185 Ga0466961_0000547
2186 Ga0466961_0017484
2187 Ga0466963_0000176
2188 Ga0466963_0000687
2189 Ga0466963_0001134
2190 Ga0466963_0050797
2191 Ga0466963_0361077
2192 Ga0466971_0000306
2193 Ga0466971_0001670
2194 Ga0466971_0033992
2195 Ga0466970_0000912
2196 Ga0466970_0001062
2197 Ga0466970_0056328
2198 Ga0466970_0060210
2199 Ga0466957_0000275
2200 Ga0466957_0000941
2201 Ga0466957_0108803
2202 Ga0466960_0087262
2203 Ga0466960_0096258
2204 Ga0466959_0000453
2205 Ga0466959_0003708
2206 Ga0466959_0021356
2207 Ga0466959_0023745
2208 Ga0466959_0102580
2209 Ga0466958_0010897
2210 Ga0466958_0138796
2211 Ga0466967_0001117
2212 Ga0466967_0011426
2213 Ga0466967_0153120
2214 Ga0466967_0413873
2215 Ga0466967_0443363
2216 Ga0466967_0629863
2217 Ga0466967_1015040
2218 Ga0495617_006202
2219 Ga0495617_015849
2220 Ga0495627_033660
2221 Ga0495627_065245
2222 Ga0495627_135945
2223 Ga0495592_0003306
2224 Ga0495592_0012362
2225 Ga0495592_0018473
2226 Ga0495592_0020976
2227 Ga0495592_0023524
2228 Ga0495592_0023546
2229 Ga0495603_0001393
2230 Ga0495603_0002486
2231 Ga0495603_0004164
2232 Ga0495603_0007598
2233 Ga0495603_0020679
2234 Ga0495603_0079972
2235 Ga0495603_0185122
2236 Ga0495603_0306866
2237 Ga0495590_0083700
2238 Ga0495591_000094
2239 Ga0495629_0000848
2240 Ga0495629_0004603
2241 Ga0495629_0008832
2242 Ga0495629_0018308
2243 Ga0495629_0024194
2244 Ga0495629_0035598
2245 Ga0495629_0061605
2246 Ga0495629_0075577
2247 Ga0495629_0077458
2248 Ga0495629_0091455
2249 Ga0495629_0096109
2250 Ga0495629_0187477
2251 Ga0495629_0213488
2252 Ga0495629_0377855
2253 Ga0495629_0584798
2254 Ga0495638_0005393
2255 Ga0495638_0032165
2256 Ga0495638_0082670
2257 Ga0495638_0143053
2258 Ga0495638_0177710
2259 Ga0495638_0245901
2260 Ga0495638_0350028
2261 Ga0495641_0023508
2262 Ga0495641_0092306
2263 Ga0495641_0293485
2264 Ga0495651_0006989
2265 Ga0495651_0026835
2266 Ga0495651_0031705
2267 Ga0495651_0036030
2268 Ga0495651_0055044
2269 Ga0495651_0089808
2270 Ga0495653_0190683
2271 Ga0495653_0376492
2272 Ga0495653_0643107
2273 Ga0495650_0047454
2274 Ga0495580_0193994
2275 Ga0495582_0073060
2276 Ga0495605_0006539
2277 Ga0495605_0007673
2278 Ga0495605_0011338
2279 Ga0495605_0140595
2280 Ga0495639_0033239
2281 Ga0495639_0057705
2282 Ga0495662_0001904
2283 Ga0495662_0004334
2284 Ga0495662_0009848
2285 Ga0495662_0236982
2286 Ga0495664_0002699
2287 Ga0495664_0002878
2288 Ga0495664_0012354
2289 Ga0495664_0131730
2290 Ga0495584_0022909
2291 Ga0495584_0105762
2292 Ga0495585_0013453
2293 Ga0495585_0021887
2294 Ga0495585_0051822
2295 Ga0495585_0066101
2296 Ga0495585_0072244
2297 Ga0495585_0160445
2298 Ga0495585_0324310
2299 Ga0495594_0000685
2300 Ga0495594_0009010
2301 Ga0495594_0019831
2302 Ga0495594_0021450
2303 Ga0495594_0024609
2304 Ga0495594_0028394
2305 Ga0495594_0041613
2306 Ga0495594_0051326
2307 Ga0495594_0086635
2308 Ga0495594_0100840
2309 Ga0495594_0303456
2310 Ga0495596_0018401
2311 Ga0495607_0032514
2312 Ga0495607_0047259
2313 Ga0495607_0061691
2314 Ga0495607_0080436
2315 Ga0495607_0143306
2316 Ga0495583_0012823
2317 Ga0495606_0005155
2318 Ga0495608_0015458
2319 Ga0495608_0110793
2320 Ga0495610_0070010
2321 Ga0495610_0109593
2322 Ga0495610_0186969
2323 Ga0495616_0012817
2324 Ga0495616_0020515
2325 Ga0495618_0014678
2326 Ga0495618_0064186
2327 Ga0495618_0152149
2328 Ga0495628_0012816
2329 Ga0495628_0281649
2330 Ga0495628_0339778
2331 Ga0495628_0374533
2332 Ga0495630_0010329
2333 Ga0495630_0020817
2334 Ga0495630_0789217
2335 Ga0495631_0005055
2336 Ga0495631_0030365
2337 Ga0495631_0063541
2338 Ga0495631_0067129
2339 Ga0495631_0085277
2340 Ga0495631_0118783
2341 Ga0495631_0272754
2342 Ga0495632_0014087
2343 Ga0495632_0022741
2344 Ga0495632_0024406
2345 Ga0495637_0067739
2346 Ga0495637_0122094
2347 Ga0495643_0001406
2348 Ga0495643_0002959
2349 Ga0495643_0004427
2350 Ga0495643_0006201
2351 Ga0495643_0035252
2352 Ga0495643_0287500
2353 Ga0495648_0117119
2354 Ga0495666_0005365
2355 Ga0495666_0111637
2356 Ga0495666_0254626
2357 Ga0495642_0191625
2358 Ga0495652_0012215
2359 Ga0495652_0020004
2360 Ga0495652_0057775
2361 Ga0495652_0073727
2362 Ga0495652_0332055
2363 Ga0495652_0624092
2364 Ga0495654_0000078
2365 Ga0495654_0138917
2366 Ga0495665_0003250
2367 Ga0495665_0028375
2368 Ga0495640_0003633
2369 Ga0495640_0007170
2370 Ga0495640_0027497
2371 Ga0495640_0033607
2372 Ga0495640_0287746
2373 Ga0495640_0323714
2374 Ga0495586_0033260
2375 Ga0495586_0035300
2376 Ga0495586_0040799
2377 Ga0495586_0225053
2378 Ga0495586_0369410
2379 Ga0495587_0004546
2380 Ga0495587_0004564
2381 Ga0495609_0039995
2382 Ga0495609_0143967
2383 Ga0495609_0201960
2384 Ga0495597_0062253
2385 Ga0495597_0100882
2386 Ga0495597_0221749
2387 Ga0495645_0024234
2388 Ga0495645_0047897
2389 Ga0495645_0228970
2390 Ga0495645_0542259
2391 Ga0495622_0005269
2392 Ga0495622_0022335
2393 Ga0495622_0026426
2394 Ga0495622_0041241
2395 Ga0495622_0095241
2396 Ga0495633_0015500
2397 Ga0495633_0031251
2398 Ga0495633_0052475
2399 Ga0495633_0052876
2400 Ga0495667_0005230
2401 Ga0495667_0016398
2402 Ga0495667_0131055
2403 Ga0495667_0428472
2404 Ga0495656_0287706
2405 Ga0495656_0450761
2406 Ga0495668_0013506
2407 Ga0495668_0013638
2408 Ga0495634_0004463
2409 Ga0495634_0005757
2410 Ga0495634_0010876
2411 Ga0495634_0018134
2412 Ga0495634_0021238
2413 Ga0495634_0041495
2414 Ga0495611_0023752
2415 Ga0495611_0028349
2416 Ga0495611_0039483
2417 Ga0495611_0098150
2418 Ga0495611_0137105
2419 Ga0495611_0174145
2420 Ga0495625_0003493
2421 Ga0495625_0024565
2422 Ga0495625_0093688
2423 Ga0495625_0285921
2424 Ga0495635_0000563
2425 Ga0495635_0004814
2426 Ga0495635_0017936
2427 Ga0495635_0041417
2428 Ga0495635_0052822
2429 Ga0495661_0113224
2430 Ga0495661_0114750
2431 Ga0495661_0149516
2432 Ga0495661_0161329
2433 Ga0495661_0292751
2434 Ga0495661_0311454
2435 Ga0495588_0000658
2436 Ga0495588_0001875
2437 Ga0495588_0002372
2438 Ga0495588_0018282
2439 Ga0495588_0045741
2440 Ga0495588_0054253
2441 Ga0495588_0097651
2442 Ga0495588_0098358
2443 Ga0495588_0100175
2444 Ga0495657_0008155
2445 Ga0495657_0009984
2446 Ga0495657_0013312
2447 Ga0495657_0014725
2448 Ga0495657_0019044
2449 Ga0495657_0026186
2450 Ga0495657_0039076
2451 Ga0495657_0072723
2452 Ga0495657_0110445
2453 Ga0495599_0002776
2454 Ga0495623_0017347
2455 Ga0495623_0085582
2456 Ga0495623_0106086
2457 Ga0495623_0299311
2458 Ga0495646_0000882
2459 Ga0495646_0041737
2460 Ga0495646_0348723
2461 Ga0495658_0035415
2462 Ga0495658_0178902
2463 Ga0495658_0367951
2464 Ga0495613_0000689
2465 Ga0495613_0000944
2466 Ga0495613_0002789
2467 Ga0495613_0003382
2468 Ga0495613_0010157
2469 Ga0495613_0012065
2470 Ga0495613_0012228
2471 Ga0495613_0029046
2472 Ga0495613_0035158
2473 Ga0495613_0036070
2474 Ga0495613_0146061
2475 Ga0495624_0010572
2476 Ga0495624_0092674
2477 Ga0495670_0001089
2478 Ga0495670_0005543
2479 Ga0495670_0019309
2480 Ga0495670_0047582
2481 Ga0495670_0372477
2482 Ga0495671_0015738
2483 Ga0495671_0020734
2484 Ga0495671_0077926
2485 Ga0495671_0372002
2486 Ga0495649_0011409
2487 Ga0495649_0257898
2488 Ga0495589_0004951
2489 Ga0495589_0010017
2490 Ga0495589_0131309
2491 Ga0495589_0208108
2492 Ga0495589_0212191
2493 Ga0495600_0011193
2494 Ga0495600_0023168
2495 Ga0495600_0039428
2496 Ga0495600_0048000
2497 Ga0495600_0067624
2498 Ga0495600_0068092
2499 Ga0495600_0075333
2500 Ga0495600_0223029
2501 Ga0495600_0524975
2502 Ga0495600_0627222
2503 Ga0495660_0032243
2504 Ga0495660_0075529
2505 Ga0495660_0078646
2506 Ga0495581_0004731
2507 Ga0495581_0046724
2508 Ga0495581_0079416
2509 Ga0495581_0107931
2510 Ga0495581_0159590
2511 Ga0495581_0223767
2512 Ga0495604_0000177
2513 Ga0495604_0003367
2514 Ga0495604_0004088
2515 Ga0495604_0019851
2516 Ga0495604_0039597
2517 Ga0495604_0071034
2518 Ga0495604_0076542
2519 Ga0495636_0040070
2520 Ga0495636_0040514
2521 Ga0495674_0034278
2522 Ga0495674_0202244
2523 Ga0495674_0426141
2524 Ga0495676_0001703
2525 Ga0495676_0002684
2526 Ga0495676_0003140
2527 Ga0495676_0010228
2528 Ga0495676_0017921
2529 Ga0495676_0018690
2530 Ga0495676_0022031
2531 Ga0495676_0023083
2532 Ga0495676_0034376
2533 Ga0495676_0195827
2534 Ga0495676_0211980
2535 Ga0495680_0009283
2536 Ga0495680_0172222
2537 Ga0495683_0013015
2538 Ga0495683_0052642
2539 Ga0495683_0202465
2540 Ga0495687_001373
2541 Ga0495687_003246
2542 Ga0495687_005687
2543 Ga0495687_017551
2544 Ga0495687_077168
2545 Ga0495687_078302
2546 Ga0495687_080675
2547 Ga0495687_126129
2548 Ga0495675_0002820
2549 Ga0495675_0018072
2550 Ga0495675_0020811
2551 Ga0495675_0029988
2552 Ga0495675_0136786
2553 Ga0495675_0183725
2554 Ga0495675_0296879
2555 Ga0495675_0351702
2556 Ga0495675_0420466
2557 Ga0495677_0078679
2558 Ga0495679_030402
2559 Ga0495685_000162
2560 Ga0495685_000439
2561 Ga0495685_000967
2562 Ga0495685_002093
2563 Ga0495685_007237
2564 Ga0495685_029355
2565 Ga0495685_094687
2566 Ga0495685_104305
2567 Ga0495685_185862
2568 Ga0495681_0000410
2569 Ga0495681_0001965
2570 Ga0495681_0004423
2571 Ga0495681_0010645
2572 Ga0495681_0025985
2573 Ga0495681_0043283
2574 Ga0495684_0025204
2575 Ga0495684_0078490
2576 Ga0495684_0258499
2577 Ga0495684_0562852
2578 Ga0495686_0008060
2579 Ga0495686_0017780
2580 Ga0495686_0027431
2581 Ga0495686_0145293
2582 Ga0495686_0309832
2583 Ga0495593_0001603
2584 Ga0495593_0002856
2585 Ga0495593_0050415
2586 Ga0495602_0016479
2587 Ga0495602_0065869
2588 Ga0495602_0118111
2589 Ga0495602_0456700
2590 Ga0495614_0000918
2591 Ga0495614_0004063
2592 Ga0495614_0007730
2593 Ga0495614_0046084
2594 Ga0495614_0150998
2595 Ga0495626_0009504
2596 Ga0496100_0724208
2597 Ga0496101_0169241
2598 Ga0496101_0592341
2599 Ga0496102_0055630
2600 Ga0496102_0102413
2601 Ga0496103_0033755
2602 Ga0496104_0186281
2603 Ga0496104_0403489
2604 Ga0496105_0267987
2605 Ga0496106_0001704
2606 Ga0496106_0488473
2607 Ga0496107_0390521
2608 Ga0496108_0049234
2609 Ga0496109_0001113
2610 Ga0496109_0023882
2611 Ga0496109_0051561
2612 Ga0496109_0121053
2613 Ga0496109_0231947
2614 Ga0496109_0326546
2615 Ga0496110_0054541
2616 Ga0496110_0066541
2617 Ga0496112_0171137
2618 Ga0496113_0187461
2619 Ga0496113_0500702
2620 Ga0496113_0656493
2621 Ga0496114_0127717
2622 Ga0496115_0503837
2623 Ga0496118_0080260
2624 Ga0496119_0117243
2625 Ga0496120_0000365
2626 Ga0496121_0000705
2627 Ga0496121_0006724
2628 Ga0496122_0005418
2629 Ga0496123_0040721
2630 Ga0496126_0096293
2631 Ga0501306_037732
2632 Ga0501306_055935
2633 Ga0501310_039625
2634 Ga0501304_016441
2635 Ga0501305_054025
2636 Ga0495678_024008
2637 Ga0495678_029142
2638 Ga0495682_0017031
2639 Ga0495682_0034481
2640 Ga0501291_044619
2641 Ga0501311_052374
2642 Ga0501314_026889
2643 Ga0501315_043164
2644 Ga0501316_048241
2645 Ga0501318_027489
2646 Ga0501318_032778
2647 Ga0501318_049895
2648 Ga0501321_025524
2649 Ga0501321_037579
2650 Ga0501323_016978
2651 Ga0501031_0001023
2652 Ga0501031_0001503
2653 Ga0501031_0001677
2654 Ga0501031_0005943
2655 Ga0501031_0028629
2656 Ga0501031_0155120
2657 Ga0501031_0163683
2658 Ga0501032_0000915
2659 Ga0501032_0005078
2660 Ga0501032_0007555
2661 Ga0501032_0008981
2662 Ga0501032_0015456
2663 Ga0501032_0033624
2664 Ga0501032_0087497
2665 Ga0501032_0338718
2666 Ga0501032_0397429
2667 Ga0501033_0001038
2668 Ga0501033_0007204
2669 Ga0501033_0009061
2670 Ga0501033_0022971
2671 Ga0501033_0052450
2672 Ga0501033_0070118
2673 Ga0501033_0167251
2674 Ga0501033_0168504
2675 Ga0501033_0180650
2676 Ga0501033_0281625
2677 Ga0501033_0295927
2678 Ga0501033_0314083
2679 Ga0501034_0002021
2680 Ga0501034_0006741
2681 Ga0501034_0009862
2682 Ga0501034_0011799
2683 Ga0501034_0013420
2684 Ga0501034_0018411
2685 Ga0501034_0020012
2686 Ga0501034_0040703
2687 Ga0501034_0042572
2688 Ga0501034_0074676
2689 Ga0501034_0547857
2690 Ga0501034_1149076
2691 Ga0501036_0001728
2692 Ga0501036_0003039
2693 Ga0501036_0003195
2694 Ga0501036_0012967
2695 Ga0501036_0017577
2696 Ga0501036_0024372
2697 Ga0501036_0078096
2698 Ga0501036_0111691
2699 Ga0501036_0241662
2700 Ga0501036_0377315
2701 Ga0501037_0000823
2702 Ga0501037_0001454
2703 Ga0501037_0011852
2704 Ga0501037_0015772
2705 Ga0501037_0026992
2706 Ga0501037_0041411
2707 Ga0501037_0094396
2708 Ga0501037_0107518
2709 Ga0501037_0170421
2710 Ga0501037_0224601
2711 Ga0501037_0550748
2712 Ga0501038_0000988
2713 Ga0501038_0003374
2714 Ga0501038_0006805
2715 Ga0501038_0011419
2716 Ga0501038_0018256
2717 Ga0501038_0033410
2718 Ga0501038_0034992
2719 Ga0501038_0166360
2720 Ga0501038_0169347
2721 Ga0501038_0262537
2722 Ga0501038_0354338
2723 Ga0501038_0680462
2724 Ga0501039_0004713
2725 Ga0501039_0030437
2726 Ga0501039_0048652
2727 Ga0501039_0052460
2728 Ga0501039_0062998
2729 Ga0501039_0085215
2730 Ga0501039_0270591
2731 Ga0501039_0364588
2732 Ga0501040_0010344
2733 Ga0501040_0020613
2734 Ga0501040_0027254
2735 Ga0501041_0001251
2736 Ga0501041_0001328
2737 Ga0501041_0028682
2738 Ga0501042_0008300
2739 Ga0501042_0012241
2740 Ga0501042_0013832
2741 Ga0501042_0023191
2742 Ga0501042_0055951
2743 Ga0501042_0057857
2744 Ga0501042_0901765
2745 Ga0501043_0000870
2746 Ga0501043_0000941
2747 Ga0501043_0009251
2748 Ga0501043_0015452
2749 Ga0501043_0016524
2750 Ga0501043_0016576
2751 Ga0501043_0023105
2752 Ga0501043_0048623
2753 Ga0501043_0060231
2754 Ga0501043_0069846
2755 Ga0501043_0147684
2756 Ga0501043_0172312
2757 Ga0501043_0178393
2758 Ga0501046_0008006
2759 Ga0501046_0014862
2760 Ga0501046_0019657
2761 Ga0501046_0026133
2762 Ga0501046_0029767
2763 Ga0501046_0040251
2764 Ga0501046_0082510
2765 Ga0501046_0137267
2766 Ga0501047_0000056
2767 Ga0501047_0000075
2768 Ga0501047_0000280
2769 Ga0501047_0000778
2770 Ga0501047_0012542
2771 Ga0501047_0014223
2772 Ga0501047_0018440
2773 Ga0501047_0019492
2774 Ga0501047_0034389
2775 Ga0501047_0039577
2776 Ga0501047_0042679
2777 Ga0501047_0044183
2778 Ga0501047_0064798
2779 Ga0501047_0070452
2780 Ga0501047_0077462
2781 Ga0501047_0197648
2782 Ga0501047_0259630
2783 Ga0501047_0698611
2784 Ga0501047_0755527
2785 Ga0501048_0003653
2786 Ga0501048_0004349
2787 Ga0501048_0009856
2788 Ga0501048_0019118
2789 Ga0501048_0025962
2790 Ga0501048_0054156
2791 Ga0501048_0312177
2792 Ga0501067_0000777
2793 Ga0501067_0001336
2794 Ga0501067_0002496
2795 Ga0501068_0000625
2796 Ga0501068_0001060
2797 Ga0501068_0001907
2798 Ga0501069_0007297
2799 Ga0501069_0108348
2800 Ga0501070_0002871
2801 Ga0501070_0039350
2802 Ga0501070_0045144
2803 Ga0501070_0058402
2804 Ga0501070_0060963
2805 Ga0501070_0083801
2806 Ga0501070_0479562
2807 Ga0501070_0546971
2808 Ga0501071_0001568
2809 Ga0501071_0001769
2810 Ga0501071_0002013
2811 Ga0501071_0414083
2812 Ga0501072_0000945
2813 Ga0501072_0002882
2814 Ga0501073_0012792
2815 Ga0501073_0016315
2816 Ga0501073_0033930
2817 Ga0501073_0270782
2818 Ga0501074_0002531
2819 Ga0501074_0005345
2820 Ga0501074_0030555
2821 Ga0501074_0144448
2822 Ga0501074_0452429
2823 Ga0501075_0354392
2824 Ga0501076_0031304
2825 Ga0501076_0042982
2826 Ga0501076_0305030
2827 Ga0501077_0017810
2828 Ga0501077_0024007
2829 Ga0501077_0064793
2830 Ga0501235_027790
2831 Ga0501257_064466
2832 Ga0501079_0024430
2833 Ga0501079_0036399
2834 Ga0501080_0033549
2835 Ga0501080_0058977
2836 Ga0501080_0131477
2837 Ga0501080_0301538
2838 Ga0501080_0990165
2839 Ga0501083_0003122
2840 Ga0501083_0019932
2841 Ga0501083_0043858
2842 Ga0501083_0230932
2843 Ga0501035_0001147
2844 Ga0501035_0004811
2845 Ga0501035_0009561
2846 Ga0501035_0010897
2847 Ga0501035_0011412
2848 Ga0501035_0012695
2849 Ga0501035_0020699
2850 Ga0501035_0024019
2851 Ga0501035_0029703
2852 Ga0501035_0038641
2853 Ga0501035_0039002
2854 Ga0501035_0039258
2855 Ga0501035_0146248
2856 Ga0501035_0155730
2857 Ga0501035_0214567
2858 Ga0501035_0626144
2859 Ga0501035_1161759
2860 Ga0501044_0002369
2861 Ga0501044_0003629
2862 Ga0501044_0005864
2863 Ga0501044_0009001
2864 Ga0501044_0012223
2865 Ga0501044_0016619
2866 Ga0501044_0022810
2867 Ga0501044_0033562
2868 Ga0501044_0050034
2869 Ga0501044_0050626
2870 Ga0501044_0054717
2871 Ga0501044_0080129
2872 Ga0501044_0099562
2873 Ga0501044_0126185
2874 Ga0501044_0126805
2875 Ga0501044_0248080
2876 Ga0501044_0262391
2877 Ga0501044_0270165
2878 Ga0501044_0338723
2879 Ga0501044_0348867
2880 Ga0501044_0507657
2881 Ga0501044_0933111
2882 Ga0501045_0023726
2883 Ga0501045_0031069
2884 Ga0501045_0057544
2885 Ga0501045_0213018
2886 Ga0501045_0262205
2887 nmdc:mga03n38_13687_c1
2888 nmdc:mga03n38_159079_c1
2889 nmdc:mga03n38_78328_c1
2890 nmdc:mga00v17_26724_c2
2891 nmdc:mga00v17_41102_c1
2892 nmdc:mga00v17_517641_c1
2893 nmdc:mga06z11_162486_c1
2894 nmdc:mga06z11_903_c1
2895 nmdc:mga04h51_9676_c1
2896 nmdc:mga07m45_101330_c1
2897 nmdc:mga07m45_151869_c1
2898 nmdc:mga07m45_259062_c1
2899 nmdc:mga09592_846225_c1
2900 nmdc:mga08y16_154699_c1
2901 nmdc:mga08y16_32291_c1
2902 nmdc:mga08y16_435128_c1
2903 nmdc:mga08y16_628517_c1
2904 nmdc:mga08y16_911139_c1
2905 nmdc:mga08y16_9548_c1
2906 nmdc:mga0n895_852226_c1
2907 nmdc:mga0sz30_334606_c1
2908 Ga0495601_0003963
2909 Ga0495612_0174188
2910 Ga0500610_0036313
2911 Ga0500610_0046147
2912 Ga0500610_0158688
2913 Ga0495655_0023071
2914 Ga0495655_0050485
2915 Ga0495655_0157483
2916 Ga0495619_0155993
2917 Ga0500578_0012302
2918 Ga0500578_0160956
2919 Ga0500643_000132
2920 Ga0500644_0116020
2921 Ga0500646_0013621
2922 Ga0500583_0096220
2923 Ga0500583_0273240
2924 Ga0500566_0012307
2925 Ga0500640_021639
2926 Ga0500640_095604
2927 Ga0500641_0154828
2928 Ga0500650_0336738
2929 Ga0500654_050515
2930 Ga0500654_079864
2931 Ga0500660_027388
2932 Ga0500660_129093
2933 Ga0500553_054950
2934 Ga0500553_138559
2935 Ga0500560_000196
2936 Ga0500560_019942
2937 Ga0500569_000083
2938 Ga0500569_002256
2939 Ga0500569_068123
2940 Ga0500572_099043
2941 Ga0500608_124280
2942 Ga0500621_056764
2943 Ga0500621_089446
2944 Ga0500628_000379
2945 Ga0500628_003563
2946 Ga0500628_008605
2947 Ga0500652_000875
2948 Ga0500652_015462
2949 Ga0500652_016648
2950 Ga0500658_0002463
2951 Ga0500658_0004327
2952 Ga0500658_0007089
2953 Ga0500658_0069850
2954 Ga0500559_0180921
2955 Ga0500561_0002687
2956 Ga0500561_0008072
2957 Ga0500561_0011160
2958 Ga0500573_0017433
2959 Ga0500573_0081381
2960 Ga0500573_0358265
2961 Ga0500577_0079106
2962 Ga0500577_0081351
2963 Ga0500579_010911
2964 Ga0500579_030592
2965 Ga0500579_082473
2966 Ga0500600_0003115
2967 Ga0500600_0152721
2968 Ga0500600_0204768
2969 Ga0500604_0003384
2970 Ga0500616_0000145
2971 Ga0500616_0006393
2972 Ga0500616_0010512
2973 Ga0500616_0052292
2974 Ga0500624_023600
2975 Ga0500633_0000640
2976 Ga0500633_0000723
2977 Ga0500633_0001014
2978 Ga0500633_0010752
2979 Ga0500634_0000287
2980 Ga0500634_0017507
2981 Ga0500634_0037432
2982 Ga0500634_0194028
2983 Ga0500636_0337546
2984 Ga0500656_003712
2985 Ga0500656_004175
2986 Ga0500587_001407
2987 Ga0500587_003016
2988 Ga0501084_0014939
2989 Ga0501084_0026942
2990 Ga0501084_0031626
2991 Ga0501084_0699657
2992 Ga0587084_043046
2993 Ga0587093_043081
2994 Ga0587070_058899
2995 Ga0587073_0081313
2996 Ga0587073_0084121
2997 Ga0587077_148079
2998 Ga0587080_026546
2999 Ga0587083_0071547
3000 Ga0587083_0135654
3001 Ga0587085_072290
3002 Ga0587090_040640
3003 Ga0587092_068206
3004 Ga0587094_063842
3005 Ga0587098_030565
3006 Ga0587106_012723
3007 Ga0587125_013920
3008 Ga0587129_011418
3009 Ga0587113_019802
3010 Ga0587117_046494
3011 Ga0587122_019578
3012 Ga0587128_047102
3013 Ga0587130_014414
3014 Ga0587068_038661
3015 Ga0587072_066147
3016 Ga0587105_012109
3017 Ga0587108_015879
3018 Ga0501082_0000551
3019 Ga0501082_0000557
3020 Ga0501082_0012099
3021 Ga0466962_0001438
3022 Ga0466962_0005196
3023 Ga0466962_0011051
3024 Ga0530510_0030131
3025 Ga0530510_0062745
3026 Ga0530510_0096285
3027 2506867086
3028 2506868377
3029 2511379317
3030 2511436184
3031 2517759554
3032 2528204509
3033 2528212247
3034 2528214879
3035 2546949598
3036 2546949905
3037 2547408202
3038 2554257745
3039 2566991888
3040 2579749036
3041 2579750471
3042 2579856205
3043 2585299239
3044 2585301009
3045 2585308409
3046 2585308894
3047 2585313220
3048 2585313581
3049 2616693265
3050 2616694985
3051 2616899728
3052 2616904567
3053 2619858352
3054 2620349335
3055 2626639187
3056 2643759568
3057 2643765046
3058 2643897640
3059 2643899118
3060 2644017107
3061 2644173932
3062 2644262385
3063 2644268871
3064 2644403301
3065 2644408786
3066 2644437238
3067 2644443503
3068 2644461115
3069 2644463016
3070 2644517112
3071 2644518023
3072 2644628976
3073 2671833853
3074 2671840183
3075 2686536089
3076 2686539087
3077 2686541086
3078 2686542395
3079 2689990328
3080 2689995649
3081 2710602650
3082 2710602827
3083 2731908354
3084 2738869875
3085 2738891744
3086 2739206807
3087 2739365746
3088 2753034848
3089 2753323365
3090 2774852009
3091 2774858339
3092 2774865521
3093 2774865832
3094 2774902759
3095 2774903956
3096 2784588663
3097 2785343189
3098 2785368267
3099 2785369606
3100 2786669266
3101 2786670696
3102 2793982908
3103 2793985453
3104 2804844676
3105 2804846886
3106 2808842139
3107 2808846030
3108 2808846928
3109 2808919499
3110 2808920662
3111 2809232273
3112 2811847941
3113 2811849145
3114 2812357992
3115 2812480436
3116 2816510538
3117 2819693857
3118 2819695499
3119 2819743032
3120 2842892384
3121 2852636559
3122 2852637548
3123 2857485168
3124 2862178684
3125 2862179382
3126 2862182690
3127 2862285752
3128 2862294800
3129 2862295876
3130 2862392604
3131 2862511716
3132 2862579163
3133 2862582616
3134 2863404502
3135 2867371980
3136 2867429517
3137 2867430039
3138 2867431763
3139 2867480820
3140 2873155638
3141 2875393591
3142 2875395623
3143 2876602800
3144 2877676859
3145 2877681022
3146 2877682310
3147 2895887849
3148 2895889504
3149 2904540420
3150 2912716400
3151 2912717754
3152 2912719850
3153 2912725231
3154 2912727018
3155 2912758338
3156 2912760878
3157 2912763343
3158 2919469434
3159 2919474601
3160 2922554524
3161 2935393325
3162 2935393988
3163 2946049917
3164 2946051092
3165 2946067851
3166 2946075993
3167 2947229143
3168 2954007278
3169 2954386130
3170 2954387442
3171 2954675729
3172 2954677020
3173 2954687137
3174 2954688535
3175 2954696768
3176 2954698275
3177 2954703953
3178 2954705370
3179 2954716147
3180 2954717295
3181 2954726089
3182 2954727263
3183 2954734529
3184 2954735720
3185 2954745015
3186 2954746169
3187 2954753426
3188 2954754576
3189 2954765136
3190 2966601738
3191 2966603485
3192 2974319762
3193 2974319871
3194 2984523632
3195 2984523743
3196 2990063184
3197 2990094361
3198 2997454595
3199 2997456344
3200 2997457758
3201 2997600338
3202 2997602213
3203 3006322020
3204 3006325800
3205 3006397744
3206 3006428784
3207 3006487174
3208 3006488570
3209 3006500843
3210 637880386
3211 637881003
3212 8002784270
3213 8008488608
3214 8008567185
3215 8016736793
3216 8019502026
3217 8023629830
3218 8025416196
3219 8025417844
3220 8025527384
3221 8025536296
3222 8025537924
3223 8033687693
3224 8033687854
3225 8047897777
3226 8047898028
3227 8048137028
3228 8048137315
3229 8048360865
3230 8048361094
3231 8048374763
3232 8048374991
3233 8048383215
3234 8048383459
3235 8048414378
3236 8053953348
3237 8054164964
3238 8054920669
3239 8054921219
3240 8054922918
3241 8055161885
3242 8056449060
3243 8056449461
3244 8056667300

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02342

TerD

TerD domain

1

182

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ibz-assembly1.cif.gz_A crystal structure of putative tellurium resistant like protein (terd) from streptomyces coelicolor a3(2) 0.9212 19 191
3ibz-assembly1.cif.gz_A crystal structure of putative tellurium resistant like protein (terd) from streptomyces coelicolor a3(2) 0.8967 19 191
2kxv-assembly1.cif.gz_A nmr structure and calcium-binding properties of the tellurite resistance protein terd from klebsiella pneumoniae 0.8595 19 191
2kxv-assembly1.cif.gz_A nmr structure and calcium-binding properties of the tellurite resistance protein terd from klebsiella pneumoniae 0.8506 19 191
2qz7-assembly2.cif.gz_B the crystal structure of a homologue of telluride resistance protein (terd), sco6318 from streptomyces coelicolor a3(2) 0.8208 19 184
ID Description Score Start End Superfamily
af_P19198_159_328_2.60.60.30 Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains 0.9658 20 184 2.60.60.30
af_P19198_159_328_2.60.60.30 Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains 0.9326 20 184 2.60.60.30
3ibzA01 Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains 0.9158 19 185 2.60.60.30
3ibzA01 Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains 0.9055 19 185 2.60.60.30
2qz7B01 Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains 0.8187 19 184 2.60.60.30
ID Description Score Start End GO Terms
AF-A0A0A8ERG0-F1-model_v4 Putative TerD-family protein 0.9895 1 191
AF-A0A7Y9LIH7-F1-model_v4 deleted 0.9894 1 191
AF-A0A499V918-F1-model_v4 Chemical-damaging agent resistance protein C 0.9864 1 191
AF-A0A0B8NLU3-F1-model_v4 Tellurium resistance protein 0.9852 1 191
AF-A0A0A8ERG0-F1-model_v4 Putative TerD-family protein 0.9844 1 191

Map