F495100
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1625 | 636 | 3244 | 190 |
Family's Representative Sequence
| Representative Sequence | 3300046616|Ga0495668_0015615|Ga0495668_0015615_2273_2848 |
| Length | 186 |
| Sequence | MGVSLTKGGNVSLTKEAPNLTAVVVGLGWDARSTTGAAFDLDASAIGAGSNKKVLSDQHFIFFNNLRSPDGSIEHKGDNTDGEEQIDVNLAAVPAEIESVVFPVSIYDAEARSQSFGQVRNAYIRVVDKANGNELARYDLSEDASTETAMVFGELYRNGAEWKFRAIGQGYASGLAGIARDYGVNV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 8 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 12 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 13 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 14 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 92 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 129 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 134 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 199 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 200 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 202 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 203 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 204 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 205 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 206 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 207 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 208 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 209 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 210 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 211 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 212 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 213 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 214 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 215 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 216 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 217 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 218 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 221 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 222 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 223 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 224 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 225 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 226 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 227 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 232 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 233 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 234 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 235 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 236 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 237 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 238 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 239 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 240 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 241 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 242 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 243 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 244 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 245 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 246 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 247 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 248 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 249 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 250 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 251 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 252 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 253 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 254 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 255 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 256 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 257 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 258 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 259 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 260 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 261 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 262 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 263 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 264 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 265 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 357 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 358 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 359 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 360 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 361 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 362 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 365 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 366 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 367 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 368 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 369 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 370 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 371 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 372 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 373 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 374 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 375 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 376 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 383 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 417 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 418 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 425 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 426 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 427 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 428 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 429 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 433 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 436 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 439 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 440 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 441 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 442 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 443 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 444 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 445 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 446 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 447 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 448 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 449 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 450 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 451 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 452 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 453 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 454 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 455 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 456 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 457 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 458 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 459 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 460 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 461 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 462 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 463 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 464 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 465 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 466 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 467 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 468 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 469 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 470 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 471 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 472 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 475 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 476 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 481 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 482 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 483 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 484 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 485 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 486 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 487 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 488 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 489 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 490 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 491 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 492 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 493 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 494 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 495 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 496 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 497 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 498 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 499 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 500 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 501 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 502 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 503 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 504 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 505 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 506 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 507 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 508 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 509 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 510 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 511 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 512 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 513 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 514 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 515 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 516 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 517 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 518 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 519 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 520 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 521 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 522 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 523 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 524 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 525 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 526 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 527 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 528 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 529 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 530 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 531 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 532 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 533 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 534 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 535 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 536 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 537 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 538 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 539 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 540 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 541 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 542 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 543 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 544 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 545 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 546 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 547 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 548 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 549 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 550 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 551 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 552 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 553 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 554 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 555 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 556 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 557 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 558 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 559 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 560 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 561 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 562 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 563 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 564 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 565 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 566 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 567 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 568 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 569 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 570 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 571 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 572 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 573 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 574 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 575 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 576 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 577 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 578 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 579 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 580 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 581 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 582 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 583 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 584 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 585 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 586 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 587 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 588 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 589 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 590 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 591 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 592 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 593 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 594 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 595 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 596 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 597 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 598 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 599 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 600 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 601 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 602 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 603 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 604 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 605 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 606 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 607 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 608 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 609 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 610 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 611 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 612 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 613 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 614 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 615 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 616 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 617 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 618 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 619 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 620 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 621 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 622 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 623 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 624 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 625 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 626 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 627 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 628 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 629 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 630 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 631 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 632 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 633 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 634 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
| 635 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 636 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.71 |
| Metatranscriptomes | 3.88 |
| Isolates | 13.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0 |
| Endosphere | 6.22 |
| Nodule | 2.22 |
| Rhizoplane | 2.28 |
| Rhizosphere | 78.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495668_0015615 | 3300046616 | Bacteria | 4430 |
| 2 | JGI24752J21851_1005213 | 3300001976 | Bacteria | 1701 |
| 3 | JGI24746J21847_1005494 | 3300001977 | Bacteria | 1977 |
| 4 | JGI24739J22299_10044486 | 3300001989 | Bacteria | 1462 |
| 5 | JGI24739J22299_10090812 | 3300001989 | Bacteria | 930 |
| 6 | JGI24739J22299_10114870 | 3300001989 | Bacteria | 806 |
| 7 | JGI24737J22298_10023636 | 3300001990 | Bacteria | 1948 |
| 8 | JGI24737J22298_10046267 | 3300001990 | Bacteria | 1328 |
| 9 | JGI24735J21928_10059706 | 3300002067 | Bacteria | 1096 |
| 10 | JGI24735J21928_10143698 | 3300002067 | Bacteria | 688 |
| 11 | JGI24745J21846_1000821 | 3300002073 | Bacteria | 2863 |
| 12 | Ga0006759J45824_1047778 | 3300003163 | Bacteria | 751 |
| 13 | rootH1_10025025 | 3300003323 | Bacteria | 3268 |
| 14 | rootH1_10074601 | 3300003323 | Bacteria | 3717 |
| 15 | Ga0007409J51694_1031317 | 3300003575 | Bacteria | 666 |
| 16 | Ga0006562J51391_1008428 | 3300003578 | Bacteria | 1412 |
| 17 | Ga0006562J51391_1014226 | 3300003578 | Bacteria | 750 |
| 18 | Ga0006562J51391_1044851 | 3300003578 | Bacteria | 931 |
| 19 | Ga0006562J51391_1091491 | 3300003578 | Bacteria | 3460 |
| 20 | Ga0058692_1045055 | 3300003856 | Bacteria | 754 |
| 21 | Ga0058859_10021593 | 3300004798 | Bacteria | 618 |
| 22 | Ga0058859_10041615 | 3300004798 | Bacteria | 787 |
| 23 | Ga0058859_11618699 | 3300004798 | Bacteria | 812 |
| 24 | Ga0058863_11804279 | 3300004799 | Bacteria | 1499 |
| 25 | Ga0070658_10108910 | 3300005327 | Bacteria | 2293 |
| 26 | Ga0070658_10164490 | 3300005327 | Bacteria | 1862 |
| 27 | Ga0070658_10209982 | 3300005327 | Bacteria | 1644 |
| 28 | Ga0070658_10320719 | 3300005327 | Bacteria | 1323 |
| 29 | Ga0070676_10097261 | 3300005328 | Bacteria | 1813 |
| 30 | Ga0070676_10275126 | 3300005328 | Bacteria | 1132 |
| 31 | Ga0070683_100004077 | 3300005329 | Bacteria | 11974 |
| 32 | Ga0070683_100039853 | 3300005329 | Bacteria | 4315 |
| 33 | Ga0070683_100238239 | 3300005329 | Bacteria | 1730 |
| 34 | Ga0070670_100025437 | 3300005331 | Bacteria | 5094 |
| 35 | Ga0070670_100042397 | 3300005331 | Bacteria | 3912 |
| 36 | Ga0070670_100425012 | 3300005331 | Bacteria | 1175 |
| 37 | Ga0070670_100717527 | 3300005331 | Bacteria | 900 |
| 38 | Ga0068869_100009447 | 3300005334 | Bacteria | 6329 |
| 39 | Ga0068869_100220134 | 3300005334 | Bacteria | 1504 |
| 40 | Ga0068869_100312165 | 3300005334 | Bacteria | 1273 |
| 41 | Ga0068869_100426183 | 3300005334 | Bacteria | 1095 |
| 42 | Ga0070680_100299428 | 3300005336 | Bacteria | 1364 |
| 43 | Ga0070682_100485276 | 3300005337 | Bacteria | 954 |
| 44 | Ga0068868_100036882 | 3300005338 | Bacteria | 3787 |
| 45 | Ga0068868_100786394 | 3300005338 | Bacteria | 857 |
| 46 | Ga0070660_100060224 | 3300005339 | Bacteria | 2946 |
| 47 | Ga0070660_100187998 | 3300005339 | Bacteria | 1672 |
| 48 | Ga0070689_100163911 | 3300005340 | Bacteria | 1798 |
| 49 | Ga0070689_100279056 | 3300005340 | Bacteria | 1385 |
| 50 | Ga0070689_100793755 | 3300005340 | Bacteria | 832 |
| 51 | Ga0070687_100182323 | 3300005343 | Bacteria | 1258 |
| 52 | Ga0070661_100096295 | 3300005344 | Bacteria | 2196 |
| 53 | Ga0070661_100134054 | 3300005344 | Bacteria | 1862 |
| 54 | Ga0070661_100244640 | 3300005344 | Bacteria | 1382 |
| 55 | Ga0070692_10041463 | 3300005345 | Bacteria | 2359 |
| 56 | Ga0070692_10156052 | 3300005345 | Bacteria | 1304 |
| 57 | Ga0070668_100028230 | 3300005347 | Bacteria | 4260 |
| 58 | Ga0070668_100114491 | 3300005347 | Bacteria | 2149 |
| 59 | Ga0070668_100690360 | 3300005347 | Bacteria | 899 |
| 60 | Ga0070675_100000719 | 3300005354 | Bacteria | 23032 |
| 61 | Ga0070675_100006141 | 3300005354 | Bacteria | 9209 |
| 62 | Ga0070675_100040915 | 3300005354 | Bacteria | 3785 |
| 63 | Ga0070671_100143027 | 3300005355 | Bacteria | 2019 |
| 64 | Ga0070673_100323075 | 3300005364 | Bacteria | 1364 |
| 65 | Ga0070688_100012654 | 3300005365 | Bacteria | 4733 |
| 66 | Ga0070688_100151271 | 3300005365 | Bacteria | 1587 |
| 67 | Ga0070659_100001482 | 3300005366 | Bacteria | 16896 |
| 68 | Ga0070659_100029976 | 3300005366 | Bacteria | 4207 |
| 69 | Ga0070659_100032308 | 3300005366 | Bacteria | 4058 |
| 70 | Ga0070659_100056655 | 3300005366 | Bacteria | 3090 |
| 71 | Ga0070667_100000001 | 3300005367 | Bacteria | 1108638 |
| 72 | Ga0070667_100023936 | 3300005367 | Bacteria | 5071 |
| 73 | Ga0070667_100447906 | 3300005367 | Bacteria | 1180 |
| 74 | Ga0070714_100416707 | 3300005435 | Bacteria | 1272 |
| 75 | Ga0070714_100419550 | 3300005435 | Bacteria | 1267 |
| 76 | Ga0070713_100395040 | 3300005436 | Bacteria | 1290 |
| 77 | Ga0070713_100793527 | 3300005436 | Bacteria | 907 |
| 78 | Ga0070710_10171816 | 3300005437 | Bacteria | 1351 |
| 79 | Ga0070701_10322939 | 3300005438 | Bacteria | 956 |
| 80 | Ga0070701_10508305 | 3300005438 | Bacteria | 783 |
| 81 | Ga0070705_100639553 | 3300005440 | Bacteria | 828 |
| 82 | Ga0070700_100023661 | 3300005441 | Bacteria | 3595 |
| 83 | Ga0070700_100091360 | 3300005441 | Bacteria | 1987 |
| 84 | Ga0070700_100392198 | 3300005441 | Bacteria | 1041 |
| 85 | Ga0070694_100373559 | 3300005444 | Bacteria | 1110 |
| 86 | Ga0070663_100074365 | 3300005455 | Bacteria | 2481 |
| 87 | Ga0070663_100074371 | 3300005455 | Bacteria | 2481 |
| 88 | Ga0070678_100042450 | 3300005456 | Bacteria | 3232 |
| 89 | Ga0070662_100073021 | 3300005457 | Bacteria | 2534 |
| 90 | Ga0070662_100284692 | 3300005457 | Bacteria | 1338 |
| 91 | Ga0070681_10683678 | 3300005458 | Bacteria | 942 |
| 92 | Ga0068867_100227300 | 3300005459 | Bacteria | 1507 |
| 93 | Ga0068867_100629740 | 3300005459 | Bacteria | 939 |
| 94 | Ga0070685_10029284 | 3300005466 | Bacteria | 3058 |
| 95 | Ga0070685_10122874 | 3300005466 | Bacteria | 1614 |
| 96 | Ga0070679_100357165 | 3300005530 | Bacteria | 1409 |
| 97 | Ga0070684_100004354 | 3300005535 | Bacteria | 10760 |
| 98 | Ga0070684_100135079 | 3300005535 | Bacteria | 2227 |
| 99 | Ga0070684_100323000 | 3300005535 | Bacteria | 1418 |
| 100 | Ga0070697_100965581 | 3300005536 | Bacteria | 757 |
| 101 | Ga0068853_100095551 | 3300005539 | Bacteria | 2621 |
| 102 | Ga0068853_100363013 | 3300005539 | Bacteria | 1349 |
| 103 | Ga0068853_100663552 | 3300005539 | Bacteria | 993 |
| 104 | Ga0070672_100304539 | 3300005543 | Bacteria | 1351 |
| 105 | Ga0070686_100380929 | 3300005544 | Bacteria | 1068 |
| 106 | Ga0070695_100478951 | 3300005545 | Bacteria | 959 |
| 107 | Ga0070696_101143822 | 3300005546 | Bacteria | 656 |
| 108 | Ga0070693_100180935 | 3300005547 | Bacteria | 1357 |
| 109 | Ga0070693_100391747 | 3300005547 | Bacteria | 961 |
| 110 | Ga0070665_100097682 | 3300005548 | Bacteria | 2941 |
| 111 | Ga0068855_100465629 | 3300005563 | Bacteria | 1378 |
| 112 | Ga0068855_100710501 | 3300005563 | Bacteria | 1075 |
| 113 | Ga0068855_101015936 | 3300005563 | Bacteria | 870 |
| 114 | Ga0070664_100000534 | 3300005564 | Bacteria | 29002 |
| 115 | Ga0070664_100251217 | 3300005564 | Bacteria | 1590 |
| 116 | Ga0068857_100006062 | 3300005577 | Bacteria | 10327 |
| 117 | Ga0068857_100052065 | 3300005577 | Bacteria | 3633 |
| 118 | Ga0068854_100024968 | 3300005578 | Bacteria | 4099 |
| 119 | Ga0068854_100067079 | 3300005578 | Bacteria | 2613 |
| 120 | Ga0068856_101157982 | 3300005614 | Bacteria | 790 |
| 121 | Ga0070702_100012334 | 3300005615 | Bacteria | 4278 |
| 122 | Ga0070702_100070267 | 3300005615 | Bacteria | 2066 |
| 123 | Ga0070702_100419494 | 3300005615 | Bacteria | 962 |
| 124 | Ga0068852_100073756 | 3300005616 | Bacteria | 3003 |
| 125 | Ga0068852_100083527 | 3300005616 | Bacteria | 2840 |
| 126 | Ga0068852_100139131 | 3300005616 | Bacteria | 2245 |
| 127 | Ga0068859_100040519 | 3300005617 | Bacteria | 4675 |
| 128 | Ga0068864_100295816 | 3300005618 | Bacteria | 1514 |
| 129 | Ga0068866_10162112 | 3300005718 | Bacteria | 1305 |
| 130 | Ga0068861_100131217 | 3300005719 | Bacteria | 2034 |
| 131 | Ga0068861_100273477 | 3300005719 | Bacteria | 1451 |
| 132 | Ga0068851_10013396 | 3300005834 | Bacteria | 3881 |
| 133 | Ga0068851_10149827 | 3300005834 | Bacteria | 1274 |
| 134 | Ga0068870_10121332 | 3300005840 | Bacteria | 1506 |
| 135 | Ga0068870_10237029 | 3300005840 | Bacteria | 1124 |
| 136 | Ga0068863_100055152 | 3300005841 | Bacteria | 3764 |
| 137 | Ga0068863_100074641 | 3300005841 | Bacteria | 3208 |
| 138 | Ga0068863_100429971 | 3300005841 | Bacteria | 1294 |
| 139 | Ga0068858_100054214 | 3300005842 | Bacteria | 3708 |
| 140 | Ga0068858_100092010 | 3300005842 | Bacteria | 2823 |
| 141 | Ga0068858_100251581 | 3300005842 | Bacteria | 1678 |
| 142 | Ga0068860_100007310 | 3300005843 | Bacteria | 11043 |
| 143 | Ga0068860_100185974 | 3300005843 | Bacteria | 2009 |
| 144 | Ga0068860_100446110 | 3300005843 | Bacteria | 1286 |
| 145 | Ga0068860_100447221 | 3300005843 | Bacteria | 1284 |
| 146 | Ga0068860_100534679 | 3300005843 | Bacteria | 1173 |
| 147 | Ga0068862_100014723 | 3300005844 | Bacteria | 6495 |
| 148 | Ga0068862_100049913 | 3300005844 | Bacteria | 3575 |
| 149 | Ga0068862_100790066 | 3300005844 | Bacteria | 926 |
| 150 | Ga0081455_10050807 | 3300005937 | Bacteria | 3561 |
| 151 | Ga0081538_10134967 | 3300005981 | Bacteria | 1151 |
| 152 | Ga0081539_10171865 | 3300005985 | Bacteria | 1024 |
| 153 | Ga0070717_10092228 | 3300006028 | Bacteria | 2559 |
| 154 | Ga0070717_10247870 | 3300006028 | Bacteria | 1573 |
| 155 | Ga0070717_10446260 | 3300006028 | Bacteria | 1166 |
| 156 | Ga0075368_10015973 | 3300006042 | Bacteria | 2791 |
| 157 | Ga0075363_100092462 | 3300006048 | Bacteria | 1666 |
| 158 | Ga0075363_100239621 | 3300006048 | Bacteria | 1042 |
| 159 | Ga0075363_100330950 | 3300006048 | Bacteria | 887 |
| 160 | Ga0075364_10032423 | 3300006051 | Bacteria | 3358 |
| 161 | Ga0070712_100226183 | 3300006175 | Bacteria | 1483 |
| 162 | Ga0075367_10000490 | 3300006178 | Bacteria | 14834 |
| 163 | Ga0075367_10017087 | 3300006178 | Bacteria | 3976 |
| 164 | Ga0075367_10125484 | 3300006178 | Bacteria | 1584 |
| 165 | Ga0097621_100379607 | 3300006237 | Bacteria | 1262 |
| 166 | Ga0075370_10046876 | 3300006353 | Bacteria | 2447 |
| 167 | Ga0075370_10108447 | 3300006353 | Bacteria | 1611 |
| 168 | Ga0075428_100443722 | 3300006844 | Bacteria | 1390 |
| 169 | Ga0075428_100734220 | 3300006844 | Bacteria | 1051 |
| 170 | Ga0075434_100389255 | 3300006871 | Bacteria | 1415 |
| 171 | Ga0075429_100516378 | 3300006880 | Bacteria | 1047 |
| 172 | Ga0068865_100032754 | 3300006881 | Bacteria | 3475 |
| 173 | Ga0068865_100114841 | 3300006881 | Bacteria | 1992 |
| 174 | Ga0068865_100466860 | 3300006881 | Bacteria | 1046 |
| 175 | Ga0097620_100040519 | 3300006931 | Bacteria | 4675 |
| 176 | Ga0099826_10104463 | 3300006948 | Bacteria | 1701 |
| 177 | Ga0105251_10028973 | 3300009011 | Bacteria | 2793 |
| 178 | Ga0105244_10003455 | 3300009036 | Bacteria | 11260 |
| 179 | Ga0105250_10057176 | 3300009092 | Bacteria | 1565 |
| 180 | Ga0105250_10075385 | 3300009092 | Bacteria | 1365 |
| 181 | Ga0105250_10271568 | 3300009092 | Bacteria | 728 |
| 182 | Ga0105240_10920876 | 3300009093 | Bacteria | 939 |
| 183 | Ga0105240_11296943 | 3300009093 | Bacteria | 768 |
| 184 | Ga0111539_10004342 | 3300009094 | Bacteria | 18562 |
| 185 | Ga0111539_10013384 | 3300009094 | Bacteria | 10255 |
| 186 | Ga0111539_10069210 | 3300009094 | Bacteria | 4167 |
| 187 | Ga0111539_10088870 | 3300009094 | Bacteria | 3630 |
| 188 | Ga0111539_10433183 | 3300009094 | Bacteria | 1531 |
| 189 | Ga0111539_10671421 | 3300009094 | Bacteria | 1207 |
| 190 | Ga0105245_10015155 | 3300009098 | Bacteria | 6716 |
| 191 | Ga0105245_10022160 | 3300009098 | Bacteria | 5578 |
| 192 | Ga0105245_10034887 | 3300009098 | Bacteria | 4463 |
| 193 | Ga0105245_10229187 | 3300009098 | Bacteria | 1796 |
| 194 | Ga0105247_10024812 | 3300009101 | Bacteria | 3614 |
| 195 | Ga0105247_10396426 | 3300009101 | Bacteria | 982 |
| 196 | Ga0105243_10070234 | 3300009148 | Bacteria | 2827 |
| 197 | Ga0105243_10104325 | 3300009148 | Bacteria | 2360 |
| 198 | Ga0105243_10230613 | 3300009148 | Bacteria | 1642 |
| 199 | Ga0105243_10482648 | 3300009148 | Bacteria | 1170 |
| 200 | Ga0105243_11512363 | 3300009148 | Bacteria | 695 |
| 201 | Ga0105241_10050846 | 3300009174 | Bacteria | 3159 |
| 202 | Ga0105241_10296336 | 3300009174 | Bacteria | 1386 |
| 203 | Ga0105242_10258670 | 3300009176 | Bacteria | 1572 |
| 204 | Ga0105248_10008353 | 3300009177 | Bacteria | 11374 |
| 205 | Ga0105248_10093427 | 3300009177 | Bacteria | 3387 |
| 206 | Ga0105248_10800258 | 3300009177 | Bacteria | 1064 |
| 207 | Ga0105237_10000576 | 3300009545 | Bacteria | 51366 |
| 208 | Ga0105237_10191132 | 3300009545 | Bacteria | 2047 |
| 209 | Ga0105237_10200555 | 3300009545 | Bacteria | 1995 |
| 210 | Ga0105237_10427372 | 3300009545 | Bacteria | 1330 |
| 211 | Ga0105237_11256746 | 3300009545 | Bacteria | 747 |
| 212 | Ga0105238_10052401 | 3300009551 | Bacteria | 4102 |
| 213 | Ga0105238_10256126 | 3300009551 | Bacteria | 1729 |
| 214 | Ga0105238_10258700 | 3300009551 | Bacteria | 1720 |
| 215 | Ga0105238_10408326 | 3300009551 | Bacteria | 1352 |
| 216 | Ga0105249_10060473 | 3300009553 | Bacteria | 3475 |
| 217 | Ga0105249_10092664 | 3300009553 | Bacteria | 2829 |
| 218 | Ga0105249_10866031 | 3300009553 | Bacteria | 969 |
| 219 | Ga0105249_11226414 | 3300009553 | Bacteria | 821 |
| 220 | Ga0105239_10050099 | 3300010375 | Bacteria | 4581 |
| 221 | Ga0105239_10067731 | 3300010375 | Bacteria | 3922 |
| 222 | Ga0105239_10167438 | 3300010375 | Bacteria | 2458 |
| 223 | Ga0105239_10194965 | 3300010375 | Bacteria | 2268 |
| 224 | Ga0105239_10289384 | 3300010375 | Bacteria | 1845 |
| 225 | Ga0105239_10294156 | 3300010375 | Bacteria | 1828 |
| 226 | Ga0105246_10230734 | 3300011119 | Bacteria | 1457 |
| 227 | Ga0157320_1005893 | 3300012481 | Bacteria | 832 |
| 228 | Ga0157371_10275398 | 3300013102 | Bacteria | 1215 |
| 229 | Ga0157369_10269515 | 3300013105 | Bacteria | 1774 |
| 230 | Ga0157374_10137124 | 3300013296 | Bacteria | 2373 |
| 231 | Ga0157374_10245735 | 3300013296 | Bacteria | 1760 |
| 232 | Ga0157378_11551392 | 3300013297 | Bacteria | 707 |
| 233 | Ga0163162_10073356 | 3300013306 | Bacteria | 3478 |
| 234 | Ga0163162_10914871 | 3300013306 | Bacteria | 990 |
| 235 | Ga0163162_11460991 | 3300013306 | Bacteria | 778 |
| 236 | Ga0157375_10393236 | 3300013308 | Bacteria | 1553 |
| 237 | Ga0157375_11102236 | 3300013308 | Bacteria | 929 |
| 238 | Ga0163163_10008177 | 3300014325 | Bacteria | 9279 |
| 239 | Ga0163163_10226676 | 3300014325 | Bacteria | 1918 |
| 240 | Ga0157380_10561381 | 3300014326 | Bacteria | 1122 |
| 241 | Ga0182008_10002234 | 3300014497 | Bacteria | 12242 |
| 242 | Ga0182008_10019441 | 3300014497 | Bacteria | 3505 |
| 243 | Ga0157377_10004764 | 3300014745 | Bacteria | 6286 |
| 244 | Ga0157377_10065456 | 3300014745 | Bacteria | 2088 |
| 245 | Ga0157379_10646569 | 3300014968 | Bacteria | 990 |
| 246 | Ga0157376_10545126 | 3300014969 | Bacteria | 1147 |
| 247 | Ga0182006_1012503 | 3300015261 | Bacteria | 3711 |
| 248 | Ga0182006_1040844 | 3300015261 | Bacteria | 1824 |
| 249 | Ga0182007_10000387 | 3300015262 | Bacteria | 27336 |
| 250 | Ga0182007_10003980 | 3300015262 | Bacteria | 6823 |
| 251 | Ga0182005_1072386 | 3300015265 | Bacteria | 947 |
| 252 | Ga0183367_1004 | 3300015688 | Bacteria | 716880 |
| 253 | Ga0183367_1005 | 3300015688 | Bacteria | 652063 |
| 254 | Ga0163161_10049917 | 3300017792 | Bacteria | 3026 |
| 255 | Ga0163161_10232522 | 3300017792 | Bacteria | 1431 |
| 256 | Ga0197907_10231912 | 3300020069 | Bacteria | 623 |
| 257 | Ga0206356_10376454 | 3300020070 | Bacteria | 995 |
| 258 | Ga0206355_1074018 | 3300020076 | Bacteria | 1157 |
| 259 | Ga0206351_10938024 | 3300020077 | Bacteria | 816 |
| 260 | Ga0206352_11133304 | 3300020078 | Bacteria | 828 |
| 261 | Ga0206350_11440865 | 3300020080 | Bacteria | 1267 |
| 262 | Ga0206353_10188020 | 3300020082 | Bacteria | 2063 |
| 263 | Ga0206353_10403514 | 3300020082 | Bacteria | 900 |
| 264 | Ga0206353_11635929 | 3300020082 | Bacteria | 851 |
| 265 | Ga0213876_10064421 | 3300021384 | Bacteria | 1935 |
| 266 | Ga0224712_10058894 | 3300022467 | Bacteria | 1523 |
| 267 | Ga0224712_10064246 | 3300022467 | Bacteria | 1472 |
| 268 | Ga0224712_10215603 | 3300022467 | Bacteria | 877 |
| 269 | Ga0209758_1015614 | 3300025297 | Bacteria | 3917 |
| 270 | Ga0207426_1002736 | 3300025302 | Bacteria | 10695 |
| 271 | Ga0207426_1007974 | 3300025302 | Bacteria | 4355 |
| 272 | Ga0207656_10041306 | 3300025321 | Bacteria | 1959 |
| 273 | Ga0207656_10185522 | 3300025321 | Bacteria | 1000 |
| 274 | Ga0207696_1033948 | 3300025711 | Bacteria | 1527 |
| 275 | Ga0207696_1051805 | 3300025711 | Bacteria | 1171 |
| 276 | Ga0207655_1003689 | 3300025728 | Bacteria | 11283 |
| 277 | Ga0207713_1017299 | 3300025735 | Bacteria | 3623 |
| 278 | Ga0207642_10216108 | 3300025899 | Bacteria | 1068 |
| 279 | Ga0207710_10000120 | 3300025900 | Bacteria | 96124 |
| 280 | Ga0207710_10000308 | 3300025900 | Bacteria | 38668 |
| 281 | Ga0207710_10060580 | 3300025900 | Bacteria | 1716 |
| 282 | Ga0207688_10019306 | 3300025901 | Bacteria | 3712 |
| 283 | Ga0207688_10053686 | 3300025901 | Bacteria | 2260 |
| 284 | Ga0207680_10151134 | 3300025903 | Bacteria | 1548 |
| 285 | Ga0207680_10262205 | 3300025903 | Bacteria | 1196 |
| 286 | Ga0207647_10048107 | 3300025904 | Bacteria | 2649 |
| 287 | Ga0207647_10061435 | 3300025904 | Bacteria | 2293 |
| 288 | Ga0207647_10239537 | 3300025904 | Bacteria | 1042 |
| 289 | Ga0207645_10026666 | 3300025907 | Bacteria | 3733 |
| 290 | Ga0207645_10104189 | 3300025907 | Bacteria | 1832 |
| 291 | Ga0207643_10002797 | 3300025908 | Bacteria | 9418 |
| 292 | Ga0207643_10016810 | 3300025908 | Bacteria | 3991 |
| 293 | Ga0207643_10161969 | 3300025908 | Bacteria | 1346 |
| 294 | Ga0207643_10282278 | 3300025908 | Bacteria | 1030 |
| 295 | Ga0207705_10112456 | 3300025909 | Bacteria | 2013 |
| 296 | Ga0207705_10113257 | 3300025909 | Bacteria | 2006 |
| 297 | Ga0207705_10529815 | 3300025909 | Bacteria | 916 |
| 298 | Ga0207654_10084989 | 3300025911 | Bacteria | 1914 |
| 299 | Ga0207695_10220111 | 3300025913 | Bacteria | 1806 |
| 300 | Ga0207671_10000532 | 3300025914 | Bacteria | 51370 |
| 301 | Ga0207693_10130426 | 3300025915 | Bacteria | 1976 |
| 302 | Ga0207663_10235680 | 3300025916 | Bacteria | 1339 |
| 303 | Ga0207660_10376801 | 3300025917 | Bacteria | 1140 |
| 304 | Ga0207662_10009099 | 3300025918 | Bacteria | 5458 |
| 305 | Ga0207662_10033911 | 3300025918 | Bacteria | 2978 |
| 306 | Ga0207657_10023477 | 3300025919 | Bacteria | 5742 |
| 307 | Ga0207657_10276173 | 3300025919 | Bacteria | 1335 |
| 308 | Ga0207649_10039626 | 3300025920 | Bacteria | 2858 |
| 309 | Ga0207649_10062430 | 3300025920 | Bacteria | 2349 |
| 310 | Ga0207652_10945645 | 3300025921 | Bacteria | 759 |
| 311 | Ga0207681_10055732 | 3300025923 | Bacteria | 2694 |
| 312 | Ga0207681_10243707 | 3300025923 | Bacteria | 1400 |
| 313 | Ga0207694_10088011 | 3300025924 | Bacteria | 2448 |
| 314 | Ga0207694_10096799 | 3300025924 | Bacteria | 2335 |
| 315 | Ga0207694_10111386 | 3300025924 | Bacteria | 2178 |
| 316 | Ga0207650_10012412 | 3300025925 | Bacteria | 5882 |
| 317 | Ga0207650_10312036 | 3300025925 | Bacteria | 1287 |
| 318 | Ga0207650_10681983 | 3300025925 | Bacteria | 867 |
| 319 | Ga0207659_10006589 | 3300025926 | Bacteria | 7129 |
| 320 | Ga0207659_10010145 | 3300025926 | Bacteria | 5907 |
| 321 | Ga0207687_10065829 | 3300025927 | Bacteria | 2574 |
| 322 | Ga0207687_10107737 | 3300025927 | Bacteria | 2062 |
| 323 | Ga0207687_10163037 | 3300025927 | Bacteria | 1713 |
| 324 | Ga0207687_10213642 | 3300025927 | Bacteria | 1515 |
| 325 | Ga0207700_10090938 | 3300025928 | Bacteria | 2410 |
| 326 | Ga0207700_10695935 | 3300025928 | Bacteria | 907 |
| 327 | Ga0207664_10397059 | 3300025929 | Bacteria | 1226 |
| 328 | Ga0207664_10479639 | 3300025929 | Bacteria | 1112 |
| 329 | Ga0207664_10515910 | 3300025929 | Bacteria | 1071 |
| 330 | Ga0207644_10125643 | 3300025931 | Bacteria | 1958 |
| 331 | Ga0207690_10187122 | 3300025932 | Bacteria | 1563 |
| 332 | Ga0207706_10010700 | 3300025933 | Bacteria | 8379 |
| 333 | Ga0207706_10021431 | 3300025933 | Bacteria | 5804 |
| 334 | Ga0207706_10048412 | 3300025933 | Bacteria | 3759 |
| 335 | Ga0207706_10128176 | 3300025933 | Bacteria | 2231 |
| 336 | Ga0207709_10040905 | 3300025935 | Bacteria | 2778 |
| 337 | Ga0207709_10245860 | 3300025935 | Bacteria | 1304 |
| 338 | Ga0207709_10881203 | 3300025935 | Bacteria | 726 |
| 339 | Ga0207691_10037306 | 3300025940 | Bacteria | 4501 |
| 340 | Ga0207691_10191403 | 3300025940 | Bacteria | 1784 |
| 341 | Ga0207689_10011188 | 3300025942 | Bacteria | 7698 |
| 342 | Ga0207689_10014176 | 3300025942 | Bacteria | 6781 |
| 343 | Ga0207689_10015806 | 3300025942 | Bacteria | 6390 |
| 344 | Ga0207689_10444260 | 3300025942 | Bacteria | 1083 |
| 345 | Ga0207661_10021123 | 3300025944 | Bacteria | 4877 |
| 346 | Ga0207661_10025750 | 3300025944 | Bacteria | 4476 |
| 347 | Ga0207661_10170850 | 3300025944 | Bacteria | 1892 |
| 348 | Ga0207661_10516332 | 3300025944 | Bacteria | 1092 |
| 349 | Ga0207679_10024199 | 3300025945 | Bacteria | 4162 |
| 350 | Ga0207679_10118473 | 3300025945 | Bacteria | 2103 |
| 351 | Ga0207679_10171161 | 3300025945 | Bacteria | 1788 |
| 352 | Ga0207667_10978561 | 3300025949 | Bacteria | 834 |
| 353 | Ga0207651_10035692 | 3300025960 | Bacteria | 3237 |
| 354 | Ga0207651_10039106 | 3300025960 | Bacteria | 3125 |
| 355 | Ga0207712_10078177 | 3300025961 | Bacteria | 2400 |
| 356 | Ga0207712_10128748 | 3300025961 | Bacteria | 1926 |
| 357 | Ga0207712_10239927 | 3300025961 | Bacteria | 1459 |
| 358 | Ga0207668_10023431 | 3300025972 | Bacteria | 3968 |
| 359 | Ga0207668_10126172 | 3300025972 | Bacteria | 1946 |
| 360 | Ga0207640_10470533 | 3300025981 | Bacteria | 1040 |
| 361 | Ga0207658_10000003 | 3300025986 | Bacteria | 1151934 |
| 362 | Ga0207658_10014793 | 3300025986 | Bacteria | 5347 |
| 363 | Ga0207658_10130588 | 3300025986 | Bacteria | 2018 |
| 364 | Ga0207677_10013586 | 3300026023 | Bacteria | 4725 |
| 365 | Ga0207677_10057563 | 3300026023 | Bacteria | 2670 |
| 366 | Ga0207703_10070001 | 3300026035 | Bacteria | 2895 |
| 367 | Ga0207639_10306144 | 3300026041 | Bacteria | 1406 |
| 368 | Ga0207639_10368840 | 3300026041 | Bacteria | 1287 |
| 369 | Ga0207678_10002575 | 3300026067 | Bacteria | 16520 |
| 370 | Ga0207678_10083442 | 3300026067 | Bacteria | 2733 |
| 371 | Ga0207708_10003567 | 3300026075 | Bacteria | 11477 |
| 372 | Ga0207708_10010752 | 3300026075 | Bacteria | 6804 |
| 373 | Ga0207708_10016331 | 3300026075 | Bacteria | 5580 |
| 374 | Ga0207708_10153060 | 3300026075 | Bacteria | 1817 |
| 375 | Ga0207702_10133291 | 3300026078 | Bacteria | 2238 |
| 376 | Ga0207702_11015102 | 3300026078 | Bacteria | 823 |
| 377 | Ga0207641_10417387 | 3300026088 | Bacteria | 1291 |
| 378 | Ga0207641_10589385 | 3300026088 | Bacteria | 1087 |
| 379 | Ga0207648_10026949 | 3300026089 | Bacteria | 5104 |
| 380 | Ga0207648_10028595 | 3300026089 | Bacteria | 4942 |
| 381 | Ga0207674_10006377 | 3300026116 | Bacteria | 13887 |
| 382 | Ga0207674_10025030 | 3300026116 | Bacteria | 6371 |
| 383 | Ga0207675_100002346 | 3300026118 | Bacteria | 18746 |
| 384 | Ga0207675_100036464 | 3300026118 | Bacteria | 4587 |
| 385 | Ga0207675_100159174 | 3300026118 | Bacteria | 2153 |
| 386 | Ga0207683_10240630 | 3300026121 | Bacteria | 1651 |
| 387 | Ga0207683_11008032 | 3300026121 | Bacteria | 773 |
| 388 | Ga0207698_10017898 | 3300026142 | Bacteria | 4817 |
| 389 | Ga0207698_10039859 | 3300026142 | Bacteria | 3483 |
| 390 | Ga0207698_10790698 | 3300026142 | Bacteria | 950 |
| 391 | Ga0209371_1023958 | 3300027312 | Bacteria | 1427 |
| 392 | Ga0209813_10008250 | 3300027866 | Bacteria | 2624 |
| 393 | Ga0207428_10094405 | 3300027907 | Bacteria | 2319 |
| 394 | Ga0207428_10436313 | 3300027907 | Bacteria | 956 |
| 395 | Ga0268266_10026696 | 3300028379 | Bacteria | 4913 |
| 396 | Ga0268266_10612224 | 3300028379 | Bacteria | 1047 |
| 397 | Ga0268265_10962461 | 3300028380 | Bacteria | 841 |
| 398 | Ga0268264_10118484 | 3300028381 | Bacteria | 2330 |
| 399 | Ga0268264_10153517 | 3300028381 | Bacteria | 2067 |
| 400 | Ga0268264_10168067 | 3300028381 | Bacteria | 1981 |
| 401 | Ga0268264_10193809 | 3300028381 | Bacteria | 1854 |
| 402 | Ga0307517_10001523 | 3300028786 | Bacteria | 38580 |
| 403 | Ga0307517_10002113 | 3300028786 | Bacteria | 32343 |
| 404 | Ga0307517_10002268 | 3300028786 | Bacteria | 31003 |
| 405 | Ga0307517_10003190 | 3300028786 | Bacteria | 25757 |
| 406 | Ga0307515_10005593 | 3300028794 | Bacteria | 25395 |
| 407 | Ga0307515_10030929 | 3300028794 | Bacteria | 8959 |
| 408 | Ga0307515_10166506 | 3300028794 | Bacteria | 2219 |
| 409 | Ga0307515_10237050 | 3300028794 | Bacteria | 1603 |
| 410 | Ga0268256_1022483 | 3300030500 | Bacteria | 1653 |
| 411 | Ga0268256_1027206 | 3300030500 | Bacteria | 1427 |
| 412 | Ga0307511_10000262 | 3300030521 | Bacteria | 54437 |
| 413 | Ga0307511_10052075 | 3300030521 | Bacteria | 3268 |
| 414 | Ga0307511_10067295 | 3300030521 | Bacteria | 2659 |
| 415 | Ga0307511_10071760 | 3300030521 | Bacteria | 2522 |
| 416 | Ga0307511_10161841 | 3300030521 | Bacteria | 1254 |
| 417 | Ga0307511_10170822 | 3300030521 | Bacteria | 1195 |
| 418 | Ga0307511_10240991 | 3300030521 | Bacteria | 882 |
| 419 | Ga0307512_10004180 | 3300030522 | Bacteria | 16012 |
| 420 | Ga0307512_10036987 | 3300030522 | Bacteria | 4130 |
| 421 | Ga0307512_10056898 | 3300030522 | Bacteria | 3065 |
| 422 | Ga0307512_10076977 | 3300030522 | Bacteria | 2427 |
| 423 | Ga0307512_10156139 | 3300030522 | Bacteria | 1350 |
| 424 | Ga0265327_10001096 | 3300031251 | Bacteria | 37556 |
| 425 | Ga0265327_10013988 | 3300031251 | Bacteria | 5286 |
| 426 | Ga0307513_10000135 | 3300031456 | Bacteria | 103254 |
| 427 | Ga0307513_10003690 | 3300031456 | Bacteria | 20706 |
| 428 | Ga0307513_10013382 | 3300031456 | Bacteria | 10071 |
| 429 | Ga0307513_10094928 | 3300031456 | Bacteria | 3025 |
| 430 | Ga0307513_10099815 | 3300031456 | Bacteria | 2930 |
| 431 | Ga0307513_10169256 | 3300031456 | Bacteria | 2064 |
| 432 | Ga0307513_10213079 | 3300031456 | Bacteria | 1761 |
| 433 | Ga0307509_10078021 | 3300031507 | Bacteria | 3434 |
| 434 | Ga0307509_10120765 | 3300031507 | Bacteria | 2598 |
| 435 | Ga0307408_100220714 | 3300031548 | Bacteria | 1547 |
| 436 | Ga0307408_100562600 | 3300031548 | Bacteria | 1008 |
| 437 | Ga0307508_10002945 | 3300031616 | Bacteria | 17606 |
| 438 | Ga0307508_10003098 | 3300031616 | Bacteria | 17069 |
| 439 | Ga0307508_10003146 | 3300031616 | Bacteria | 16895 |
| 440 | Ga0307508_10008636 | 3300031616 | Bacteria | 9403 |
| 441 | Ga0307508_10028997 | 3300031616 | Bacteria | 5002 |
| 442 | Ga0307508_10044489 | 3300031616 | Bacteria | 3971 |
| 443 | Ga0307508_10059525 | 3300031616 | Bacteria | 3378 |
| 444 | Ga0307508_10090924 | 3300031616 | Bacteria | 2639 |
| 445 | Ga0307508_10120891 | 3300031616 | Bacteria | 2222 |
| 446 | Ga0307508_10235900 | 3300031616 | Bacteria | 1427 |
| 447 | Ga0307508_10428645 | 3300031616 | Bacteria | 914 |
| 448 | Ga0307514_10005889 | 3300031649 | Bacteria | 10814 |
| 449 | Ga0307514_10039469 | 3300031649 | Bacteria | 3729 |
| 450 | Ga0307514_10078640 | 3300031649 | Bacteria | 2448 |
| 451 | Ga0307514_10172953 | 3300031649 | Bacteria | 1406 |
| 452 | Ga0307514_10215647 | 3300031649 | Bacteria | 1184 |
| 453 | Ga0307516_10034805 | 3300031730 | Bacteria | 5057 |
| 454 | Ga0307516_10068674 | 3300031730 | Bacteria | 3412 |
| 455 | Ga0307516_10102412 | 3300031730 | Bacteria | 2678 |
| 456 | Ga0307516_10110456 | 3300031730 | Bacteria | 2553 |
| 457 | Ga0307516_10382657 | 3300031730 | Bacteria | 1068 |
| 458 | Ga0307516_10456645 | 3300031730 | Bacteria | 933 |
| 459 | Ga0307413_10004008 | 3300031824 | Bacteria | 6329 |
| 460 | Ga0307413_10008993 | 3300031824 | Bacteria | 4752 |
| 461 | Ga0307413_10178883 | 3300031824 | Bacteria | 1510 |
| 462 | Ga0307413_10219042 | 3300031824 | Bacteria | 1389 |
| 463 | Ga0307413_10422565 | 3300031824 | Bacteria | 1050 |
| 464 | Ga0307413_10463870 | 3300031824 | Bacteria | 1008 |
| 465 | Ga0307413_10529441 | 3300031824 | Bacteria | 952 |
| 466 | Ga0307407_10708366 | 3300031903 | Bacteria | 759 |
| 467 | Ga0307407_10868333 | 3300031903 | Bacteria | 690 |
| 468 | Ga0307409_100099917 | 3300031995 | Bacteria | 2404 |
| 469 | Ga0307409_100298276 | 3300031995 | Bacteria | 1498 |
| 470 | Ga0307409_100580366 | 3300031995 | Bacteria | 1105 |
| 471 | Ga0307409_100683338 | 3300031995 | Bacteria | 1024 |
| 472 | Ga0307409_100747990 | 3300031995 | Bacteria | 981 |
| 473 | Ga0307409_101469561 | 3300031995 | Bacteria | 709 |
| 474 | Ga0307416_100133444 | 3300032002 | Bacteria | 2241 |
| 475 | Ga0307416_100330535 | 3300032002 | Bacteria | 1531 |
| 476 | Ga0307416_100387339 | 3300032002 | Bacteria | 1430 |
| 477 | Ga0307416_100621617 | 3300032002 | Bacteria | 1162 |
| 478 | Ga0307416_102072700 | 3300032002 | Bacteria | 671 |
| 479 | Ga0307411_10024481 | 3300032005 | Bacteria | 3599 |
| 480 | Ga0307411_10234445 | 3300032005 | Bacteria | 1433 |
| 481 | Ga0307415_100013814 | 3300032126 | Bacteria | 4726 |
| 482 | Ga0307415_100215679 | 3300032126 | Bacteria | 1535 |
| 483 | Ga0307415_100347063 | 3300032126 | Bacteria | 1248 |
| 484 | Ga0307507_10004394 | 3300033179 | Bacteria | 25126 |
| 485 | Ga0307507_10017950 | 3300033179 | Bacteria | 8088 |
| 486 | Ga0307507_10019844 | 3300033179 | Bacteria | 7552 |
| 487 | Ga0307507_10060005 | 3300033179 | Bacteria | 3555 |
| 488 | Ga0307507_10096125 | 3300033179 | Bacteria | 2508 |
| 489 | Ga0307507_10097007 | 3300033179 | Bacteria | 2489 |
| 490 | Ga0307507_10143892 | 3300033179 | Bacteria | 1818 |
| 491 | Ga0307507_10163188 | 3300033179 | Bacteria | 1640 |
| 492 | Ga0307510_10005436 | 3300033180 | Bacteria | 15167 |
| 493 | Ga0307510_10135431 | 3300033180 | Bacteria | 2122 |
| 494 | Ga0307510_10212189 | 3300033180 | Bacteria | 1457 |
| 495 | Ga0373940_0204944 | 3300035088 | Bacteria | 650 |
| 496 | Ga0373951_0090995 | 3300035091 | Bacteria | 801 |
| 497 | Ga0373952_0096951 | 3300035092 | Bacteria | 773 |
| 498 | Ga0373962_0148504 | 3300035242 | Bacteria | 766 |
| 499 | Ga0395898_0006424 | 3300037466 | Bacteria | 12555 |
| 500 | Ga0395898_0007866 | 3300037466 | Bacteria | 11312 |
| 501 | Ga0395898_0157778 | 3300037466 | Bacteria | 2170 |
| 502 | Ga0395898_0828079 | 3300037466 | Bacteria | 865 |
| 503 | Ga0395901_0090147 | 3300038443 | Bacteria | 3209 |
| 504 | Ga0436365_0241176 | 3300039437 | Bacteria | 2689 |
| 505 | Ga0436365_0402914 | 3300039437 | Bacteria | 1912 |
| 506 | Ga0439436_0000208 | 3300041404 | Bacteria | 14124 |
| 507 | Ga0439439_0003117 | 3300041406 | Bacteria | 3619 |
| 508 | Ga0451793_0500026 | 3300041452 | Bacteria | 716 |
| 509 | Ga0451800_1554937 | 3300041459 | Bacteria | 698 |
| 510 | Ga0451802_0326665 | 3300041460 | Bacteria | 1789 |
| 511 | Ga0451802_0444163 | 3300041460 | Bacteria | 1841 |
| 512 | Ga0451807_2266131 | 3300041486 | Bacteria | 1188 |
| 513 | Ga0451807_2446817 | 3300041486 | Bacteria | 777 |
| 514 | Ga0451833_0081940 | 3300041491 | Bacteria | 2153 |
| 515 | Ga0451833_0163126 | 3300041491 | Bacteria | 2544 |
| 516 | Ga0451835_0504647 | 3300041492 | Bacteria | 1593 |
| 517 | Ga0451837_0073117 | 3300041494 | Bacteria | 819 |
| 518 | Ga0451837_1411785 | 3300041494 | Bacteria | 1175 |
| 519 | Ga0451837_1594594 | 3300041494 | Bacteria | 4140 |
| 520 | Ga0451841_0766413 | 3300041498 | Bacteria | 1291 |
| 521 | Ga0451853_0494340 | 3300041512 | Bacteria | 1141 |
| 522 | Ga0451853_3237062 | 3300041512 | Bacteria | 940 |
| 523 | Ga0451853_3883896 | 3300041512 | Bacteria | 1695 |
| 524 | Ga0451853_3940744 | 3300041512 | Bacteria | 1714 |
| 525 | Ga0439442_037360 | 3300042002 | Bacteria | 1017 |
| 526 | Ga0439448_0001704 | 3300042005 | Bacteria | 5790 |
| 527 | Ga0439449_0021758 | 3300042007 | Bacteria | 2400 |
| 528 | Ga0439455_0001757 | 3300042012 | Bacteria | 3759 |
| 529 | Ga0439455_0004112 | 3300042012 | Bacteria | 2855 |
| 530 | Ga0439457_006866 | 3300042014 | Bacteria | 2755 |
| 531 | Ga0439462_0023614 | 3300042015 | Bacteria | 1612 |
| 532 | Ga0450894_000035 | 3300042131 | Bacteria | 19542 |
| 533 | Ga0450898_004052 | 3300042134 | Bacteria | 2141 |
| 534 | Ga0450899_001604 | 3300042135 | Bacteria | 2499 |
| 535 | Ga0450900_008358 | 3300042136 | Bacteria | 1292 |
| 536 | Ga0450900_041855 | 3300042136 | Bacteria | 687 |
| 537 | Ga0450903_000067 | 3300042138 | Bacteria | 20805 |
| 538 | Ga0450903_000495 | 3300042138 | Bacteria | 8255 |
| 539 | Ga0450906_063339 | 3300042145 | Bacteria | 658 |
| 540 | Ga0439458_0001440 | 3300042157 | Bacteria | 5996 |
| 541 | Ga0439458_0001566 | 3300042157 | Bacteria | 5720 |
| 542 | Ga0450908_004084 | 3300042184 | Bacteria | 2821 |
| 543 | Ga0450901_020493 | 3300042533 | Bacteria | 708 |
| 544 | Ga0439440_0088535 | 3300042993 | Bacteria | 828 |
| 545 | Ga0466969_0006677 | 3300044656 | Bacteria | 6132 |
| 546 | Ga0466969_0017088 | 3300044656 | Bacteria | 3792 |
| 547 | Ga0466969_0159346 | 3300044656 | Bacteria | 1037 |
| 548 | Ga0466972_0009190 | 3300044658 | Bacteria | 4965 |
| 549 | Ga0466972_0013383 | 3300044658 | Bacteria | 4120 |
| 550 | Ga0466972_0064413 | 3300044658 | Bacteria | 1754 |
| 551 | Ga0466972_0093850 | 3300044658 | Bacteria | 1422 |
| 552 | Ga0466965_0000073 | 3300044683 | Bacteria | 29903 |
| 553 | Ga0466965_0000929 | 3300044683 | Bacteria | 11246 |
| 554 | Ga0466965_0002548 | 3300044683 | Bacteria | 7785 |
| 555 | Ga0466965_0030028 | 3300044683 | Bacteria | 2647 |
| 556 | Ga0466965_0154330 | 3300044683 | Bacteria | 1201 |
| 557 | Ga0466965_0470787 | 3300044683 | Bacteria | 702 |
| 558 | Ga0466966_0000262 | 3300044684 | Bacteria | 35143 |
| 559 | Ga0466966_0026502 | 3300044684 | Bacteria | 3783 |
| 560 | Ga0466966_0026733 | 3300044684 | Bacteria | 3766 |
| 561 | Ga0466966_0148370 | 3300044684 | Bacteria | 1431 |
| 562 | Ga0466961_0000470 | 3300044693 | Bacteria | 25557 |
| 563 | Ga0466961_0000547 | 3300044693 | Bacteria | 23953 |
| 564 | Ga0466961_0017484 | 3300044693 | Bacteria | 4607 |
| 565 | Ga0466963_0000176 | 3300044694 | Bacteria | 26457 |
| 566 | Ga0466963_0000687 | 3300044694 | Bacteria | 16444 |
| 567 | Ga0466963_0001134 | 3300044694 | Bacteria | 13915 |
| 568 | Ga0466963_0050797 | 3300044694 | Bacteria | 2745 |
| 569 | Ga0466963_0361077 | 3300044694 | Bacteria | 1023 |
| 570 | Ga0466971_0000306 | 3300044719 | Bacteria | 18885 |
| 571 | Ga0466971_0001670 | 3300044719 | Bacteria | 9387 |
| 572 | Ga0466971_0033992 | 3300044719 | Bacteria | 2284 |
| 573 | Ga0466970_0000912 | 3300044765 | Bacteria | 14276 |
| 574 | Ga0466970_0001062 | 3300044765 | Bacteria | 13291 |
| 575 | Ga0466970_0056328 | 3300044765 | Bacteria | 2101 |
| 576 | Ga0466970_0060210 | 3300044765 | Bacteria | 2033 |
| 577 | Ga0466957_0000275 | 3300044842 | Bacteria | 24997 |
| 578 | Ga0466957_0000941 | 3300044842 | Bacteria | 14902 |
| 579 | Ga0466957_0108803 | 3300044842 | Bacteria | 1756 |
| 580 | Ga0466960_0087262 | 3300044901 | Bacteria | 1583 |
| 581 | Ga0466960_0096258 | 3300044901 | Bacteria | 1517 |
| 582 | Ga0466959_0000453 | 3300045049 | Bacteria | 23862 |
| 583 | Ga0466959_0003708 | 3300045049 | Bacteria | 10084 |
| 584 | Ga0466959_0021356 | 3300045049 | Bacteria | 4774 |
| 585 | Ga0466959_0023745 | 3300045049 | Bacteria | 4539 |
| 586 | Ga0466959_0102580 | 3300045049 | Bacteria | 2047 |
| 587 | Ga0466958_0010897 | 3300045836 | Bacteria | 5105 |
| 588 | Ga0466958_0138796 | 3300045836 | Bacteria | 1530 |
| 589 | Ga0466967_0001117 | 3300045976 | Bacteria | 14897 |
| 590 | Ga0466967_0011426 | 3300045976 | Bacteria | 6723 |
| 591 | Ga0466967_0153120 | 3300045976 | Bacteria | 2157 |
| 592 | Ga0466967_0413873 | 3300045976 | Bacteria | 1313 |
| 593 | Ga0466967_0443363 | 3300045976 | Bacteria | 1268 |
| 594 | Ga0466967_0629863 | 3300045976 | Bacteria | 1060 |
| 595 | Ga0466967_1015040 | 3300045976 | Bacteria | 826 |
| 596 | Ga0495617_006202 | 3300046452 | Bacteria | 4207 |
| 597 | Ga0495617_015849 | 3300046452 | Bacteria | 2550 |
| 598 | Ga0495627_033660 | 3300046453 | Bacteria | 1605 |
| 599 | Ga0495627_065245 | 3300046453 | Bacteria | 1070 |
| 600 | Ga0495627_135945 | 3300046453 | Bacteria | 690 |
| 601 | Ga0495592_0003306 | 3300046454 | Bacteria | 11552 |
| 602 | Ga0495592_0012362 | 3300046454 | Bacteria | 6484 |
| 603 | Ga0495592_0018473 | 3300046454 | Bacteria | 5303 |
| 604 | Ga0495592_0020976 | 3300046454 | Bacteria | 4969 |
| 605 | Ga0495592_0023524 | 3300046454 | Bacteria | 4686 |
| 606 | Ga0495592_0023546 | 3300046454 | Bacteria | 4684 |
| 607 | Ga0495603_0001393 | 3300046455 | Bacteria | 14053 |
| 608 | Ga0495603_0002486 | 3300046455 | Bacteria | 10845 |
| 609 | Ga0495603_0004164 | 3300046455 | Bacteria | 8620 |
| 610 | Ga0495603_0007598 | 3300046455 | Bacteria | 6522 |
| 611 | Ga0495603_0020679 | 3300046455 | Bacteria | 3986 |
| 612 | Ga0495603_0079972 | 3300046455 | Bacteria | 1915 |
| 613 | Ga0495603_0185122 | 3300046455 | Bacteria | 1204 |
| 614 | Ga0495603_0306866 | 3300046455 | Bacteria | 911 |
| 615 | Ga0495590_0083700 | 3300046457 | Bacteria | 1124 |
| 616 | Ga0495591_000094 | 3300046458 | Bacteria | 101106 |
| 617 | Ga0495629_0000848 | 3300046459 | Bacteria | 24687 |
| 618 | Ga0495629_0004603 | 3300046459 | Bacteria | 10323 |
| 619 | Ga0495629_0008832 | 3300046459 | Bacteria | 7408 |
| 620 | Ga0495629_0018308 | 3300046459 | Bacteria | 5015 |
| 621 | Ga0495629_0024194 | 3300046459 | Bacteria | 4324 |
| 622 | Ga0495629_0035598 | 3300046459 | Bacteria | 3518 |
| 623 | Ga0495629_0061605 | 3300046459 | Bacteria | 2622 |
| 624 | Ga0495629_0075577 | 3300046459 | Bacteria | 2352 |
| 625 | Ga0495629_0077458 | 3300046459 | Bacteria | 2321 |
| 626 | Ga0495629_0091455 | 3300046459 | Bacteria | 2123 |
| 627 | Ga0495629_0096109 | 3300046459 | Bacteria | 2066 |
| 628 | Ga0495629_0187477 | 3300046459 | Bacteria | 1432 |
| 629 | Ga0495629_0213488 | 3300046459 | Bacteria | 1332 |
| 630 | Ga0495629_0377855 | 3300046459 | Bacteria | 964 |
| 631 | Ga0495629_0584798 | 3300046459 | Bacteria | 747 |
| 632 | Ga0495638_0005393 | 3300046460 | Bacteria | 9531 |
| 633 | Ga0495638_0032165 | 3300046460 | Bacteria | 3366 |
| 634 | Ga0495638_0082670 | 3300046460 | Bacteria | 1947 |
| 635 | Ga0495638_0143053 | 3300046460 | Bacteria | 1394 |
| 636 | Ga0495638_0177710 | 3300046460 | Bacteria | 1217 |
| 637 | Ga0495638_0245901 | 3300046460 | Bacteria | 988 |
| 638 | Ga0495638_0350028 | 3300046460 | Bacteria | 780 |
| 639 | Ga0495641_0023508 | 3300046461 | Bacteria | 3059 |
| 640 | Ga0495641_0092306 | 3300046461 | Bacteria | 1353 |
| 641 | Ga0495641_0293485 | 3300046461 | Bacteria | 732 |
| 642 | Ga0495651_0006989 | 3300046462 | Bacteria | 8630 |
| 643 | Ga0495651_0026835 | 3300046462 | Bacteria | 4485 |
| 644 | Ga0495651_0031705 | 3300046462 | Bacteria | 4120 |
| 645 | Ga0495651_0036030 | 3300046462 | Bacteria | 3851 |
| 646 | Ga0495651_0055044 | 3300046462 | Bacteria | 3057 |
| 647 | Ga0495651_0089808 | 3300046462 | Bacteria | 2306 |
| 648 | Ga0495653_0190683 | 3300046463 | Bacteria | 1399 |
| 649 | Ga0495653_0376492 | 3300046463 | Bacteria | 907 |
| 650 | Ga0495653_0643107 | 3300046463 | Bacteria | 648 |
| 651 | Ga0495650_0047454 | 3300046471 | Bacteria | 1796 |
| 652 | Ga0495580_0193994 | 3300046472 | Bacteria | 1400 |
| 653 | Ga0495582_0073060 | 3300046473 | Bacteria | 1898 |
| 654 | Ga0495605_0006539 | 3300046474 | Bacteria | 6688 |
| 655 | Ga0495605_0007673 | 3300046474 | Bacteria | 6115 |
| 656 | Ga0495605_0011338 | 3300046474 | Bacteria | 4977 |
| 657 | Ga0495605_0140595 | 3300046474 | Bacteria | 1083 |
| 658 | Ga0495639_0033239 | 3300046475 | Bacteria | 2303 |
| 659 | Ga0495639_0057705 | 3300046475 | Bacteria | 1774 |
| 660 | Ga0495662_0001904 | 3300046476 | Bacteria | 10478 |
| 661 | Ga0495662_0004334 | 3300046476 | Bacteria | 7132 |
| 662 | Ga0495662_0009848 | 3300046476 | Bacteria | 4694 |
| 663 | Ga0495662_0236982 | 3300046476 | Bacteria | 899 |
| 664 | Ga0495664_0002699 | 3300046477 | Bacteria | 9550 |
| 665 | Ga0495664_0002878 | 3300046477 | Bacteria | 9275 |
| 666 | Ga0495664_0012354 | 3300046477 | Bacteria | 4835 |
| 667 | Ga0495664_0131730 | 3300046477 | Bacteria | 1514 |
| 668 | Ga0495584_0022909 | 3300046491 | Bacteria | 3169 |
| 669 | Ga0495584_0105762 | 3300046491 | Bacteria | 1423 |
| 670 | Ga0495585_0013453 | 3300046492 | Bacteria | 4788 |
| 671 | Ga0495585_0021887 | 3300046492 | Bacteria | 3670 |
| 672 | Ga0495585_0051822 | 3300046492 | Bacteria | 2273 |
| 673 | Ga0495585_0066101 | 3300046492 | Bacteria | 1980 |
| 674 | Ga0495585_0072244 | 3300046492 | Bacteria | 1880 |
| 675 | Ga0495585_0160445 | 3300046492 | Bacteria | 1167 |
| 676 | Ga0495585_0324310 | 3300046492 | Bacteria | 752 |
| 677 | Ga0495594_0000685 | 3300046499 | Bacteria | 17457 |
| 678 | Ga0495594_0009010 | 3300046499 | Bacteria | 5149 |
| 679 | Ga0495594_0019831 | 3300046499 | Bacteria | 3576 |
| 680 | Ga0495594_0021450 | 3300046499 | Bacteria | 3447 |
| 681 | Ga0495594_0024609 | 3300046499 | Bacteria | 3235 |
| 682 | Ga0495594_0028394 | 3300046499 | Bacteria | 3019 |
| 683 | Ga0495594_0041613 | 3300046499 | Bacteria | 2515 |
| 684 | Ga0495594_0051326 | 3300046499 | Bacteria | 2269 |
| 685 | Ga0495594_0086635 | 3300046499 | Bacteria | 1752 |
| 686 | Ga0495594_0100840 | 3300046499 | Bacteria | 1624 |
| 687 | Ga0495594_0303456 | 3300046499 | Bacteria | 909 |
| 688 | Ga0495596_0018401 | 3300046500 | Bacteria | 2880 |
| 689 | Ga0495607_0032514 | 3300046501 | Bacteria | 3183 |
| 690 | Ga0495607_0047259 | 3300046501 | Bacteria | 2522 |
| 691 | Ga0495607_0061691 | 3300046501 | Bacteria | 2129 |
| 692 | Ga0495607_0080436 | 3300046501 | Bacteria | 1792 |
| 693 | Ga0495607_0143306 | 3300046501 | Bacteria | 1230 |
| 694 | Ga0495583_0012823 | 3300046506 | Bacteria | 4715 |
| 695 | Ga0495606_0005155 | 3300046507 | Bacteria | 12661 |
| 696 | Ga0495608_0015458 | 3300046511 | Bacteria | 5293 |
| 697 | Ga0495608_0110793 | 3300046511 | Bacteria | 1765 |
| 698 | Ga0495610_0070010 | 3300046512 | Bacteria | 1640 |
| 699 | Ga0495610_0109593 | 3300046512 | Bacteria | 1225 |
| 700 | Ga0495610_0186969 | 3300046512 | Bacteria | 857 |
| 701 | Ga0495616_0012817 | 3300046513 | Bacteria | 4744 |
| 702 | Ga0495616_0020515 | 3300046513 | Bacteria | 3592 |
| 703 | Ga0495618_0014678 | 3300046514 | Bacteria | 4776 |
| 704 | Ga0495618_0064186 | 3300046514 | Bacteria | 2333 |
| 705 | Ga0495618_0152149 | 3300046514 | Bacteria | 1477 |
| 706 | Ga0495628_0012816 | 3300046516 | Bacteria | 7059 |
| 707 | Ga0495628_0281649 | 3300046516 | Bacteria | 1234 |
| 708 | Ga0495628_0339778 | 3300046516 | Bacteria | 1105 |
| 709 | Ga0495628_0374533 | 3300046516 | Bacteria | 1043 |
| 710 | Ga0495630_0010329 | 3300046517 | Bacteria | 6739 |
| 711 | Ga0495630_0020817 | 3300046517 | Bacteria | 4840 |
| 712 | Ga0495630_0789217 | 3300046517 | Bacteria | 725 |
| 713 | Ga0495631_0005055 | 3300046518 | Bacteria | 6948 |
| 714 | Ga0495631_0030365 | 3300046518 | Bacteria | 2452 |
| 715 | Ga0495631_0063541 | 3300046518 | Bacteria | 1599 |
| 716 | Ga0495631_0067129 | 3300046518 | Bacteria | 1552 |
| 717 | Ga0495631_0085277 | 3300046518 | Bacteria | 1361 |
| 718 | Ga0495631_0118783 | 3300046518 | Bacteria | 1137 |
| 719 | Ga0495631_0272754 | 3300046518 | Bacteria | 720 |
| 720 | Ga0495632_0014087 | 3300046519 | Bacteria | 4537 |
| 721 | Ga0495632_0022741 | 3300046519 | Bacteria | 3356 |
| 722 | Ga0495632_0024406 | 3300046519 | Bacteria | 3212 |
| 723 | Ga0495637_0067739 | 3300046520 | Bacteria | 1448 |
| 724 | Ga0495637_0122094 | 3300046520 | Bacteria | 1001 |
| 725 | Ga0495643_0001406 | 3300046522 | Bacteria | 22332 |
| 726 | Ga0495643_0002959 | 3300046522 | Bacteria | 12865 |
| 727 | Ga0495643_0004427 | 3300046522 | Bacteria | 9829 |
| 728 | Ga0495643_0006201 | 3300046522 | Bacteria | 7932 |
| 729 | Ga0495643_0035252 | 3300046522 | Bacteria | 2756 |
| 730 | Ga0495643_0287500 | 3300046522 | Bacteria | 754 |
| 731 | Ga0495648_0117119 | 3300046524 | Bacteria | 1438 |
| 732 | Ga0495666_0005365 | 3300046526 | Bacteria | 6455 |
| 733 | Ga0495666_0111637 | 3300046526 | Bacteria | 1283 |
| 734 | Ga0495666_0254626 | 3300046526 | Bacteria | 799 |
| 735 | Ga0495642_0191625 | 3300046528 | Bacteria | 890 |
| 736 | Ga0495652_0012215 | 3300046529 | Bacteria | 7754 |
| 737 | Ga0495652_0020004 | 3300046529 | Bacteria | 5954 |
| 738 | Ga0495652_0057775 | 3300046529 | Bacteria | 3288 |
| 739 | Ga0495652_0073727 | 3300046529 | Bacteria | 2841 |
| 740 | Ga0495652_0332055 | 3300046529 | Bacteria | 1095 |
| 741 | Ga0495652_0624092 | 3300046529 | Bacteria | 733 |
| 742 | Ga0495654_0000078 | 3300046530 | Bacteria | 110443 |
| 743 | Ga0495654_0138917 | 3300046530 | Bacteria | 1084 |
| 744 | Ga0495665_0003250 | 3300046531 | Bacteria | 8795 |
| 745 | Ga0495665_0028375 | 3300046531 | Bacteria | 3001 |
| 746 | Ga0495640_0003633 | 3300046533 | Bacteria | 12382 |
| 747 | Ga0495640_0007170 | 3300046533 | Bacteria | 8779 |
| 748 | Ga0495640_0027497 | 3300046533 | Bacteria | 4101 |
| 749 | Ga0495640_0033607 | 3300046533 | Bacteria | 3642 |
| 750 | Ga0495640_0287746 | 3300046533 | Bacteria | 1022 |
| 751 | Ga0495640_0323714 | 3300046533 | Bacteria | 954 |
| 752 | Ga0495586_0033260 | 3300046535 | Bacteria | 2767 |
| 753 | Ga0495586_0035300 | 3300046535 | Bacteria | 2686 |
| 754 | Ga0495586_0040799 | 3300046535 | Bacteria | 2498 |
| 755 | Ga0495586_0225053 | 3300046535 | Bacteria | 1067 |
| 756 | Ga0495586_0369410 | 3300046535 | Bacteria | 825 |
| 757 | Ga0495587_0004546 | 3300046536 | Bacteria | 9114 |
| 758 | Ga0495587_0004564 | 3300046536 | Bacteria | 9091 |
| 759 | Ga0495609_0039995 | 3300046538 | Bacteria | 2110 |
| 760 | Ga0495609_0143967 | 3300046538 | Bacteria | 1016 |
| 761 | Ga0495609_0201960 | 3300046538 | Bacteria | 830 |
| 762 | Ga0495597_0062253 | 3300046542 | Bacteria | 1624 |
| 763 | Ga0495597_0100882 | 3300046542 | Bacteria | 1217 |
| 764 | Ga0495597_0221749 | 3300046542 | Bacteria | 750 |
| 765 | Ga0495645_0024234 | 3300046543 | Bacteria | 4402 |
| 766 | Ga0495645_0047897 | 3300046543 | Bacteria | 3113 |
| 767 | Ga0495645_0228970 | 3300046543 | Bacteria | 1246 |
| 768 | Ga0495645_0542259 | 3300046543 | Bacteria | 722 |
| 769 | Ga0495622_0005269 | 3300046557 | Bacteria | 5996 |
| 770 | Ga0495622_0022335 | 3300046557 | Bacteria | 2948 |
| 771 | Ga0495622_0026426 | 3300046557 | Bacteria | 2710 |
| 772 | Ga0495622_0041241 | 3300046557 | Bacteria | 2146 |
| 773 | Ga0495622_0095241 | 3300046557 | Bacteria | 1366 |
| 774 | Ga0495633_0015500 | 3300046558 | Bacteria | 3952 |
| 775 | Ga0495633_0031251 | 3300046558 | Bacteria | 2583 |
| 776 | Ga0495633_0052475 | 3300046558 | Bacteria | 1921 |
| 777 | Ga0495633_0052876 | 3300046558 | Bacteria | 1912 |
| 778 | Ga0495667_0005230 | 3300046559 | Bacteria | 8773 |
| 779 | Ga0495667_0016398 | 3300046559 | Bacteria | 5007 |
| 780 | Ga0495667_0131055 | 3300046559 | Bacteria | 1617 |
| 781 | Ga0495667_0428472 | 3300046559 | Bacteria | 832 |
| 782 | Ga0495656_0287706 | 3300046615 | Bacteria | 839 |
| 783 | Ga0495656_0450761 | 3300046615 | Bacteria | 678 |
| 784 | Ga0495668_0013506 | 3300046616 | Bacteria | 4814 |
| 785 | Ga0495668_0013638 | 3300046616 | Bacteria | 4785 |
| 786 | Ga0495634_0004463 | 3300046642 | Bacteria | 10979 |
| 787 | Ga0495634_0005757 | 3300046642 | Bacteria | 9463 |
| 788 | Ga0495634_0010876 | 3300046642 | Bacteria | 6648 |
| 789 | Ga0495634_0018134 | 3300046642 | Bacteria | 5014 |
| 790 | Ga0495634_0021238 | 3300046642 | Bacteria | 4591 |
| 791 | Ga0495634_0041495 | 3300046642 | Bacteria | 3124 |
| 792 | Ga0495611_0023752 | 3300046648 | Bacteria | 2662 |
| 793 | Ga0495611_0028349 | 3300046648 | Bacteria | 2451 |
| 794 | Ga0495611_0039483 | 3300046648 | Bacteria | 2101 |
| 795 | Ga0495611_0098150 | 3300046648 | Bacteria | 1358 |
| 796 | Ga0495611_0137105 | 3300046648 | Bacteria | 1142 |
| 797 | Ga0495611_0174145 | 3300046648 | Bacteria | 1005 |
| 798 | Ga0495625_0003493 | 3300046660 | Bacteria | 15586 |
| 799 | Ga0495625_0024565 | 3300046660 | Bacteria | 4584 |
| 800 | Ga0495625_0093688 | 3300046660 | Bacteria | 2073 |
| 801 | Ga0495625_0285921 | 3300046660 | Bacteria | 1059 |
| 802 | Ga0495635_0000563 | 3300046663 | Bacteria | 23671 |
| 803 | Ga0495635_0004814 | 3300046663 | Bacteria | 9386 |
| 804 | Ga0495635_0017936 | 3300046663 | Bacteria | 4943 |
| 805 | Ga0495635_0041417 | 3300046663 | Bacteria | 3181 |
| 806 | Ga0495635_0052822 | 3300046663 | Bacteria | 2799 |
| 807 | Ga0495661_0113224 | 3300046665 | Bacteria | 1509 |
| 808 | Ga0495661_0114750 | 3300046665 | Bacteria | 1496 |
| 809 | Ga0495661_0149516 | 3300046665 | Bacteria | 1263 |
| 810 | Ga0495661_0161329 | 3300046665 | Bacteria | 1203 |
| 811 | Ga0495661_0292751 | 3300046665 | Bacteria | 817 |
| 812 | Ga0495661_0311454 | 3300046665 | Bacteria | 785 |
| 813 | Ga0495588_0000658 | 3300046674 | Bacteria | 15999 |
| 814 | Ga0495588_0001875 | 3300046674 | Bacteria | 8955 |
| 815 | Ga0495588_0002372 | 3300046674 | Bacteria | 8058 |
| 816 | Ga0495588_0018282 | 3300046674 | Bacteria | 3415 |
| 817 | Ga0495588_0045741 | 3300046674 | Bacteria | 2244 |
| 818 | Ga0495588_0054253 | 3300046674 | Bacteria | 2068 |
| 819 | Ga0495588_0097651 | 3300046674 | Bacteria | 1542 |
| 820 | Ga0495588_0098358 | 3300046674 | Bacteria | 1536 |
| 821 | Ga0495588_0100175 | 3300046674 | Bacteria | 1522 |
| 822 | Ga0495657_0008155 | 3300046675 | Bacteria | 8024 |
| 823 | Ga0495657_0009984 | 3300046675 | Bacteria | 7163 |
| 824 | Ga0495657_0013312 | 3300046675 | Bacteria | 6074 |
| 825 | Ga0495657_0014725 | 3300046675 | Bacteria | 5740 |
| 826 | Ga0495657_0019044 | 3300046675 | Bacteria | 4959 |
| 827 | Ga0495657_0026186 | 3300046675 | Bacteria | 4131 |
| 828 | Ga0495657_0039076 | 3300046675 | Bacteria | 3262 |
| 829 | Ga0495657_0072723 | 3300046675 | Bacteria | 2241 |
| 830 | Ga0495657_0110445 | 3300046675 | Bacteria | 1742 |
| 831 | Ga0495599_0002776 | 3300046678 | Bacteria | 10216 |
| 832 | Ga0495623_0017347 | 3300046679 | Bacteria | 4652 |
| 833 | Ga0495623_0085582 | 3300046679 | Bacteria | 1944 |
| 834 | Ga0495623_0106086 | 3300046679 | Bacteria | 1707 |
| 835 | Ga0495623_0299311 | 3300046679 | Bacteria | 889 |
| 836 | Ga0495646_0000882 | 3300046680 | Bacteria | 17025 |
| 837 | Ga0495646_0041737 | 3300046680 | Bacteria | 2817 |
| 838 | Ga0495646_0348723 | 3300046680 | Bacteria | 776 |
| 839 | Ga0495658_0035415 | 3300046683 | Bacteria | 2746 |
| 840 | Ga0495658_0178902 | 3300046683 | Bacteria | 1315 |
| 841 | Ga0495658_0367951 | 3300046683 | Bacteria | 914 |
| 842 | Ga0495613_0000689 | 3300046689 | Bacteria | 26707 |
| 843 | Ga0495613_0000944 | 3300046689 | Bacteria | 22202 |
| 844 | Ga0495613_0002789 | 3300046689 | Bacteria | 13121 |
| 845 | Ga0495613_0003382 | 3300046689 | Bacteria | 11921 |
| 846 | Ga0495613_0010157 | 3300046689 | Bacteria | 6993 |
| 847 | Ga0495613_0012065 | 3300046689 | Bacteria | 6422 |
| 848 | Ga0495613_0012228 | 3300046689 | Bacteria | 6379 |
| 849 | Ga0495613_0029046 | 3300046689 | Bacteria | 4111 |
| 850 | Ga0495613_0035158 | 3300046689 | Bacteria | 3719 |
| 851 | Ga0495613_0036070 | 3300046689 | Bacteria | 3667 |
| 852 | Ga0495613_0146061 | 3300046689 | Bacteria | 1688 |
| 853 | Ga0495624_0010572 | 3300046690 | Bacteria | 6359 |
| 854 | Ga0495624_0092674 | 3300046690 | Bacteria | 1863 |
| 855 | Ga0495670_0001089 | 3300046691 | Bacteria | 13186 |
| 856 | Ga0495670_0005543 | 3300046691 | Bacteria | 6193 |
| 857 | Ga0495670_0019309 | 3300046691 | Bacteria | 3357 |
| 858 | Ga0495670_0047582 | 3300046691 | Bacteria | 2144 |
| 859 | Ga0495670_0372477 | 3300046691 | Bacteria | 770 |
| 860 | Ga0495671_0015738 | 3300046692 | Bacteria | 4046 |
| 861 | Ga0495671_0020734 | 3300046692 | Bacteria | 3461 |
| 862 | Ga0495671_0077926 | 3300046692 | Bacteria | 1625 |
| 863 | Ga0495671_0372002 | 3300046692 | Bacteria | 685 |
| 864 | Ga0495649_0011409 | 3300046694 | Bacteria | 5210 |
| 865 | Ga0495649_0257898 | 3300046694 | Bacteria | 894 |
| 866 | Ga0495589_0004951 | 3300046794 | Bacteria | 7057 |
| 867 | Ga0495589_0010017 | 3300046794 | Bacteria | 4925 |
| 868 | Ga0495589_0131309 | 3300046794 | Bacteria | 1202 |
| 869 | Ga0495589_0208108 | 3300046794 | Bacteria | 921 |
| 870 | Ga0495589_0212191 | 3300046794 | Bacteria | 911 |
| 871 | Ga0495600_0011193 | 3300046809 | Bacteria | 5587 |
| 872 | Ga0495600_0023168 | 3300046809 | Bacteria | 3993 |
| 873 | Ga0495600_0039428 | 3300046809 | Bacteria | 3076 |
| 874 | Ga0495600_0048000 | 3300046809 | Bacteria | 2785 |
| 875 | Ga0495600_0067624 | 3300046809 | Bacteria | 2335 |
| 876 | Ga0495600_0068092 | 3300046809 | Bacteria | 2326 |
| 877 | Ga0495600_0075333 | 3300046809 | Bacteria | 2204 |
| 878 | Ga0495600_0223029 | 3300046809 | Bacteria | 1205 |
| 879 | Ga0495600_0524975 | 3300046809 | Bacteria | 725 |
| 880 | Ga0495600_0627222 | 3300046809 | Bacteria | 651 |
| 881 | Ga0495660_0032243 | 3300046810 | Bacteria | 2942 |
| 882 | Ga0495660_0075529 | 3300046810 | Bacteria | 1777 |
| 883 | Ga0495660_0078646 | 3300046810 | Bacteria | 1733 |
| 884 | Ga0495581_0004731 | 3300047315 | Bacteria | 7857 |
| 885 | Ga0495581_0046724 | 3300047315 | Bacteria | 2502 |
| 886 | Ga0495581_0079416 | 3300047315 | Bacteria | 1899 |
| 887 | Ga0495581_0107931 | 3300047315 | Bacteria | 1618 |
| 888 | Ga0495581_0159590 | 3300047315 | Bacteria | 1318 |
| 889 | Ga0495581_0223767 | 3300047315 | Bacteria | 1100 |
| 890 | Ga0495604_0000177 | 3300047317 | Bacteria | 56559 |
| 891 | Ga0495604_0003367 | 3300047317 | Bacteria | 12746 |
| 892 | Ga0495604_0004088 | 3300047317 | Bacteria | 11597 |
| 893 | Ga0495604_0019851 | 3300047317 | Bacteria | 5376 |
| 894 | Ga0495604_0039597 | 3300047317 | Bacteria | 3704 |
| 895 | Ga0495604_0071034 | 3300047317 | Bacteria | 2634 |
| 896 | Ga0495604_0076542 | 3300047317 | Bacteria | 2516 |
| 897 | Ga0495636_0040070 | 3300047318 | Bacteria | 1941 |
| 898 | Ga0495636_0040514 | 3300047318 | Bacteria | 1931 |
| 899 | Ga0495674_0034278 | 3300047319 | Bacteria | 4591 |
| 900 | Ga0495674_0202244 | 3300047319 | Bacteria | 1647 |
| 901 | Ga0495674_0426141 | 3300047319 | Bacteria | 1068 |
| 902 | Ga0495676_0001703 | 3300047321 | Bacteria | 19187 |
| 903 | Ga0495676_0002684 | 3300047321 | Bacteria | 15938 |
| 904 | Ga0495676_0003140 | 3300047321 | Bacteria | 14944 |
| 905 | Ga0495676_0010228 | 3300047321 | Bacteria | 8517 |
| 906 | Ga0495676_0017921 | 3300047321 | Bacteria | 6250 |
| 907 | Ga0495676_0018690 | 3300047321 | Bacteria | 6112 |
| 908 | Ga0495676_0022031 | 3300047321 | Bacteria | 5552 |
| 909 | Ga0495676_0023083 | 3300047321 | Bacteria | 5403 |
| 910 | Ga0495676_0034376 | 3300047321 | Bacteria | 4255 |
| 911 | Ga0495676_0195827 | 3300047321 | Bacteria | 1407 |
| 912 | Ga0495676_0211980 | 3300047321 | Bacteria | 1339 |
| 913 | Ga0495680_0009283 | 3300047322 | Bacteria | 8861 |
| 914 | Ga0495680_0172222 | 3300047322 | Bacteria | 1567 |
| 915 | Ga0495683_0013015 | 3300047323 | Bacteria | 4357 |
| 916 | Ga0495683_0052642 | 3300047323 | Bacteria | 2031 |
| 917 | Ga0495683_0202465 | 3300047323 | Bacteria | 894 |
| 918 | Ga0495687_001373 | 3300047443 | Bacteria | 22509 |
| 919 | Ga0495687_003246 | 3300047443 | Bacteria | 12000 |
| 920 | Ga0495687_005687 | 3300047443 | Bacteria | 7865 |
| 921 | Ga0495687_017551 | 3300047443 | Bacteria | 3565 |
| 922 | Ga0495687_077168 | 3300047443 | Bacteria | 1316 |
| 923 | Ga0495687_078302 | 3300047443 | Bacteria | 1302 |
| 924 | Ga0495687_080675 | 3300047443 | Bacteria | 1275 |
| 925 | Ga0495687_126129 | 3300047443 | Bacteria | 914 |
| 926 | Ga0495675_0002820 | 3300047444 | Bacteria | 10415 |
| 927 | Ga0495675_0018072 | 3300047444 | Bacteria | 4470 |
| 928 | Ga0495675_0020811 | 3300047444 | Bacteria | 4175 |
| 929 | Ga0495675_0029988 | 3300047444 | Bacteria | 3470 |
| 930 | Ga0495675_0136786 | 3300047444 | Bacteria | 1520 |
| 931 | Ga0495675_0183725 | 3300047444 | Bacteria | 1279 |
| 932 | Ga0495675_0296879 | 3300047444 | Bacteria | 960 |
| 933 | Ga0495675_0351702 | 3300047444 | Bacteria | 866 |
| 934 | Ga0495675_0420466 | 3300047444 | Bacteria | 777 |
| 935 | Ga0495677_0078679 | 3300047445 | Bacteria | 1234 |
| 936 | Ga0495679_030402 | 3300047446 | Bacteria | 1753 |
| 937 | Ga0495685_000162 | 3300047447 | Bacteria | 22500 |
| 938 | Ga0495685_000439 | 3300047447 | Bacteria | 13091 |
| 939 | Ga0495685_000967 | 3300047447 | Bacteria | 8696 |
| 940 | Ga0495685_002093 | 3300047447 | Bacteria | 6203 |
| 941 | Ga0495685_007237 | 3300047447 | Bacteria | 3658 |
| 942 | Ga0495685_029355 | 3300047447 | Bacteria | 1890 |
| 943 | Ga0495685_094687 | 3300047447 | Bacteria | 988 |
| 944 | Ga0495685_104305 | 3300047447 | Bacteria | 935 |
| 945 | Ga0495685_185862 | 3300047447 | Bacteria | 668 |
| 946 | Ga0495681_0000410 | 3300047470 | Bacteria | 33110 |
| 947 | Ga0495681_0001965 | 3300047470 | Bacteria | 15030 |
| 948 | Ga0495681_0004423 | 3300047470 | Bacteria | 9587 |
| 949 | Ga0495681_0010645 | 3300047470 | Bacteria | 5557 |
| 950 | Ga0495681_0025985 | 3300047470 | Bacteria | 3057 |
| 951 | Ga0495681_0043283 | 3300047470 | Bacteria | 2172 |
| 952 | Ga0495684_0025204 | 3300047471 | Bacteria | 4572 |
| 953 | Ga0495684_0078490 | 3300047471 | Bacteria | 2506 |
| 954 | Ga0495684_0258499 | 3300047471 | Bacteria | 1264 |
| 955 | Ga0495684_0562852 | 3300047471 | Bacteria | 774 |
| 956 | Ga0495686_0008060 | 3300047472 | Bacteria | 7801 |
| 957 | Ga0495686_0017780 | 3300047472 | Bacteria | 4785 |
| 958 | Ga0495686_0027431 | 3300047472 | Bacteria | 3718 |
| 959 | Ga0495686_0145293 | 3300047472 | Bacteria | 1396 |
| 960 | Ga0495686_0309832 | 3300047472 | Bacteria | 868 |
| 961 | Ga0495593_0001603 | 3300047673 | Bacteria | 13363 |
| 962 | Ga0495593_0002856 | 3300047673 | Bacteria | 10408 |
| 963 | Ga0495593_0050415 | 3300047673 | Bacteria | 2205 |
| 964 | Ga0495602_0016479 | 3300048088 | Bacteria | 7432 |
| 965 | Ga0495602_0065869 | 3300048088 | Bacteria | 3124 |
| 966 | Ga0495602_0118111 | 3300048088 | Bacteria | 2139 |
| 967 | Ga0495602_0456700 | 3300048088 | Bacteria | 901 |
| 968 | Ga0495614_0000918 | 3300048089 | Bacteria | 12564 |
| 969 | Ga0495614_0004063 | 3300048089 | Bacteria | 6577 |
| 970 | Ga0495614_0007730 | 3300048089 | Bacteria | 4777 |
| 971 | Ga0495614_0046084 | 3300048089 | Bacteria | 1869 |
| 972 | Ga0495614_0150998 | 3300048089 | Bacteria | 1036 |
| 973 | Ga0495626_0009504 | 3300048091 | Bacteria | 5253 |
| 974 | Ga0496100_0724208 | 3300048903 | Bacteria | 777 |
| 975 | Ga0496101_0169241 | 3300048904 | Bacteria | 1679 |
| 976 | Ga0496101_0592341 | 3300048904 | Bacteria | 877 |
| 977 | Ga0496102_0055630 | 3300048905 | Bacteria | 3608 |
| 978 | Ga0496102_0102413 | 3300048905 | Bacteria | 2662 |
| 979 | Ga0496103_0033755 | 3300048906 | Bacteria | 3127 |
| 980 | Ga0496104_0186281 | 3300048907 | Bacteria | 1986 |
| 981 | Ga0496104_0403489 | 3300048907 | Bacteria | 1279 |
| 982 | Ga0496105_0267987 | 3300048908 | Bacteria | 1380 |
| 983 | Ga0496106_0001704 | 3300048909 | Bacteria | 16439 |
| 984 | Ga0496106_0488473 | 3300048909 | Bacteria | 989 |
| 985 | Ga0496107_0390521 | 3300048910 | Bacteria | 1035 |
| 986 | Ga0496108_0049234 | 3300048911 | Bacteria | 3524 |
| 987 | Ga0496109_0001113 | 3300048912 | Bacteria | 22299 |
| 988 | Ga0496109_0023882 | 3300048912 | Bacteria | 5429 |
| 989 | Ga0496109_0051561 | 3300048912 | Bacteria | 3748 |
| 990 | Ga0496109_0121053 | 3300048912 | Bacteria | 2438 |
| 991 | Ga0496109_0231947 | 3300048912 | Bacteria | 1737 |
| 992 | Ga0496109_0326546 | 3300048912 | Bacteria | 1448 |
| 993 | Ga0496110_0054541 | 3300048913 | Bacteria | 3516 |
| 994 | Ga0496110_0066541 | 3300048913 | Bacteria | 3187 |
| 995 | Ga0496112_0171137 | 3300048915 | Bacteria | 2137 |
| 996 | Ga0496113_0187461 | 3300048916 | Bacteria | 1641 |
| 997 | Ga0496113_0500702 | 3300048916 | Bacteria | 975 |
| 998 | Ga0496113_0656493 | 3300048916 | Bacteria | 839 |
| 999 | Ga0496114_0127717 | 3300048917 | Bacteria | 2193 |
| 1000 | Ga0496115_0503837 | 3300048918 | Bacteria | 973 |
| 1001 | Ga0496118_0080260 | 3300048921 | Bacteria | 2297 |
| 1002 | Ga0496119_0117243 | 3300048922 | Bacteria | 1468 |
| 1003 | Ga0496120_0000365 | 3300048923 | Bacteria | 73526 |
| 1004 | Ga0496121_0000705 | 3300048924 | Bacteria | 62174 |
| 1005 | Ga0496121_0006724 | 3300048924 | Bacteria | 14115 |
| 1006 | Ga0496122_0005418 | 3300048925 | Bacteria | 15216 |
| 1007 | Ga0496123_0040721 | 3300048926 | Bacteria | 3231 |
| 1008 | Ga0496126_0096293 | 3300048929 | Bacteria | 2595 |
| 1009 | Ga0501306_037732 | 3300049127 | Bacteria | 740 |
| 1010 | Ga0501306_055935 | 3300049127 | Bacteria | 642 |
| 1011 | Ga0501310_039625 | 3300049130 | Bacteria | 652 |
| 1012 | Ga0501304_016441 | 3300049160 | Bacteria | 700 |
| 1013 | Ga0501305_054025 | 3300049161 | Bacteria | 680 |
| 1014 | Ga0495678_024008 | 3300049459 | Bacteria | 2640 |
| 1015 | Ga0495678_029142 | 3300049459 | Bacteria | 2321 |
| 1016 | Ga0495682_0017031 | 3300049460 | Bacteria | 2748 |
| 1017 | Ga0495682_0034481 | 3300049460 | Bacteria | 1866 |
| 1018 | Ga0501291_044619 | 3300049514 | Bacteria | 790 |
| 1019 | Ga0501311_052374 | 3300049527 | Bacteria | 642 |
| 1020 | Ga0501314_026889 | 3300049530 | Bacteria | 625 |
| 1021 | Ga0501315_043164 | 3300049531 | Bacteria | 688 |
| 1022 | Ga0501316_048241 | 3300049532 | Bacteria | 608 |
| 1023 | Ga0501318_027489 | 3300049534 | Bacteria | 757 |
| 1024 | Ga0501318_032778 | 3300049534 | Bacteria | 714 |
| 1025 | Ga0501318_049895 | 3300049534 | Bacteria | 620 |
| 1026 | Ga0501321_025524 | 3300049537 | Bacteria | 762 |
| 1027 | Ga0501321_037579 | 3300049537 | Bacteria | 670 |
| 1028 | Ga0501323_016978 | 3300049539 | Bacteria | 932 |
| 1029 | Ga0501031_0001023 | 3300049568 | Bacteria | 16953 |
| 1030 | Ga0501031_0001503 | 3300049568 | Bacteria | 14525 |
| 1031 | Ga0501031_0001677 | 3300049568 | Bacteria | 13908 |
| 1032 | Ga0501031_0005943 | 3300049568 | Bacteria | 7961 |
| 1033 | Ga0501031_0028629 | 3300049568 | Bacteria | 3632 |
| 1034 | Ga0501031_0155120 | 3300049568 | Bacteria | 1496 |
| 1035 | Ga0501031_0163683 | 3300049568 | Bacteria | 1454 |
| 1036 | Ga0501032_0000915 | 3300049569 | Bacteria | 23862 |
| 1037 | Ga0501032_0005078 | 3300049569 | Bacteria | 9829 |
| 1038 | Ga0501032_0007555 | 3300049569 | Bacteria | 7938 |
| 1039 | Ga0501032_0008981 | 3300049569 | Bacteria | 7269 |
| 1040 | Ga0501032_0015456 | 3300049569 | Bacteria | 5383 |
| 1041 | Ga0501032_0033624 | 3300049569 | Bacteria | 3512 |
| 1042 | Ga0501032_0087497 | 3300049569 | Bacteria | 2069 |
| 1043 | Ga0501032_0338718 | 3300049569 | Bacteria | 969 |
| 1044 | Ga0501032_0397429 | 3300049569 | Bacteria | 885 |
| 1045 | Ga0501033_0001038 | 3300049570 | Bacteria | 25291 |
| 1046 | Ga0501033_0007204 | 3300049570 | Bacteria | 8680 |
| 1047 | Ga0501033_0009061 | 3300049570 | Bacteria | 7677 |
| 1048 | Ga0501033_0022971 | 3300049570 | Bacteria | 4701 |
| 1049 | Ga0501033_0052450 | 3300049570 | Bacteria | 3022 |
| 1050 | Ga0501033_0070118 | 3300049570 | Bacteria | 2575 |
| 1051 | Ga0501033_0167251 | 3300049570 | Bacteria | 1580 |
| 1052 | Ga0501033_0168504 | 3300049570 | Bacteria | 1573 |
| 1053 | Ga0501033_0180650 | 3300049570 | Bacteria | 1512 |
| 1054 | Ga0501033_0281625 | 3300049570 | Bacteria | 1173 |
| 1055 | Ga0501033_0295927 | 3300049570 | Bacteria | 1140 |
| 1056 | Ga0501033_0314083 | 3300049570 | Bacteria | 1101 |
| 1057 | Ga0501034_0002021 | 3300049571 | Bacteria | 25537 |
| 1058 | Ga0501034_0006741 | 3300049571 | Bacteria | 12296 |
| 1059 | Ga0501034_0009862 | 3300049571 | Bacteria | 9987 |
| 1060 | Ga0501034_0011799 | 3300049571 | Bacteria | 9043 |
| 1061 | Ga0501034_0013420 | 3300049571 | Bacteria | 8432 |
| 1062 | Ga0501034_0018411 | 3300049571 | Bacteria | 7162 |
| 1063 | Ga0501034_0020012 | 3300049571 | Bacteria | 6835 |
| 1064 | Ga0501034_0040703 | 3300049571 | Bacteria | 4703 |
| 1065 | Ga0501034_0042572 | 3300049571 | Bacteria | 4597 |
| 1066 | Ga0501034_0074676 | 3300049571 | Bacteria | 3398 |
| 1067 | Ga0501034_0547857 | 3300049571 | Bacteria | 1066 |
| 1068 | Ga0501034_1149076 | 3300049571 | Bacteria | 656 |
| 1069 | Ga0501036_0001728 | 3300049572 | Bacteria | 16975 |
| 1070 | Ga0501036_0003039 | 3300049572 | Bacteria | 13363 |
| 1071 | Ga0501036_0003195 | 3300049572 | Bacteria | 13083 |
| 1072 | Ga0501036_0012967 | 3300049572 | Bacteria | 6919 |
| 1073 | Ga0501036_0017577 | 3300049572 | Bacteria | 5981 |
| 1074 | Ga0501036_0024372 | 3300049572 | Bacteria | 5099 |
| 1075 | Ga0501036_0078096 | 3300049572 | Bacteria | 2800 |
| 1076 | Ga0501036_0111691 | 3300049572 | Bacteria | 2309 |
| 1077 | Ga0501036_0241662 | 3300049572 | Bacteria | 1514 |
| 1078 | Ga0501036_0377315 | 3300049572 | Bacteria | 1183 |
| 1079 | Ga0501037_0000823 | 3300049573 | Bacteria | 23178 |
| 1080 | Ga0501037_0001454 | 3300049573 | Bacteria | 17404 |
| 1081 | Ga0501037_0011852 | 3300049573 | Bacteria | 6420 |
| 1082 | Ga0501037_0015772 | 3300049573 | Bacteria | 5559 |
| 1083 | Ga0501037_0026992 | 3300049573 | Bacteria | 4243 |
| 1084 | Ga0501037_0041411 | 3300049573 | Bacteria | 3387 |
| 1085 | Ga0501037_0094396 | 3300049573 | Bacteria | 2163 |
| 1086 | Ga0501037_0107518 | 3300049573 | Bacteria | 2010 |
| 1087 | Ga0501037_0170421 | 3300049573 | Bacteria | 1547 |
| 1088 | Ga0501037_0224601 | 3300049573 | Bacteria | 1320 |
| 1089 | Ga0501037_0550748 | 3300049573 | Bacteria | 778 |
| 1090 | Ga0501038_0000988 | 3300049574 | Bacteria | 25564 |
| 1091 | Ga0501038_0003374 | 3300049574 | Bacteria | 14894 |
| 1092 | Ga0501038_0006805 | 3300049574 | Bacteria | 10560 |
| 1093 | Ga0501038_0011419 | 3300049574 | Bacteria | 8106 |
| 1094 | Ga0501038_0018256 | 3300049574 | Bacteria | 6332 |
| 1095 | Ga0501038_0033410 | 3300049574 | Bacteria | 4532 |
| 1096 | Ga0501038_0034992 | 3300049574 | Bacteria | 4413 |
| 1097 | Ga0501038_0166360 | 3300049574 | Bacteria | 1788 |
| 1098 | Ga0501038_0169347 | 3300049574 | Bacteria | 1769 |
| 1099 | Ga0501038_0262537 | 3300049574 | Bacteria | 1364 |
| 1100 | Ga0501038_0354338 | 3300049574 | Bacteria | 1142 |
| 1101 | Ga0501038_0680462 | 3300049574 | Bacteria | 772 |
| 1102 | Ga0501039_0004713 | 3300049575 | Bacteria | 10325 |
| 1103 | Ga0501039_0030437 | 3300049575 | Bacteria | 4162 |
| 1104 | Ga0501039_0048652 | 3300049575 | Bacteria | 3277 |
| 1105 | Ga0501039_0052460 | 3300049575 | Bacteria | 3156 |
| 1106 | Ga0501039_0062998 | 3300049575 | Bacteria | 2873 |
| 1107 | Ga0501039_0085215 | 3300049575 | Bacteria | 2462 |
| 1108 | Ga0501039_0270591 | 3300049575 | Bacteria | 1335 |
| 1109 | Ga0501039_0364588 | 3300049575 | Bacteria | 1135 |
| 1110 | Ga0501040_0010344 | 3300049576 | Bacteria | 6099 |
| 1111 | Ga0501040_0020613 | 3300049576 | Bacteria | 4394 |
| 1112 | Ga0501040_0027254 | 3300049576 | Bacteria | 3845 |
| 1113 | Ga0501041_0001251 | 3300049577 | Bacteria | 13929 |
| 1114 | Ga0501041_0001328 | 3300049577 | Bacteria | 13604 |
| 1115 | Ga0501041_0028682 | 3300049577 | Bacteria | 3357 |
| 1116 | Ga0501042_0008300 | 3300049578 | Bacteria | 6847 |
| 1117 | Ga0501042_0012241 | 3300049578 | Bacteria | 5805 |
| 1118 | Ga0501042_0013832 | 3300049578 | Bacteria | 5496 |
| 1119 | Ga0501042_0023191 | 3300049578 | Bacteria | 4340 |
| 1120 | Ga0501042_0055951 | 3300049578 | Bacteria | 2815 |
| 1121 | Ga0501042_0057857 | 3300049578 | Bacteria | 2766 |
| 1122 | Ga0501042_0901765 | 3300049578 | Bacteria | 644 |
| 1123 | Ga0501043_0000870 | 3300049579 | Bacteria | 26774 |
| 1124 | Ga0501043_0000941 | 3300049579 | Bacteria | 25840 |
| 1125 | Ga0501043_0009251 | 3300049579 | Bacteria | 7741 |
| 1126 | Ga0501043_0015452 | 3300049579 | Bacteria | 5979 |
| 1127 | Ga0501043_0016524 | 3300049579 | Bacteria | 5784 |
| 1128 | Ga0501043_0016576 | 3300049579 | Bacteria | 5774 |
| 1129 | Ga0501043_0023105 | 3300049579 | Bacteria | 4877 |
| 1130 | Ga0501043_0048623 | 3300049579 | Bacteria | 3334 |
| 1131 | Ga0501043_0060231 | 3300049579 | Bacteria | 2980 |
| 1132 | Ga0501043_0069846 | 3300049579 | Bacteria | 2759 |
| 1133 | Ga0501043_0147684 | 3300049579 | Bacteria | 1840 |
| 1134 | Ga0501043_0172312 | 3300049579 | Bacteria | 1688 |
| 1135 | Ga0501043_0178393 | 3300049579 | Bacteria | 1655 |
| 1136 | Ga0501046_0008006 | 3300049580 | Bacteria | 9237 |
| 1137 | Ga0501046_0014862 | 3300049580 | Bacteria | 6553 |
| 1138 | Ga0501046_0019657 | 3300049580 | Bacteria | 5597 |
| 1139 | Ga0501046_0026133 | 3300049580 | Bacteria | 4769 |
| 1140 | Ga0501046_0029767 | 3300049580 | Bacteria | 4437 |
| 1141 | Ga0501046_0040251 | 3300049580 | Bacteria | 3736 |
| 1142 | Ga0501046_0082510 | 3300049580 | Bacteria | 2483 |
| 1143 | Ga0501046_0137267 | 3300049580 | Bacteria | 1852 |
| 1144 | Ga0501047_0000056 | 3300049581 | Bacteria | 143501 |
| 1145 | Ga0501047_0000075 | 3300049581 | Bacteria | 124995 |
| 1146 | Ga0501047_0000280 | 3300049581 | Bacteria | 59132 |
| 1147 | Ga0501047_0000778 | 3300049581 | Bacteria | 33367 |
| 1148 | Ga0501047_0012542 | 3300049581 | Bacteria | 8025 |
| 1149 | Ga0501047_0014223 | 3300049581 | Bacteria | 7563 |
| 1150 | Ga0501047_0018440 | 3300049581 | Bacteria | 6690 |
| 1151 | Ga0501047_0019492 | 3300049581 | Bacteria | 6506 |
| 1152 | Ga0501047_0034389 | 3300049581 | Bacteria | 4893 |
| 1153 | Ga0501047_0039577 | 3300049581 | Bacteria | 4560 |
| 1154 | Ga0501047_0042679 | 3300049581 | Bacteria | 4382 |
| 1155 | Ga0501047_0044183 | 3300049581 | Bacteria | 4304 |
| 1156 | Ga0501047_0064798 | 3300049581 | Bacteria | 3524 |
| 1157 | Ga0501047_0070452 | 3300049581 | Bacteria | 3367 |
| 1158 | Ga0501047_0077462 | 3300049581 | Bacteria | 3198 |
| 1159 | Ga0501047_0197648 | 3300049581 | Bacteria | 1872 |
| 1160 | Ga0501047_0259630 | 3300049581 | Bacteria | 1585 |
| 1161 | Ga0501047_0698611 | 3300049581 | Bacteria | 832 |
| 1162 | Ga0501047_0755527 | 3300049581 | Bacteria | 788 |
| 1163 | Ga0501048_0003653 | 3300049582 | Bacteria | 11719 |
| 1164 | Ga0501048_0004349 | 3300049582 | Bacteria | 10780 |
| 1165 | Ga0501048_0009856 | 3300049582 | Bacteria | 7163 |
| 1166 | Ga0501048_0019118 | 3300049582 | Bacteria | 5031 |
| 1167 | Ga0501048_0025962 | 3300049582 | Bacteria | 4266 |
| 1168 | Ga0501048_0054156 | 3300049582 | Bacteria | 2850 |
| 1169 | Ga0501048_0312177 | 3300049582 | Bacteria | 1119 |
| 1170 | Ga0501067_0000777 | 3300049583 | Bacteria | 17138 |
| 1171 | Ga0501067_0001336 | 3300049583 | Bacteria | 13370 |
| 1172 | Ga0501067_0002496 | 3300049583 | Bacteria | 10166 |
| 1173 | Ga0501068_0000625 | 3300049584 | Bacteria | 18053 |
| 1174 | Ga0501068_0001060 | 3300049584 | Bacteria | 14554 |
| 1175 | Ga0501068_0001907 | 3300049584 | Bacteria | 11089 |
| 1176 | Ga0501069_0007297 | 3300049585 | Bacteria | 5797 |
| 1177 | Ga0501069_0108348 | 3300049585 | Bacteria | 1580 |
| 1178 | Ga0501070_0002871 | 3300049586 | Bacteria | 15008 |
| 1179 | Ga0501070_0039350 | 3300049586 | Bacteria | 3944 |
| 1180 | Ga0501070_0045144 | 3300049586 | Bacteria | 3665 |
| 1181 | Ga0501070_0058402 | 3300049586 | Bacteria | 3198 |
| 1182 | Ga0501070_0060963 | 3300049586 | Bacteria | 3126 |
| 1183 | Ga0501070_0083801 | 3300049586 | Bacteria | 2639 |
| 1184 | Ga0501070_0479562 | 3300049586 | Bacteria | 1000 |
| 1185 | Ga0501070_0546971 | 3300049586 | Bacteria | 927 |
| 1186 | Ga0501071_0001568 | 3300049587 | Bacteria | 13369 |
| 1187 | Ga0501071_0001769 | 3300049587 | Bacteria | 12735 |
| 1188 | Ga0501071_0002013 | 3300049587 | Bacteria | 12158 |
| 1189 | Ga0501071_0414083 | 3300049587 | Bacteria | 1030 |
| 1190 | Ga0501072_0000945 | 3300049588 | Bacteria | 21381 |
| 1191 | Ga0501072_0002882 | 3300049588 | Bacteria | 12933 |
| 1192 | Ga0501073_0012792 | 3300049589 | Bacteria | 6120 |
| 1193 | Ga0501073_0016315 | 3300049589 | Bacteria | 5382 |
| 1194 | Ga0501073_0033930 | 3300049589 | Bacteria | 3632 |
| 1195 | Ga0501073_0270782 | 3300049589 | Bacteria | 1172 |
| 1196 | Ga0501074_0002531 | 3300049590 | Bacteria | 12756 |
| 1197 | Ga0501074_0005345 | 3300049590 | Bacteria | 9231 |
| 1198 | Ga0501074_0030555 | 3300049590 | Bacteria | 3903 |
| 1199 | Ga0501074_0144448 | 3300049590 | Bacteria | 1701 |
| 1200 | Ga0501074_0452429 | 3300049590 | Bacteria | 910 |
| 1201 | Ga0501075_0354392 | 3300049591 | Bacteria | 1118 |
| 1202 | Ga0501076_0031304 | 3300049592 | Bacteria | 4148 |
| 1203 | Ga0501076_0042982 | 3300049592 | Bacteria | 3560 |
| 1204 | Ga0501076_0305030 | 3300049592 | Bacteria | 1305 |
| 1205 | Ga0501077_0017810 | 3300049593 | Bacteria | 4488 |
| 1206 | Ga0501077_0024007 | 3300049593 | Bacteria | 3869 |
| 1207 | Ga0501077_0064793 | 3300049593 | Bacteria | 2318 |
| 1208 | Ga0501235_027790 | 3300049669 | Bacteria | 1270 |
| 1209 | Ga0501257_064466 | 3300049686 | Bacteria | 929 |
| 1210 | Ga0501079_0024430 | 3300049741 | Bacteria | 4636 |
| 1211 | Ga0501079_0036399 | 3300049741 | Bacteria | 3791 |
| 1212 | Ga0501080_0033549 | 3300049742 | Bacteria | 4791 |
| 1213 | Ga0501080_0058977 | 3300049742 | Bacteria | 3572 |
| 1214 | Ga0501080_0131477 | 3300049742 | Bacteria | 2317 |
| 1215 | Ga0501080_0301538 | 3300049742 | Bacteria | 1453 |
| 1216 | Ga0501080_0990165 | 3300049742 | Bacteria | 730 |
| 1217 | Ga0501083_0003122 | 3300049744 | Bacteria | 11522 |
| 1218 | Ga0501083_0019932 | 3300049744 | Bacteria | 4667 |
| 1219 | Ga0501083_0043858 | 3300049744 | Bacteria | 3028 |
| 1220 | Ga0501083_0230932 | 3300049744 | Bacteria | 1205 |
| 1221 | Ga0501035_0001147 | 3300049822 | Bacteria | 27697 |
| 1222 | Ga0501035_0004811 | 3300049822 | Bacteria | 12797 |
| 1223 | Ga0501035_0009561 | 3300049822 | Bacteria | 9014 |
| 1224 | Ga0501035_0010897 | 3300049822 | Bacteria | 8418 |
| 1225 | Ga0501035_0011412 | 3300049822 | Bacteria | 8237 |
| 1226 | Ga0501035_0012695 | 3300049822 | Bacteria | 7783 |
| 1227 | Ga0501035_0020699 | 3300049822 | Bacteria | 6046 |
| 1228 | Ga0501035_0024019 | 3300049822 | Bacteria | 5593 |
| 1229 | Ga0501035_0029703 | 3300049822 | Bacteria | 4985 |
| 1230 | Ga0501035_0038641 | 3300049822 | Bacteria | 4321 |
| 1231 | Ga0501035_0039002 | 3300049822 | Bacteria | 4300 |
| 1232 | Ga0501035_0039258 | 3300049822 | Bacteria | 4284 |
| 1233 | Ga0501035_0146248 | 3300049822 | Bacteria | 2052 |
| 1234 | Ga0501035_0155730 | 3300049822 | Bacteria | 1980 |
| 1235 | Ga0501035_0214567 | 3300049822 | Bacteria | 1645 |
| 1236 | Ga0501035_0626144 | 3300049822 | Bacteria | 874 |
| 1237 | Ga0501035_1161759 | 3300049822 | Bacteria | 600 |
| 1238 | Ga0501044_0002369 | 3300049823 | Bacteria | 21458 |
| 1239 | Ga0501044_0003629 | 3300049823 | Bacteria | 17366 |
| 1240 | Ga0501044_0005864 | 3300049823 | Bacteria | 13606 |
| 1241 | Ga0501044_0009001 | 3300049823 | Bacteria | 10921 |
| 1242 | Ga0501044_0012223 | 3300049823 | Bacteria | 9294 |
| 1243 | Ga0501044_0016619 | 3300049823 | Bacteria | 7899 |
| 1244 | Ga0501044_0022810 | 3300049823 | Bacteria | 6666 |
| 1245 | Ga0501044_0033562 | 3300049823 | Bacteria | 5392 |
| 1246 | Ga0501044_0050034 | 3300049823 | Bacteria | 4313 |
| 1247 | Ga0501044_0050626 | 3300049823 | Bacteria | 4284 |
| 1248 | Ga0501044_0054717 | 3300049823 | Bacteria | 4100 |
| 1249 | Ga0501044_0080129 | 3300049823 | Bacteria | 3307 |
| 1250 | Ga0501044_0099562 | 3300049823 | Bacteria | 2925 |
| 1251 | Ga0501044_0126185 | 3300049823 | Bacteria | 2556 |
| 1252 | Ga0501044_0126805 | 3300049823 | Bacteria | 2549 |
| 1253 | Ga0501044_0248080 | 3300049823 | Bacteria | 1722 |
| 1254 | Ga0501044_0262391 | 3300049823 | Bacteria | 1665 |
| 1255 | Ga0501044_0270165 | 3300049823 | Bacteria | 1636 |
| 1256 | Ga0501044_0338723 | 3300049823 | Bacteria | 1425 |
| 1257 | Ga0501044_0348867 | 3300049823 | Bacteria | 1400 |
| 1258 | Ga0501044_0507657 | 3300049823 | Bacteria | 1106 |
| 1259 | Ga0501044_0933111 | 3300049823 | Bacteria | 742 |
| 1260 | Ga0501045_0023726 | 3300049824 | Bacteria | 4400 |
| 1261 | Ga0501045_0031069 | 3300049824 | Bacteria | 3867 |
| 1262 | Ga0501045_0057544 | 3300049824 | Bacteria | 2844 |
| 1263 | Ga0501045_0213018 | 3300049824 | Bacteria | 1439 |
| 1264 | Ga0501045_0262205 | 3300049824 | Bacteria | 1286 |
| 1265 | nmdc:mga03n38_13687_c1 | 3300050490 | Bacteria | 3089 |
| 1266 | nmdc:mga03n38_159079_c1 | 3300050490 | Bacteria | 1142 |
| 1267 | nmdc:mga03n38_78328_c1 | 3300050490 | Bacteria | 1547 |
| 1268 | nmdc:mga00v17_26724_c2 | 3300050491 | Bacteria | 1050 |
| 1269 | nmdc:mga00v17_41102_c1 | 3300050491 | Bacteria | 2776 |
| 1270 | nmdc:mga00v17_517641_c1 | 3300050491 | Bacteria | 773 |
| 1271 | nmdc:mga06z11_162486_c1 | 3300050494 | Bacteria | 1277 |
| 1272 | nmdc:mga06z11_903_c1 | 3300050494 | Bacteria | 10791 |
| 1273 | nmdc:mga04h51_9676_c1 | 3300050495 | Bacteria | 2623 |
| 1274 | nmdc:mga07m45_101330_c1 | 3300050496 | Bacteria | 1653 |
| 1275 | nmdc:mga07m45_151869_c1 | 3300050496 | Bacteria | 1343 |
| 1276 | nmdc:mga07m45_259062_c1 | 3300050496 | Bacteria | 1012 |
| 1277 | nmdc:mga09592_846225_c1 | 3300050508 | Bacteria | 772 |
| 1278 | nmdc:mga08y16_154699_c1 | 3300050511 | Bacteria | 2383 |
| 1279 | nmdc:mga08y16_32291_c1 | 3300050511 | Bacteria | 5505 |
| 1280 | nmdc:mga08y16_435128_c1 | 3300050511 | Bacteria | 1339 |
| 1281 | nmdc:mga08y16_628517_c1 | 3300050511 | Bacteria | 1080 |
| 1282 | nmdc:mga08y16_911139_c1 | 3300050511 | Bacteria | 865 |
| 1283 | nmdc:mga08y16_9548_c1 | 3300050511 | Bacteria | 10183 |
| 1284 | nmdc:mga0n895_852226_c1 | 3300050512 | Bacteria | 899 |
| 1285 | nmdc:mga0sz30_334606_c1 | 3300050516 | Bacteria | 676 |
| 1286 | Ga0495601_0003963 | 3300053077 | Bacteria | 8526 |
| 1287 | Ga0495612_0174188 | 3300053078 | Bacteria | 943 |
| 1288 | Ga0500610_0036313 | 3300053079 | Bacteria | 2533 |
| 1289 | Ga0500610_0046147 | 3300053079 | Bacteria | 2262 |
| 1290 | Ga0500610_0158688 | 3300053079 | Bacteria | 1127 |
| 1291 | Ga0495655_0023071 | 3300053083 | Bacteria | 1430 |
| 1292 | Ga0495655_0050485 | 3300053083 | Bacteria | 1099 |
| 1293 | Ga0495655_0157483 | 3300053083 | Bacteria | 718 |
| 1294 | Ga0495619_0155993 | 3300053085 | Bacteria | 1575 |
| 1295 | Ga0500578_0012302 | 3300053086 | Bacteria | 5526 |
| 1296 | Ga0500578_0160956 | 3300053086 | Bacteria | 1392 |
| 1297 | Ga0500643_000132 | 3300053087 | Bacteria | 76916 |
| 1298 | Ga0500644_0116020 | 3300053088 | Bacteria | 1037 |
| 1299 | Ga0500646_0013621 | 3300053090 | Bacteria | 2105 |
| 1300 | Ga0500583_0096220 | 3300053092 | Bacteria | 1446 |
| 1301 | Ga0500583_0273240 | 3300053092 | Bacteria | 831 |
| 1302 | Ga0500566_0012307 | 3300053094 | Bacteria | 5037 |
| 1303 | Ga0500640_021639 | 3300053095 | Bacteria | 2775 |
| 1304 | Ga0500640_095604 | 3300053095 | Bacteria | 1236 |
| 1305 | Ga0500641_0154828 | 3300053096 | Bacteria | 989 |
| 1306 | Ga0500650_0336738 | 3300053098 | Bacteria | 662 |
| 1307 | Ga0500654_050515 | 3300053099 | Bacteria | 2244 |
| 1308 | Ga0500654_079864 | 3300053099 | Bacteria | 1532 |
| 1309 | Ga0500660_027388 | 3300053100 | Bacteria | 2997 |
| 1310 | Ga0500660_129093 | 3300053100 | Bacteria | 1032 |
| 1311 | Ga0500553_054950 | 3300053101 | Bacteria | 1893 |
| 1312 | Ga0500553_138559 | 3300053101 | Bacteria | 964 |
| 1313 | Ga0500560_000196 | 3300053107 | Bacteria | 7160 |
| 1314 | Ga0500560_019942 | 3300053107 | Bacteria | 1894 |
| 1315 | Ga0500569_000083 | 3300053109 | Bacteria | 15479 |
| 1316 | Ga0500569_002256 | 3300053109 | Bacteria | 3772 |
| 1317 | Ga0500569_068123 | 3300053109 | Bacteria | 1114 |
| 1318 | Ga0500572_099043 | 3300053111 | Bacteria | 930 |
| 1319 | Ga0500608_124280 | 3300053122 | Bacteria | 1166 |
| 1320 | Ga0500621_056764 | 3300053126 | Bacteria | 1583 |
| 1321 | Ga0500621_089446 | 3300053126 | Bacteria | 1226 |
| 1322 | Ga0500628_000379 | 3300053129 | Bacteria | 8421 |
| 1323 | Ga0500628_003563 | 3300053129 | Bacteria | 2573 |
| 1324 | Ga0500628_008605 | 3300053129 | Bacteria | 1780 |
| 1325 | Ga0500652_000875 | 3300053131 | Bacteria | 9971 |
| 1326 | Ga0500652_015462 | 3300053131 | Bacteria | 2754 |
| 1327 | Ga0500652_016648 | 3300053131 | Bacteria | 2680 |
| 1328 | Ga0500658_0002463 | 3300053134 | Bacteria | 7157 |
| 1329 | Ga0500658_0004327 | 3300053134 | Bacteria | 5322 |
| 1330 | Ga0500658_0007089 | 3300053134 | Bacteria | 4148 |
| 1331 | Ga0500658_0069850 | 3300053134 | Bacteria | 1479 |
| 1332 | Ga0500559_0180921 | 3300053136 | Bacteria | 993 |
| 1333 | Ga0500561_0002687 | 3300053137 | Bacteria | 3018 |
| 1334 | Ga0500561_0008072 | 3300053137 | Bacteria | 2081 |
| 1335 | Ga0500561_0011160 | 3300053137 | Bacteria | 1881 |
| 1336 | Ga0500573_0017433 | 3300053140 | Bacteria | 4089 |
| 1337 | Ga0500573_0081381 | 3300053140 | Bacteria | 1840 |
| 1338 | Ga0500573_0358265 | 3300053140 | Bacteria | 706 |
| 1339 | Ga0500577_0079106 | 3300053142 | Bacteria | 1307 |
| 1340 | Ga0500577_0081351 | 3300053142 | Bacteria | 1292 |
| 1341 | Ga0500579_010911 | 3300053143 | Bacteria | 5805 |
| 1342 | Ga0500579_030592 | 3300053143 | Bacteria | 3455 |
| 1343 | Ga0500579_082473 | 3300053143 | Bacteria | 1789 |
| 1344 | Ga0500600_0003115 | 3300053149 | Bacteria | 9482 |
| 1345 | Ga0500600_0152721 | 3300053149 | Bacteria | 1146 |
| 1346 | Ga0500600_0204768 | 3300053149 | Bacteria | 926 |
| 1347 | Ga0500604_0003384 | 3300053151 | Bacteria | 4289 |
| 1348 | Ga0500616_0000145 | 3300053153 | Bacteria | 120927 |
| 1349 | Ga0500616_0006393 | 3300053153 | Bacteria | 7724 |
| 1350 | Ga0500616_0010512 | 3300053153 | Bacteria | 5534 |
| 1351 | Ga0500616_0052292 | 3300053153 | Bacteria | 2148 |
| 1352 | Ga0500624_023600 | 3300053157 | Bacteria | 1009 |
| 1353 | Ga0500633_0000640 | 3300053160 | Bacteria | 5823 |
| 1354 | Ga0500633_0000723 | 3300053160 | Bacteria | 5607 |
| 1355 | Ga0500633_0001014 | 3300053160 | Bacteria | 4990 |
| 1356 | Ga0500633_0010752 | 3300053160 | Bacteria | 2464 |
| 1357 | Ga0500634_0000287 | 3300053161 | Bacteria | 16181 |
| 1358 | Ga0500634_0017507 | 3300053161 | Bacteria | 3836 |
| 1359 | Ga0500634_0037432 | 3300053161 | Bacteria | 2638 |
| 1360 | Ga0500634_0194028 | 3300053161 | Bacteria | 899 |
| 1361 | Ga0500636_0337546 | 3300053177 | Bacteria | 725 |
| 1362 | Ga0500656_003712 | 3300053732 | Bacteria | 1439 |
| 1363 | Ga0500656_004175 | 3300053732 | Bacteria | 1386 |
| 1364 | Ga0500587_001407 | 3300053739 | Bacteria | 3396 |
| 1365 | Ga0500587_003016 | 3300053739 | Bacteria | 2383 |
| 1366 | Ga0501084_0014939 | 3300054114 | Bacteria | 6437 |
| 1367 | Ga0501084_0026942 | 3300054114 | Bacteria | 4801 |
| 1368 | Ga0501084_0031626 | 3300054114 | Bacteria | 4423 |
| 1369 | Ga0501084_0699657 | 3300054114 | Bacteria | 855 |
| 1370 | Ga0587084_043046 | 3300059477 | Bacteria | 774 |
| 1371 | Ga0587093_043081 | 3300059478 | Bacteria | 691 |
| 1372 | Ga0587070_058899 | 3300059491 | Bacteria | 788 |
| 1373 | Ga0587073_0081313 | 3300059492 | Bacteria | 805 |
| 1374 | Ga0587073_0084121 | 3300059492 | Bacteria | 796 |
| 1375 | Ga0587077_148079 | 3300059493 | Bacteria | 611 |
| 1376 | Ga0587080_026546 | 3300059503 | Bacteria | 984 |
| 1377 | Ga0587083_0071547 | 3300059505 | Bacteria | 806 |
| 1378 | Ga0587083_0135654 | 3300059505 | Bacteria | 650 |
| 1379 | Ga0587085_072290 | 3300059506 | Bacteria | 677 |
| 1380 | Ga0587090_040640 | 3300059510 | Bacteria | 817 |
| 1381 | Ga0587092_068206 | 3300059512 | Bacteria | 679 |
| 1382 | Ga0587094_063842 | 3300059513 | Bacteria | 650 |
| 1383 | Ga0587098_030565 | 3300059604 | Bacteria | 739 |
| 1384 | Ga0587106_012723 | 3300059605 | Bacteria | 1133 |
| 1385 | Ga0587125_013920 | 3300059607 | Bacteria | 874 |
| 1386 | Ga0587129_011418 | 3300059608 | Bacteria | 699 |
| 1387 | Ga0587113_019802 | 3300059625 | Bacteria | 700 |
| 1388 | Ga0587117_046494 | 3300059627 | Bacteria | 708 |
| 1389 | Ga0587122_019578 | 3300059628 | Bacteria | 725 |
| 1390 | Ga0587128_047102 | 3300059630 | Bacteria | 775 |
| 1391 | Ga0587130_014414 | 3300059631 | Bacteria | 807 |
| 1392 | Ga0587068_038661 | 3300059641 | Bacteria | 856 |
| 1393 | Ga0587072_066147 | 3300059643 | Bacteria | 755 |
| 1394 | Ga0587105_012109 | 3300059651 | Bacteria | 673 |
| 1395 | Ga0587108_015879 | 3300059653 | Bacteria | 681 |
| 1396 | Ga0501082_0000551 | 3300060353 | Bacteria | 33339 |
| 1397 | Ga0501082_0000557 | 3300060353 | Bacteria | 33125 |
| 1398 | Ga0501082_0012099 | 3300060353 | Bacteria | 7415 |
| 1399 | Ga0466962_0001438 | 3300061719 | Bacteria | 11099 |
| 1400 | Ga0466962_0005196 | 3300061719 | Bacteria | 6264 |
| 1401 | Ga0466962_0011051 | 3300061719 | Bacteria | 4346 |
| 1402 | Ga0530510_0030131 | 3300061734 | Bacteria | 3896 |
| 1403 | Ga0530510_0062745 | 3300061734 | Bacteria | 2690 |
| 1404 | Ga0530510_0096285 | 3300061734 | Bacteria | 2163 |
| 1405 | 2506867086 | 2506783011 | Bacteria | 5323186 |
| 1406 | 2506868377 | 2506783011 | Bacteria | 5323186 |
| 1407 | 2511379317 | 2511231025 | Bacteria | 5324661 |
| 1408 | 2511436184 | 2511231035 | Bacteria | 5341610 |
| 1409 | 2517759554 | 2517572101 | Bacteria | 6884336 |
| 1410 | 2528204509 | 2527291627 | Bacteria | 5309833 |
| 1411 | 2528212247 | 2527291629 | Bacteria | 5267418 |
| 1412 | 2528214879 | 2527291629 | Bacteria | 5267418 |
| 1413 | 2546949598 | 2546825537 | Bacteria | 5389291 |
| 1414 | 2546949905 | 2546825537 | Bacteria | 5389291 |
| 1415 | 2547408202 | 2547132111 | Bacteria | 8013147 |
| 1416 | 2554257745 | 2554235005 | Bacteria | 6457341 |
| 1417 | 2566991888 | 2565956761 | Bacteria | 6601618 |
| 1418 | 2579749036 | 2576861822 | Bacteria | 5004595 |
| 1419 | 2579750471 | 2576861822 | Bacteria | 5004595 |
| 1420 | 2579856205 | 2579778521 | Bacteria | 7624758 |
| 1421 | 2585299239 | 2582581312 | Bacteria | 7308206 |
| 1422 | 2585301009 | 2582581312 | Bacteria | 7308206 |
| 1423 | 2585308409 | 2582581313 | Bacteria | 10042643 |
| 1424 | 2585308894 | 2582581313 | Bacteria | 10042643 |
| 1425 | 2585313220 | 2582581314 | Bacteria | 11452267 |
| 1426 | 2585313581 | 2582581314 | Bacteria | 11452267 |
| 1427 | 2616693265 | 2616644814 | Bacteria | 11555299 |
| 1428 | 2616694985 | 2616644814 | Bacteria | 11555299 |
| 1429 | 2616899728 | 2616644941 | Bacteria | 8510691 |
| 1430 | 2616904567 | 2616644941 | Bacteria | 8510691 |
| 1431 | 2619858352 | 2619618881 | Bacteria | 7521104 |
| 1432 | 2620349335 | 2619619003 | Bacteria | 7619552 |
| 1433 | 2626639187 | 2626541554 | Bacteria | 7741902 |
| 1434 | 2643759568 | 2643221548 | Bacteria | 8053412 |
| 1435 | 2643765046 | 2643221548 | Bacteria | 8053412 |
| 1436 | 2643897640 | 2643221578 | Bacteria | 9213798 |
| 1437 | 2643899118 | 2643221578 | Bacteria | 9213798 |
| 1438 | 2644017107 | 2643221601 | Bacteria | 7493239 |
| 1439 | 2644173932 | 2643221631 | Bacteria | 8168043 |
| 1440 | 2644262385 | 2643221647 | Bacteria | 10741251 |
| 1441 | 2644268871 | 2643221647 | Bacteria | 10741251 |
| 1442 | 2644403301 | 2643221673 | Bacteria | 9196637 |
| 1443 | 2644408786 | 2643221673 | Bacteria | 9196637 |
| 1444 | 2644437238 | 2643221678 | Bacteria | 9540101 |
| 1445 | 2644443503 | 2643221678 | Bacteria | 9540101 |
| 1446 | 2644461115 | 2643221682 | Bacteria | 6743283 |
| 1447 | 2644463016 | 2643221682 | Bacteria | 6743283 |
| 1448 | 2644517112 | 2643221692 | Bacteria | 7282860 |
| 1449 | 2644518023 | 2643221692 | Bacteria | 7282860 |
| 1450 | 2644628976 | 2643221714 | Bacteria | 9015452 |
| 1451 | 2671833853 | 2671180195 | Bacteria | 9757215 |
| 1452 | 2671840183 | 2671180195 | Bacteria | 9757215 |
| 1453 | 2686536089 | 2684623035 | Bacteria | 8032739 |
| 1454 | 2686539087 | 2684623035 | Bacteria | 8032739 |
| 1455 | 2686541086 | 2684623036 | Bacteria | 5199090 |
| 1456 | 2686542395 | 2684623036 | Bacteria | 5199090 |
| 1457 | 2689990328 | 2687453743 | Bacteria | 8361025 |
| 1458 | 2689995649 | 2687453743 | Bacteria | 8361025 |
| 1459 | 2710602650 | 2710264753 | Bacteria | 5455564 |
| 1460 | 2710602827 | 2710264753 | Bacteria | 5455564 |
| 1461 | 2731908354 | 2731639228 | Bacteria | 4187555 |
| 1462 | 2738869875 | 2738541305 | Bacteria | 4910150 |
| 1463 | 2738891744 | 2738541308 | Bacteria | 7020677 |
| 1464 | 2739206807 | 2738543005 | Bacteria | 5278128 |
| 1465 | 2739365746 | 2738543034 | Bacteria | 6084756 |
| 1466 | 2753034848 | 2751185725 | Bacteria | 5740550 |
| 1467 | 2753323365 | 2751185792 | Bacteria | 5739090 |
| 1468 | 2774852009 | 2773857922 | Bacteria | 9757215 |
| 1469 | 2774858339 | 2773857922 | Bacteria | 9757215 |
| 1470 | 2774865521 | 2773857924 | Bacteria | 5256821 |
| 1471 | 2774865832 | 2773857924 | Bacteria | 5256821 |
| 1472 | 2774902759 | 2773857933 | Bacteria | 5818019 |
| 1473 | 2774903956 | 2773857933 | Bacteria | 5818019 |
| 1474 | 2784588663 | 2784132148 | Bacteria | 8627943 |
| 1475 | 2785343189 | 2784746763 | Bacteria | 9783172 |
| 1476 | 2785368267 | 2784746768 | Bacteria | 10036182 |
| 1477 | 2785369606 | 2784746768 | Bacteria | 10036182 |
| 1478 | 2786669266 | 2786546132 | Bacteria | 10419719 |
| 1479 | 2786670696 | 2786546132 | Bacteria | 10419719 |
| 1480 | 2793982908 | 2791355406 | Bacteria | 11364898 |
| 1481 | 2793985453 | 2791355406 | Bacteria | 11364898 |
| 1482 | 2804844676 | 2802429296 | Bacteria | 7227771 |
| 1483 | 2804846886 | 2802429296 | Bacteria | 7227771 |
| 1484 | 2808842139 | 2808606359 | Bacteria | 9866990 |
| 1485 | 2808846030 | 2808606359 | Bacteria | 9866990 |
| 1486 | 2808846928 | 2808606359 | Bacteria | 9866990 |
| 1487 | 2808919499 | 2808606375 | Bacteria | 9466072 |
| 1488 | 2808920662 | 2808606375 | Bacteria | 9466072 |
| 1489 | 2809232273 | 2808606448 | Bacteria | 8656184 |
| 1490 | 2811847941 | 2808606982 | Bacteria | 7791042 |
| 1491 | 2811849145 | 2808606982 | Bacteria | 7791042 |
| 1492 | 2812357992 | 2811994879 | Bacteria | 9313447 |
| 1493 | 2812480436 | 2811994917 | Bacteria | 7761064 |
| 1494 | 2816510538 | 2816332139 | Bacteria | 9138787 |
| 1495 | 2819693857 | 2818991463 | Bacteria | 7948711 |
| 1496 | 2819695499 | 2818991463 | Bacteria | 7948711 |
| 1497 | 2819743032 | 2818991472 | Bacteria | 10089953 |
| 1498 | 2842892384 | 2842888712 | Bacteria | 4279094 |
| 1499 | 2852636559 | 2852635781 | Bacteria | 8251373 |
| 1500 | 2852637548 | 2852635781 | Bacteria | 8251373 |
| 1501 | 2857485168 | 2857481737 | Bacteria | 4761446 |
| 1502 | 2862178684 | 2862178590 | Bacteria | 8583590 |
| 1503 | 2862179382 | 2862178590 | Bacteria | 8583590 |
| 1504 | 2862182690 | 2862178590 | Bacteria | 8583590 |
| 1505 | 2862285752 | 2862281513 | Bacteria | 9621493 |
| 1506 | 2862294800 | 2862290372 | Bacteria | 7471434 |
| 1507 | 2862295876 | 2862290372 | Bacteria | 7471434 |
| 1508 | 2862392604 | 2862382967 | Bacteria | 10317375 |
| 1509 | 2862511716 | 2862507626 | Bacteria | 9425308 |
| 1510 | 2862579163 | 2862574272 | Bacteria | 10567477 |
| 1511 | 2862582616 | 2862574272 | Bacteria | 10567477 |
| 1512 | 2863404502 | 2863404153 | Bacteria | 9672205 |
| 1513 | 2867371980 | 2867369537 | Bacteria | 6501581 |
| 1514 | 2867429517 | 2867428634 | Bacteria | 9590268 |
| 1515 | 2867430039 | 2867428634 | Bacteria | 9590268 |
| 1516 | 2867431763 | 2867428634 | Bacteria | 9590268 |
| 1517 | 2867480820 | 2867475112 | Bacteria | 6909112 |
| 1518 | 2873155638 | 2873151551 | Bacteria | 8625867 |
| 1519 | 2875393591 | 2875391855 | Bacteria | 7600475 |
| 1520 | 2875395623 | 2875391855 | Bacteria | 7600475 |
| 1521 | 2876602800 | 2876601092 | Bacteria | 5114497 |
| 1522 | 2877676859 | 2877676314 | Bacteria | 9512378 |
| 1523 | 2877681022 | 2877676314 | Bacteria | 9512378 |
| 1524 | 2877682310 | 2877676314 | Bacteria | 9512378 |
| 1525 | 2895887849 | 2895880812 | Bacteria | 11255272 |
| 1526 | 2895889504 | 2895880812 | Bacteria | 11255272 |
| 1527 | 2904540420 | 2904535858 | Bacteria | 6308016 |
| 1528 | 2912716400 | 2912715099 | Bacteria | 9460473 |
| 1529 | 2912717754 | 2912715099 | Bacteria | 9460473 |
| 1530 | 2912719850 | 2912715099 | Bacteria | 9460473 |
| 1531 | 2912725231 | 2912723979 | Bacteria | 8557534 |
| 1532 | 2912727018 | 2912723979 | Bacteria | 8557534 |
| 1533 | 2912758338 | 2912757875 | Bacteria | 7940295 |
| 1534 | 2912760878 | 2912757875 | Bacteria | 7940295 |
| 1535 | 2912763343 | 2912757875 | Bacteria | 7940295 |
| 1536 | 2919469434 | 2919468124 | Bacteria | 9133025 |
| 1537 | 2919474601 | 2919468124 | Bacteria | 9133025 |
| 1538 | 2922554524 | 2922554459 | Bacteria | 6683962 |
| 1539 | 2935393325 | 2935390628 | Bacteria | 7043367 |
| 1540 | 2935393988 | 2935390628 | Bacteria | 7043367 |
| 1541 | 2946049917 | 2946045630 | Bacteria | 8527308 |
| 1542 | 2946051092 | 2946045630 | Bacteria | 8527308 |
| 1543 | 2946067851 | 2946064051 | Bacteria | 8957905 |
| 1544 | 2946075993 | 2946072368 | Bacteria | 8999607 |
| 1545 | 2947229143 | 2947224130 | Bacteria | 9938529 |
| 1546 | 2954007278 | 2954002825 | Bacteria | 9173742 |
| 1547 | 2954386130 | 2954380949 | Bacteria | 10050426 |
| 1548 | 2954387442 | 2954380949 | Bacteria | 10050426 |
| 1549 | 2954675729 | 2954673503 | Bacteria | 9685905 |
| 1550 | 2954677020 | 2954673503 | Bacteria | 9685905 |
| 1551 | 2954687137 | 2954682443 | Bacteria | 9862841 |
| 1552 | 2954688535 | 2954682443 | Bacteria | 9862841 |
| 1553 | 2954696768 | 2954691527 | Bacteria | 10720516 |
| 1554 | 2954698275 | 2954691527 | Bacteria | 10720516 |
| 1555 | 2954703953 | 2954701450 | Bacteria | 10834262 |
| 1556 | 2954705370 | 2954701450 | Bacteria | 10834262 |
| 1557 | 2954716147 | 2954711539 | Bacteria | 10867210 |
| 1558 | 2954717295 | 2954711539 | Bacteria | 10867210 |
| 1559 | 2954726089 | 2954721474 | Bacteria | 10456478 |
| 1560 | 2954727263 | 2954721474 | Bacteria | 10456478 |
| 1561 | 2954734529 | 2954731030 | Bacteria | 10243860 |
| 1562 | 2954735720 | 2954731030 | Bacteria | 10243860 |
| 1563 | 2954745015 | 2954740390 | Bacteria | 10229294 |
| 1564 | 2954746169 | 2954740390 | Bacteria | 10229294 |
| 1565 | 2954753426 | 2954749733 | Bacteria | 10366972 |
| 1566 | 2954754576 | 2954749733 | Bacteria | 10366972 |
| 1567 | 2954765136 | 2954759201 | Bacteria | 9358192 |
| 1568 | 2966601738 | 2966598605 | Bacteria | 7676064 |
| 1569 | 2966603485 | 2966598605 | Bacteria | 7676064 |
| 1570 | 2974319762 | 2974315732 | Bacteria | 4602776 |
| 1571 | 2974319871 | 2974315732 | Bacteria | 4602776 |
| 1572 | 2984523632 | 2984523437 | Bacteria | 4508481 |
| 1573 | 2984523743 | 2984523437 | Bacteria | 4508481 |
| 1574 | 2990063184 | 2990059506 | Bacteria | 9321252 |
| 1575 | 2990094361 | 2990088156 | Bacteria | 6657676 |
| 1576 | 2997454595 | 2997451912 | Bacteria | 8492419 |
| 1577 | 2997456344 | 2997451912 | Bacteria | 8492419 |
| 1578 | 2997457758 | 2997451912 | Bacteria | 8492419 |
| 1579 | 2997600338 | 2997600082 | Bacteria | 9896405 |
| 1580 | 2997602213 | 2997600082 | Bacteria | 9896405 |
| 1581 | 3006322020 | 3006321560 | Bacteria | 8247479 |
| 1582 | 3006325800 | 3006321560 | Bacteria | 8247479 |
| 1583 | 3006397744 | 3006393351 | Bacteria | 6615579 |
| 1584 | 3006428784 | 3006425503 | Bacteria | 6491253 |
| 1585 | 3006487174 | 3006486233 | Bacteria | 8157040 |
| 1586 | 3006488570 | 3006486233 | Bacteria | 8157040 |
| 1587 | 3006500843 | 3006493962 | Bacteria | 8825450 |
| 1588 | 637880386 | 637000116 | Bacteria | 5433628 |
| 1589 | 637881003 | 637000116 | Bacteria | 5433628 |
| 1590 | 8002784270 | 8002784119 | Bacteria | 9788632 |
| 1591 | 8008488608 | 8008485437 | Bacteria | 7198341 |
| 1592 | 8008567185 | 8008558824 | Bacteria | 10610750 |
| 1593 | 8016736793 | 8016733728 | Bacteria | 5274317 |
| 1594 | 8019502026 | 8019499862 | Bacteria | 5169538 |
| 1595 | 8023629830 | 8023623736 | Bacteria | 8593882 |
| 1596 | 8025416196 | 8025413630 | Bacteria | 7014048 |
| 1597 | 8025417844 | 8025413630 | Bacteria | 7014048 |
| 1598 | 8025527384 | 8025524527 | Bacteria | 7197316 |
| 1599 | 8025536296 | 8025530807 | Bacteria | 8495698 |
| 1600 | 8025537924 | 8025530807 | Bacteria | 8495698 |
| 1601 | 8033687693 | 8033684223 | Bacteria | 6906479 |
| 1602 | 8033687854 | 8033684223 | Bacteria | 6906479 |
| 1603 | 8047897777 | 8047893842 | Bacteria | 11723082 |
| 1604 | 8047898028 | 8047893842 | Bacteria | 11723082 |
| 1605 | 8048137028 | 8048127548 | Bacteria | 11053136 |
| 1606 | 8048137315 | 8048127548 | Bacteria | 11053136 |
| 1607 | 8048360865 | 8048356638 | Bacteria | 11044339 |
| 1608 | 8048361094 | 8048356638 | Bacteria | 11044339 |
| 1609 | 8048374763 | 8048369669 | Bacteria | 11666822 |
| 1610 | 8048374991 | 8048369669 | Bacteria | 11666822 |
| 1611 | 8048383215 | 8048379754 | Bacteria | 11877923 |
| 1612 | 8048383459 | 8048379754 | Bacteria | 11877923 |
| 1613 | 8048414378 | 8048406513 | Bacteria | 8936924 |
| 1614 | 8053953348 | 8053945823 | Bacteria | 8962862 |
| 1615 | 8054164964 | 8054160619 | Bacteria | 7783213 |
| 1616 | 8054920669 | 8054913762 | Bacteria | 7713009 |
| 1617 | 8054921219 | 8054920844 | Bacteria | 7068637 |
| 1618 | 8054922918 | 8054920844 | Bacteria | 7068637 |
| 1619 | 8055161885 | 8055157932 | Bacteria | 6429399 |
| 1620 | 8056449060 | 8056447290 | Bacteria | 7680491 |
| 1621 | 8056449461 | 8056447290 | Bacteria | 7680491 |
| 1622 | 8056667300 | 8056667051 | Bacteria | 6953971 |
| 1623 | Ga0495668_0015615 | |||
| 1624 | JGI24752J21851_1005213 | |||
| 1625 | JGI24746J21847_1005494 | |||
| 1626 | JGI24739J22299_10044486 | |||
| 1627 | JGI24739J22299_10090812 | |||
| 1628 | JGI24739J22299_10114870 | |||
| 1629 | JGI24737J22298_10023636 | |||
| 1630 | JGI24737J22298_10046267 | |||
| 1631 | JGI24735J21928_10059706 | |||
| 1632 | JGI24735J21928_10143698 | |||
| 1633 | JGI24745J21846_1000821 | |||
| 1634 | Ga0006759J45824_1047778 | |||
| 1635 | rootH1_10025025 | |||
| 1636 | rootH1_10074601 | |||
| 1637 | Ga0007409J51694_1031317 | |||
| 1638 | Ga0006562J51391_1008428 | |||
| 1639 | Ga0006562J51391_1014226 | |||
| 1640 | Ga0006562J51391_1044851 | |||
| 1641 | Ga0006562J51391_1091491 | |||
| 1642 | Ga0058692_1045055 | |||
| 1643 | Ga0058859_10021593 | |||
| 1644 | Ga0058859_10041615 | |||
| 1645 | Ga0058859_11618699 | |||
| 1646 | Ga0058863_11804279 | |||
| 1647 | Ga0070658_10108910 | |||
| 1648 | Ga0070658_10164490 | |||
| 1649 | Ga0070658_10209982 | |||
| 1650 | Ga0070658_10320719 | |||
| 1651 | Ga0070676_10097261 | |||
| 1652 | Ga0070676_10275126 | |||
| 1653 | Ga0070683_100004077 | |||
| 1654 | Ga0070683_100039853 | |||
| 1655 | Ga0070683_100238239 | |||
| 1656 | Ga0070670_100025437 | |||
| 1657 | Ga0070670_100042397 | |||
| 1658 | Ga0070670_100425012 | |||
| 1659 | Ga0070670_100717527 | |||
| 1660 | Ga0068869_100009447 | |||
| 1661 | Ga0068869_100220134 | |||
| 1662 | Ga0068869_100312165 | |||
| 1663 | Ga0068869_100426183 | |||
| 1664 | Ga0070680_100299428 | |||
| 1665 | Ga0070682_100485276 | |||
| 1666 | Ga0068868_100036882 | |||
| 1667 | Ga0068868_100786394 | |||
| 1668 | Ga0070660_100060224 | |||
| 1669 | Ga0070660_100187998 | |||
| 1670 | Ga0070689_100163911 | |||
| 1671 | Ga0070689_100279056 | |||
| 1672 | Ga0070689_100793755 | |||
| 1673 | Ga0070687_100182323 | |||
| 1674 | Ga0070661_100096295 | |||
| 1675 | Ga0070661_100134054 | |||
| 1676 | Ga0070661_100244640 | |||
| 1677 | Ga0070692_10041463 | |||
| 1678 | Ga0070692_10156052 | |||
| 1679 | Ga0070668_100028230 | |||
| 1680 | Ga0070668_100114491 | |||
| 1681 | Ga0070668_100690360 | |||
| 1682 | Ga0070675_100000719 | |||
| 1683 | Ga0070675_100006141 | |||
| 1684 | Ga0070675_100040915 | |||
| 1685 | Ga0070671_100143027 | |||
| 1686 | Ga0070673_100323075 | |||
| 1687 | Ga0070688_100012654 | |||
| 1688 | Ga0070688_100151271 | |||
| 1689 | Ga0070659_100001482 | |||
| 1690 | Ga0070659_100029976 | |||
| 1691 | Ga0070659_100032308 | |||
| 1692 | Ga0070659_100056655 | |||
| 1693 | Ga0070667_100000001 | |||
| 1694 | Ga0070667_100023936 | |||
| 1695 | Ga0070667_100447906 | |||
| 1696 | Ga0070714_100416707 | |||
| 1697 | Ga0070714_100419550 | |||
| 1698 | Ga0070713_100395040 | |||
| 1699 | Ga0070713_100793527 | |||
| 1700 | Ga0070710_10171816 | |||
| 1701 | Ga0070701_10322939 | |||
| 1702 | Ga0070701_10508305 | |||
| 1703 | Ga0070705_100639553 | |||
| 1704 | Ga0070700_100023661 | |||
| 1705 | Ga0070700_100091360 | |||
| 1706 | Ga0070700_100392198 | |||
| 1707 | Ga0070694_100373559 | |||
| 1708 | Ga0070663_100074365 | |||
| 1709 | Ga0070663_100074371 | |||
| 1710 | Ga0070678_100042450 | |||
| 1711 | Ga0070662_100073021 | |||
| 1712 | Ga0070662_100284692 | |||
| 1713 | Ga0070681_10683678 | |||
| 1714 | Ga0068867_100227300 | |||
| 1715 | Ga0068867_100629740 | |||
| 1716 | Ga0070685_10029284 | |||
| 1717 | Ga0070685_10122874 | |||
| 1718 | Ga0070679_100357165 | |||
| 1719 | Ga0070684_100004354 | |||
| 1720 | Ga0070684_100135079 | |||
| 1721 | Ga0070684_100323000 | |||
| 1722 | Ga0070697_100965581 | |||
| 1723 | Ga0068853_100095551 | |||
| 1724 | Ga0068853_100363013 | |||
| 1725 | Ga0068853_100663552 | |||
| 1726 | Ga0070672_100304539 | |||
| 1727 | Ga0070686_100380929 | |||
| 1728 | Ga0070695_100478951 | |||
| 1729 | Ga0070696_101143822 | |||
| 1730 | Ga0070693_100180935 | |||
| 1731 | Ga0070693_100391747 | |||
| 1732 | Ga0070665_100097682 | |||
| 1733 | Ga0068855_100465629 | |||
| 1734 | Ga0068855_100710501 | |||
| 1735 | Ga0068855_101015936 | |||
| 1736 | Ga0070664_100000534 | |||
| 1737 | Ga0070664_100251217 | |||
| 1738 | Ga0068857_100006062 | |||
| 1739 | Ga0068857_100052065 | |||
| 1740 | Ga0068854_100024968 | |||
| 1741 | Ga0068854_100067079 | |||
| 1742 | Ga0068856_101157982 | |||
| 1743 | Ga0070702_100012334 | |||
| 1744 | Ga0070702_100070267 | |||
| 1745 | Ga0070702_100419494 | |||
| 1746 | Ga0068852_100073756 | |||
| 1747 | Ga0068852_100083527 | |||
| 1748 | Ga0068852_100139131 | |||
| 1749 | Ga0068859_100040519 | |||
| 1750 | Ga0068864_100295816 | |||
| 1751 | Ga0068866_10162112 | |||
| 1752 | Ga0068861_100131217 | |||
| 1753 | Ga0068861_100273477 | |||
| 1754 | Ga0068851_10013396 | |||
| 1755 | Ga0068851_10149827 | |||
| 1756 | Ga0068870_10121332 | |||
| 1757 | Ga0068870_10237029 | |||
| 1758 | Ga0068863_100055152 | |||
| 1759 | Ga0068863_100074641 | |||
| 1760 | Ga0068863_100429971 | |||
| 1761 | Ga0068858_100054214 | |||
| 1762 | Ga0068858_100092010 | |||
| 1763 | Ga0068858_100251581 | |||
| 1764 | Ga0068860_100007310 | |||
| 1765 | Ga0068860_100185974 | |||
| 1766 | Ga0068860_100446110 | |||
| 1767 | Ga0068860_100447221 | |||
| 1768 | Ga0068860_100534679 | |||
| 1769 | Ga0068862_100014723 | |||
| 1770 | Ga0068862_100049913 | |||
| 1771 | Ga0068862_100790066 | |||
| 1772 | Ga0081455_10050807 | |||
| 1773 | Ga0081538_10134967 | |||
| 1774 | Ga0081539_10171865 | |||
| 1775 | Ga0070717_10092228 | |||
| 1776 | Ga0070717_10247870 | |||
| 1777 | Ga0070717_10446260 | |||
| 1778 | Ga0075368_10015973 | |||
| 1779 | Ga0075363_100092462 | |||
| 1780 | Ga0075363_100239621 | |||
| 1781 | Ga0075363_100330950 | |||
| 1782 | Ga0075364_10032423 | |||
| 1783 | Ga0070712_100226183 | |||
| 1784 | Ga0075367_10000490 | |||
| 1785 | Ga0075367_10017087 | |||
| 1786 | Ga0075367_10125484 | |||
| 1787 | Ga0097621_100379607 | |||
| 1788 | Ga0075370_10046876 | |||
| 1789 | Ga0075370_10108447 | |||
| 1790 | Ga0075428_100443722 | |||
| 1791 | Ga0075428_100734220 | |||
| 1792 | Ga0075434_100389255 | |||
| 1793 | Ga0075429_100516378 | |||
| 1794 | Ga0068865_100032754 | |||
| 1795 | Ga0068865_100114841 | |||
| 1796 | Ga0068865_100466860 | |||
| 1797 | Ga0097620_100040519 | |||
| 1798 | Ga0099826_10104463 | |||
| 1799 | Ga0105251_10028973 | |||
| 1800 | Ga0105244_10003455 | |||
| 1801 | Ga0105250_10057176 | |||
| 1802 | Ga0105250_10075385 | |||
| 1803 | Ga0105250_10271568 | |||
| 1804 | Ga0105240_10920876 | |||
| 1805 | Ga0105240_11296943 | |||
| 1806 | Ga0111539_10004342 | |||
| 1807 | Ga0111539_10013384 | |||
| 1808 | Ga0111539_10069210 | |||
| 1809 | Ga0111539_10088870 | |||
| 1810 | Ga0111539_10433183 | |||
| 1811 | Ga0111539_10671421 | |||
| 1812 | Ga0105245_10015155 | |||
| 1813 | Ga0105245_10022160 | |||
| 1814 | Ga0105245_10034887 | |||
| 1815 | Ga0105245_10229187 | |||
| 1816 | Ga0105247_10024812 | |||
| 1817 | Ga0105247_10396426 | |||
| 1818 | Ga0105243_10070234 | |||
| 1819 | Ga0105243_10104325 | |||
| 1820 | Ga0105243_10230613 | |||
| 1821 | Ga0105243_10482648 | |||
| 1822 | Ga0105243_11512363 | |||
| 1823 | Ga0105241_10050846 | |||
| 1824 | Ga0105241_10296336 | |||
| 1825 | Ga0105242_10258670 | |||
| 1826 | Ga0105248_10008353 | |||
| 1827 | Ga0105248_10093427 | |||
| 1828 | Ga0105248_10800258 | |||
| 1829 | Ga0105237_10000576 | |||
| 1830 | Ga0105237_10191132 | |||
| 1831 | Ga0105237_10200555 | |||
| 1832 | Ga0105237_10427372 | |||
| 1833 | Ga0105237_11256746 | |||
| 1834 | Ga0105238_10052401 | |||
| 1835 | Ga0105238_10256126 | |||
| 1836 | Ga0105238_10258700 | |||
| 1837 | Ga0105238_10408326 | |||
| 1838 | Ga0105249_10060473 | |||
| 1839 | Ga0105249_10092664 | |||
| 1840 | Ga0105249_10866031 | |||
| 1841 | Ga0105249_11226414 | |||
| 1842 | Ga0105239_10050099 | |||
| 1843 | Ga0105239_10067731 | |||
| 1844 | Ga0105239_10167438 | |||
| 1845 | Ga0105239_10194965 | |||
| 1846 | Ga0105239_10289384 | |||
| 1847 | Ga0105239_10294156 | |||
| 1848 | Ga0105246_10230734 | |||
| 1849 | Ga0157320_1005893 | |||
| 1850 | Ga0157371_10275398 | |||
| 1851 | Ga0157369_10269515 | |||
| 1852 | Ga0157374_10137124 | |||
| 1853 | Ga0157374_10245735 | |||
| 1854 | Ga0157378_11551392 | |||
| 1855 | Ga0163162_10073356 | |||
| 1856 | Ga0163162_10914871 | |||
| 1857 | Ga0163162_11460991 | |||
| 1858 | Ga0157375_10393236 | |||
| 1859 | Ga0157375_11102236 | |||
| 1860 | Ga0163163_10008177 | |||
| 1861 | Ga0163163_10226676 | |||
| 1862 | Ga0157380_10561381 | |||
| 1863 | Ga0182008_10002234 | |||
| 1864 | Ga0182008_10019441 | |||
| 1865 | Ga0157377_10004764 | |||
| 1866 | Ga0157377_10065456 | |||
| 1867 | Ga0157379_10646569 | |||
| 1868 | Ga0157376_10545126 | |||
| 1869 | Ga0182006_1012503 | |||
| 1870 | Ga0182006_1040844 | |||
| 1871 | Ga0182007_10000387 | |||
| 1872 | Ga0182007_10003980 | |||
| 1873 | Ga0182005_1072386 | |||
| 1874 | Ga0183367_1004 | |||
| 1875 | Ga0183367_1005 | |||
| 1876 | Ga0163161_10049917 | |||
| 1877 | Ga0163161_10232522 | |||
| 1878 | Ga0197907_10231912 | |||
| 1879 | Ga0206356_10376454 | |||
| 1880 | Ga0206355_1074018 | |||
| 1881 | Ga0206351_10938024 | |||
| 1882 | Ga0206352_11133304 | |||
| 1883 | Ga0206350_11440865 | |||
| 1884 | Ga0206353_10188020 | |||
| 1885 | Ga0206353_10403514 | |||
| 1886 | Ga0206353_11635929 | |||
| 1887 | Ga0213876_10064421 | |||
| 1888 | Ga0224712_10058894 | |||
| 1889 | Ga0224712_10064246 | |||
| 1890 | Ga0224712_10215603 | |||
| 1891 | Ga0209758_1015614 | |||
| 1892 | Ga0207426_1002736 | |||
| 1893 | Ga0207426_1007974 | |||
| 1894 | Ga0207656_10041306 | |||
| 1895 | Ga0207656_10185522 | |||
| 1896 | Ga0207696_1033948 | |||
| 1897 | Ga0207696_1051805 | |||
| 1898 | Ga0207655_1003689 | |||
| 1899 | Ga0207713_1017299 | |||
| 1900 | Ga0207642_10216108 | |||
| 1901 | Ga0207710_10000120 | |||
| 1902 | Ga0207710_10000308 | |||
| 1903 | Ga0207710_10060580 | |||
| 1904 | Ga0207688_10019306 | |||
| 1905 | Ga0207688_10053686 | |||
| 1906 | Ga0207680_10151134 | |||
| 1907 | Ga0207680_10262205 | |||
| 1908 | Ga0207647_10048107 | |||
| 1909 | Ga0207647_10061435 | |||
| 1910 | Ga0207647_10239537 | |||
| 1911 | Ga0207645_10026666 | |||
| 1912 | Ga0207645_10104189 | |||
| 1913 | Ga0207643_10002797 | |||
| 1914 | Ga0207643_10016810 | |||
| 1915 | Ga0207643_10161969 | |||
| 1916 | Ga0207643_10282278 | |||
| 1917 | Ga0207705_10112456 | |||
| 1918 | Ga0207705_10113257 | |||
| 1919 | Ga0207705_10529815 | |||
| 1920 | Ga0207654_10084989 | |||
| 1921 | Ga0207695_10220111 | |||
| 1922 | Ga0207671_10000532 | |||
| 1923 | Ga0207693_10130426 | |||
| 1924 | Ga0207663_10235680 | |||
| 1925 | Ga0207660_10376801 | |||
| 1926 | Ga0207662_10009099 | |||
| 1927 | Ga0207662_10033911 | |||
| 1928 | Ga0207657_10023477 | |||
| 1929 | Ga0207657_10276173 | |||
| 1930 | Ga0207649_10039626 | |||
| 1931 | Ga0207649_10062430 | |||
| 1932 | Ga0207652_10945645 | |||
| 1933 | Ga0207681_10055732 | |||
| 1934 | Ga0207681_10243707 | |||
| 1935 | Ga0207694_10088011 | |||
| 1936 | Ga0207694_10096799 | |||
| 1937 | Ga0207694_10111386 | |||
| 1938 | Ga0207650_10012412 | |||
| 1939 | Ga0207650_10312036 | |||
| 1940 | Ga0207650_10681983 | |||
| 1941 | Ga0207659_10006589 | |||
| 1942 | Ga0207659_10010145 | |||
| 1943 | Ga0207687_10065829 | |||
| 1944 | Ga0207687_10107737 | |||
| 1945 | Ga0207687_10163037 | |||
| 1946 | Ga0207687_10213642 | |||
| 1947 | Ga0207700_10090938 | |||
| 1948 | Ga0207700_10695935 | |||
| 1949 | Ga0207664_10397059 | |||
| 1950 | Ga0207664_10479639 | |||
| 1951 | Ga0207664_10515910 | |||
| 1952 | Ga0207644_10125643 | |||
| 1953 | Ga0207690_10187122 | |||
| 1954 | Ga0207706_10010700 | |||
| 1955 | Ga0207706_10021431 | |||
| 1956 | Ga0207706_10048412 | |||
| 1957 | Ga0207706_10128176 | |||
| 1958 | Ga0207709_10040905 | |||
| 1959 | Ga0207709_10245860 | |||
| 1960 | Ga0207709_10881203 | |||
| 1961 | Ga0207691_10037306 | |||
| 1962 | Ga0207691_10191403 | |||
| 1963 | Ga0207689_10011188 | |||
| 1964 | Ga0207689_10014176 | |||
| 1965 | Ga0207689_10015806 | |||
| 1966 | Ga0207689_10444260 | |||
| 1967 | Ga0207661_10021123 | |||
| 1968 | Ga0207661_10025750 | |||
| 1969 | Ga0207661_10170850 | |||
| 1970 | Ga0207661_10516332 | |||
| 1971 | Ga0207679_10024199 | |||
| 1972 | Ga0207679_10118473 | |||
| 1973 | Ga0207679_10171161 | |||
| 1974 | Ga0207667_10978561 | |||
| 1975 | Ga0207651_10035692 | |||
| 1976 | Ga0207651_10039106 | |||
| 1977 | Ga0207712_10078177 | |||
| 1978 | Ga0207712_10128748 | |||
| 1979 | Ga0207712_10239927 | |||
| 1980 | Ga0207668_10023431 | |||
| 1981 | Ga0207668_10126172 | |||
| 1982 | Ga0207640_10470533 | |||
| 1983 | Ga0207658_10000003 | |||
| 1984 | Ga0207658_10014793 | |||
| 1985 | Ga0207658_10130588 | |||
| 1986 | Ga0207677_10013586 | |||
| 1987 | Ga0207677_10057563 | |||
| 1988 | Ga0207703_10070001 | |||
| 1989 | Ga0207639_10306144 | |||
| 1990 | Ga0207639_10368840 | |||
| 1991 | Ga0207678_10002575 | |||
| 1992 | Ga0207678_10083442 | |||
| 1993 | Ga0207708_10003567 | |||
| 1994 | Ga0207708_10010752 | |||
| 1995 | Ga0207708_10016331 | |||
| 1996 | Ga0207708_10153060 | |||
| 1997 | Ga0207702_10133291 | |||
| 1998 | Ga0207702_11015102 | |||
| 1999 | Ga0207641_10417387 | |||
| 2000 | Ga0207641_10589385 | |||
| 2001 | Ga0207648_10026949 | |||
| 2002 | Ga0207648_10028595 | |||
| 2003 | Ga0207674_10006377 | |||
| 2004 | Ga0207674_10025030 | |||
| 2005 | Ga0207675_100002346 | |||
| 2006 | Ga0207675_100036464 | |||
| 2007 | Ga0207675_100159174 | |||
| 2008 | Ga0207683_10240630 | |||
| 2009 | Ga0207683_11008032 | |||
| 2010 | Ga0207698_10017898 | |||
| 2011 | Ga0207698_10039859 | |||
| 2012 | Ga0207698_10790698 | |||
| 2013 | Ga0209371_1023958 | |||
| 2014 | Ga0209813_10008250 | |||
| 2015 | Ga0207428_10094405 | |||
| 2016 | Ga0207428_10436313 | |||
| 2017 | Ga0268266_10026696 | |||
| 2018 | Ga0268266_10612224 | |||
| 2019 | Ga0268265_10962461 | |||
| 2020 | Ga0268264_10118484 | |||
| 2021 | Ga0268264_10153517 | |||
| 2022 | Ga0268264_10168067 | |||
| 2023 | Ga0268264_10193809 | |||
| 2024 | Ga0307517_10001523 | |||
| 2025 | Ga0307517_10002113 | |||
| 2026 | Ga0307517_10002268 | |||
| 2027 | Ga0307517_10003190 | |||
| 2028 | Ga0307515_10005593 | |||
| 2029 | Ga0307515_10030929 | |||
| 2030 | Ga0307515_10166506 | |||
| 2031 | Ga0307515_10237050 | |||
| 2032 | Ga0268256_1022483 | |||
| 2033 | Ga0268256_1027206 | |||
| 2034 | Ga0307511_10000262 | |||
| 2035 | Ga0307511_10052075 | |||
| 2036 | Ga0307511_10067295 | |||
| 2037 | Ga0307511_10071760 | |||
| 2038 | Ga0307511_10161841 | |||
| 2039 | Ga0307511_10170822 | |||
| 2040 | Ga0307511_10240991 | |||
| 2041 | Ga0307512_10004180 | |||
| 2042 | Ga0307512_10036987 | |||
| 2043 | Ga0307512_10056898 | |||
| 2044 | Ga0307512_10076977 | |||
| 2045 | Ga0307512_10156139 | |||
| 2046 | Ga0265327_10001096 | |||
| 2047 | Ga0265327_10013988 | |||
| 2048 | Ga0307513_10000135 | |||
| 2049 | Ga0307513_10003690 | |||
| 2050 | Ga0307513_10013382 | |||
| 2051 | Ga0307513_10094928 | |||
| 2052 | Ga0307513_10099815 | |||
| 2053 | Ga0307513_10169256 | |||
| 2054 | Ga0307513_10213079 | |||
| 2055 | Ga0307509_10078021 | |||
| 2056 | Ga0307509_10120765 | |||
| 2057 | Ga0307408_100220714 | |||
| 2058 | Ga0307408_100562600 | |||
| 2059 | Ga0307508_10002945 | |||
| 2060 | Ga0307508_10003098 | |||
| 2061 | Ga0307508_10003146 | |||
| 2062 | Ga0307508_10008636 | |||
| 2063 | Ga0307508_10028997 | |||
| 2064 | Ga0307508_10044489 | |||
| 2065 | Ga0307508_10059525 | |||
| 2066 | Ga0307508_10090924 | |||
| 2067 | Ga0307508_10120891 | |||
| 2068 | Ga0307508_10235900 | |||
| 2069 | Ga0307508_10428645 | |||
| 2070 | Ga0307514_10005889 | |||
| 2071 | Ga0307514_10039469 | |||
| 2072 | Ga0307514_10078640 | |||
| 2073 | Ga0307514_10172953 | |||
| 2074 | Ga0307514_10215647 | |||
| 2075 | Ga0307516_10034805 | |||
| 2076 | Ga0307516_10068674 | |||
| 2077 | Ga0307516_10102412 | |||
| 2078 | Ga0307516_10110456 | |||
| 2079 | Ga0307516_10382657 | |||
| 2080 | Ga0307516_10456645 | |||
| 2081 | Ga0307413_10004008 | |||
| 2082 | Ga0307413_10008993 | |||
| 2083 | Ga0307413_10178883 | |||
| 2084 | Ga0307413_10219042 | |||
| 2085 | Ga0307413_10422565 | |||
| 2086 | Ga0307413_10463870 | |||
| 2087 | Ga0307413_10529441 | |||
| 2088 | Ga0307407_10708366 | |||
| 2089 | Ga0307407_10868333 | |||
| 2090 | Ga0307409_100099917 | |||
| 2091 | Ga0307409_100298276 | |||
| 2092 | Ga0307409_100580366 | |||
| 2093 | Ga0307409_100683338 | |||
| 2094 | Ga0307409_100747990 | |||
| 2095 | Ga0307409_101469561 | |||
| 2096 | Ga0307416_100133444 | |||
| 2097 | Ga0307416_100330535 | |||
| 2098 | Ga0307416_100387339 | |||
| 2099 | Ga0307416_100621617 | |||
| 2100 | Ga0307416_102072700 | |||
| 2101 | Ga0307411_10024481 | |||
| 2102 | Ga0307411_10234445 | |||
| 2103 | Ga0307415_100013814 | |||
| 2104 | Ga0307415_100215679 | |||
| 2105 | Ga0307415_100347063 | |||
| 2106 | Ga0307507_10004394 | |||
| 2107 | Ga0307507_10017950 | |||
| 2108 | Ga0307507_10019844 | |||
| 2109 | Ga0307507_10060005 | |||
| 2110 | Ga0307507_10096125 | |||
| 2111 | Ga0307507_10097007 | |||
| 2112 | Ga0307507_10143892 | |||
| 2113 | Ga0307507_10163188 | |||
| 2114 | Ga0307510_10005436 | |||
| 2115 | Ga0307510_10135431 | |||
| 2116 | Ga0307510_10212189 | |||
| 2117 | Ga0373940_0204944 | |||
| 2118 | Ga0373951_0090995 | |||
| 2119 | Ga0373952_0096951 | |||
| 2120 | Ga0373962_0148504 | |||
| 2121 | Ga0395898_0006424 | |||
| 2122 | Ga0395898_0007866 | |||
| 2123 | Ga0395898_0157778 | |||
| 2124 | Ga0395898_0828079 | |||
| 2125 | Ga0395901_0090147 | |||
| 2126 | Ga0436365_0241176 | |||
| 2127 | Ga0436365_0402914 | |||
| 2128 | Ga0439436_0000208 | |||
| 2129 | Ga0439439_0003117 | |||
| 2130 | Ga0451793_0500026 | |||
| 2131 | Ga0451800_1554937 | |||
| 2132 | Ga0451802_0326665 | |||
| 2133 | Ga0451802_0444163 | |||
| 2134 | Ga0451807_2266131 | |||
| 2135 | Ga0451807_2446817 | |||
| 2136 | Ga0451833_0081940 | |||
| 2137 | Ga0451833_0163126 | |||
| 2138 | Ga0451835_0504647 | |||
| 2139 | Ga0451837_0073117 | |||
| 2140 | Ga0451837_1411785 | |||
| 2141 | Ga0451837_1594594 | |||
| 2142 | Ga0451841_0766413 | |||
| 2143 | Ga0451853_0494340 | |||
| 2144 | Ga0451853_3237062 | |||
| 2145 | Ga0451853_3883896 | |||
| 2146 | Ga0451853_3940744 | |||
| 2147 | Ga0439442_037360 | |||
| 2148 | Ga0439448_0001704 | |||
| 2149 | Ga0439449_0021758 | |||
| 2150 | Ga0439455_0001757 | |||
| 2151 | Ga0439455_0004112 | |||
| 2152 | Ga0439457_006866 | |||
| 2153 | Ga0439462_0023614 | |||
| 2154 | Ga0450894_000035 | |||
| 2155 | Ga0450898_004052 | |||
| 2156 | Ga0450899_001604 | |||
| 2157 | Ga0450900_008358 | |||
| 2158 | Ga0450900_041855 | |||
| 2159 | Ga0450903_000067 | |||
| 2160 | Ga0450903_000495 | |||
| 2161 | Ga0450906_063339 | |||
| 2162 | Ga0439458_0001440 | |||
| 2163 | Ga0439458_0001566 | |||
| 2164 | Ga0450908_004084 | |||
| 2165 | Ga0450901_020493 | |||
| 2166 | Ga0439440_0088535 | |||
| 2167 | Ga0466969_0006677 | |||
| 2168 | Ga0466969_0017088 | |||
| 2169 | Ga0466969_0159346 | |||
| 2170 | Ga0466972_0009190 | |||
| 2171 | Ga0466972_0013383 | |||
| 2172 | Ga0466972_0064413 | |||
| 2173 | Ga0466972_0093850 | |||
| 2174 | Ga0466965_0000073 | |||
| 2175 | Ga0466965_0000929 | |||
| 2176 | Ga0466965_0002548 | |||
| 2177 | Ga0466965_0030028 | |||
| 2178 | Ga0466965_0154330 | |||
| 2179 | Ga0466965_0470787 | |||
| 2180 | Ga0466966_0000262 | |||
| 2181 | Ga0466966_0026502 | |||
| 2182 | Ga0466966_0026733 | |||
| 2183 | Ga0466966_0148370 | |||
| 2184 | Ga0466961_0000470 | |||
| 2185 | Ga0466961_0000547 | |||
| 2186 | Ga0466961_0017484 | |||
| 2187 | Ga0466963_0000176 | |||
| 2188 | Ga0466963_0000687 | |||
| 2189 | Ga0466963_0001134 | |||
| 2190 | Ga0466963_0050797 | |||
| 2191 | Ga0466963_0361077 | |||
| 2192 | Ga0466971_0000306 | |||
| 2193 | Ga0466971_0001670 | |||
| 2194 | Ga0466971_0033992 | |||
| 2195 | Ga0466970_0000912 | |||
| 2196 | Ga0466970_0001062 | |||
| 2197 | Ga0466970_0056328 | |||
| 2198 | Ga0466970_0060210 | |||
| 2199 | Ga0466957_0000275 | |||
| 2200 | Ga0466957_0000941 | |||
| 2201 | Ga0466957_0108803 | |||
| 2202 | Ga0466960_0087262 | |||
| 2203 | Ga0466960_0096258 | |||
| 2204 | Ga0466959_0000453 | |||
| 2205 | Ga0466959_0003708 | |||
| 2206 | Ga0466959_0021356 | |||
| 2207 | Ga0466959_0023745 | |||
| 2208 | Ga0466959_0102580 | |||
| 2209 | Ga0466958_0010897 | |||
| 2210 | Ga0466958_0138796 | |||
| 2211 | Ga0466967_0001117 | |||
| 2212 | Ga0466967_0011426 | |||
| 2213 | Ga0466967_0153120 | |||
| 2214 | Ga0466967_0413873 | |||
| 2215 | Ga0466967_0443363 | |||
| 2216 | Ga0466967_0629863 | |||
| 2217 | Ga0466967_1015040 | |||
| 2218 | Ga0495617_006202 | |||
| 2219 | Ga0495617_015849 | |||
| 2220 | Ga0495627_033660 | |||
| 2221 | Ga0495627_065245 | |||
| 2222 | Ga0495627_135945 | |||
| 2223 | Ga0495592_0003306 | |||
| 2224 | Ga0495592_0012362 | |||
| 2225 | Ga0495592_0018473 | |||
| 2226 | Ga0495592_0020976 | |||
| 2227 | Ga0495592_0023524 | |||
| 2228 | Ga0495592_0023546 | |||
| 2229 | Ga0495603_0001393 | |||
| 2230 | Ga0495603_0002486 | |||
| 2231 | Ga0495603_0004164 | |||
| 2232 | Ga0495603_0007598 | |||
| 2233 | Ga0495603_0020679 | |||
| 2234 | Ga0495603_0079972 | |||
| 2235 | Ga0495603_0185122 | |||
| 2236 | Ga0495603_0306866 | |||
| 2237 | Ga0495590_0083700 | |||
| 2238 | Ga0495591_000094 | |||
| 2239 | Ga0495629_0000848 | |||
| 2240 | Ga0495629_0004603 | |||
| 2241 | Ga0495629_0008832 | |||
| 2242 | Ga0495629_0018308 | |||
| 2243 | Ga0495629_0024194 | |||
| 2244 | Ga0495629_0035598 | |||
| 2245 | Ga0495629_0061605 | |||
| 2246 | Ga0495629_0075577 | |||
| 2247 | Ga0495629_0077458 | |||
| 2248 | Ga0495629_0091455 | |||
| 2249 | Ga0495629_0096109 | |||
| 2250 | Ga0495629_0187477 | |||
| 2251 | Ga0495629_0213488 | |||
| 2252 | Ga0495629_0377855 | |||
| 2253 | Ga0495629_0584798 | |||
| 2254 | Ga0495638_0005393 | |||
| 2255 | Ga0495638_0032165 | |||
| 2256 | Ga0495638_0082670 | |||
| 2257 | Ga0495638_0143053 | |||
| 2258 | Ga0495638_0177710 | |||
| 2259 | Ga0495638_0245901 | |||
| 2260 | Ga0495638_0350028 | |||
| 2261 | Ga0495641_0023508 | |||
| 2262 | Ga0495641_0092306 | |||
| 2263 | Ga0495641_0293485 | |||
| 2264 | Ga0495651_0006989 | |||
| 2265 | Ga0495651_0026835 | |||
| 2266 | Ga0495651_0031705 | |||
| 2267 | Ga0495651_0036030 | |||
| 2268 | Ga0495651_0055044 | |||
| 2269 | Ga0495651_0089808 | |||
| 2270 | Ga0495653_0190683 | |||
| 2271 | Ga0495653_0376492 | |||
| 2272 | Ga0495653_0643107 | |||
| 2273 | Ga0495650_0047454 | |||
| 2274 | Ga0495580_0193994 | |||
| 2275 | Ga0495582_0073060 | |||
| 2276 | Ga0495605_0006539 | |||
| 2277 | Ga0495605_0007673 | |||
| 2278 | Ga0495605_0011338 | |||
| 2279 | Ga0495605_0140595 | |||
| 2280 | Ga0495639_0033239 | |||
| 2281 | Ga0495639_0057705 | |||
| 2282 | Ga0495662_0001904 | |||
| 2283 | Ga0495662_0004334 | |||
| 2284 | Ga0495662_0009848 | |||
| 2285 | Ga0495662_0236982 | |||
| 2286 | Ga0495664_0002699 | |||
| 2287 | Ga0495664_0002878 | |||
| 2288 | Ga0495664_0012354 | |||
| 2289 | Ga0495664_0131730 | |||
| 2290 | Ga0495584_0022909 | |||
| 2291 | Ga0495584_0105762 | |||
| 2292 | Ga0495585_0013453 | |||
| 2293 | Ga0495585_0021887 | |||
| 2294 | Ga0495585_0051822 | |||
| 2295 | Ga0495585_0066101 | |||
| 2296 | Ga0495585_0072244 | |||
| 2297 | Ga0495585_0160445 | |||
| 2298 | Ga0495585_0324310 | |||
| 2299 | Ga0495594_0000685 | |||
| 2300 | Ga0495594_0009010 | |||
| 2301 | Ga0495594_0019831 | |||
| 2302 | Ga0495594_0021450 | |||
| 2303 | Ga0495594_0024609 | |||
| 2304 | Ga0495594_0028394 | |||
| 2305 | Ga0495594_0041613 | |||
| 2306 | Ga0495594_0051326 | |||
| 2307 | Ga0495594_0086635 | |||
| 2308 | Ga0495594_0100840 | |||
| 2309 | Ga0495594_0303456 | |||
| 2310 | Ga0495596_0018401 | |||
| 2311 | Ga0495607_0032514 | |||
| 2312 | Ga0495607_0047259 | |||
| 2313 | Ga0495607_0061691 | |||
| 2314 | Ga0495607_0080436 | |||
| 2315 | Ga0495607_0143306 | |||
| 2316 | Ga0495583_0012823 | |||
| 2317 | Ga0495606_0005155 | |||
| 2318 | Ga0495608_0015458 | |||
| 2319 | Ga0495608_0110793 | |||
| 2320 | Ga0495610_0070010 | |||
| 2321 | Ga0495610_0109593 | |||
| 2322 | Ga0495610_0186969 | |||
| 2323 | Ga0495616_0012817 | |||
| 2324 | Ga0495616_0020515 | |||
| 2325 | Ga0495618_0014678 | |||
| 2326 | Ga0495618_0064186 | |||
| 2327 | Ga0495618_0152149 | |||
| 2328 | Ga0495628_0012816 | |||
| 2329 | Ga0495628_0281649 | |||
| 2330 | Ga0495628_0339778 | |||
| 2331 | Ga0495628_0374533 | |||
| 2332 | Ga0495630_0010329 | |||
| 2333 | Ga0495630_0020817 | |||
| 2334 | Ga0495630_0789217 | |||
| 2335 | Ga0495631_0005055 | |||
| 2336 | Ga0495631_0030365 | |||
| 2337 | Ga0495631_0063541 | |||
| 2338 | Ga0495631_0067129 | |||
| 2339 | Ga0495631_0085277 | |||
| 2340 | Ga0495631_0118783 | |||
| 2341 | Ga0495631_0272754 | |||
| 2342 | Ga0495632_0014087 | |||
| 2343 | Ga0495632_0022741 | |||
| 2344 | Ga0495632_0024406 | |||
| 2345 | Ga0495637_0067739 | |||
| 2346 | Ga0495637_0122094 | |||
| 2347 | Ga0495643_0001406 | |||
| 2348 | Ga0495643_0002959 | |||
| 2349 | Ga0495643_0004427 | |||
| 2350 | Ga0495643_0006201 | |||
| 2351 | Ga0495643_0035252 | |||
| 2352 | Ga0495643_0287500 | |||
| 2353 | Ga0495648_0117119 | |||
| 2354 | Ga0495666_0005365 | |||
| 2355 | Ga0495666_0111637 | |||
| 2356 | Ga0495666_0254626 | |||
| 2357 | Ga0495642_0191625 | |||
| 2358 | Ga0495652_0012215 | |||
| 2359 | Ga0495652_0020004 | |||
| 2360 | Ga0495652_0057775 | |||
| 2361 | Ga0495652_0073727 | |||
| 2362 | Ga0495652_0332055 | |||
| 2363 | Ga0495652_0624092 | |||
| 2364 | Ga0495654_0000078 | |||
| 2365 | Ga0495654_0138917 | |||
| 2366 | Ga0495665_0003250 | |||
| 2367 | Ga0495665_0028375 | |||
| 2368 | Ga0495640_0003633 | |||
| 2369 | Ga0495640_0007170 | |||
| 2370 | Ga0495640_0027497 | |||
| 2371 | Ga0495640_0033607 | |||
| 2372 | Ga0495640_0287746 | |||
| 2373 | Ga0495640_0323714 | |||
| 2374 | Ga0495586_0033260 | |||
| 2375 | Ga0495586_0035300 | |||
| 2376 | Ga0495586_0040799 | |||
| 2377 | Ga0495586_0225053 | |||
| 2378 | Ga0495586_0369410 | |||
| 2379 | Ga0495587_0004546 | |||
| 2380 | Ga0495587_0004564 | |||
| 2381 | Ga0495609_0039995 | |||
| 2382 | Ga0495609_0143967 | |||
| 2383 | Ga0495609_0201960 | |||
| 2384 | Ga0495597_0062253 | |||
| 2385 | Ga0495597_0100882 | |||
| 2386 | Ga0495597_0221749 | |||
| 2387 | Ga0495645_0024234 | |||
| 2388 | Ga0495645_0047897 | |||
| 2389 | Ga0495645_0228970 | |||
| 2390 | Ga0495645_0542259 | |||
| 2391 | Ga0495622_0005269 | |||
| 2392 | Ga0495622_0022335 | |||
| 2393 | Ga0495622_0026426 | |||
| 2394 | Ga0495622_0041241 | |||
| 2395 | Ga0495622_0095241 | |||
| 2396 | Ga0495633_0015500 | |||
| 2397 | Ga0495633_0031251 | |||
| 2398 | Ga0495633_0052475 | |||
| 2399 | Ga0495633_0052876 | |||
| 2400 | Ga0495667_0005230 | |||
| 2401 | Ga0495667_0016398 | |||
| 2402 | Ga0495667_0131055 | |||
| 2403 | Ga0495667_0428472 | |||
| 2404 | Ga0495656_0287706 | |||
| 2405 | Ga0495656_0450761 | |||
| 2406 | Ga0495668_0013506 | |||
| 2407 | Ga0495668_0013638 | |||
| 2408 | Ga0495634_0004463 | |||
| 2409 | Ga0495634_0005757 | |||
| 2410 | Ga0495634_0010876 | |||
| 2411 | Ga0495634_0018134 | |||
| 2412 | Ga0495634_0021238 | |||
| 2413 | Ga0495634_0041495 | |||
| 2414 | Ga0495611_0023752 | |||
| 2415 | Ga0495611_0028349 | |||
| 2416 | Ga0495611_0039483 | |||
| 2417 | Ga0495611_0098150 | |||
| 2418 | Ga0495611_0137105 | |||
| 2419 | Ga0495611_0174145 | |||
| 2420 | Ga0495625_0003493 | |||
| 2421 | Ga0495625_0024565 | |||
| 2422 | Ga0495625_0093688 | |||
| 2423 | Ga0495625_0285921 | |||
| 2424 | Ga0495635_0000563 | |||
| 2425 | Ga0495635_0004814 | |||
| 2426 | Ga0495635_0017936 | |||
| 2427 | Ga0495635_0041417 | |||
| 2428 | Ga0495635_0052822 | |||
| 2429 | Ga0495661_0113224 | |||
| 2430 | Ga0495661_0114750 | |||
| 2431 | Ga0495661_0149516 | |||
| 2432 | Ga0495661_0161329 | |||
| 2433 | Ga0495661_0292751 | |||
| 2434 | Ga0495661_0311454 | |||
| 2435 | Ga0495588_0000658 | |||
| 2436 | Ga0495588_0001875 | |||
| 2437 | Ga0495588_0002372 | |||
| 2438 | Ga0495588_0018282 | |||
| 2439 | Ga0495588_0045741 | |||
| 2440 | Ga0495588_0054253 | |||
| 2441 | Ga0495588_0097651 | |||
| 2442 | Ga0495588_0098358 | |||
| 2443 | Ga0495588_0100175 | |||
| 2444 | Ga0495657_0008155 | |||
| 2445 | Ga0495657_0009984 | |||
| 2446 | Ga0495657_0013312 | |||
| 2447 | Ga0495657_0014725 | |||
| 2448 | Ga0495657_0019044 | |||
| 2449 | Ga0495657_0026186 | |||
| 2450 | Ga0495657_0039076 | |||
| 2451 | Ga0495657_0072723 | |||
| 2452 | Ga0495657_0110445 | |||
| 2453 | Ga0495599_0002776 | |||
| 2454 | Ga0495623_0017347 | |||
| 2455 | Ga0495623_0085582 | |||
| 2456 | Ga0495623_0106086 | |||
| 2457 | Ga0495623_0299311 | |||
| 2458 | Ga0495646_0000882 | |||
| 2459 | Ga0495646_0041737 | |||
| 2460 | Ga0495646_0348723 | |||
| 2461 | Ga0495658_0035415 | |||
| 2462 | Ga0495658_0178902 | |||
| 2463 | Ga0495658_0367951 | |||
| 2464 | Ga0495613_0000689 | |||
| 2465 | Ga0495613_0000944 | |||
| 2466 | Ga0495613_0002789 | |||
| 2467 | Ga0495613_0003382 | |||
| 2468 | Ga0495613_0010157 | |||
| 2469 | Ga0495613_0012065 | |||
| 2470 | Ga0495613_0012228 | |||
| 2471 | Ga0495613_0029046 | |||
| 2472 | Ga0495613_0035158 | |||
| 2473 | Ga0495613_0036070 | |||
| 2474 | Ga0495613_0146061 | |||
| 2475 | Ga0495624_0010572 | |||
| 2476 | Ga0495624_0092674 | |||
| 2477 | Ga0495670_0001089 | |||
| 2478 | Ga0495670_0005543 | |||
| 2479 | Ga0495670_0019309 | |||
| 2480 | Ga0495670_0047582 | |||
| 2481 | Ga0495670_0372477 | |||
| 2482 | Ga0495671_0015738 | |||
| 2483 | Ga0495671_0020734 | |||
| 2484 | Ga0495671_0077926 | |||
| 2485 | Ga0495671_0372002 | |||
| 2486 | Ga0495649_0011409 | |||
| 2487 | Ga0495649_0257898 | |||
| 2488 | Ga0495589_0004951 | |||
| 2489 | Ga0495589_0010017 | |||
| 2490 | Ga0495589_0131309 | |||
| 2491 | Ga0495589_0208108 | |||
| 2492 | Ga0495589_0212191 | |||
| 2493 | Ga0495600_0011193 | |||
| 2494 | Ga0495600_0023168 | |||
| 2495 | Ga0495600_0039428 | |||
| 2496 | Ga0495600_0048000 | |||
| 2497 | Ga0495600_0067624 | |||
| 2498 | Ga0495600_0068092 | |||
| 2499 | Ga0495600_0075333 | |||
| 2500 | Ga0495600_0223029 | |||
| 2501 | Ga0495600_0524975 | |||
| 2502 | Ga0495600_0627222 | |||
| 2503 | Ga0495660_0032243 | |||
| 2504 | Ga0495660_0075529 | |||
| 2505 | Ga0495660_0078646 | |||
| 2506 | Ga0495581_0004731 | |||
| 2507 | Ga0495581_0046724 | |||
| 2508 | Ga0495581_0079416 | |||
| 2509 | Ga0495581_0107931 | |||
| 2510 | Ga0495581_0159590 | |||
| 2511 | Ga0495581_0223767 | |||
| 2512 | Ga0495604_0000177 | |||
| 2513 | Ga0495604_0003367 | |||
| 2514 | Ga0495604_0004088 | |||
| 2515 | Ga0495604_0019851 | |||
| 2516 | Ga0495604_0039597 | |||
| 2517 | Ga0495604_0071034 | |||
| 2518 | Ga0495604_0076542 | |||
| 2519 | Ga0495636_0040070 | |||
| 2520 | Ga0495636_0040514 | |||
| 2521 | Ga0495674_0034278 | |||
| 2522 | Ga0495674_0202244 | |||
| 2523 | Ga0495674_0426141 | |||
| 2524 | Ga0495676_0001703 | |||
| 2525 | Ga0495676_0002684 | |||
| 2526 | Ga0495676_0003140 | |||
| 2527 | Ga0495676_0010228 | |||
| 2528 | Ga0495676_0017921 | |||
| 2529 | Ga0495676_0018690 | |||
| 2530 | Ga0495676_0022031 | |||
| 2531 | Ga0495676_0023083 | |||
| 2532 | Ga0495676_0034376 | |||
| 2533 | Ga0495676_0195827 | |||
| 2534 | Ga0495676_0211980 | |||
| 2535 | Ga0495680_0009283 | |||
| 2536 | Ga0495680_0172222 | |||
| 2537 | Ga0495683_0013015 | |||
| 2538 | Ga0495683_0052642 | |||
| 2539 | Ga0495683_0202465 | |||
| 2540 | Ga0495687_001373 | |||
| 2541 | Ga0495687_003246 | |||
| 2542 | Ga0495687_005687 | |||
| 2543 | Ga0495687_017551 | |||
| 2544 | Ga0495687_077168 | |||
| 2545 | Ga0495687_078302 | |||
| 2546 | Ga0495687_080675 | |||
| 2547 | Ga0495687_126129 | |||
| 2548 | Ga0495675_0002820 | |||
| 2549 | Ga0495675_0018072 | |||
| 2550 | Ga0495675_0020811 | |||
| 2551 | Ga0495675_0029988 | |||
| 2552 | Ga0495675_0136786 | |||
| 2553 | Ga0495675_0183725 | |||
| 2554 | Ga0495675_0296879 | |||
| 2555 | Ga0495675_0351702 | |||
| 2556 | Ga0495675_0420466 | |||
| 2557 | Ga0495677_0078679 | |||
| 2558 | Ga0495679_030402 | |||
| 2559 | Ga0495685_000162 | |||
| 2560 | Ga0495685_000439 | |||
| 2561 | Ga0495685_000967 | |||
| 2562 | Ga0495685_002093 | |||
| 2563 | Ga0495685_007237 | |||
| 2564 | Ga0495685_029355 | |||
| 2565 | Ga0495685_094687 | |||
| 2566 | Ga0495685_104305 | |||
| 2567 | Ga0495685_185862 | |||
| 2568 | Ga0495681_0000410 | |||
| 2569 | Ga0495681_0001965 | |||
| 2570 | Ga0495681_0004423 | |||
| 2571 | Ga0495681_0010645 | |||
| 2572 | Ga0495681_0025985 | |||
| 2573 | Ga0495681_0043283 | |||
| 2574 | Ga0495684_0025204 | |||
| 2575 | Ga0495684_0078490 | |||
| 2576 | Ga0495684_0258499 | |||
| 2577 | Ga0495684_0562852 | |||
| 2578 | Ga0495686_0008060 | |||
| 2579 | Ga0495686_0017780 | |||
| 2580 | Ga0495686_0027431 | |||
| 2581 | Ga0495686_0145293 | |||
| 2582 | Ga0495686_0309832 | |||
| 2583 | Ga0495593_0001603 | |||
| 2584 | Ga0495593_0002856 | |||
| 2585 | Ga0495593_0050415 | |||
| 2586 | Ga0495602_0016479 | |||
| 2587 | Ga0495602_0065869 | |||
| 2588 | Ga0495602_0118111 | |||
| 2589 | Ga0495602_0456700 | |||
| 2590 | Ga0495614_0000918 | |||
| 2591 | Ga0495614_0004063 | |||
| 2592 | Ga0495614_0007730 | |||
| 2593 | Ga0495614_0046084 | |||
| 2594 | Ga0495614_0150998 | |||
| 2595 | Ga0495626_0009504 | |||
| 2596 | Ga0496100_0724208 | |||
| 2597 | Ga0496101_0169241 | |||
| 2598 | Ga0496101_0592341 | |||
| 2599 | Ga0496102_0055630 | |||
| 2600 | Ga0496102_0102413 | |||
| 2601 | Ga0496103_0033755 | |||
| 2602 | Ga0496104_0186281 | |||
| 2603 | Ga0496104_0403489 | |||
| 2604 | Ga0496105_0267987 | |||
| 2605 | Ga0496106_0001704 | |||
| 2606 | Ga0496106_0488473 | |||
| 2607 | Ga0496107_0390521 | |||
| 2608 | Ga0496108_0049234 | |||
| 2609 | Ga0496109_0001113 | |||
| 2610 | Ga0496109_0023882 | |||
| 2611 | Ga0496109_0051561 | |||
| 2612 | Ga0496109_0121053 | |||
| 2613 | Ga0496109_0231947 | |||
| 2614 | Ga0496109_0326546 | |||
| 2615 | Ga0496110_0054541 | |||
| 2616 | Ga0496110_0066541 | |||
| 2617 | Ga0496112_0171137 | |||
| 2618 | Ga0496113_0187461 | |||
| 2619 | Ga0496113_0500702 | |||
| 2620 | Ga0496113_0656493 | |||
| 2621 | Ga0496114_0127717 | |||
| 2622 | Ga0496115_0503837 | |||
| 2623 | Ga0496118_0080260 | |||
| 2624 | Ga0496119_0117243 | |||
| 2625 | Ga0496120_0000365 | |||
| 2626 | Ga0496121_0000705 | |||
| 2627 | Ga0496121_0006724 | |||
| 2628 | Ga0496122_0005418 | |||
| 2629 | Ga0496123_0040721 | |||
| 2630 | Ga0496126_0096293 | |||
| 2631 | Ga0501306_037732 | |||
| 2632 | Ga0501306_055935 | |||
| 2633 | Ga0501310_039625 | |||
| 2634 | Ga0501304_016441 | |||
| 2635 | Ga0501305_054025 | |||
| 2636 | Ga0495678_024008 | |||
| 2637 | Ga0495678_029142 | |||
| 2638 | Ga0495682_0017031 | |||
| 2639 | Ga0495682_0034481 | |||
| 2640 | Ga0501291_044619 | |||
| 2641 | Ga0501311_052374 | |||
| 2642 | Ga0501314_026889 | |||
| 2643 | Ga0501315_043164 | |||
| 2644 | Ga0501316_048241 | |||
| 2645 | Ga0501318_027489 | |||
| 2646 | Ga0501318_032778 | |||
| 2647 | Ga0501318_049895 | |||
| 2648 | Ga0501321_025524 | |||
| 2649 | Ga0501321_037579 | |||
| 2650 | Ga0501323_016978 | |||
| 2651 | Ga0501031_0001023 | |||
| 2652 | Ga0501031_0001503 | |||
| 2653 | Ga0501031_0001677 | |||
| 2654 | Ga0501031_0005943 | |||
| 2655 | Ga0501031_0028629 | |||
| 2656 | Ga0501031_0155120 | |||
| 2657 | Ga0501031_0163683 | |||
| 2658 | Ga0501032_0000915 | |||
| 2659 | Ga0501032_0005078 | |||
| 2660 | Ga0501032_0007555 | |||
| 2661 | Ga0501032_0008981 | |||
| 2662 | Ga0501032_0015456 | |||
| 2663 | Ga0501032_0033624 | |||
| 2664 | Ga0501032_0087497 | |||
| 2665 | Ga0501032_0338718 | |||
| 2666 | Ga0501032_0397429 | |||
| 2667 | Ga0501033_0001038 | |||
| 2668 | Ga0501033_0007204 | |||
| 2669 | Ga0501033_0009061 | |||
| 2670 | Ga0501033_0022971 | |||
| 2671 | Ga0501033_0052450 | |||
| 2672 | Ga0501033_0070118 | |||
| 2673 | Ga0501033_0167251 | |||
| 2674 | Ga0501033_0168504 | |||
| 2675 | Ga0501033_0180650 | |||
| 2676 | Ga0501033_0281625 | |||
| 2677 | Ga0501033_0295927 | |||
| 2678 | Ga0501033_0314083 | |||
| 2679 | Ga0501034_0002021 | |||
| 2680 | Ga0501034_0006741 | |||
| 2681 | Ga0501034_0009862 | |||
| 2682 | Ga0501034_0011799 | |||
| 2683 | Ga0501034_0013420 | |||
| 2684 | Ga0501034_0018411 | |||
| 2685 | Ga0501034_0020012 | |||
| 2686 | Ga0501034_0040703 | |||
| 2687 | Ga0501034_0042572 | |||
| 2688 | Ga0501034_0074676 | |||
| 2689 | Ga0501034_0547857 | |||
| 2690 | Ga0501034_1149076 | |||
| 2691 | Ga0501036_0001728 | |||
| 2692 | Ga0501036_0003039 | |||
| 2693 | Ga0501036_0003195 | |||
| 2694 | Ga0501036_0012967 | |||
| 2695 | Ga0501036_0017577 | |||
| 2696 | Ga0501036_0024372 | |||
| 2697 | Ga0501036_0078096 | |||
| 2698 | Ga0501036_0111691 | |||
| 2699 | Ga0501036_0241662 | |||
| 2700 | Ga0501036_0377315 | |||
| 2701 | Ga0501037_0000823 | |||
| 2702 | Ga0501037_0001454 | |||
| 2703 | Ga0501037_0011852 | |||
| 2704 | Ga0501037_0015772 | |||
| 2705 | Ga0501037_0026992 | |||
| 2706 | Ga0501037_0041411 | |||
| 2707 | Ga0501037_0094396 | |||
| 2708 | Ga0501037_0107518 | |||
| 2709 | Ga0501037_0170421 | |||
| 2710 | Ga0501037_0224601 | |||
| 2711 | Ga0501037_0550748 | |||
| 2712 | Ga0501038_0000988 | |||
| 2713 | Ga0501038_0003374 | |||
| 2714 | Ga0501038_0006805 | |||
| 2715 | Ga0501038_0011419 | |||
| 2716 | Ga0501038_0018256 | |||
| 2717 | Ga0501038_0033410 | |||
| 2718 | Ga0501038_0034992 | |||
| 2719 | Ga0501038_0166360 | |||
| 2720 | Ga0501038_0169347 | |||
| 2721 | Ga0501038_0262537 | |||
| 2722 | Ga0501038_0354338 | |||
| 2723 | Ga0501038_0680462 | |||
| 2724 | Ga0501039_0004713 | |||
| 2725 | Ga0501039_0030437 | |||
| 2726 | Ga0501039_0048652 | |||
| 2727 | Ga0501039_0052460 | |||
| 2728 | Ga0501039_0062998 | |||
| 2729 | Ga0501039_0085215 | |||
| 2730 | Ga0501039_0270591 | |||
| 2731 | Ga0501039_0364588 | |||
| 2732 | Ga0501040_0010344 | |||
| 2733 | Ga0501040_0020613 | |||
| 2734 | Ga0501040_0027254 | |||
| 2735 | Ga0501041_0001251 | |||
| 2736 | Ga0501041_0001328 | |||
| 2737 | Ga0501041_0028682 | |||
| 2738 | Ga0501042_0008300 | |||
| 2739 | Ga0501042_0012241 | |||
| 2740 | Ga0501042_0013832 | |||
| 2741 | Ga0501042_0023191 | |||
| 2742 | Ga0501042_0055951 | |||
| 2743 | Ga0501042_0057857 | |||
| 2744 | Ga0501042_0901765 | |||
| 2745 | Ga0501043_0000870 | |||
| 2746 | Ga0501043_0000941 | |||
| 2747 | Ga0501043_0009251 | |||
| 2748 | Ga0501043_0015452 | |||
| 2749 | Ga0501043_0016524 | |||
| 2750 | Ga0501043_0016576 | |||
| 2751 | Ga0501043_0023105 | |||
| 2752 | Ga0501043_0048623 | |||
| 2753 | Ga0501043_0060231 | |||
| 2754 | Ga0501043_0069846 | |||
| 2755 | Ga0501043_0147684 | |||
| 2756 | Ga0501043_0172312 | |||
| 2757 | Ga0501043_0178393 | |||
| 2758 | Ga0501046_0008006 | |||
| 2759 | Ga0501046_0014862 | |||
| 2760 | Ga0501046_0019657 | |||
| 2761 | Ga0501046_0026133 | |||
| 2762 | Ga0501046_0029767 | |||
| 2763 | Ga0501046_0040251 | |||
| 2764 | Ga0501046_0082510 | |||
| 2765 | Ga0501046_0137267 | |||
| 2766 | Ga0501047_0000056 | |||
| 2767 | Ga0501047_0000075 | |||
| 2768 | Ga0501047_0000280 | |||
| 2769 | Ga0501047_0000778 | |||
| 2770 | Ga0501047_0012542 | |||
| 2771 | Ga0501047_0014223 | |||
| 2772 | Ga0501047_0018440 | |||
| 2773 | Ga0501047_0019492 | |||
| 2774 | Ga0501047_0034389 | |||
| 2775 | Ga0501047_0039577 | |||
| 2776 | Ga0501047_0042679 | |||
| 2777 | Ga0501047_0044183 | |||
| 2778 | Ga0501047_0064798 | |||
| 2779 | Ga0501047_0070452 | |||
| 2780 | Ga0501047_0077462 | |||
| 2781 | Ga0501047_0197648 | |||
| 2782 | Ga0501047_0259630 | |||
| 2783 | Ga0501047_0698611 | |||
| 2784 | Ga0501047_0755527 | |||
| 2785 | Ga0501048_0003653 | |||
| 2786 | Ga0501048_0004349 | |||
| 2787 | Ga0501048_0009856 | |||
| 2788 | Ga0501048_0019118 | |||
| 2789 | Ga0501048_0025962 | |||
| 2790 | Ga0501048_0054156 | |||
| 2791 | Ga0501048_0312177 | |||
| 2792 | Ga0501067_0000777 | |||
| 2793 | Ga0501067_0001336 | |||
| 2794 | Ga0501067_0002496 | |||
| 2795 | Ga0501068_0000625 | |||
| 2796 | Ga0501068_0001060 | |||
| 2797 | Ga0501068_0001907 | |||
| 2798 | Ga0501069_0007297 | |||
| 2799 | Ga0501069_0108348 | |||
| 2800 | Ga0501070_0002871 | |||
| 2801 | Ga0501070_0039350 | |||
| 2802 | Ga0501070_0045144 | |||
| 2803 | Ga0501070_0058402 | |||
| 2804 | Ga0501070_0060963 | |||
| 2805 | Ga0501070_0083801 | |||
| 2806 | Ga0501070_0479562 | |||
| 2807 | Ga0501070_0546971 | |||
| 2808 | Ga0501071_0001568 | |||
| 2809 | Ga0501071_0001769 | |||
| 2810 | Ga0501071_0002013 | |||
| 2811 | Ga0501071_0414083 | |||
| 2812 | Ga0501072_0000945 | |||
| 2813 | Ga0501072_0002882 | |||
| 2814 | Ga0501073_0012792 | |||
| 2815 | Ga0501073_0016315 | |||
| 2816 | Ga0501073_0033930 | |||
| 2817 | Ga0501073_0270782 | |||
| 2818 | Ga0501074_0002531 | |||
| 2819 | Ga0501074_0005345 | |||
| 2820 | Ga0501074_0030555 | |||
| 2821 | Ga0501074_0144448 | |||
| 2822 | Ga0501074_0452429 | |||
| 2823 | Ga0501075_0354392 | |||
| 2824 | Ga0501076_0031304 | |||
| 2825 | Ga0501076_0042982 | |||
| 2826 | Ga0501076_0305030 | |||
| 2827 | Ga0501077_0017810 | |||
| 2828 | Ga0501077_0024007 | |||
| 2829 | Ga0501077_0064793 | |||
| 2830 | Ga0501235_027790 | |||
| 2831 | Ga0501257_064466 | |||
| 2832 | Ga0501079_0024430 | |||
| 2833 | Ga0501079_0036399 | |||
| 2834 | Ga0501080_0033549 | |||
| 2835 | Ga0501080_0058977 | |||
| 2836 | Ga0501080_0131477 | |||
| 2837 | Ga0501080_0301538 | |||
| 2838 | Ga0501080_0990165 | |||
| 2839 | Ga0501083_0003122 | |||
| 2840 | Ga0501083_0019932 | |||
| 2841 | Ga0501083_0043858 | |||
| 2842 | Ga0501083_0230932 | |||
| 2843 | Ga0501035_0001147 | |||
| 2844 | Ga0501035_0004811 | |||
| 2845 | Ga0501035_0009561 | |||
| 2846 | Ga0501035_0010897 | |||
| 2847 | Ga0501035_0011412 | |||
| 2848 | Ga0501035_0012695 | |||
| 2849 | Ga0501035_0020699 | |||
| 2850 | Ga0501035_0024019 | |||
| 2851 | Ga0501035_0029703 | |||
| 2852 | Ga0501035_0038641 | |||
| 2853 | Ga0501035_0039002 | |||
| 2854 | Ga0501035_0039258 | |||
| 2855 | Ga0501035_0146248 | |||
| 2856 | Ga0501035_0155730 | |||
| 2857 | Ga0501035_0214567 | |||
| 2858 | Ga0501035_0626144 | |||
| 2859 | Ga0501035_1161759 | |||
| 2860 | Ga0501044_0002369 | |||
| 2861 | Ga0501044_0003629 | |||
| 2862 | Ga0501044_0005864 | |||
| 2863 | Ga0501044_0009001 | |||
| 2864 | Ga0501044_0012223 | |||
| 2865 | Ga0501044_0016619 | |||
| 2866 | Ga0501044_0022810 | |||
| 2867 | Ga0501044_0033562 | |||
| 2868 | Ga0501044_0050034 | |||
| 2869 | Ga0501044_0050626 | |||
| 2870 | Ga0501044_0054717 | |||
| 2871 | Ga0501044_0080129 | |||
| 2872 | Ga0501044_0099562 | |||
| 2873 | Ga0501044_0126185 | |||
| 2874 | Ga0501044_0126805 | |||
| 2875 | Ga0501044_0248080 | |||
| 2876 | Ga0501044_0262391 | |||
| 2877 | Ga0501044_0270165 | |||
| 2878 | Ga0501044_0338723 | |||
| 2879 | Ga0501044_0348867 | |||
| 2880 | Ga0501044_0507657 | |||
| 2881 | Ga0501044_0933111 | |||
| 2882 | Ga0501045_0023726 | |||
| 2883 | Ga0501045_0031069 | |||
| 2884 | Ga0501045_0057544 | |||
| 2885 | Ga0501045_0213018 | |||
| 2886 | Ga0501045_0262205 | |||
| 2887 | nmdc:mga03n38_13687_c1 | |||
| 2888 | nmdc:mga03n38_159079_c1 | |||
| 2889 | nmdc:mga03n38_78328_c1 | |||
| 2890 | nmdc:mga00v17_26724_c2 | |||
| 2891 | nmdc:mga00v17_41102_c1 | |||
| 2892 | nmdc:mga00v17_517641_c1 | |||
| 2893 | nmdc:mga06z11_162486_c1 | |||
| 2894 | nmdc:mga06z11_903_c1 | |||
| 2895 | nmdc:mga04h51_9676_c1 | |||
| 2896 | nmdc:mga07m45_101330_c1 | |||
| 2897 | nmdc:mga07m45_151869_c1 | |||
| 2898 | nmdc:mga07m45_259062_c1 | |||
| 2899 | nmdc:mga09592_846225_c1 | |||
| 2900 | nmdc:mga08y16_154699_c1 | |||
| 2901 | nmdc:mga08y16_32291_c1 | |||
| 2902 | nmdc:mga08y16_435128_c1 | |||
| 2903 | nmdc:mga08y16_628517_c1 | |||
| 2904 | nmdc:mga08y16_911139_c1 | |||
| 2905 | nmdc:mga08y16_9548_c1 | |||
| 2906 | nmdc:mga0n895_852226_c1 | |||
| 2907 | nmdc:mga0sz30_334606_c1 | |||
| 2908 | Ga0495601_0003963 | |||
| 2909 | Ga0495612_0174188 | |||
| 2910 | Ga0500610_0036313 | |||
| 2911 | Ga0500610_0046147 | |||
| 2912 | Ga0500610_0158688 | |||
| 2913 | Ga0495655_0023071 | |||
| 2914 | Ga0495655_0050485 | |||
| 2915 | Ga0495655_0157483 | |||
| 2916 | Ga0495619_0155993 | |||
| 2917 | Ga0500578_0012302 | |||
| 2918 | Ga0500578_0160956 | |||
| 2919 | Ga0500643_000132 | |||
| 2920 | Ga0500644_0116020 | |||
| 2921 | Ga0500646_0013621 | |||
| 2922 | Ga0500583_0096220 | |||
| 2923 | Ga0500583_0273240 | |||
| 2924 | Ga0500566_0012307 | |||
| 2925 | Ga0500640_021639 | |||
| 2926 | Ga0500640_095604 | |||
| 2927 | Ga0500641_0154828 | |||
| 2928 | Ga0500650_0336738 | |||
| 2929 | Ga0500654_050515 | |||
| 2930 | Ga0500654_079864 | |||
| 2931 | Ga0500660_027388 | |||
| 2932 | Ga0500660_129093 | |||
| 2933 | Ga0500553_054950 | |||
| 2934 | Ga0500553_138559 | |||
| 2935 | Ga0500560_000196 | |||
| 2936 | Ga0500560_019942 | |||
| 2937 | Ga0500569_000083 | |||
| 2938 | Ga0500569_002256 | |||
| 2939 | Ga0500569_068123 | |||
| 2940 | Ga0500572_099043 | |||
| 2941 | Ga0500608_124280 | |||
| 2942 | Ga0500621_056764 | |||
| 2943 | Ga0500621_089446 | |||
| 2944 | Ga0500628_000379 | |||
| 2945 | Ga0500628_003563 | |||
| 2946 | Ga0500628_008605 | |||
| 2947 | Ga0500652_000875 | |||
| 2948 | Ga0500652_015462 | |||
| 2949 | Ga0500652_016648 | |||
| 2950 | Ga0500658_0002463 | |||
| 2951 | Ga0500658_0004327 | |||
| 2952 | Ga0500658_0007089 | |||
| 2953 | Ga0500658_0069850 | |||
| 2954 | Ga0500559_0180921 | |||
| 2955 | Ga0500561_0002687 | |||
| 2956 | Ga0500561_0008072 | |||
| 2957 | Ga0500561_0011160 | |||
| 2958 | Ga0500573_0017433 | |||
| 2959 | Ga0500573_0081381 | |||
| 2960 | Ga0500573_0358265 | |||
| 2961 | Ga0500577_0079106 | |||
| 2962 | Ga0500577_0081351 | |||
| 2963 | Ga0500579_010911 | |||
| 2964 | Ga0500579_030592 | |||
| 2965 | Ga0500579_082473 | |||
| 2966 | Ga0500600_0003115 | |||
| 2967 | Ga0500600_0152721 | |||
| 2968 | Ga0500600_0204768 | |||
| 2969 | Ga0500604_0003384 | |||
| 2970 | Ga0500616_0000145 | |||
| 2971 | Ga0500616_0006393 | |||
| 2972 | Ga0500616_0010512 | |||
| 2973 | Ga0500616_0052292 | |||
| 2974 | Ga0500624_023600 | |||
| 2975 | Ga0500633_0000640 | |||
| 2976 | Ga0500633_0000723 | |||
| 2977 | Ga0500633_0001014 | |||
| 2978 | Ga0500633_0010752 | |||
| 2979 | Ga0500634_0000287 | |||
| 2980 | Ga0500634_0017507 | |||
| 2981 | Ga0500634_0037432 | |||
| 2982 | Ga0500634_0194028 | |||
| 2983 | Ga0500636_0337546 | |||
| 2984 | Ga0500656_003712 | |||
| 2985 | Ga0500656_004175 | |||
| 2986 | Ga0500587_001407 | |||
| 2987 | Ga0500587_003016 | |||
| 2988 | Ga0501084_0014939 | |||
| 2989 | Ga0501084_0026942 | |||
| 2990 | Ga0501084_0031626 | |||
| 2991 | Ga0501084_0699657 | |||
| 2992 | Ga0587084_043046 | |||
| 2993 | Ga0587093_043081 | |||
| 2994 | Ga0587070_058899 | |||
| 2995 | Ga0587073_0081313 | |||
| 2996 | Ga0587073_0084121 | |||
| 2997 | Ga0587077_148079 | |||
| 2998 | Ga0587080_026546 | |||
| 2999 | Ga0587083_0071547 | |||
| 3000 | Ga0587083_0135654 | |||
| 3001 | Ga0587085_072290 | |||
| 3002 | Ga0587090_040640 | |||
| 3003 | Ga0587092_068206 | |||
| 3004 | Ga0587094_063842 | |||
| 3005 | Ga0587098_030565 | |||
| 3006 | Ga0587106_012723 | |||
| 3007 | Ga0587125_013920 | |||
| 3008 | Ga0587129_011418 | |||
| 3009 | Ga0587113_019802 | |||
| 3010 | Ga0587117_046494 | |||
| 3011 | Ga0587122_019578 | |||
| 3012 | Ga0587128_047102 | |||
| 3013 | Ga0587130_014414 | |||
| 3014 | Ga0587068_038661 | |||
| 3015 | Ga0587072_066147 | |||
| 3016 | Ga0587105_012109 | |||
| 3017 | Ga0587108_015879 | |||
| 3018 | Ga0501082_0000551 | |||
| 3019 | Ga0501082_0000557 | |||
| 3020 | Ga0501082_0012099 | |||
| 3021 | Ga0466962_0001438 | |||
| 3022 | Ga0466962_0005196 | |||
| 3023 | Ga0466962_0011051 | |||
| 3024 | Ga0530510_0030131 | |||
| 3025 | Ga0530510_0062745 | |||
| 3026 | Ga0530510_0096285 | |||
| 3027 | 2506867086 | |||
| 3028 | 2506868377 | |||
| 3029 | 2511379317 | |||
| 3030 | 2511436184 | |||
| 3031 | 2517759554 | |||
| 3032 | 2528204509 | |||
| 3033 | 2528212247 | |||
| 3034 | 2528214879 | |||
| 3035 | 2546949598 | |||
| 3036 | 2546949905 | |||
| 3037 | 2547408202 | |||
| 3038 | 2554257745 | |||
| 3039 | 2566991888 | |||
| 3040 | 2579749036 | |||
| 3041 | 2579750471 | |||
| 3042 | 2579856205 | |||
| 3043 | 2585299239 | |||
| 3044 | 2585301009 | |||
| 3045 | 2585308409 | |||
| 3046 | 2585308894 | |||
| 3047 | 2585313220 | |||
| 3048 | 2585313581 | |||
| 3049 | 2616693265 | |||
| 3050 | 2616694985 | |||
| 3051 | 2616899728 | |||
| 3052 | 2616904567 | |||
| 3053 | 2619858352 | |||
| 3054 | 2620349335 | |||
| 3055 | 2626639187 | |||
| 3056 | 2643759568 | |||
| 3057 | 2643765046 | |||
| 3058 | 2643897640 | |||
| 3059 | 2643899118 | |||
| 3060 | 2644017107 | |||
| 3061 | 2644173932 | |||
| 3062 | 2644262385 | |||
| 3063 | 2644268871 | |||
| 3064 | 2644403301 | |||
| 3065 | 2644408786 | |||
| 3066 | 2644437238 | |||
| 3067 | 2644443503 | |||
| 3068 | 2644461115 | |||
| 3069 | 2644463016 | |||
| 3070 | 2644517112 | |||
| 3071 | 2644518023 | |||
| 3072 | 2644628976 | |||
| 3073 | 2671833853 | |||
| 3074 | 2671840183 | |||
| 3075 | 2686536089 | |||
| 3076 | 2686539087 | |||
| 3077 | 2686541086 | |||
| 3078 | 2686542395 | |||
| 3079 | 2689990328 | |||
| 3080 | 2689995649 | |||
| 3081 | 2710602650 | |||
| 3082 | 2710602827 | |||
| 3083 | 2731908354 | |||
| 3084 | 2738869875 | |||
| 3085 | 2738891744 | |||
| 3086 | 2739206807 | |||
| 3087 | 2739365746 | |||
| 3088 | 2753034848 | |||
| 3089 | 2753323365 | |||
| 3090 | 2774852009 | |||
| 3091 | 2774858339 | |||
| 3092 | 2774865521 | |||
| 3093 | 2774865832 | |||
| 3094 | 2774902759 | |||
| 3095 | 2774903956 | |||
| 3096 | 2784588663 | |||
| 3097 | 2785343189 | |||
| 3098 | 2785368267 | |||
| 3099 | 2785369606 | |||
| 3100 | 2786669266 | |||
| 3101 | 2786670696 | |||
| 3102 | 2793982908 | |||
| 3103 | 2793985453 | |||
| 3104 | 2804844676 | |||
| 3105 | 2804846886 | |||
| 3106 | 2808842139 | |||
| 3107 | 2808846030 | |||
| 3108 | 2808846928 | |||
| 3109 | 2808919499 | |||
| 3110 | 2808920662 | |||
| 3111 | 2809232273 | |||
| 3112 | 2811847941 | |||
| 3113 | 2811849145 | |||
| 3114 | 2812357992 | |||
| 3115 | 2812480436 | |||
| 3116 | 2816510538 | |||
| 3117 | 2819693857 | |||
| 3118 | 2819695499 | |||
| 3119 | 2819743032 | |||
| 3120 | 2842892384 | |||
| 3121 | 2852636559 | |||
| 3122 | 2852637548 | |||
| 3123 | 2857485168 | |||
| 3124 | 2862178684 | |||
| 3125 | 2862179382 | |||
| 3126 | 2862182690 | |||
| 3127 | 2862285752 | |||
| 3128 | 2862294800 | |||
| 3129 | 2862295876 | |||
| 3130 | 2862392604 | |||
| 3131 | 2862511716 | |||
| 3132 | 2862579163 | |||
| 3133 | 2862582616 | |||
| 3134 | 2863404502 | |||
| 3135 | 2867371980 | |||
| 3136 | 2867429517 | |||
| 3137 | 2867430039 | |||
| 3138 | 2867431763 | |||
| 3139 | 2867480820 | |||
| 3140 | 2873155638 | |||
| 3141 | 2875393591 | |||
| 3142 | 2875395623 | |||
| 3143 | 2876602800 | |||
| 3144 | 2877676859 | |||
| 3145 | 2877681022 | |||
| 3146 | 2877682310 | |||
| 3147 | 2895887849 | |||
| 3148 | 2895889504 | |||
| 3149 | 2904540420 | |||
| 3150 | 2912716400 | |||
| 3151 | 2912717754 | |||
| 3152 | 2912719850 | |||
| 3153 | 2912725231 | |||
| 3154 | 2912727018 | |||
| 3155 | 2912758338 | |||
| 3156 | 2912760878 | |||
| 3157 | 2912763343 | |||
| 3158 | 2919469434 | |||
| 3159 | 2919474601 | |||
| 3160 | 2922554524 | |||
| 3161 | 2935393325 | |||
| 3162 | 2935393988 | |||
| 3163 | 2946049917 | |||
| 3164 | 2946051092 | |||
| 3165 | 2946067851 | |||
| 3166 | 2946075993 | |||
| 3167 | 2947229143 | |||
| 3168 | 2954007278 | |||
| 3169 | 2954386130 | |||
| 3170 | 2954387442 | |||
| 3171 | 2954675729 | |||
| 3172 | 2954677020 | |||
| 3173 | 2954687137 | |||
| 3174 | 2954688535 | |||
| 3175 | 2954696768 | |||
| 3176 | 2954698275 | |||
| 3177 | 2954703953 | |||
| 3178 | 2954705370 | |||
| 3179 | 2954716147 | |||
| 3180 | 2954717295 | |||
| 3181 | 2954726089 | |||
| 3182 | 2954727263 | |||
| 3183 | 2954734529 | |||
| 3184 | 2954735720 | |||
| 3185 | 2954745015 | |||
| 3186 | 2954746169 | |||
| 3187 | 2954753426 | |||
| 3188 | 2954754576 | |||
| 3189 | 2954765136 | |||
| 3190 | 2966601738 | |||
| 3191 | 2966603485 | |||
| 3192 | 2974319762 | |||
| 3193 | 2974319871 | |||
| 3194 | 2984523632 | |||
| 3195 | 2984523743 | |||
| 3196 | 2990063184 | |||
| 3197 | 2990094361 | |||
| 3198 | 2997454595 | |||
| 3199 | 2997456344 | |||
| 3200 | 2997457758 | |||
| 3201 | 2997600338 | |||
| 3202 | 2997602213 | |||
| 3203 | 3006322020 | |||
| 3204 | 3006325800 | |||
| 3205 | 3006397744 | |||
| 3206 | 3006428784 | |||
| 3207 | 3006487174 | |||
| 3208 | 3006488570 | |||
| 3209 | 3006500843 | |||
| 3210 | 637880386 | |||
| 3211 | 637881003 | |||
| 3212 | 8002784270 | |||
| 3213 | 8008488608 | |||
| 3214 | 8008567185 | |||
| 3215 | 8016736793 | |||
| 3216 | 8019502026 | |||
| 3217 | 8023629830 | |||
| 3218 | 8025416196 | |||
| 3219 | 8025417844 | |||
| 3220 | 8025527384 | |||
| 3221 | 8025536296 | |||
| 3222 | 8025537924 | |||
| 3223 | 8033687693 | |||
| 3224 | 8033687854 | |||
| 3225 | 8047897777 | |||
| 3226 | 8047898028 | |||
| 3227 | 8048137028 | |||
| 3228 | 8048137315 | |||
| 3229 | 8048360865 | |||
| 3230 | 8048361094 | |||
| 3231 | 8048374763 | |||
| 3232 | 8048374991 | |||
| 3233 | 8048383215 | |||
| 3234 | 8048383459 | |||
| 3235 | 8048414378 | |||
| 3236 | 8053953348 | |||
| 3237 | 8054164964 | |||
| 3238 | 8054920669 | |||
| 3239 | 8054921219 | |||
| 3240 | 8054922918 | |||
| 3241 | 8055161885 | |||
| 3242 | 8056449060 | |||
| 3243 | 8056449461 | |||
| 3244 | 8056667300 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ibz-assembly1.cif.gz_A | crystal structure of putative tellurium resistant like protein (terd) from streptomyces coelicolor a3(2) | 0.9212 | 19 | 191 |
| 3ibz-assembly1.cif.gz_A | crystal structure of putative tellurium resistant like protein (terd) from streptomyces coelicolor a3(2) | 0.8967 | 19 | 191 |
| 2kxv-assembly1.cif.gz_A | nmr structure and calcium-binding properties of the tellurite resistance protein terd from klebsiella pneumoniae | 0.8595 | 19 | 191 |
| 2kxv-assembly1.cif.gz_A | nmr structure and calcium-binding properties of the tellurite resistance protein terd from klebsiella pneumoniae | 0.8506 | 19 | 191 |
| 2qz7-assembly2.cif.gz_B | the crystal structure of a homologue of telluride resistance protein (terd), sco6318 from streptomyces coelicolor a3(2) | 0.8208 | 19 | 184 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P19198_159_328_2.60.60.30 | Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains | 0.9658 | 20 | 184 | 2.60.60.30 |
| af_P19198_159_328_2.60.60.30 | Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains | 0.9326 | 20 | 184 | 2.60.60.30 |
| 3ibzA01 | Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains | 0.9158 | 19 | 185 | 2.60.60.30 |
| 3ibzA01 | Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains | 0.9055 | 19 | 185 | 2.60.60.30 |
| 2qz7B01 | Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains | 0.8187 | 19 | 184 | 2.60.60.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0A8ERG0-F1-model_v4 | Putative TerD-family protein | 0.9895 | 1 | 191 |
|
| AF-A0A7Y9LIH7-F1-model_v4 | deleted | 0.9894 | 1 | 191 |
|
| AF-A0A499V918-F1-model_v4 | Chemical-damaging agent resistance protein C | 0.9864 | 1 | 191 |
|
| AF-A0A0B8NLU3-F1-model_v4 | Tellurium resistance protein | 0.9852 | 1 | 191 |
|
| AF-A0A0A8ERG0-F1-model_v4 | Putative TerD-family protein | 0.9844 | 1 | 191 |
|