F494961

General Info

Members Datasets Scaffolds Average Seq Length
1595 808 1294 335

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10041475|Ga0163162_100414753
Length 370
Sequence MRHRAARCARRATRRRCGPGGGRAMAELRLTGVVKRFAGVTAVDGVGLEIPSGEFFVLLGPSGAGKTTTLRLVAGLERPDAGRVSIGGREVTALAPALRDVAFVFQQYSLYPHLSVFDNLAFPLRSPLRPCPEPEVRRKVEEVARMLRIDDKLHNPATRLSGGQMQRVAIGRALVRSPALYLMDEPLSSLDAKLRNDLRLELKRIQQDLGATMLYVTHDQIEAMTLATRIGVLDAGRLVQVGTPQQIYENPGSAHVASRLGSPRINLVARALFPQLDGPERAVMVGLRAEHLRLHRRPAAGGPDVAHRGASVRRIERLSDLHLVHVGLDDSSQELIVSAPPDESFEPNDAVQVEPLRPLWFDAEGLRIHA

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
5 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
6 2509276019 Ensifer aridi TW10 Isolate Nodule
7 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
10 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
11 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
12 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
13 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
14 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
15 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
16 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
17 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
18 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
19 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
20 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
21 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
22 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
23 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
24 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
25 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
26 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
27 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
28 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
29 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
30 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
31 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
32 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
33 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
34 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
35 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
36 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
37 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
38 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
39 2519899620 Rhizobium sp. Pop5 Isolate Nodule
40 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
41 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
42 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
43 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
44 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
45 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
46 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
47 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
48 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
49 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
50 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
51 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
52 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
53 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
54 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
55 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
56 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
57 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
58 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
59 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
60 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
61 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
62 2718217882 Rhizobium sp. N741 Isolate Nodule
63 2718218009 Rhizobium sp. N561 Isolate Nodule
64 2718218363 Rhizobium sp. N113 Isolate Nodule
65 2718218365 Rhizobium sp. N731 Isolate Nodule
66 2718218366 Rhizobium sp. N621 Isolate Nodule
67 2721755514 Rhizobium sp. N6212 Isolate Nodule
68 2721755810 Rhizobium sp. N871 Isolate Nodule
69 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
70 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
71 2728369365 Rhizobium sp. N1341 Isolate Nodule
72 2728369397 Rhizobium sp. N1314 Isolate Nodule
73 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
74 2738543013 Variovorax sp. BT01 Isolate Unclassified
75 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
76 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
77 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
78 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
79 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
80 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
81 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
82 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
83 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
84 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
85 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
86 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
87 2791355260 Rhizobium sp. L9 Isolate Nodule
88 2791355264 Rhizobium sp. S9 Isolate Nodule
89 2791355265 Rhizobium sp. H4 Isolate Nodule
90 2791355266 Rhizobium sp. L43 Isolate Nodule
91 2791355267 Rhizobium sp. L18 Isolate Nodule
92 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
93 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
94 2802429633 Rhizobium anhuiense J3 Isolate Nodule
95 2802429634 Rhizobium anhuiense S10 Isolate Nodule
96 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
97 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
98 2802429637 Rhizobium anhuiense C15 Isolate Nodule
99 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
100 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
101 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
102 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
103 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
104 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
105 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
106 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
107 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
108 2838048938 Rhizobium pisi 27/80 Isolate Nodule
109 2838061910 Rhizobium phaseoli L15 Isolate Nodule
110 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
111 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
112 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
113 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
114 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
115 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
116 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
117 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
118 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
119 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
120 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
121 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
122 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
123 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
124 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
125 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
126 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
127 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
128 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
129 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
130 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
131 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
132 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
133 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
134 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
135 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
136 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
137 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
138 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
139 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
140 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
141 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
142 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
143 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
144 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
145 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
146 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
147 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
148 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
149 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
150 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
151 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
152 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
153 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
154 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
155 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
156 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
157 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
158 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
159 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
160 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
161 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
162 2851182111 Bosea sp. Tri-44 Isolate Nodule
163 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
164 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
165 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
166 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
167 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
168 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
169 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
170 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
171 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
172 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
173 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
174 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
175 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
176 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
177 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
178 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
179 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
180 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
181 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
182 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
183 2906610324
184 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
185 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
186 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
187 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
188 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
189 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
190 2922368715
191 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
192 2922425934
193 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
194 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
195 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
196 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
197 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
198 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
199 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
200 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
201 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
202 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
203 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
204 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
205 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
206 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
207 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
208 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
209 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
210 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
211 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
212 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
213 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
214 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
215 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
216 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
217 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
218 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
219 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
220 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
221 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
222 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
223 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
224 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
225 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
226 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
227 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
228 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
229 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
230 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
231 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
232 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
233 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
234 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
235 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
236 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
237 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
238 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
239 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
240 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
241 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
242 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
243 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
244 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
245 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
246 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
247 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
248 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
249 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
250 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
251 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
252 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
253 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
254 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
255 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
256 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
257 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
258 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
259 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
260 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
261 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
262 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
263 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
264 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
265 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
266 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
267 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
268 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
269 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
270 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
271 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
272 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
273 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
274 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
275 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
276 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
277 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
278 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
279 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
280 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
281 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
282 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
283 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
284 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
285 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
286 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
287 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
288 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
289 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
290 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
291 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
292 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
293 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
294 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
295 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
296 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
297 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
298 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
299 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
300 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
301 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
302 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
303 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
304 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
305 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
306 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
307 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
308 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
309 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
310 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
311 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
312 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
313 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
314 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
315 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
316 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
317 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
318 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
319 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
320 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
321 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
322 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
323 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
324 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
325 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
326 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
327 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
328 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
329 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
330 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
331 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
332 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
333 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
334 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
335 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
336 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
337 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
338 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
339 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
340 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
341 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
342 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
343 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
344 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
345 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
346 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
347 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
348 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
349 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
350 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
351 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
352 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
353 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
354 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
355 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
356 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
357 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
358 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
359 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
360 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
361 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
362 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
363 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
364 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
365 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
366 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
367 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
368 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
369 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
370 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
371 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
372 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
373 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
374 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
375 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
376 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
377 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
378 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
379 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
380 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
381 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
382 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
383 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
384 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
385 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
386 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
387 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
388 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
389 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
390 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
391 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
392 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
393 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
394 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
395 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
396 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
397 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
398 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
399 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
400 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
401 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
402 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
403 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
404 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
405 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
406 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
407 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
408 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
409 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
410 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
411 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
412 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
413 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
414 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
415 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
416 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
417 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
418 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
419 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
420 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
421 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
422 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
423 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
424 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
425 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
426 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
427 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
428 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
429 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
430 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
431 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
443 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
444 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
445 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
446 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
447 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
450 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
451 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
452 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
453 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
455 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
456 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
457 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
458 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
459 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
460 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
461 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
462 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
463 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
464 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
465 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
466 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
467 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
468 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
469 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
470 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
471 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
472 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
473 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
474 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
475 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
476 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
477 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
478 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
479 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
480 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
481 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
482 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
483 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
484 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
485 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
486 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
487 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
488 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
489 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
490 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
491 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
492 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
493 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
494 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
495 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
496 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
497 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
498 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
499 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
500 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
501 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
502 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
503 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
504 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
505 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
506 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
507 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
508 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
509 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
510 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
511 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
512 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
513 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
514 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
515 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
516 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
517 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
518 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
519 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
520 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
521 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
522 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
523 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
524 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
525 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
526 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
527 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
528 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
529 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
530 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
531 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
532 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
533 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
534 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
535 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
536 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
537 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
538 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
539 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
540 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
541 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
542 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
543 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
544 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
545 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
546 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
547 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
548 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
549 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
550 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
551 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
552 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
553 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
554 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
555 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
556 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
557 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
558 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
559 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
560 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
561 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
562 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
563 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
564 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
565 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
566 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
567 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
568 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
569 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
570 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
571 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
572 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
573 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
574 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
575 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
576 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
577 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
578 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
579 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
580 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
581 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
582 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
583 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
584 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
585 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
586 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
587 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
588 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
589 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
590 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
591 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
592 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
593 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
594 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
595 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
596 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
597 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
598 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
599 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
600 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
601 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
602 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
603 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
604 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
605 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
606 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
607 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
608 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
609 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
610 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
611 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
612 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
613 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
614 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
615 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
616 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
617 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
618 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
619 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
620 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
621 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
622 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
623 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
624 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
625 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
626 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
627 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
628 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
629 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
630 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
631 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
632 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
633 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
634 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
635 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
636 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
637 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
638 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
639 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
640 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
641 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
642 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
643 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
644 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
645 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
646 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
647 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
648 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
649 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
650 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
651 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
652 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
653 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
654 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
655 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
656 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
657 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
658 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
659 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
660 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
661 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
662 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
663 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
664 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
665 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
666 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
667 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
668 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
669 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
670 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
671 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
672 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
673 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
674 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
675 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
676 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
677 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
678 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
679 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
680 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
681 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
682 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
683 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
684 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
685 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
686 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
687 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
688 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
689 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
690 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
691 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
692 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
693 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
694 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
695 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
696 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
697 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
698 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
699 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
700 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
701 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
702 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
703 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
704 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
705 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
706 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
707 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
708 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
709 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
710 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
711 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
712 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
713 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
714 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
715 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
716 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
717 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
718 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
719 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
720 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
721 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
722 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
723 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
724 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
725 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
726 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
727 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
728 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
729 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
730 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
731 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
732 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
733 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
734 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
735 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
736 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
737 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
738 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
739 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
740 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
741 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
742 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
743 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
744 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
745 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
746 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
747 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
748 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
749 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
750 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
751 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
752 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
753 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
754 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
755 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
756 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
757 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
758 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
759 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
760 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
761 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
762 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
763 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
764 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
765 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
766 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
767 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
768 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
769 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
770 8005258706 Rhizobium sp. R693 Isolate Nodule
771 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
772 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
773 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
774 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
775 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
776 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
777 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
778 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
779 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
780 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
781 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
782 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
783 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
784 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
785 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
786 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
787 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
788 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
789 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
790 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
791 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
792 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
793 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
794 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
795 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
796 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
797 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
798 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
799 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
800 8024501048 Rhizobium sp. H4 Isolate Nodule
801 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
802 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
803 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
804 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
805 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
806 8056382006 Rhizobium croatiense 13T Isolate Nodule
807 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
808 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.28
Metatranscriptomes 0
Isolates 18.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.59
Nodule 15.49
Rhizoplane 4.58
Rhizosphere 60.56
Stem 0
Stem Tuber 0
Unclassified 9.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10013596 3300002067 Bacteria 2556
2 JGI25156J39149_1000240 3300002705 Bacteria 37927
3 JGI25156J39149_1000577 3300002705 Bacteria 21003
4 JGI25154J39366_1000445 3300002738 Bacteria 21954
5 JGI25157J39369_1000148 3300002741 Bacteria 58782
6 JGI25152J39213_1004235 3300002773 Bacteria 4591
7 JGI25150J39212_1008481 3300002774 Bacteria 2008
8 JGI25151J46595_10008594 3300003187 Bacteria 4895
9 JGI25406J46586_10000039 3300003203 Bacteria 59006
10 JGI25406J46586_10067282 3300003203 Bacteria 1135
11 JGI25153J46596_10020132 3300003215 Bacteria 2530
12 rootH2_10026777 3300003320 Bacteria 3809
13 JGI25160J50197_1004178 3300003354 Bacteria 6280
14 JGI25404J52841_10000081 3300003659 Bacteria 8816
15 JGI25404J52841_10000800 3300003659 Bacteria 4997
16 JGI25404J52841_10002033 3300003659 Bacteria 3742
17 JGI25404J52841_10003979 3300003659 Bacteria 2966
18 Ga0055539_1002041 3300003752 Bacteria 3309
19 Ga0055539_1003138 3300003752 Bacteria 2357
20 Ga0055533_1000016 3300003756 Bacteria 396179
21 Ga0055533_1000702 3300003756 Bacteria 10998
22 Ga0055525_1002495 3300003759 Bacteria 1858
23 Ga0055535_1000107 3300003761 Bacteria 89840
24 Ga0055529_1000111 3300003763 Bacteria 118734
25 Ga0055526_1014297 3300003771 Bacteria 3276
26 Ga0055528_1025221 3300003790 Bacteria 1754
27 Ga0055540_1000192 3300003792 Bacteria 58828
28 Ga0055540_1018930 3300003792 Bacteria 1871
29 Ga0055543_1000329 3300004625 Bacteria 32613
30 Ga0065165_1016048 3300005262 Bacteria 2823
31 Ga0065707_10085391 3300005295 Bacteria 6191
32 Ga0070658_10044005 3300005327 Bacteria 3607
33 Ga0070658_10084121 3300005327 Bacteria 2616
34 Ga0070676_10061945 3300005328 Bacteria 2225
35 Ga0070676_10097288 3300005328 Bacteria 1813
36 Ga0070683_100002714 3300005329 Bacteria 14136
37 Ga0070683_100032630 3300005329 Bacteria 4742
38 Ga0070690_100007969 3300005330 Bacteria 6081
39 Ga0070670_100182508 3300005331 Bacteria 1822
40 Ga0068869_100078358 3300005334 Bacteria 2461
41 Ga0068869_100118949 3300005334 Bacteria 2018
42 Ga0070680_100032603 3300005336 Bacteria 4194
43 Ga0070680_100194056 3300005336 Bacteria 1712
44 Ga0070682_100234854 3300005337 Bacteria 1313
45 Ga0068868_100037825 3300005338 Bacteria 3743
46 Ga0068868_100108684 3300005338 Bacteria 2251
47 Ga0068868_100124026 3300005338 Bacteria 2108
48 Ga0070660_100066483 3300005339 Bacteria 2806
49 Ga0070660_100067269 3300005339 Bacteria 2791
50 Ga0070689_100119364 3300005340 Bacteria 2105
51 Ga0070691_10195753 3300005341 Bacteria 1060
52 Ga0070687_100078258 3300005343 Bacteria 1797
53 Ga0070661_100004039 3300005344 Bacteria 10095
54 Ga0070668_100011099 3300005347 Bacteria 6706
55 Ga0070668_100020589 3300005347 Bacteria 4979
56 Ga0070668_100033402 3300005347 Bacteria 3918
57 Ga0070668_100087753 3300005347 Bacteria 2448
58 Ga0070668_100189538 3300005347 Bacteria 1684
59 Ga0070669_100020965 3300005353 Bacteria 4669
60 Ga0070669_100070459 3300005353 Bacteria 2584
61 Ga0070669_100130310 3300005353 Bacteria 1928
62 Ga0070675_100035549 3300005354 Bacteria 4049
63 Ga0070675_100103891 3300005354 Bacteria 2396
64 Ga0070671_100086573 3300005355 Bacteria 2622
65 Ga0070671_100096269 3300005355 Bacteria 2482
66 Ga0070671_100143750 3300005355 Bacteria 2014
67 Ga0070674_100001054 3300005356 Bacteria 14410
68 Ga0070674_100007035 3300005356 Bacteria 6613
69 Ga0070674_100042949 3300005356 Bacteria 3073
70 Ga0070674_100046627 3300005356 Bacteria 2966
71 Ga0070673_100005668 3300005364 Bacteria 8023
72 Ga0070673_100106792 3300005364 Bacteria 2315
73 Ga0070688_100247981 3300005365 Bacteria 1267
74 Ga0070659_100057521 3300005366 Bacteria 3067
75 Ga0070659_100137413 3300005366 Bacteria 1988
76 Ga0070659_100189478 3300005366 Bacteria 1690
77 Ga0070659_100294127 3300005366 Bacteria 1353
78 Ga0070659_100336457 3300005366 Bacteria 1264
79 Ga0070667_100018497 3300005367 Bacteria 5778
80 Ga0070667_100029096 3300005367 Bacteria 4601
81 Ga0070667_100041228 3300005367 Bacteria 3873
82 Ga0070667_100050524 3300005367 Bacteria 3505
83 Ga0070667_100170212 3300005367 Bacteria 1923
84 Ga0070709_10000575 3300005434 Bacteria 21472
85 Ga0070714_100009073 3300005435 Bacteria 7798
86 Ga0070714_100010743 3300005435 Bacteria 7245
87 Ga0070714_100038400 3300005435 Bacteria 4025
88 Ga0070714_100100930 3300005435 Bacteria 2542
89 Ga0070714_100143638 3300005435 Bacteria 2144
90 Ga0070714_100158810 3300005435 Bacteria 2044
91 Ga0070713_100014695 3300005436 Bacteria 5823
92 Ga0070713_100019136 3300005436 Bacteria 5219
93 Ga0070713_100026782 3300005436 Bacteria 4532
94 Ga0070713_100151247 3300005436 Bacteria 2065
95 Ga0070710_10000123 3300005437 Bacteria 36332
96 Ga0070710_10003768 3300005437 Bacteria 7171
97 Ga0070710_10054385 3300005437 Bacteria 2258
98 Ga0070710_10185662 3300005437 Bacteria 1305
99 Ga0070701_10011581 3300005438 Bacteria 3950
100 Ga0070701_10112218 3300005438 Bacteria 1525
101 Ga0070711_100033655 3300005439 Bacteria 3413
102 Ga0070711_100122509 3300005439 Bacteria 1925
103 Ga0070711_100298814 3300005439 Bacteria 1280
104 Ga0070705_100095323 3300005440 Bacteria 1865
105 Ga0070700_100022083 3300005441 Bacteria 3706
106 Ga0070708_100002230 3300005445 Bacteria 14982
107 Ga0070708_100214100 3300005445 Bacteria 1806
108 Ga0070708_100304506 3300005445 Bacteria 1501
109 Ga0070663_100070522 3300005455 Bacteria 2541
110 Ga0070663_100146211 3300005455 Bacteria 1809
111 Ga0070663_100360937 3300005455 Bacteria 1178
112 Ga0070678_100010558 3300005456 Bacteria 5649
113 Ga0070678_100084055 3300005456 Bacteria 2422
114 Ga0070678_100087849 3300005456 Bacteria 2375
115 Ga0070662_100010779 3300005457 Bacteria 6017
116 Ga0070662_100031158 3300005457 Bacteria 3740
117 Ga0070662_100048692 3300005457 Bacteria 3054
118 Ga0070662_100207951 3300005457 Bacteria 1556
119 Ga0070662_100254098 3300005457 Bacteria 1414
120 Ga0070681_10010183 3300005458 Bacteria 9274
121 Ga0070681_10018273 3300005458 Bacteria 7008
122 Ga0068867_100000020 3300005459 Bacteria 93210
123 Ga0068867_100017231 3300005459 Bacteria 5131
124 Ga0068867_100048095 3300005459 Bacteria 3137
125 Ga0068867_100152615 3300005459 Bacteria 1816
126 Ga0070706_100000873 3300005467 Bacteria 33089
127 Ga0070706_100041721 3300005467 Bacteria 4237
128 Ga0070706_100055029 3300005467 Bacteria 3672
129 Ga0070707_100333171 3300005468 Bacteria 1474
130 Ga0070699_100039618 3300005518 Bacteria 4079
131 Ga0070699_100240175 3300005518 Bacteria 1617
132 Ga0070699_100284062 3300005518 Bacteria 1483
133 Ga0070679_100016076 3300005530 Bacteria 7208
134 Ga0070679_100016549 3300005530 Bacteria 7118
135 Ga0070679_100056648 3300005530 Bacteria 3905
136 Ga0070684_100003618 3300005535 Bacteria 11636
137 Ga0070684_100102819 3300005535 Bacteria 2555
138 Ga0070684_100240214 3300005535 Bacteria 1655
139 Ga0070697_100043563 3300005536 Bacteria 3635
140 Ga0070697_100109950 3300005536 Bacteria 2296
141 Ga0068853_100040370 3300005539 Bacteria 3981
142 Ga0068853_100296844 3300005539 Bacteria 1493
143 Ga0068853_100319522 3300005539 Bacteria 1439
144 Ga0068853_100348299 3300005539 Bacteria 1377
145 Ga0068853_100370061 3300005539 Bacteria 1337
146 Ga0070672_100095595 3300005543 Bacteria 2403
147 Ga0070672_100185087 3300005543 Bacteria 1737
148 Ga0070672_100325557 3300005543 Bacteria 1307
149 Ga0070696_100014780 3300005546 Bacteria 5238
150 Ga0070696_100098384 3300005546 Bacteria 2093
151 Ga0070696_100112187 3300005546 Bacteria 1964
152 Ga0070665_100015661 3300005548 Bacteria 7615
153 Ga0070665_100059073 3300005548 Bacteria 3844
154 Ga0070665_100073671 3300005548 Bacteria 3420
155 Ga0070665_100074569 3300005548 Bacteria 3399
156 Ga0070665_100103789 3300005548 Bacteria 2846
157 Ga0070665_100117997 3300005548 Bacteria 2656
158 Ga0070665_100142795 3300005548 Bacteria 2397
159 Ga0070665_100153637 3300005548 Bacteria 2303
160 Ga0070665_100227335 3300005548 Bacteria 1866
161 Ga0070665_100283770 3300005548 Bacteria 1658
162 Ga0070704_100086022 3300005549 Bacteria 2328
163 Ga0070704_100106728 3300005549 Bacteria 2123
164 Ga0070704_100268781 3300005549 Bacteria 1408
165 Ga0068855_100002242 3300005563 Bacteria 23893
166 Ga0068855_100018220 3300005563 Bacteria 8435
167 Ga0068855_100062837 3300005563 Bacteria 4334
168 Ga0068855_100072098 3300005563 Bacteria 4015
169 Ga0068855_100220273 3300005563 Bacteria 2128
170 Ga0070664_100001933 3300005564 Bacteria 16650
171 Ga0070664_100086832 3300005564 Bacteria 2703
172 Ga0070664_100096918 3300005564 Bacteria 2560
173 Ga0070664_100149480 3300005564 Bacteria 2061
174 Ga0070664_100260130 3300005564 Bacteria 1561
175 Ga0068857_100004409 3300005577 Bacteria 11897
176 Ga0068857_100011076 3300005577 Bacteria 7846
177 Ga0068857_100053523 3300005577 Bacteria 3580
178 Ga0068857_100096683 3300005577 Bacteria 2647
179 Ga0068854_100018998 3300005578 Bacteria 4623
180 Ga0068854_100025857 3300005578 Bacteria 4029
181 Ga0068854_100101012 3300005578 Bacteria 2163
182 Ga0068854_100123512 3300005578 Bacteria 1969
183 Ga0068854_100142607 3300005578 Bacteria 1840
184 Ga0068854_100266034 3300005578 Bacteria 1375
185 Ga0068856_100008374 3300005614 Bacteria 10077
186 Ga0068856_100040825 3300005614 Bacteria 4558
187 Ga0068856_100205199 3300005614 Bacteria 1986
188 Ga0070702_100090478 3300005615 Bacteria 1855
189 Ga0070702_100202473 3300005615 Bacteria 1315
190 Ga0068852_100000511 3300005616 Bacteria 25571
191 Ga0068852_100211614 3300005616 Bacteria 1839
192 Ga0068852_100216668 3300005616 Bacteria 1819
193 Ga0068859_100006931 3300005617 Bacteria 11507
194 Ga0068859_100057158 3300005617 Bacteria 3930
195 Ga0068859_100143848 3300005617 Bacteria 2458
196 Ga0068859_100228755 3300005617 Bacteria 1947
197 Ga0068859_100258692 3300005617 Bacteria 1832
198 Ga0068864_100009044 3300005618 Bacteria 8210
199 Ga0068864_100014213 3300005618 Bacteria 6609
200 Ga0068864_100075419 3300005618 Bacteria 2944
201 Ga0068864_100183081 3300005618 Bacteria 1916
202 Ga0068861_100045484 3300005719 Bacteria 3305
203 Ga0068861_100072207 3300005719 Bacteria 2677
204 Ga0068861_100111381 3300005719 Bacteria 2193
205 Ga0068861_100305611 3300005719 Bacteria 1379
206 Ga0068851_10004499 3300005834 Bacteria 6291
207 Ga0068851_10033935 3300005834 Bacteria 2545
208 Ga0068863_100045110 3300005841 Bacteria 4183
209 Ga0068863_100097496 3300005841 Bacteria 2792
210 Ga0068858_100028464 3300005842 Bacteria 5190
211 Ga0068858_100231022 3300005842 Bacteria 1754
212 Ga0068860_100099735 3300005843 Bacteria 2770
213 Ga0068860_100100810 3300005843 Bacteria 2755
214 Ga0068860_100120557 3300005843 Bacteria 2511
215 Ga0068860_100168411 3300005843 Bacteria 2115
216 Ga0068860_100413140 3300005843 Bacteria 1337
217 Ga0068862_100016461 3300005844 Bacteria 6154
218 Ga0068862_100020306 3300005844 Bacteria 5548
219 Ga0068862_100045044 3300005844 Bacteria 3764
220 Ga0068862_100111422 3300005844 Bacteria 2402
221 Ga0068862_100203149 3300005844 Bacteria 1788
222 Ga0068862_100296576 3300005844 Bacteria 1486
223 Ga0081455_10005782 3300005937 Bacteria 13481
224 Ga0081455_10160148 3300005937 Bacteria 1726
225 Ga0081538_10001104 3300005981 Bacteria 28580
226 Ga0081540_1000195 3300005983 Bacteria 62863
227 Ga0081540_1002129 3300005983 Bacteria 16484
228 Ga0081540_1002161 3300005983 Bacteria 16332
229 Ga0081540_1003618 3300005983 Bacteria 12132
230 Ga0081540_1004467 3300005983 Bacteria 10650
231 Ga0081540_1008340 3300005983 Bacteria 7245
232 Ga0081540_1040261 3300005983 Bacteria 2437
233 Ga0081539_10000169 3300005985 Bacteria 153327
234 Ga0081539_10002228 3300005985 Bacteria 28275
235 Ga0081539_10004005 3300005985 Bacteria 16961
236 Ga0081539_10005221 3300005985 Bacteria 13445
237 Ga0081539_10049362 3300005985 Bacteria 2389
238 Ga0070717_10077650 3300006028 Bacteria 2781
239 Ga0070717_10134531 3300006028 Bacteria 2128
240 Ga0075365_10076208 3300006038 Bacteria 2264
241 Ga0075365_10089411 3300006038 Bacteria 2096
242 Ga0075365_10100467 3300006038 Bacteria 1980
243 Ga0075363_100042014 3300006048 Bacteria 2413
244 Ga0075364_10011789 3300006051 Bacteria 5322
245 Ga0075364_10104787 3300006051 Bacteria 1884
246 Ga0075432_10074957 3300006058 Bacteria 1220
247 Ga0070715_10002302 3300006163 Bacteria 5825
248 Ga0070715_10113009 3300006163 Bacteria 1284
249 Ga0070716_100005823 3300006173 Bacteria 5986
250 Ga0070716_100027070 3300006173 Bacteria 3076
251 Ga0070716_100029446 3300006173 Bacteria 2969
252 Ga0070716_100264802 3300006173 Bacteria 1178
253 Ga0070712_100003703 3300006175 Bacteria 9420
254 Ga0070712_100102581 3300006175 Bacteria 2119
255 Ga0075362_10015634 3300006177 Bacteria 3090
256 Ga0075362_10088533 3300006177 Bacteria 1434
257 Ga0075362_10134931 3300006177 Bacteria 1176
258 Ga0075367_10005414 3300006178 Bacteria 6334
259 Ga0075367_10038586 3300006178 Bacteria 2781
260 Ga0075367_10041835 3300006178 Bacteria 2680
261 Ga0075367_10042114 3300006178 Bacteria 2671
262 Ga0075369_10027238 3300006186 Bacteria 2388
263 Ga0075369_10039800 3300006186 Bacteria 2008
264 Ga0075366_10009032 3300006195 Bacteria 5559
265 Ga0075366_10013479 3300006195 Bacteria 4655
266 Ga0075366_10026168 3300006195 Bacteria 3416
267 Ga0075366_10048153 3300006195 Bacteria 2527
268 Ga0075366_10084781 3300006195 Bacteria 1894
269 Ga0075366_10094274 3300006195 Bacteria 1794
270 Ga0097621_100055296 3300006237 Bacteria 3240
271 Ga0075370_10002403 3300006353 Bacteria 8668
272 Ga0075370_10006919 3300006353 Bacteria 5744
273 Ga0075370_10022864 3300006353 Bacteria 3438
274 Ga0075370_10033493 3300006353 Bacteria 2877
275 Ga0075370_10066745 3300006353 Bacteria 2052
276 Ga0075370_10070577 3300006353 Bacteria 1998
277 Ga0075370_10106095 3300006353 Bacteria 1629
278 Ga0068871_100009046 3300006358 Bacteria 7194
279 Ga0075428_100132849 3300006844 Bacteria 2707
280 Ga0075428_100252329 3300006844 Bacteria 1901
281 Ga0075430_100018985 3300006846 Bacteria 5849
282 Ga0075431_100012951 3300006847 Bacteria 8419
283 Ga0075434_100096581 3300006871 Bacteria 2960
284 Ga0075434_100106770 3300006871 Bacteria 2810
285 Ga0075434_100559567 3300006871 Bacteria 1163
286 Ga0097620_100006931 3300006931 Bacteria 11507
287 Ga0097620_100057158 3300006931 Bacteria 3930
288 Ga0097620_100143847 3300006931 Bacteria 2458
289 Ga0097620_100228753 3300006931 Bacteria 1947
290 Ga0097620_100258689 3300006931 Bacteria 1832
291 Ga0097620_100316058 3300006931 Bacteria 1656
292 Ga0099824_1022176 3300006942 Bacteria 4241
293 Ga0099822_1004906 3300006943 Bacteria 17459
294 Ga0075435_100062845 3300007076 Bacteria 3014
295 Ga0075435_100411866 3300007076 Bacteria 1163
296 Ga0099794_10002417 3300007265 Bacteria 6880
297 Ga0099794_10025953 3300007265 Bacteria 2704
298 Ga0099795_10004316 3300007788 Bacteria 3652
299 Ga0099795_10029791 3300007788 Bacteria 1868
300 Ga0105250_10086862 3300009092 Bacteria 1270
301 Ga0105240_10000933 3300009093 Bacteria 51939
302 Ga0105240_10011759 3300009093 Bacteria 12161
303 Ga0105240_10016843 3300009093 Bacteria 9878
304 Ga0105240_10031202 3300009093 Bacteria 6914
305 Ga0105240_10087196 3300009093 Bacteria 3823
306 Ga0111539_10055979 3300009094 Bacteria 4689
307 Ga0111539_10205975 3300009094 Bacteria 2293
308 Ga0105245_10060265 3300009098 Bacteria 3418
309 Ga0105245_10073859 3300009098 Bacteria 3102
310 Ga0105245_10277391 3300009098 Bacteria 1637
311 Ga0105247_10017735 3300009101 Bacteria 4269
312 Ga0114129_10141644 3300009147 Bacteria 3295
313 Ga0114129_10158707 3300009147 Bacteria 3092
314 Ga0114129_10332294 3300009147 Bacteria 2017
315 Ga0114129_10540748 3300009147 Bacteria 1516
316 Ga0114129_10704922 3300009147 Bacteria 1297
317 Ga0105243_10025143 3300009148 Bacteria 4548
318 Ga0105243_10032960 3300009148 Bacteria 4004
319 Ga0105243_10045659 3300009148 Bacteria 3444
320 Ga0105243_10268527 3300009148 Bacteria 1530
321 Ga0105243_10347435 3300009148 Bacteria 1361
322 Ga0105241_10007024 3300009174 Bacteria 8283
323 Ga0105241_10014987 3300009174 Bacteria 5677
324 Ga0105241_10050565 3300009174 Bacteria 3168
325 Ga0105248_10014000 3300009177 Bacteria 8825
326 Ga0105248_10028709 3300009177 Bacteria 6200
327 Ga0105248_10154438 3300009177 Bacteria 2590
328 Ga0105248_10174058 3300009177 Bacteria 2426
329 Ga0105248_10235978 3300009177 Bacteria 2059
330 Ga0105248_10465627 3300009177 Bacteria 1425
331 Ga0105237_10000407 3300009545 Bacteria 61234
332 Ga0105237_10006258 3300009545 Bacteria 13250
333 Ga0105237_10017035 3300009545 Bacteria 7544
334 Ga0105237_10023255 3300009545 Bacteria 6353
335 Ga0105237_10029825 3300009545 Bacteria 5541
336 Ga0105237_10085828 3300009545 Bacteria 3137
337 Ga0105237_10122834 3300009545 Bacteria 2591
338 Ga0105237_10128946 3300009545 Bacteria 2524
339 Ga0105237_10157199 3300009545 Bacteria 2271
340 Ga0105237_10250045 3300009545 Bacteria 1775
341 Ga0105237_10354483 3300009545 Bacteria 1472
342 Ga0105237_10392256 3300009545 Bacteria 1393
343 Ga0105237_10433471 3300009545 Bacteria 1320
344 Ga0105238_10005854 3300009551 Bacteria 12178
345 Ga0105238_10010029 3300009551 Bacteria 9499
346 Ga0105238_10016113 3300009551 Bacteria 7560
347 Ga0105238_10108545 3300009551 Bacteria 2756
348 Ga0105238_10208998 3300009551 Bacteria 1928
349 Ga0105238_10321064 3300009551 Bacteria 1534
350 Ga0105238_10419086 3300009551 Bacteria 1333
351 Ga0105249_10072678 3300009553 Bacteria 3180
352 Ga0105249_10288633 3300009553 Bacteria 1641
353 Ga0105249_10334152 3300009553 Bacteria 1530
354 Ga0105249_10577096 3300009553 Bacteria 1177
355 Ga0099796_10026519 3300010159 Bacteria 1841
356 Ga0105239_10000335 3300010375 Bacteria 68810
357 Ga0105239_10035550 3300010375 Bacteria 5471
358 Ga0105239_10039190 3300010375 Bacteria 5191
359 Ga0105239_10077141 3300010375 Bacteria 3666
360 Ga0105239_10093933 3300010375 Bacteria 3312
361 Ga0105239_10157084 3300010375 Bacteria 2540
362 Ga0105239_10211349 3300010375 Bacteria 2175
363 Ga0105239_10551399 3300010375 Bacteria 1313
364 Ga0105239_10749121 3300010375 Bacteria 1118
365 Ga0105246_10176301 3300011119 Bacteria 1642
366 Ga0105246_10341649 3300011119 Bacteria 1224
367 Ga0157373_10047441 3300013100 Bacteria 3064
368 Ga0157370_10005026 3300013104 Bacteria 14938
369 Ga0157370_10057819 3300013104 Bacteria 3686
370 Ga0157369_10008569 3300013105 Bacteria 11730
371 Ga0157369_10030554 3300013105 Bacteria 5941
372 Ga0157369_10047093 3300013105 Bacteria 4684
373 Ga0157374_10485952 3300013296 Bacteria 1238
374 Ga0157378_10004078 3300013297 Bacteria 12907
375 Ga0157378_10080645 3300013297 Bacteria 2940
376 Ga0157378_10302238 3300013297 Bacteria 1549
377 Ga0163162_10001909 3300013306 Bacteria 19640
378 Ga0163162_10040094 3300013306 Bacteria 4681
379 Ga0163162_10041475 3300013306 Bacteria 4605
380 Ga0163162_10053558 3300013306 Bacteria 4056
381 Ga0163162_10114327 3300013306 Bacteria 2798
382 Ga0163162_10134352 3300013306 Bacteria 2584
383 Ga0163162_10277471 3300013306 Bacteria 1808
384 Ga0157372_10006560 3300013307 Bacteria 12382
385 Ga0157375_10021587 3300013308 Bacteria 5908
386 Ga0157375_10027966 3300013308 Bacteria 5278
387 Ga0157375_10191451 3300013308 Bacteria 2200
388 Ga0163163_10010972 3300014325 Bacteria 8188
389 Ga0163163_10127210 3300014325 Bacteria 2586
390 Ga0163163_10308697 3300014325 Bacteria 1635
391 Ga0163163_10354179 3300014325 Bacteria 1524
392 Ga0157380_10065010 3300014326 Bacteria 2930
393 Ga0157380_10189385 3300014326 Bacteria 1815
394 Ga0182008_10002327 3300014497 Bacteria 11969
395 Ga0182008_10053607 3300014497 Bacteria 1996
396 Ga0157377_10000032 3300014745 Bacteria 121003
397 Ga0157379_10026406 3300014968 Bacteria 5169
398 Ga0157379_10092466 3300014968 Bacteria 2713
399 Ga0157379_10166222 3300014968 Bacteria 1991
400 Ga0157379_10201601 3300014968 Bacteria 1799
401 Ga0157379_10277561 3300014968 Bacteria 1525
402 Ga0157376_10135506 3300014969 Bacteria 2203
403 Ga0157376_10300509 3300014969 Bacteria 1519
404 Ga0182006_1052068 3300015261 Bacteria 1574
405 Ga0182007_10001161 3300015262 Bacteria 14261
406 Ga0183362_10002 3300015683 Bacteria 1432711
407 Ga0163161_10025674 3300017792 Bacteria 4171
408 Ga0163161_10190847 3300017792 Bacteria 1575
409 Ga0214544_1000013 3300021320 Bacteria 228947
410 Ga0214544_1000018 3300021320 Bacteria 187095
411 Ga0214542_1000013 3300021321 Bacteria 234019
412 Ga0214542_1000081 3300021321 Bacteria 121242
413 Ga0214542_1022360 3300021321 Bacteria 4073
414 Ga0214545_1000012 3300021324 Bacteria 187898
415 Ga0214543_1000012 3300021327 Bacteria 338982
416 Ga0214543_1000042 3300021327 Bacteria 164433
417 Ga0214543_1000065 3300021327 Bacteria 126516
418 Ga0213873_10000963 3300021358 Bacteria 4664
419 Ga0213874_10017590 3300021377 Bacteria 1919
420 Ga0213874_10036705 3300021377 Bacteria 1446
421 Ga0213876_10002957 3300021384 Bacteria 9843
422 Ga0209674_100041 3300025226 Bacteria 396231
423 Ga0209674_100048 3300025226 Bacteria 353032
424 Ga0209672_106802 3300025228 Bacteria 1823
425 Ga0209563_100043 3300025230 Bacteria 397271
426 Ga0209258_100267 3300025242 Bacteria 89896
427 Ga0209646_1000069 3300025246 Bacteria 230340
428 Ga0209026_1000006 3300025250 Bacteria 677225
429 Ga0209677_100212 3300025253 Bacteria 43828
430 Ga0209677_100805 3300025253 Bacteria 15686
431 Ga0209677_101117 3300025253 Bacteria 12572
432 Ga0209148_1000643 3300025254 Bacteria 30450
433 Ga0209148_1000647 3300025254 Bacteria 30166
434 Ga0209148_1011717 3300025254 Bacteria 1623
435 Ga0209759_1000032 3300025256 Bacteria 278697
436 Ga0209759_1000075 3300025256 Bacteria 176235
437 Ga0209759_1000691 3300025256 Bacteria 30300
438 Ga0209759_1000951 3300025256 Bacteria 20726
439 Ga0209759_1006433 3300025256 Bacteria 3944
440 Ga0209129_1001986 3300025258 Bacteria 10630
441 Ga0209129_1004886 3300025258 Bacteria 5007
442 Ga0209233_1001170 3300025261 Bacteria 10599
443 Ga0209233_1010430 3300025261 Bacteria 2784
444 Ga0209233_1016614 3300025261 Bacteria 2024
445 Ga0209455_1000158 3300025272 Bacteria 118973
446 Ga0209455_1005167 3300025272 Bacteria 4097
447 Ga0209673_1005041 3300025273 Bacteria 6811
448 Ga0209025_1006605 3300025294 Bacteria 8936
449 Ga0209758_1008781 3300025297 Bacteria 6442
450 Ga0209758_1018742 3300025297 Bacteria 3375
451 Ga0209758_1039634 3300025297 Bacteria 1789
452 Ga0209050_1008894 3300025298 Bacteria 5256
453 Ga0207426_1000039 3300025302 Bacteria 439937
454 Ga0207426_1042886 3300025302 Bacteria 1393
455 Ga0209051_1000253 3300025303 Bacteria 90622
456 Ga0209051_1006237 3300025303 Bacteria 6763
457 Ga0209051_1007994 3300025303 Bacteria 5678
458 Ga0209051_1010924 3300025303 Bacteria 4531
459 Ga0209257_1008074 3300025304 Bacteria 6126
460 Ga0207697_10011897 3300025315 Bacteria 3667
461 Ga0207697_10080082 3300025315 Bacteria 1376
462 Ga0207656_10058279 3300025321 Bacteria 1687
463 Ga0207653_10025620 3300025885 Bacteria 1886
464 Ga0207682_10004544 3300025893 Bacteria 5781
465 Ga0207692_10001920 3300025898 Bacteria 7914
466 Ga0207692_10004113 3300025898 Bacteria 5740
467 Ga0207642_10077887 3300025899 Bacteria 1601
468 Ga0207710_10012995 3300025900 Bacteria 3507
469 Ga0207680_10064483 3300025903 Bacteria 2246
470 Ga0207647_10005772 3300025904 Bacteria 9031
471 Ga0207699_10005809 3300025906 Bacteria 5936
472 Ga0207699_10021067 3300025906 Bacteria 3506
473 Ga0207699_10080639 3300025906 Bacteria 2017
474 Ga0207645_10037323 3300025907 Bacteria 3117
475 Ga0207645_10046830 3300025907 Bacteria 2762
476 Ga0207645_10111369 3300025907 Bacteria 1772
477 Ga0207645_10194661 3300025907 Bacteria 1333
478 Ga0207643_10028118 3300025908 Bacteria 3121
479 Ga0207705_10012116 3300025909 Bacteria 6232
480 Ga0207705_10063917 3300025909 Bacteria 2659
481 Ga0207684_10003492 3300025910 Bacteria 15341
482 Ga0207684_10150913 3300025910 Bacteria 1999
483 Ga0207654_10044646 3300025911 Bacteria 2518
484 Ga0207654_10104159 3300025911 Bacteria 1753
485 Ga0207707_10001229 3300025912 Bacteria 24021
486 Ga0207707_10020086 3300025912 Bacteria 5830
487 Ga0207707_10044886 3300025912 Bacteria 3852
488 Ga0207695_10000006 3300025913 Bacteria 1135309
489 Ga0207695_10010418 3300025913 Bacteria 11374
490 Ga0207695_10030775 3300025913 Bacteria 5905
491 Ga0207695_10128881 3300025913 Bacteria 2489
492 Ga0207695_10308852 3300025913 Bacteria 1472
493 Ga0207671_10009057 3300025914 Bacteria 8368
494 Ga0207671_10011585 3300025914 Bacteria 7161
495 Ga0207671_10018145 3300025914 Bacteria 5406
496 Ga0207671_10031044 3300025914 Bacteria 3983
497 Ga0207671_10073481 3300025914 Bacteria 2554
498 Ga0207671_10103726 3300025914 Bacteria 2157
499 Ga0207671_10222759 3300025914 Bacteria 1478
500 Ga0207671_10263597 3300025914 Bacteria 1356
501 Ga0207693_10006626 3300025915 Bacteria 9565
502 Ga0207693_10006645 3300025915 Bacteria 9555
503 Ga0207693_10022713 3300025915 Bacteria 4983
504 Ga0207693_10067559 3300025915 Bacteria 2799
505 Ga0207663_10000075 3300025916 Bacteria 47189
506 Ga0207663_10030257 3300025916 Bacteria 3192
507 Ga0207663_10165866 3300025916 Bacteria 1564
508 Ga0207662_10092474 3300025918 Bacteria 1862
509 Ga0207657_10000658 3300025919 Bacteria 36762
510 Ga0207657_10011685 3300025919 Bacteria 8701
511 Ga0207657_10154515 3300025919 Bacteria 1867
512 Ga0207649_10002873 3300025920 Bacteria 9481
513 Ga0207649_10090706 3300025920 Bacteria 2000
514 Ga0207649_10108412 3300025920 Bacteria 1851
515 Ga0207652_10005888 3300025921 Bacteria 9920
516 Ga0207652_10027465 3300025921 Bacteria 4743
517 Ga0207646_10069582 3300025922 Bacteria 3143
518 Ga0207681_10015333 3300025923 Bacteria 4779
519 Ga0207681_10126500 3300025923 Bacteria 1883
520 Ga0207681_10153364 3300025923 Bacteria 1729
521 Ga0207694_10002406 3300025924 Bacteria 15296
522 Ga0207694_10005548 3300025924 Bacteria 9669
523 Ga0207694_10012928 3300025924 Bacteria 6287
524 Ga0207659_10089124 3300025926 Bacteria 2300
525 Ga0207687_10053770 3300025927 Bacteria 2815
526 Ga0207687_10144716 3300025927 Bacteria 1807
527 Ga0207700_10102267 3300025928 Bacteria 2288
528 Ga0207700_10128828 3300025928 Bacteria 2063
529 Ga0207700_10133916 3300025928 Bacteria 2027
530 Ga0207700_10155650 3300025928 Bacteria 1893
531 Ga0207700_10160945 3300025928 Bacteria 1864
532 Ga0207700_10351537 3300025928 Bacteria 1283
533 Ga0207664_10012282 3300025929 Bacteria 6121
534 Ga0207664_10017070 3300025929 Bacteria 5309
535 Ga0207664_10037837 3300025929 Bacteria 3737
536 Ga0207664_10147166 3300025929 Bacteria 1998
537 Ga0207644_10013240 3300025931 Bacteria 5495
538 Ga0207644_10028664 3300025931 Bacteria 3857
539 Ga0207644_10069782 3300025931 Bacteria 2566
540 Ga0207690_10098147 3300025932 Bacteria 2086
541 Ga0207690_10185089 3300025932 Bacteria 1571
542 Ga0207690_10195613 3300025932 Bacteria 1532
543 Ga0207706_10000266 3300025933 Bacteria 56883
544 Ga0207706_10033826 3300025933 Bacteria 4549
545 Ga0207706_10041595 3300025933 Bacteria 4073
546 Ga0207706_10060636 3300025933 Bacteria 3332
547 Ga0207706_10096803 3300025933 Bacteria 2596
548 Ga0207706_10205795 3300025933 Bacteria 1726
549 Ga0207706_10214218 3300025933 Bacteria 1688
550 Ga0207706_10495171 3300025933 Bacteria 1055
551 Ga0207709_10000641 3300025935 Bacteria 28524
552 Ga0207709_10008413 3300025935 Bacteria 5706
553 Ga0207709_10045251 3300025935 Bacteria 2664
554 Ga0207709_10204766 3300025935 Bacteria 1412
555 Ga0207709_10255018 3300025935 Bacteria 1283
556 Ga0207670_10040156 3300025936 Bacteria 3070
557 Ga0207669_10006725 3300025937 Bacteria 5275
558 Ga0207669_10034479 3300025937 Bacteria 2868
559 Ga0207669_10092948 3300025937 Bacteria 1969
560 Ga0207704_10045296 3300025938 Bacteria 2613
561 Ga0207704_10200172 3300025938 Bacteria 1461
562 Ga0207665_10001949 3300025939 Bacteria 13896
563 Ga0207665_10007226 3300025939 Bacteria 7349
564 Ga0207665_10017888 3300025939 Bacteria 4659
565 Ga0207691_10111908 3300025940 Bacteria 2427
566 Ga0207691_10115632 3300025940 Bacteria 2382
567 Ga0207691_10339752 3300025940 Bacteria 1285
568 Ga0207711_10017162 3300025941 Bacteria 6014
569 Ga0207711_10181074 3300025941 Bacteria 1916
570 Ga0207711_10192015 3300025941 Bacteria 1861
571 Ga0207711_10365190 3300025941 Bacteria 1338
572 Ga0207711_10430765 3300025941 Bacteria 1227
573 Ga0207689_10001210 3300025942 Bacteria 24834
574 Ga0207689_10008082 3300025942 Bacteria 9176
575 Ga0207689_10020623 3300025942 Bacteria 5543
576 Ga0207689_10030832 3300025942 Bacteria 4468
577 Ga0207689_10063252 3300025942 Bacteria 3044
578 Ga0207661_10000703 3300025944 Bacteria 21689
579 Ga0207661_10035367 3300025944 Bacteria 3892
580 Ga0207661_10241994 3300025944 Bacteria 1601
581 Ga0207679_10012204 3300025945 Bacteria 5596
582 Ga0207679_10145087 3300025945 Bacteria 1924
583 Ga0207679_10194492 3300025945 Bacteria 1689
584 Ga0207679_10267142 3300025945 Bacteria 1461
585 Ga0207667_10017780 3300025949 Bacteria 7995
586 Ga0207667_10033492 3300025949 Bacteria 5523
587 Ga0207667_10086269 3300025949 Bacteria 3248
588 Ga0207667_10099955 3300025949 Bacteria 2993
589 Ga0207667_10124871 3300025949 Bacteria 2651
590 Ga0207667_10170598 3300025949 Bacteria 2236
591 Ga0207651_10002064 3300025960 Bacteria 9461
592 Ga0207651_10065970 3300025960 Bacteria 2541
593 Ga0207651_10162582 3300025960 Bacteria 1752
594 Ga0207712_10046477 3300025961 Bacteria 3010
595 Ga0207712_10178291 3300025961 Bacteria 1667
596 Ga0207712_10247137 3300025961 Bacteria 1440
597 Ga0207668_10020133 3300025972 Bacteria 4232
598 Ga0207668_10025131 3300025972 Bacteria 3850
599 Ga0207668_10066910 3300025972 Bacteria 2548
600 Ga0207668_10078537 3300025972 Bacteria 2384
601 Ga0207668_10105696 3300025972 Bacteria 2102
602 Ga0207668_10153926 3300025972 Bacteria 1783
603 Ga0207668_10157297 3300025972 Bacteria 1767
604 Ga0207668_10201702 3300025972 Bacteria 1584
605 Ga0207668_10226514 3300025972 Bacteria 1504
606 Ga0207668_10289405 3300025972 Bacteria 1347
607 Ga0207640_10013803 3300025981 Bacteria 4639
608 Ga0207640_10022152 3300025981 Bacteria 3798
609 Ga0207640_10062328 3300025981 Bacteria 2474
610 Ga0207658_10002081 3300025986 Bacteria 14887
611 Ga0207658_10011725 3300025986 Bacteria 5969
612 Ga0207658_10027878 3300025986 Bacteria 3973
613 Ga0207677_10024222 3300026023 Bacteria 3767
614 Ga0207677_10034058 3300026023 Bacteria 3294
615 Ga0207677_10068685 3300026023 Bacteria 2489
616 Ga0207677_10152481 3300026023 Bacteria 1785
617 Ga0207677_10155552 3300026023 Bacteria 1770
618 Ga0207703_10022170 3300026035 Bacteria 4979
619 Ga0207703_10077650 3300026035 Bacteria 2757
620 Ga0207703_10144618 3300026035 Bacteria 2067
621 Ga0207703_10369499 3300026035 Bacteria 1325
622 Ga0207639_10048968 3300026041 Bacteria 3201
623 Ga0207639_10066316 3300026041 Bacteria 2805
624 Ga0207678_10038950 3300026067 Bacteria 4127
625 Ga0207678_10051569 3300026067 Bacteria 3552
626 Ga0207678_10141187 3300026067 Bacteria 2056
627 Ga0207678_10271466 3300026067 Bacteria 1454
628 Ga0207702_10000942 3300026078 Bacteria 29961
629 Ga0207702_10004171 3300026078 Bacteria 12941
630 Ga0207702_10089229 3300026078 Bacteria 2696
631 Ga0207641_10067734 3300026088 Bacteria 3059
632 Ga0207641_10071518 3300026088 Bacteria 2984
633 Ga0207648_10000172 3300026089 Bacteria 66986
634 Ga0207648_10004439 3300026089 Bacteria 14397
635 Ga0207648_10067027 3300026089 Bacteria 3130
636 Ga0207648_10086738 3300026089 Bacteria 2731
637 Ga0207648_10172858 3300026089 Bacteria 1910
638 Ga0207676_10064256 3300026095 Bacteria 2918
639 Ga0207674_10000118 3300026116 Bacteria 92408
640 Ga0207674_10001181 3300026116 Bacteria 33934
641 Ga0207674_10053120 3300026116 Bacteria 4130
642 Ga0207674_10202893 3300026116 Bacteria 1932
643 Ga0207674_10205570 3300026116 Bacteria 1918
644 Ga0207675_100017216 3300026118 Bacteria 6749
645 Ga0207675_100087869 3300026118 Bacteria 2920
646 Ga0207675_100091301 3300026118 Bacteria 2863
647 Ga0207675_100258500 3300026118 Bacteria 1687
648 Ga0207683_10039922 3300026121 Bacteria 4094
649 Ga0207683_10062801 3300026121 Bacteria 3272
650 Ga0207683_10064742 3300026121 Bacteria 3222
651 Ga0207683_10099317 3300026121 Bacteria 2598
652 Ga0207683_10292745 3300026121 Bacteria 1489
653 Ga0207698_10007421 3300026142 Bacteria 6869
654 Ga0207698_10016114 3300026142 Bacteria 5029
655 Ga0207698_10210522 3300026142 Bacteria 1749
656 Ga0209389_1000100 3300027296 Bacteria 79023
657 Ga0209389_1000181 3300027296 Bacteria 49013
658 Ga0209589_1000042 3300027357 Bacteria 122436
659 Ga0209589_1000092 3300027357 Bacteria 89530
660 Ga0209489_100006 3300027361 Bacteria 475698
661 Ga0209489_100095 3300027361 Bacteria 122436
662 Ga0209489_103729 3300027361 Bacteria 29160
663 Ga0209700_100005 3300027363 Bacteria 573969
664 Ga0209700_100095 3300027363 Bacteria 122436
665 Ga0209179_1003933 3300027512 Bacteria 2196
666 Ga0209813_10024127 3300027866 Bacteria 1736
667 Ga0207428_10119704 3300027907 Bacteria 2020
668 Ga0268266_10002919 3300028379 Bacteria 17681
669 Ga0268266_10008606 3300028379 Bacteria 9062
670 Ga0268266_10047223 3300028379 Bacteria 3688
671 Ga0268266_10070968 3300028379 Bacteria 3019
672 Ga0268266_10170082 3300028379 Bacteria 1977
673 Ga0268266_10189445 3300028379 Bacteria 1877
674 Ga0268265_10028233 3300028380 Bacteria 4016
675 Ga0268265_10031405 3300028380 Bacteria 3836
676 Ga0268265_10089897 3300028380 Bacteria 2451
677 Ga0268265_10204786 3300028380 Bacteria 1714
678 Ga0268265_10242142 3300028380 Bacteria 1592
679 Ga0268265_10388650 3300028380 Bacteria 1286
680 Ga0268264_10000050 3300028381 Bacteria 323697
681 Ga0268264_10089984 3300028381 Bacteria 2644
682 Ga0268264_10092502 3300028381 Bacteria 2611
683 Ga0268264_10323527 3300028381 Bacteria 1459
684 Ga0307517_10001469 3300028786 Bacteria 39464
685 Ga0307517_10067186 3300028786 Bacteria 3286
686 Ga0307517_10083974 3300028786 Bacteria 2685
687 Ga0307515_10000131 3300028794 Bacteria 178919
688 Ga0307515_10000240 3300028794 Bacteria 135655
689 Ga0307515_10001319 3300028794 Bacteria 56336
690 Ga0307515_10003518 3300028794 Bacteria 32919
691 Ga0307515_10005390 3300028794 Bacteria 25923
692 Ga0307515_10054084 3300028794 Bacteria 5902
693 Ga0307515_10134875 3300028794 Bacteria 2692
694 Ga0307515_10223224 3300028794 Bacteria 1696
695 Ga0307512_10089762 3300030522 Bacteria 2148
696 Ga0265330_10015050 3300031235 Bacteria 3582
697 Ga0265332_10037532 3300031238 Bacteria 2101
698 Ga0265328_10029354 3300031239 Bacteria 2054
699 Ga0265328_10030050 3300031239 Bacteria 2026
700 Ga0265325_10061509 3300031241 Bacteria 1904
701 Ga0265340_10007729 3300031247 Bacteria 5831
702 Ga0265339_10050005 3300031249 Bacteria 2287
703 Ga0265331_10001729 3300031250 Bacteria 15720
704 Ga0265327_10003742 3300031251 Bacteria 14142
705 Ga0307513_10049358 3300031456 Bacteria 4560
706 Ga0307513_10064413 3300031456 Bacteria 3863
707 Ga0307513_10197129 3300031456 Bacteria 1859
708 Ga0307513_10337544 3300031456 Bacteria 1258
709 Ga0307513_10355563 3300031456 Bacteria 1211
710 Ga0307509_10003237 3300031507 Bacteria 25135
711 Ga0307509_10013707 3300031507 Bacteria 9573
712 Ga0307509_10017777 3300031507 Bacteria 8171
713 Ga0307509_10085879 3300031507 Bacteria 3237
714 Ga0307509_10228759 3300031507 Bacteria 1664
715 Ga0307509_10322717 3300031507 Bacteria 1280
716 Ga0307408_100032090 3300031548 Bacteria 3662
717 Ga0265313_10000543 3300031595 Bacteria 39362
718 Ga0307508_10000029 3300031616 Bacteria 168411
719 Ga0307508_10005913 3300031616 Bacteria 11546
720 Ga0307508_10024170 3300031616 Bacteria 5514
721 Ga0307508_10042436 3300031616 Bacteria 4080
722 Ga0307508_10083431 3300031616 Bacteria 2778
723 Ga0307508_10108926 3300031616 Bacteria 2370
724 Ga0307508_10114255 3300031616 Bacteria 2300
725 Ga0307508_10304997 3300031616 Bacteria 1185
726 Ga0265314_10042749 3300031711 Bacteria 3228
727 Ga0265342_10048798 3300031712 Bacteria 2536
728 Ga0265342_10132257 3300031712 Bacteria 1397
729 Ga0307516_10000340 3300031730 Bacteria 61066
730 Ga0307516_10000763 3300031730 Bacteria 43894
731 Ga0307516_10001388 3300031730 Bacteria 33439
732 Ga0307516_10004925 3300031730 Bacteria 16239
733 Ga0307516_10007591 3300031730 Bacteria 12429
734 Ga0307516_10007878 3300031730 Bacteria 12136
735 Ga0307516_10039620 3300031730 Bacteria 4695
736 Ga0307516_10050803 3300031730 Bacteria 4066
737 Ga0307516_10099875 3300031730 Bacteria 2718
738 Ga0307516_10209948 3300031730 Bacteria 1662
739 Ga0307516_10294053 3300031730 Bacteria 1302
740 Ga0307405_10018511 3300031731 Bacteria 3844
741 Ga0307407_10039321 3300031903 Bacteria 2630
742 Ga0307412_10072616 3300031911 Bacteria 2352
743 Ga0307409_100001244 3300031995 Bacteria 12277
744 Ga0307416_100143042 3300032002 Bacteria 2178
745 Ga0307415_100001555 3300032126 Bacteria 11041
746 Ga0307507_10143236 3300033179 Bacteria 1825
747 Ga0307510_10012890 3300033180 Bacteria 9923
748 Ga0307510_10015834 3300033180 Bacteria 8910
749 Ga0307510_10065142 3300033180 Bacteria 3694
750 Ga0307510_10077966 3300033180 Bacteria 3245
751 Ga0307510_10119136 3300033180 Bacteria 2350
752 Ga0307510_10150234 3300033180 Bacteria 1950
753 Ga0307510_10233922 3300033180 Bacteria 1338
754 Ga0373926_0025820 3300035083 Bacteria 2052
755 Ga0373923_0051564 3300035111 Bacteria 1727
756 Ga0373936_0013378 3300035113 Bacteria 3133
757 Ga0373954_0000871 3300035118 Bacteria 11706
758 Ga0373954_0028630 3300035118 Bacteria 2562
759 Ga0373954_0071625 3300035118 Bacteria 1647
760 Ga0373956_0003759 3300035119 Bacteria 6114
761 Ga0373956_0028669 3300035119 Bacteria 2424
762 Ga0373957_0000492 3300035120 Bacteria 9929
763 Ga0373957_0004249 3300035120 Bacteria 4344
764 Ga0373943_0005276 3300035170 Bacteria 5815
765 Ga0373946_0018761 3300035171 Bacteria 2659
766 Ga0373946_0035846 3300035171 Bacteria 2008
767 Ga0373955_0004827 3300035172 Bacteria 6008
768 Ga0373955_0041413 3300035172 Bacteria 2469
769 Ga0373955_0195537 3300035172 Bacteria 1203
770 Ga0373924_0001494 3300035410 Bacteria 7613
771 Ga0373931_0056434 3300035691 Bacteria 2104
772 Ga0373927_0000449 3300035695 Bacteria 31465
773 Ga0373927_0006633 3300035695 Bacteria 7881
774 Ga0373927_0011073 3300035695 Bacteria 6008
775 Ga0373927_0016946 3300035695 Bacteria 4801
776 Ga0373927_0033968 3300035695 Bacteria 3319
777 Ga0373927_0124627 3300035695 Bacteria 1682
778 Ga0373927_0277437 3300035695 Bacteria 1102
779 Ga0373933_0000225 3300035724 Bacteria 37547
780 Ga0373933_0001750 3300035724 Bacteria 12597
781 Ga0373933_0009186 3300035724 Bacteria 5396
782 Ga0373937_0100873 3300036401 Bacteria 2679
783 Ga0373925_0007139 3300037068 Bacteria 8163
784 Ga0373925_0066579 3300037068 Bacteria 2716
785 Ga0373925_0164582 3300037068 Bacteria 1749
786 Ga0373925_0326750 3300037068 Bacteria 1242
787 Ga0395899_0001949 3300037312 Bacteria 16981
788 Ga0395899_0038828 3300037312 Bacteria 3564
789 Ga0395900_0044939 3300037418 Bacteria 4549
790 Ga0395898_0005706 3300037466 Bacteria 13412
791 Ga0395898_0524861 3300037466 Bacteria 1125
792 Ga0395905_0000009 3300037471 Bacteria 488729
793 Ga0395905_0000398 3300037471 Bacteria 61654
794 Ga0395905_0025545 3300037471 Bacteria 5570
795 Ga0395905_0026353 3300037471 Bacteria 5481
796 Ga0395905_0046282 3300037471 Bacteria 4079
797 Ga0395905_0061220 3300037471 Bacteria 3521
798 Ga0395905_0062295 3300037471 Bacteria 3489
799 Ga0395905_0128258 3300037471 Bacteria 2386
800 Ga0395901_0019109 3300038443 Bacteria 7007
801 Ga0395901_0117974 3300038443 Bacteria 2788
802 Ga0395901_0245747 3300038443 Bacteria 1865
803 Ga0436365_0164550 3300039437 Bacteria 3084
804 Ga0436365_0954239 3300039437 Bacteria 40865
805 Ga0436365_1246958 3300039437 Bacteria 2563
806 Ga0436365_1290035 3300039437 Bacteria 2158
807 Ga0436360_0323156 3300039438 Bacteria 2135
808 Ga0436360_1001325 3300039438 Bacteria 17844
809 Ga0436361_0086639 3300039447 Bacteria 2010
810 Ga0436361_0613754 3300039447 Bacteria 2422
811 Ga0436361_0768335 3300039447 Bacteria 1810
812 Ga0436361_0833528 3300039447 Bacteria 1155
813 Ga0436363_0657874 3300039450 Bacteria 5703
814 Ga0436363_0715786 3300039450 Bacteria 1298
815 Ga0436363_1349888 3300039450 Bacteria 1564
816 Ga0436363_1534966 3300039450 Bacteria 3243
817 Ga0436362_0022522 3300039453 Bacteria 5354
818 Ga0436362_0952674 3300039453 Bacteria 3097
819 Ga0439436_0000231 3300041404 Bacteria 13384
820 Ga0439439_0007026 3300041406 Bacteria 2623
821 Ga0439431_0038494 3300041997 Bacteria 1211
822 Ga0439449_0015812 3300042007 Bacteria 2837
823 Ga0439455_0022643 3300042012 Bacteria 1507
824 Ga0450890_005209 3300042127 Bacteria 1676
825 Ga0450898_027205 3300042134 Bacteria 1034
826 Ga0439434_0012357 3300042435 Bacteria 2527
827 Ga0466969_0004520 3300044656 Bacteria 7406
828 Ga0466969_0006057 3300044656 Bacteria 6435
829 Ga0466969_0017140 3300044656 Bacteria 3786
830 Ga0466969_0050564 3300044656 Bacteria 2049
831 Ga0466969_0075371 3300044656 Bacteria 1617
832 Ga0466972_0000169 3300044658 Bacteria 51450
833 Ga0466972_0003740 3300044658 Bacteria 7565
834 Ga0466972_0005546 3300044658 Bacteria 6324
835 Ga0466972_0060985 3300044658 Bacteria 1809
836 Ga0453683_0000791 3300044673 Bacteria 31228
837 Ga0466965_0003762 3300044683 Bacteria 6700
838 Ga0466965_0021534 3300044683 Bacteria 3104
839 Ga0466965_0048964 3300044683 Bacteria 2094
840 Ga0466966_0001226 3300044684 Bacteria 16469
841 Ga0466966_0028270 3300044684 Bacteria 3653
842 Ga0466961_0000503 3300044693 Bacteria 24926
843 Ga0466961_0014145 3300044693 Bacteria 5119
844 Ga0466961_0016554 3300044693 Bacteria 4738
845 Ga0466963_0002548 3300044694 Bacteria 10211
846 Ga0466964_0029387 3300044706 Bacteria 2169
847 Ga0466964_0041685 3300044706 Bacteria 1858
848 Ga0466964_0057478 3300044706 Bacteria 1610
849 Ga0466964_0059348 3300044706 Bacteria 1588
850 Ga0466971_0011456 3300044719 Bacteria 3885
851 Ga0466968_0005213 3300044735 Bacteria 4866
852 Ga0466970_0001313 3300044765 Bacteria 12046
853 Ga0466957_0090030 3300044842 Bacteria 1921
854 Ga0466957_0129282 3300044842 Bacteria 1616
855 Ga0466960_0021987 3300044901 Bacteria 2846
856 Ga0466959_0000398 3300045049 Bacteria 25522
857 Ga0466959_0045172 3300045049 Bacteria 3244
858 Ga0466959_0089477 3300045049 Bacteria 2212
859 Ga0466959_0102897 3300045049 Bacteria 2043
860 Ga0451576_0013137 3300045051 Bacteria 9270
861 Ga0451576_0089406 3300045051 Bacteria 3203
862 Ga0451576_0463127 3300045051 Bacteria 1331
863 Ga0466958_0002017 3300045836 Bacteria 10011
864 Ga0466967_0003144 3300045976 Bacteria 10633
865 Ga0466967_0029802 3300045976 Bacteria 4572
866 Ga0466967_0214556 3300045976 Bacteria 1826
867 Ga0495627_033911 3300046453 Bacteria 1598
868 Ga0495592_0000205 3300046454 Bacteria 50544
869 Ga0495592_0011229 3300046454 Bacteria 6770
870 Ga0495592_0013147 3300046454 Bacteria 6299
871 Ga0495592_0053757 3300046454 Bacteria 2986
872 Ga0495603_0000818 3300046455 Bacteria 17861
873 Ga0495590_0007877 3300046457 Bacteria 4088
874 Ga0495629_0001431 3300046459 Bacteria 18823
875 Ga0495629_0006770 3300046459 Bacteria 8470
876 Ga0495629_0013918 3300046459 Bacteria 5799
877 Ga0495629_0015490 3300046459 Bacteria 5474
878 Ga0495629_0022831 3300046459 Bacteria 4458
879 Ga0495629_0111637 3300046459 Bacteria 1906
880 Ga0495638_0002582 3300046460 Bacteria 14642
881 Ga0495638_0003476 3300046460 Bacteria 12375
882 Ga0495638_0019761 3300046460 Bacteria 4453
883 Ga0495641_0007310 3300046461 Bacteria 6917
884 Ga0495641_0007710 3300046461 Bacteria 6677
885 Ga0495651_0016327 3300046462 Bacteria 5749
886 Ga0495651_0032580 3300046462 Bacteria 4064
887 Ga0495651_0044409 3300046462 Bacteria 3444
888 Ga0495653_0001246 3300046463 Bacteria 19690
889 Ga0495653_0001607 3300046463 Bacteria 17763
890 Ga0495653_0063267 3300046463 Bacteria 2793
891 Ga0495653_0234911 3300046463 Bacteria 1225
892 Ga0495650_0005654 3300046471 Bacteria 8031
893 Ga0495650_0066156 3300046471 Bacteria 1431
894 Ga0495580_0000010 3300046472 Bacteria 99935
895 Ga0495580_0000419 3300046472 Bacteria 35257
896 Ga0495580_0016170 3300046472 Bacteria 5607
897 Ga0495582_0000897 3300046473 Bacteria 16550
898 Ga0495582_0001574 3300046473 Bacteria 12874
899 Ga0495582_0034022 3300046473 Bacteria 2802
900 Ga0495605_0011410 3300046474 Bacteria 4953
901 Ga0495605_0011724 3300046474 Bacteria 4880
902 Ga0495605_0059097 3300046474 Bacteria 1842
903 Ga0495639_0000021 3300046475 Bacteria 73256
904 Ga0495662_0001876 3300046476 Bacteria 10528
905 Ga0495664_0000581 3300046477 Bacteria 18414
906 Ga0495664_0012190 3300046477 Bacteria 4866
907 Ga0495585_0014960 3300046492 Bacteria 4512
908 Ga0495585_0053087 3300046492 Bacteria 2243
909 Ga0495585_0056755 3300046492 Bacteria 2162
910 Ga0495594_0000199 3300046499 Bacteria 29410
911 Ga0495594_0108073 3300046499 Bacteria 1567
912 Ga0495607_0008139 3300046501 Bacteria 7191
913 Ga0495607_0150057 3300046501 Bacteria 1194
914 Ga0495583_0028721 3300046506 Bacteria 2731
915 Ga0495606_0011074 3300046507 Bacteria 7394
916 Ga0495606_0058867 3300046507 Bacteria 2467
917 Ga0495606_0105318 3300046507 Bacteria 1710
918 Ga0495608_0005805 3300046511 Bacteria 8795
919 Ga0495608_0076051 3300046511 Bacteria 2188
920 Ga0495610_0026452 3300046512 Bacteria 3097
921 Ga0495610_0055986 3300046512 Bacteria 1898
922 Ga0495618_0002544 3300046514 Bacteria 11677
923 Ga0495618_0009590 3300046514 Bacteria 5846
924 Ga0495618_0009795 3300046514 Bacteria 5793
925 Ga0495618_0064509 3300046514 Bacteria 2327
926 Ga0495618_0108804 3300046514 Bacteria 1775
927 Ga0495628_0006259 3300046516 Bacteria 10402
928 Ga0495628_0010408 3300046516 Bacteria 7900
929 Ga0495628_0040141 3300046516 Bacteria 3740
930 Ga0495628_0165123 3300046516 Bacteria 1681
931 Ga0495630_0006163 3300046517 Bacteria 8505
932 Ga0495630_0027758 3300046517 Bacteria 4203
933 Ga0495630_0059379 3300046517 Bacteria 2869
934 Ga0495631_0020145 3300046518 Bacteria 3120
935 Ga0495632_0015766 3300046519 Bacteria 4224
936 Ga0495632_0016557 3300046519 Bacteria 4097
937 Ga0495632_0112571 3300046519 Bacteria 1277
938 Ga0495643_0008482 3300046522 Bacteria 6501
939 Ga0495643_0025154 3300046522 Bacteria 3371
940 Ga0495643_0048728 3300046522 Bacteria 2288
941 Ga0495644_0031250 3300046523 Bacteria 2012
942 Ga0495648_0000234 3300046524 Bacteria 63485
943 Ga0495648_0012986 3300046524 Bacteria 6183
944 Ga0495648_0033989 3300046524 Bacteria 3325
945 Ga0495666_0001171 3300046526 Bacteria 12598
946 Ga0495666_0007712 3300046526 Bacteria 5385
947 Ga0495642_0005522 3300046528 Bacteria 4858
948 Ga0495652_0003670 3300046529 Bacteria 15031
949 Ga0495652_0014405 3300046529 Bacteria 7099
950 Ga0495652_0076299 3300046529 Bacteria 2781
951 Ga0495652_0202693 3300046529 Bacteria 1504
952 Ga0495654_0078699 3300046530 Bacteria 1550
953 Ga0495665_0006815 3300046531 Bacteria 6164
954 Ga0495665_0007347 3300046531 Bacteria 5954
955 Ga0495640_0001933 3300046533 Bacteria 16508
956 Ga0495640_0008697 3300046533 Bacteria 7957
957 Ga0495640_0009862 3300046533 Bacteria 7410
958 Ga0495640_0032849 3300046533 Bacteria 3693
959 Ga0495586_0012030 3300046535 Bacteria 4596
960 Ga0495587_0000646 3300046536 Bacteria 23379
961 Ga0495587_0004784 3300046536 Bacteria 8891
962 Ga0495587_0055034 3300046536 Bacteria 2344
963 Ga0495598_0001977 3300046537 Bacteria 4164
964 Ga0495609_0032932 3300046538 Bacteria 2353
965 Ga0495621_0002523 3300046539 Bacteria 4937
966 Ga0495597_0012282 3300046542 Bacteria 4133
967 Ga0495597_0063646 3300046542 Bacteria 1603
968 Ga0495645_0003644 3300046543 Bacteria 10461
969 Ga0495622_0001054 3300046557 Bacteria 14632
970 Ga0495622_0014896 3300046557 Bacteria 3615
971 Ga0495622_0050643 3300046557 Bacteria 1926
972 Ga0495622_0054300 3300046557 Bacteria 1859
973 Ga0495667_0002231 3300046559 Bacteria 12957
974 Ga0495667_0013207 3300046559 Bacteria 5592
975 Ga0495656_0000673 3300046615 Bacteria 10969
976 Ga0495668_0020377 3300046616 Bacteria 3814
977 Ga0495668_0034584 3300046616 Bacteria 2834
978 Ga0495668_0038699 3300046616 Bacteria 2664
979 Ga0495668_0105245 3300046616 Bacteria 1543
980 Ga0495634_0000537 3300046642 Bacteria 37265
981 Ga0495634_0001399 3300046642 Bacteria 21698
982 Ga0495634_0041861 3300046642 Bacteria 3110
983 Ga0495611_0005106 3300046648 Bacteria 5626
984 Ga0495611_0064112 3300046648 Bacteria 1673
985 Ga0495625_0011106 3300046660 Bacteria 7375
986 Ga0495625_0015503 3300046660 Bacteria 6035
987 Ga0495625_0019451 3300046660 Bacteria 5266
988 Ga0495625_0076817 3300046660 Bacteria 2334
989 Ga0495625_0215206 3300046660 Bacteria 1261
990 Ga0495635_0000544 3300046663 Bacteria 24018
991 Ga0495635_0001202 3300046663 Bacteria 17269
992 Ga0495635_0001417 3300046663 Bacteria 16004
993 Ga0495635_0014768 3300046663 Bacteria 5463
994 Ga0495659_0015934 3300046664 Bacteria 2475
995 Ga0495661_0003286 3300046665 Bacteria 12002
996 Ga0495661_0034985 3300046665 Bacteria 3157
997 Ga0495588_0005106 3300046674 Bacteria 5833
998 Ga0495588_0008073 3300046674 Bacteria 4813
999 Ga0495588_0019754 3300046674 Bacteria 3305
1000 Ga0495588_0078955 3300046674 Bacteria 1717
1001 Ga0495588_0145188 3300046674 Bacteria 1254
1002 Ga0495657_0004009 3300046675 Bacteria 11811
1003 Ga0495657_0025951 3300046675 Bacteria 4156
1004 Ga0495599_0002969 3300046678 Bacteria 9874
1005 Ga0495599_0013395 3300046678 Bacteria 5067
1006 Ga0495623_0013456 3300046679 Bacteria 5305
1007 Ga0495623_0146185 3300046679 Bacteria 1402
1008 Ga0495646_0009311 3300046680 Bacteria 6232
1009 Ga0495646_0025629 3300046680 Bacteria 3708
1010 Ga0495646_0028479 3300046680 Bacteria 3497
1011 Ga0495647_0003504 3300046681 Bacteria 5024
1012 Ga0495658_0002413 3300046683 Bacteria 9421
1013 Ga0495658_0038641 3300046683 Bacteria 2644
1014 Ga0495669_0004064 3300046684 Bacteria 6017
1015 Ga0495669_0011949 3300046684 Bacteria 3692
1016 Ga0495669_0021300 3300046684 Bacteria 2812
1017 Ga0495669_0111127 3300046684 Bacteria 1279
1018 Ga0495613_0026305 3300046689 Bacteria 4335
1019 Ga0495624_0001588 3300046690 Bacteria 17466
1020 Ga0495624_0025173 3300046690 Bacteria 3910
1021 Ga0495624_0103577 3300046690 Bacteria 1751
1022 Ga0495624_0112737 3300046690 Bacteria 1672
1023 Ga0495670_0053887 3300046691 Bacteria 2014
1024 Ga0495671_0027092 3300046692 Bacteria 2962
1025 Ga0495671_0090308 3300046692 Bacteria 1499
1026 Ga0495649_0005062 3300046694 Bacteria 8468
1027 Ga0495649_0012079 3300046694 Bacteria 5039
1028 Ga0495649_0099447 3300046694 Bacteria 1547
1029 Ga0495589_0002668 3300046794 Bacteria 9867
1030 Ga0495589_0080122 3300046794 Bacteria 1589
1031 Ga0495589_0112459 3300046794 Bacteria 1314
1032 Ga0495600_0025979 3300046809 Bacteria 3777
1033 Ga0495660_0022956 3300046810 Bacteria 3560
1034 Ga0495660_0054596 3300046810 Bacteria 2164
1035 Ga0495581_0000167 3300047315 Bacteria 29560
1036 Ga0495581_0000206 3300047315 Bacteria 27642
1037 Ga0495604_0001283 3300047317 Bacteria 20556
1038 Ga0495604_0002111 3300047317 Bacteria 16002
1039 Ga0495604_0003226 3300047317 Bacteria 13040
1040 Ga0495604_0044826 3300047317 Bacteria 3453
1041 Ga0495636_0004964 3300047318 Bacteria 5217
1042 Ga0495674_0000145 3300047319 Bacteria 54755
1043 Ga0495674_0006528 3300047319 Bacteria 11195
1044 Ga0495674_0017157 3300047319 Bacteria 6744
1045 Ga0495674_0044533 3300047319 Bacteria 3945
1046 Ga0495674_0045000 3300047319 Bacteria 3921
1047 Ga0495674_0065545 3300047319 Bacteria 3154
1048 Ga0495674_0311552 3300047319 Bacteria 1284
1049 Ga0495672_0002635 3300047320 Bacteria 16196
1050 Ga0495676_0178316 3300047321 Bacteria 1491
1051 Ga0495680_0001105 3300047322 Bacteria 29792
1052 Ga0495680_0001309 3300047322 Bacteria 27134
1053 Ga0495680_0005784 3300047322 Bacteria 11569
1054 Ga0495683_0019699 3300047323 Bacteria 3482
1055 Ga0495683_0090379 3300047323 Bacteria 1484
1056 Ga0495687_000161 3300047443 Bacteria 100635
1057 Ga0495687_007111 3300047443 Bacteria 6673
1058 Ga0495687_007129 3300047443 Bacteria 6664
1059 Ga0495687_028489 3300047443 Bacteria 2598
1060 Ga0495687_039208 3300047443 Bacteria 2098
1061 Ga0495675_0004021 3300047444 Bacteria 8914
1062 Ga0495679_000217 3300047446 Bacteria 49035
1063 Ga0495679_017654 3300047446 Bacteria 2550
1064 Ga0495685_057713 3300047447 Bacteria 1311
1065 Ga0495681_0083405 3300047470 Bacteria 1423
1066 Ga0495684_0032318 3300047471 Bacteria 4017
1067 Ga0495684_0058496 3300047471 Bacteria 2936
1068 Ga0495686_0008703 3300047472 Bacteria 7410
1069 Ga0495686_0042376 3300047472 Bacteria 2895
1070 Ga0495686_0066067 3300047472 Bacteria 2236
1071 Ga0495593_0000013 3300047673 Bacteria 82874
1072 Ga0495593_0003915 3300047673 Bacteria 8895
1073 Ga0495593_0007071 3300047673 Bacteria 6582
1074 Ga0495593_0013439 3300047673 Bacteria 4670
1075 Ga0495593_0019616 3300047673 Bacteria 3790
1076 Ga0495593_0035124 3300047673 Bacteria 2723
1077 Ga0495602_0016074 3300048088 Bacteria 7530
1078 Ga0495602_0017266 3300048088 Bacteria 7236
1079 Ga0495602_0022452 3300048088 Bacteria 6175
1080 Ga0495602_0070141 3300048088 Bacteria 3001
1081 Ga0495614_0007950 3300048089 Bacteria 4713
1082 Ga0495614_0067377 3300048089 Bacteria 1540
1083 Ga0495626_0027926 3300048091 Bacteria 2740
1084 Ga0495626_0118423 3300048091 Bacteria 1141
1085 Ga0496100_0007356 3300048903 Bacteria 6069
1086 Ga0496100_0147197 3300048903 Bacteria 1676
1087 Ga0496100_0256537 3300048903 Bacteria 1295
1088 Ga0496101_0039289 3300048904 Bacteria 3365
1089 Ga0496101_0046322 3300048904 Bacteria 3118
1090 Ga0496101_0244360 3300048904 Bacteria 1397
1091 Ga0496101_0339673 3300048904 Bacteria 1179
1092 Ga0496102_0002871 3300048905 Bacteria 14633
1093 Ga0496102_0031230 3300048905 Bacteria 4776
1094 Ga0496102_0118725 3300048905 Bacteria 2469
1095 Ga0496102_0136424 3300048905 Bacteria 2299
1096 Ga0496102_0215676 3300048905 Bacteria 1809
1097 Ga0496102_0358283 3300048905 Bacteria 1373
1098 Ga0496103_0013406 3300048906 Bacteria 4859
1099 Ga0496103_0017937 3300048906 Bacteria 4242
1100 Ga0496103_0019056 3300048906 Bacteria 4120
1101 Ga0496103_0019311 3300048906 Bacteria 4093
1102 Ga0496104_0016282 3300048907 Bacteria 6750
1103 Ga0496104_0026918 3300048907 Bacteria 5316
1104 Ga0496104_0040743 3300048907 Bacteria 4354
1105 Ga0496104_0044319 3300048907 Bacteria 4180
1106 Ga0496104_0080792 3300048907 Bacteria 3100
1107 Ga0496104_0120356 3300048907 Bacteria 2520
1108 Ga0496104_0188476 3300048907 Bacteria 1974
1109 Ga0496104_0229779 3300048907 Bacteria 1767
1110 Ga0496105_0003511 3300048908 Bacteria 11615
1111 Ga0496105_0115655 3300048908 Bacteria 2212
1112 Ga0496105_0168995 3300048908 Bacteria 1793
1113 Ga0496106_0017437 3300048909 Bacteria 5313
1114 Ga0496106_0028680 3300048909 Bacteria 4146
1115 Ga0496106_0034749 3300048909 Bacteria 3767
1116 Ga0496106_0053808 3300048909 Bacteria 3041
1117 Ga0496106_0054840 3300048909 Bacteria 3012
1118 Ga0496106_0087877 3300048909 Bacteria 2395
1119 Ga0496107_0164054 3300048910 Bacteria 1647
1120 Ga0496108_0102405 3300048911 Bacteria 2443
1121 Ga0496108_0197389 3300048911 Bacteria 1746
1122 Ga0496109_0013281 3300048912 Bacteria 7134
1123 Ga0496109_0138740 3300048912 Bacteria 2273
1124 Ga0496109_0183572 3300048912 Bacteria 1965
1125 Ga0496110_0017067 3300048913 Bacteria 6068
1126 Ga0496110_0031842 3300048913 Bacteria 4552
1127 Ga0496110_0082619 3300048913 Bacteria 2865
1128 Ga0496110_0082687 3300048913 Bacteria 2864
1129 Ga0496110_0109796 3300048913 Bacteria 2477
1130 Ga0496110_0197274 3300048913 Bacteria 1828
1131 Ga0496110_0383383 3300048913 Bacteria 1281
1132 Ga0496111_0010126 3300048914 Bacteria 6311
1133 Ga0496111_0064659 3300048914 Bacteria 2654
1134 Ga0496111_0087657 3300048914 Bacteria 2278
1135 Ga0496111_0250169 3300048914 Bacteria 1316
1136 Ga0496112_0000014 3300048915 Bacteria 210932
1137 Ga0496112_0007451 3300048915 Bacteria 9715
1138 Ga0496112_0026585 3300048915 Bacteria 5573
1139 Ga0496112_0027410 3300048915 Bacteria 5492
1140 Ga0496112_0034872 3300048915 Bacteria 4897
1141 Ga0496112_0047474 3300048915 Bacteria 4212
1142 Ga0496112_0074531 3300048915 Bacteria 3355
1143 Ga0496112_0116204 3300048915 Bacteria 2646
1144 Ga0496112_0272275 3300048915 Bacteria 1641
1145 Ga0496113_0060287 3300048916 Bacteria 2860
1146 Ga0496113_0069599 3300048916 Bacteria 2673
1147 Ga0496113_0071728 3300048916 Bacteria 2635
1148 Ga0496113_0134418 3300048916 Bacteria 1942
1149 Ga0496113_0170397 3300048916 Bacteria 1724
1150 Ga0496114_0021665 3300048917 Bacteria 5229
1151 Ga0496114_0064538 3300048917 Bacteria 3067
1152 Ga0496114_0160571 3300048917 Bacteria 1954
1153 Ga0496115_0024502 3300048918 Bacteria 4691
1154 Ga0496115_0044864 3300048918 Bacteria 3528
1155 Ga0496115_0080729 3300048918 Bacteria 2648
1156 Ga0496116_0077684 3300048919 Bacteria 2073
1157 Ga0496117_0043929 3300048920 Bacteria 3242
1158 Ga0496117_0127006 3300048920 Bacteria 1554
1159 Ga0496118_0013700 3300048921 Bacteria 7650
1160 Ga0496118_0014127 3300048921 Bacteria 7490
1161 Ga0496118_0067240 3300048921 Bacteria 2611
1162 Ga0496118_0130526 3300048921 Bacteria 1615
1163 Ga0496119_0000993 3300048922 Bacteria 36386
1164 Ga0496119_0008920 3300048922 Bacteria 8715
1165 Ga0496119_0033397 3300048922 Bacteria 3411
1166 Ga0496121_0024554 3300048924 Bacteria 5759
1167 Ga0496122_0012125 3300048925 Bacteria 8630
1168 Ga0496122_0164388 3300048925 Bacteria 1348
1169 Ga0496123_0002663 3300048926 Bacteria 21562
1170 Ga0496124_0030911 3300048927 Bacteria 4744
1171 Ga0496124_0263794 3300048927 Bacteria 1266
1172 Ga0496125_0028676 3300048928 Bacteria 5021
1173 Ga0496125_0185643 3300048928 Bacteria 1379
1174 Ga0496126_0000196 3300048929 Bacteria 134394
1175 Ga0496126_0000679 3300048929 Bacteria 62626
1176 Ga0496126_0009508 3300048929 Bacteria 10315
1177 Ga0496126_0012615 3300048929 Bacteria 8648
1178 Ga0496126_0048707 3300048929 Bacteria 3871
1179 Ga0496126_0200201 3300048929 Bacteria 1687
1180 Ga0501034_0054939 3300049571 Bacteria 4008
1181 Ga0501036_0279960 3300049572 Bacteria 1396
1182 Ga0501038_0080223 3300049574 Bacteria 2751
1183 Ga0501040_0032832 3300049576 Bacteria 3513
1184 Ga0501041_0045944 3300049577 Bacteria 2656
1185 Ga0501042_0196987 3300049578 Bacteria 1453
1186 Ga0501072_0099070 3300049588 Bacteria 2317
1187 Ga0501073_0009620 3300049589 Bacteria 7129
1188 Ga0501073_0140321 3300049589 Bacteria 1675
1189 Ga0501073_0176854 3300049589 Bacteria 1477
1190 Ga0501074_0026529 3300049590 Bacteria 4200
1191 Ga0501075_0016056 3300049591 Bacteria 5387
1192 Ga0501076_0013787 3300049592 Bacteria 6066
1193 Ga0501077_0031715 3300049593 Bacteria 3362
1194 Ga0501079_0093314 3300049741 Bacteria 2332
1195 Ga0501081_0004781 3300049743 Bacteria 8718
1196 Ga0501035_0120349 3300049822 Bacteria 2296
1197 Ga0501045_0010293 3300049824 Bacteria 6552
1198 nmdc:mga03683_27707_c1 3300050489 Bacteria 2247
1199 nmdc:mga03n38_81831_c1 3300050490 Bacteria 1519
1200 nmdc:mga00v17_52854_c1 3300050491 Bacteria 2474
1201 nmdc:mga00v17_86883_c1 3300050491 Bacteria 1960
1202 nmdc:mga0yw44_227812_c1 3300050492 Bacteria 1237
1203 nmdc:mga0k408_12101_c1 3300050493 Bacteria 4712
1204 nmdc:mga0k408_127338_c1 3300050493 Bacteria 1511
1205 nmdc:mga0k408_174176_c1 3300050493 Bacteria 1283
1206 nmdc:mga0k408_176748_c1 3300050493 Bacteria 1273
1207 nmdc:mga0k408_20184_c1 3300050493 Bacteria 3730
1208 nmdc:mga0k408_51178_c1 3300050493 Bacteria 2392
1209 nmdc:mga0k408_9111_c1 3300050493 Bacteria 5345
1210 nmdc:mga06z11_10232_c1 3300050494 Bacteria 3984
1211 nmdc:mga06z11_180329_c1 3300050494 Bacteria 1217
1212 nmdc:mga06z11_187037_c1 3300050494 Bacteria 1197
1213 nmdc:mga06z11_31136_c1 3300050494 Bacteria 2589
1214 nmdc:mga04h51_19713_c1 3300050495 Bacteria 2003
1215 nmdc:mga04h51_29754_c1 3300050495 Bacteria 1714
1216 nmdc:mga07m45_135609_c1 3300050496 Bacteria 1425
1217 nmdc:mga07m45_39087_c1 3300050496 Bacteria 2650
1218 nmdc:mga07m45_6449_c1 3300050496 Bacteria 5675
1219 nmdc:mga07m45_96423_c1 3300050496 Bacteria 1697
1220 nmdc:mga05p37_134523_c1 3300050507 Bacteria 3033
1221 nmdc:mga05p37_138555_c1 3300050507 Bacteria 2982
1222 nmdc:mga06r32_76795_c1 3300050510 Bacteria 3244
1223 nmdc:mga08y16_14550_c1 3300050511 Bacteria 8274
1224 nmdc:mga08y16_57693_c1 3300050511 Bacteria 4056
1225 nmdc:mga0n895_230649_c1 3300050512 Bacteria 1879
1226 nmdc:mga0rr50_301327_c1 3300050513 Bacteria 1341
1227 nmdc:mga0rr50_362930_c1 3300050513 Bacteria 1219
1228 nmdc:mga08x19_153720_c1 3300050514 Bacteria 1559
1229 nmdc:mga0a205_39655_c1 3300050515 Bacteria 4532
1230 nmdc:mga0sz30_78734_c1 3300050516 Bacteria 1425
1231 Ga0495601_0015307 3300053077 Bacteria 4635
1232 Ga0495601_0019287 3300053077 Bacteria 4158
1233 Ga0495601_0235688 3300053077 Bacteria 1195
1234 Ga0495612_0002548 3300053078 Bacteria 7516
1235 Ga0495612_0124159 3300053078 Bacteria 1112
1236 Ga0500635_0008596 3300053080 Bacteria 2804
1237 Ga0495655_0041228 3300053083 Bacteria 1179
1238 Ga0495595_0000442 3300053084 Bacteria 15717
1239 Ga0495619_0006616 3300053085 Bacteria 7333
1240 Ga0495619_0008105 3300053085 Bacteria 6650
1241 Ga0500578_0072449 3300053086 Bacteria 2195
1242 Ga0500578_0106240 3300053086 Bacteria 1773
1243 Ga0500643_015020 3300053087 Bacteria 2669
1244 Ga0500644_0048799 3300053088 Bacteria 1442
1245 Ga0500583_0014268 3300053092 Bacteria 3104
1246 Ga0500583_0048694 3300053092 Bacteria 1957
1247 Ga0500583_0141805 3300053092 Bacteria 1194
1248 Ga0500651_0215545 3300053093 Bacteria 1127
1249 Ga0500641_0019800 3300053096 Bacteria 2547
1250 Ga0500554_000799 3300053102 Bacteria 6232
1251 Ga0500556_0000148 3300053104 Bacteria 58772
1252 Ga0500562_005782 3300053108 Bacteria 3113
1253 Ga0500595_000302 3300053119 Bacteria 32439
1254 Ga0500595_001031 3300053119 Bacteria 15533
1255 Ga0500595_033517 3300053119 Bacteria 1704
1256 Ga0500642_0006746 3300053130 Bacteria 3808
1257 Ga0500642_0020613 3300053130 Bacteria 2594
1258 Ga0500658_0000642 3300053134 Bacteria 14510
1259 Ga0500658_0003506 3300053134 Bacteria 5922
1260 Ga0500658_0039319 3300053134 Bacteria 1890
1261 Ga0500658_0040891 3300053134 Bacteria 1858
1262 Ga0500559_0000339 3300053136 Bacteria 35031
1263 Ga0500559_0007867 3300053136 Bacteria 4706
1264 Ga0500559_0083909 3300053136 Bacteria 1452
1265 Ga0500568_0000019 3300053139 Bacteria 195696
1266 Ga0500573_0050258 3300053140 Bacteria 2398
1267 Ga0500577_0012546 3300053142 Bacteria 2565
1268 Ga0500577_0021519 3300053142 Bacteria 2126
1269 Ga0500590_048803 3300053148 Bacteria 2157
1270 Ga0500603_000821 3300053150 Bacteria 7419
1271 Ga0500616_0000715 3300053153 Bacteria 38448
1272 Ga0500616_0014978 3300053153 Bacteria 4444
1273 Ga0500616_0029175 3300053153 Bacteria 3038
1274 Ga0500616_0093594 3300053153 Bacteria 1483
1275 Ga0500622_0001202 3300053156 Bacteria 21303
1276 Ga0500622_0003724 3300053156 Bacteria 9990
1277 Ga0500622_0004961 3300053156 Bacteria 8110
1278 Ga0500627_0033050 3300053158 Bacteria 2184
1279 Ga0500639_073864 3300053163 Bacteria 1731
1280 Ga0500636_0006447 3300053177 Bacteria 6737
1281 Ga0500636_0015436 3300053177 Bacteria 4500
1282 Ga0500636_0110373 3300053177 Bacteria 1555
1283 Ga0500636_0140310 3300053177 Bacteria 1338
1284 Ga0500637_0002825 3300053178 Bacteria 7819
1285 Ga0500637_0149103 3300053178 Bacteria 1352
1286 Ga0500645_016719 3300053730 Bacteria 2307
1287 Ga0500609_006213 3300053731 Bacteria 1628
1288 Ga0500599_000221 3300053736 Bacteria 5324
1289 Ga0500601_000130 3300053737 Bacteria 15343
1290 Ga0501084_0001165 3300054114 Bacteria 20508
1291 Ga0500661_004632 3300055283 Bacteria 2569
1292 Ga0500661_010201 3300055283 Bacteria 1711
1293 Ga0501082_0027865 3300060353 Bacteria 4865
1294 Ga0530510_0039974 3300061734 Bacteria 3385

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003790 Ga0055528_1025221 Ga0055528_10252212 275
2 3300003354 JGI25160J50197_1004178 JGI25160J50197_10041782 285
3 3300003792 Ga0055540_1000192 Ga0055540_100019217 285
4 3300004625 Ga0055543_1000329 Ga0055543_10003291 285
5 3300005262 Ga0065165_1016048 Ga0065165_10160482 285
6 3300025298 Ga0209050_1008894 Ga0209050_10088944 286
7 3300025302 Ga0207426_1000039 Ga0207426_1000039361 286
8 3300025303 Ga0209051_1000253 Ga0209051_100025345 286
9 3300025304 Ga0209257_1008074 Ga0209257_10080743 286
10 3300050490 nmdc:mga03n38_81831_c1 nmdc:mga03n38_81831_c1_61_1089 286
11 3300050493 nmdc:mga0k408_174176_c1 nmdc:mga0k408_174176_c1_215_1243 286
12 3300046660 Ga0495625_0215206 Ga0495625_0215206_132_1160 288
13 3300003215 JGI25153J46596_10020132 JGI25153J46596_100201322 292
14 3300003792 Ga0055540_1018930 Ga0055540_10189301 292
15 3300046474 Ga0495605_0011724 Ga0495605_0011724_3298_4305 292
16 3300053134 Ga0500658_0000642 Ga0500658_0000642_124_1131 292
17 3300025273 Ga0209673_1005041 Ga0209673_10050416 293
18 3300025297 Ga0209758_1018742 Ga0209758_10187422 293
19 3300025303 Ga0209051_1010924 Ga0209051_10109244 293
20 3300046518 Ga0495631_0020145 Ga0495631_0020145_1413_2420 293
21 3300046522 Ga0495643_0008482 Ga0495643_0008482_3928_4935 293
22 3300046616 Ga0495668_0020377 Ga0495668_0020377_749_1756 293
23 3300046660 Ga0495625_0019451 Ga0495625_0019451_264_1271 293
24 3300046810 Ga0495660_0022956 Ga0495660_0022956_748_1755 293
25 3300050494 nmdc:mga06z11_187037_c1 nmdc:mga06z11_187037_c1_11_1018 293
26 iso_pu_bacteria 2929615660 2929619181 294
27 iso_pu_bacteria 2929624759 2929628324 294
28 3300021320 Ga0214544_1000018 Ga0214544_100001842 295
29 3300021321 Ga0214542_1000081 Ga0214542_10000819 295
30 3300021327 Ga0214543_1000042 Ga0214543_100004252 295
31 3300002773 JGI25152J39213_1004235 JGI25152J39213_10042353 297
32 3300003771 Ga0055526_1014297 Ga0055526_10142974 297
33 3300005367 Ga0070667_100041228 Ga0070667_1000412282 297
34 3300009177 Ga0105248_10235978 Ga0105248_102359782 297
35 iso_pu_bacteria 8016511872 8016516868 297
36 3300037471 Ga0395905_0026353 Ga0395905_0026353_1783_2787 299
37 3300006048 Ga0075363_100042014 Ga0075363_1000420142 301
38 3300025258 Ga0209129_1001986 Ga0209129_100198610 301
39 3300025302 Ga0207426_1042886 Ga0207426_10428862 301
40 3300025941 Ga0207711_10430765 Ga0207711_104307652 301
41 3300026067 Ga0207678_10141187 Ga0207678_101411872 301
42 3300048907 Ga0496104_0229779 Ga0496104_0229779_722_1744 301
43 3300048908 Ga0496105_0168995 Ga0496105_0168995_644_1651 301
44 3300048916 Ga0496113_0071728 Ga0496113_0071728_616_1623 301
45 3300048919 Ga0496116_0077684 Ga0496116_0077684_64_1071 301
46 3300048929 Ga0496126_0048707 Ga0496126_0048707_2061_3077 301
47 3300046453 Ga0495627_033911 Ga0495627_033911_196_1203 302
48 3300046616 Ga0495668_0038699 Ga0495668_0038699_1322_2329 302
49 3300046674 Ga0495588_0019754 Ga0495588_0019754_1899_2906 302
50 3300046794 Ga0495589_0080122 Ga0495589_0080122_301_1308 302
51 3300005937 Ga0081455_10160148 Ga0081455_101601482 304
52 3300006846 Ga0075430_100018985 Ga0075430_1000189854 305
53 3300048913 Ga0496110_0383383 Ga0496110_0383383_156_1172 305
54 3300050511 nmdc:mga08y16_57693_c1 nmdc:mga08y16_57693_c1_2423_3454 305
55 3300046516 Ga0495628_0040141 Ga0495628_0040141_13_933 306
56 3300025914 Ga0207671_10222759 Ga0207671_102227591 307
57 3300049589 Ga0501073_0176854 Ga0501073_0176854_348_1373 307
58 3300005347 Ga0070668_100033402 Ga0070668_1000334025 308
59 3300005366 Ga0070659_100137413 Ga0070659_1001374132 308
60 3300005564 Ga0070664_100096918 Ga0070664_1000969183 308
61 3300005564 Ga0070664_100149480 Ga0070664_1001494802 308
62 3300005578 Ga0068854_100142607 Ga0068854_1001426072 308
63 3300005843 Ga0068860_100099735 Ga0068860_1000997352 308
64 3300006844 Ga0075428_100132849 Ga0075428_1001328494 308
65 3300010375 Ga0105239_10749121 Ga0105239_107491211 308
66 3300025945 Ga0207679_10145087 Ga0207679_101450872 308
67 3300025945 Ga0207679_10194492 Ga0207679_101944922 308
68 3300028380 Ga0268265_10388650 Ga0268265_103886502 308
69 3300028381 Ga0268264_10092502 Ga0268264_100925022 308
70 3300050510 nmdc:mga06r32_76795_c1 nmdc:mga06r32_76795_c1_1388_2419 308
71 3300049589 Ga0501073_0009620 Ga0501073_0009620_3871_4896 309
72 3300037471 Ga0395905_0000398 Ga0395905_0000398_14324_15343 310
73 3300037471 Ga0395905_0025545 Ga0395905_0025545_3012_4016 310
74 3300028794 Ga0307515_10223224 Ga0307515_102232241 311
75 3300042127 Ga0450890_005209 Ga0450890_005209_323_1342 311
76 3300042134 Ga0450898_027205 Ga0450898_027205_68_1018 311
77 3300048913 Ga0496110_0082687 Ga0496110_0082687_241_1236 311
78 3300048916 Ga0496113_0170397 Ga0496113_0170397_565_1560 311
79 3300053153 Ga0500616_0093594 Ga0500616_0093594_105_1127 311
80 3300005518 Ga0070699_100284062 Ga0070699_1002840621 312
81 3300005546 Ga0070696_100014780 Ga0070696_1000147802 312
82 3300005338 Ga0068868_100037825 Ga0068868_1000378255 313
83 3300005354 Ga0070675_100035549 Ga0070675_1000355493 313
84 3300005456 Ga0070678_100087849 Ga0070678_1000878492 313
85 3300005459 Ga0068867_100152615 Ga0068867_1001526152 313
86 3300005548 Ga0070665_100074569 Ga0070665_1000745692 313
87 3300005617 Ga0068859_100006931 Ga0068859_1000069315 313
88 3300005618 Ga0068864_100183081 Ga0068864_1001830812 313
89 3300005719 Ga0068861_100305611 Ga0068861_1003056112 313
90 3300005841 Ga0068863_100045110 Ga0068863_1000451105 313
91 3300005844 Ga0068862_100296576 Ga0068862_1002965762 313
92 3300006237 Ga0097621_100055296 Ga0097621_1000552962 313
93 3300006358 Ga0068871_100009046 Ga0068871_1000090463 313
94 3300006931 Ga0097620_100006931 Ga0097620_1000069315 313
95 3300009177 Ga0105248_10014000 Ga0105248_100140003 313
96 3300011119 Ga0105246_10176301 Ga0105246_101763012 313
97 3300013297 Ga0157378_10080645 Ga0157378_100806454 313
98 3300013306 Ga0163162_10053558 Ga0163162_100535585 313
99 3300014325 Ga0163163_10127210 Ga0163163_101272102 313
100 3300014968 Ga0157379_10026406 Ga0157379_100264065 313
101 3300025911 Ga0207654_10104159 Ga0207654_101041593 313
102 3300025941 Ga0207711_10017162 Ga0207711_100171626 313
103 3300025942 Ga0207689_10001210 Ga0207689_100012108 313
104 3300026023 Ga0207677_10024222 Ga0207677_100242225 313
105 3300026088 Ga0207641_10071518 Ga0207641_100715182 313
106 3300026095 Ga0207676_10064256 Ga0207676_100642563 313
107 3300026118 Ga0207675_100017216 Ga0207675_1000172166 313
108 3300026121 Ga0207683_10039922 Ga0207683_100399224 313
109 3300026121 Ga0207683_10062801 Ga0207683_100628012 313
110 3300028794 Ga0307515_10003518 Ga0307515_100035186 313
111 3300032002 Ga0307416_100143042 Ga0307416_1001430422 314
112 3300044901 Ga0466960_0021987 Ga0466960_0021987_298_1305 314
113 3300005347 Ga0070668_100189538 Ga0070668_1001895382 315
114 3300005548 Ga0070665_100153637 Ga0070665_1001536371 315
115 3300005549 Ga0070704_100268781 Ga0070704_1002687812 315
116 3300005843 Ga0068860_100120557 Ga0068860_1001205574 315
117 3300006871 Ga0075434_100559567 Ga0075434_1005595672 315
118 3300009147 Ga0114129_10704922 Ga0114129_107049222 315
119 3300025972 Ga0207668_10289405 Ga0207668_102894052 315
120 3300049589 Ga0501073_0140321 Ga0501073_0140321_525_1547 315
121 3300053153 Ga0500616_0000715 Ga0500616_0000715_1454_2482 316
122 3300021377 Ga0213874_10036705 Ga0213874_100367051 317
123 3300039450 Ga0436363_1349888 Ga0436363_1349888_102_1136 317
124 3300044693 Ga0466961_0016554 Ga0466961_0016554_179_1174 318
125 3300044694 Ga0466963_0002548 Ga0466963_0002548_5595_6590 318
126 3300044706 Ga0466964_0029387 Ga0466964_0029387_990_1985 318
127 3300044765 Ga0466970_0001313 Ga0466970_0001313_505_1500 318
128 3300044842 Ga0466957_0129282 Ga0466957_0129282_309_1304 318
129 3300045049 Ga0466959_0000398 Ga0466959_0000398_10160_11155 318
130 3300044656 Ga0466969_0017140 Ga0466969_0017140_1763_2779 319
131 3300044673 Ga0453683_0000791 Ga0453683_0000791_9948_10955 319
132 3300044693 Ga0466961_0000503 Ga0466961_0000503_10134_11150 319
133 3300045051 Ga0451576_0013137 Ga0451576_0013137_4848_5855 319
134 3300046471 Ga0495650_0005654 Ga0495650_0005654_5274_6302 319
135 3300021321 Ga0214542_1022360 Ga0214542_10223605 320
136 3300021327 Ga0214543_1000012 Ga0214543_1000012241 320
137 3300025942 Ga0207689_10030832 Ga0207689_100308325 320
138 3300028379 Ga0268266_10008606 Ga0268266_100086064 320
139 3300046530 Ga0495654_0078699 Ga0495654_0078699_184_1212 320
140 3300048921 Ga0496118_0130526 Ga0496118_0130526_423_1397 320
141 3300007788 Ga0099795_10004316 Ga0099795_100043163 321
142 3300044684 Ga0466966_0001226 Ga0466966_0001226_2960_3970 323
143 3300005445 Ga0070708_100002230 Ga0070708_1000022304 324
144 3300005981 Ga0081538_10001104 Ga0081538_100011045 324
145 3300009094 Ga0111539_10205975 Ga0111539_102059754 324
146 3300002774 JGI25150J39212_1008481 JGI25150J39212_10084812 325
147 3300003187 JGI25151J46595_10008594 JGI25151J46595_100085946 325
148 3300005841 Ga0068863_100097496 Ga0068863_1000974962 325
149 3300026078 Ga0207702_10089229 Ga0207702_100892292 325
150 iso_pu_bacteria 2517287029 2517407001 325
151 iso_pu_bacteria 2534681796 2535517542 325
152 iso_pu_bacteria 3005409236 3005416343 325
153 iso_pu_bacteria 8005258706 8005259099 325
154 iso_pu_bacteria 8005542996 8005546373 325
155 3300005339 Ga0070660_100066483 Ga0070660_1000664832 326
156 3300005344 Ga0070661_100004039 Ga0070661_10000403911 326
157 3300005355 Ga0070671_100143750 Ga0070671_1001437502 326
158 3300005356 Ga0070674_100001054 Ga0070674_1000010549 326
159 3300005366 Ga0070659_100057521 Ga0070659_1000575214 326
160 3300005366 Ga0070659_100189478 Ga0070659_1001894782 326
161 3300005367 Ga0070667_100050524 Ga0070667_1000505241 326
162 3300005435 Ga0070714_100038400 Ga0070714_1000384005 326
163 3300005445 Ga0070708_100214100 Ga0070708_1002141002 326
164 3300005458 Ga0070681_10010183 Ga0070681_100101835 326
165 3300005459 Ga0068867_100017231 Ga0068867_1000172315 326
166 3300005518 Ga0070699_100240175 Ga0070699_1002401752 326
167 3300005530 Ga0070679_100016549 Ga0070679_1000165491 326
168 3300005535 Ga0070684_100240214 Ga0070684_1002402142 326
169 3300005543 Ga0070672_100095595 Ga0070672_1000955952 326
170 3300005563 Ga0068855_100002242 Ga0068855_10000224223 326
171 3300005563 Ga0068855_100072098 Ga0068855_1000720985 326
172 3300005564 Ga0070664_100001933 Ga0070664_1000019339 326
173 3300005564 Ga0070664_100086832 Ga0070664_1000868324 326
174 3300005577 Ga0068857_100004409 Ga0068857_10000440912 326
175 3300005578 Ga0068854_100025857 Ga0068854_1000258575 326
176 3300005614 Ga0068856_100040825 Ga0068856_1000408255 326
177 3300005614 Ga0068856_100205199 Ga0068856_1002051991 326
178 3300005616 Ga0068852_100000511 Ga0068852_10000051121 326
179 3300005834 Ga0068851_10033935 Ga0068851_100339354 326
180 3300007076 Ga0075435_100062845 Ga0075435_1000628455 326
181 3300009093 Ga0105240_10000933 Ga0105240_1000093345 326
182 3300009551 Ga0105238_10010029 Ga0105238_100100295 326
183 3300013100 Ga0157373_10047441 Ga0157373_100474412 326
184 3300013104 Ga0157370_10005026 Ga0157370_100050265 326
185 3300013105 Ga0157369_10008569 Ga0157369_100085698 326
186 3300013297 Ga0157378_10004078 Ga0157378_100040788 326
187 3300013307 Ga0157372_10006560 Ga0157372_1000656012 326
188 3300025321 Ga0207656_10058279 Ga0207656_100582792 326
189 3300025899 Ga0207642_10077887 Ga0207642_100778872 326
190 3300025912 Ga0207707_10044886 Ga0207707_100448865 326
191 3300025913 Ga0207695_10030775 Ga0207695_100307755 326
192 3300025914 Ga0207671_10031044 Ga0207671_100310442 326
193 3300025914 Ga0207671_10263597 Ga0207671_102635972 326
194 3300025916 Ga0207663_10165866 Ga0207663_101658662 326
195 3300025919 Ga0207657_10011685 Ga0207657_100116854 326
196 3300025920 Ga0207649_10002873 Ga0207649_100028736 326
197 3300025924 Ga0207694_10002406 Ga0207694_100024069 326
198 3300025929 Ga0207664_10012282 Ga0207664_100122825 326
199 3300025932 Ga0207690_10195613 Ga0207690_101956132 326
200 3300025937 Ga0207669_10006725 Ga0207669_100067257 326
201 3300025938 Ga0207704_10045296 Ga0207704_100452962 326
202 3300025940 Ga0207691_10115632 Ga0207691_101156322 326
203 3300025944 Ga0207661_10035367 Ga0207661_100353673 326
204 3300025945 Ga0207679_10012204 Ga0207679_100122044 326
205 3300025949 Ga0207667_10017780 Ga0207667_100177804 326
206 3300025949 Ga0207667_10086269 Ga0207667_100862692 326
207 3300025981 Ga0207640_10022152 Ga0207640_100221524 326
208 3300025986 Ga0207658_10011725 Ga0207658_100117255 326
209 3300026041 Ga0207639_10048968 Ga0207639_100489682 326
210 3300026078 Ga0207702_10004171 Ga0207702_100041719 326
211 3300026089 Ga0207648_10004439 Ga0207648_100044398 326
212 3300026116 Ga0207674_10000118 Ga0207674_1000011850 326
213 3300026142 Ga0207698_10007421 Ga0207698_100074213 326
214 3300045051 Ga0451576_0463127 Ga0451576_0463127_37_1065 326
215 3300050513 nmdc:mga0rr50_301327_c1 nmdc:mga0rr50_301327_c1_170_1252 326
216 3300050515 nmdc:mga0a205_39655_c1 nmdc:mga0a205_39655_c1_2618_3700 326
217 3300053130 Ga0500642_0020613 Ga0500642_0020613_118_1143 326
218 iso_pu_bacteria 2508501122 2509109164 326
219 iso_pu_bacteria 2509276019 2509377660 326
220 iso_pu_bacteria 2509276033 2509446632 326
221 iso_pu_bacteria 2510461076 2510894938 326
222 iso_pu_bacteria 2513237084 2513573360 326
223 iso_pu_bacteria 2513237085 2513577508 326
224 iso_pu_bacteria 2513237093 2513629842 326
225 iso_pu_bacteria 2513237103 2513708476 326
226 iso_pu_bacteria 2513237144 2513911425 326
227 iso_pu_bacteria 2513237146 2513928863 326
228 iso_pu_bacteria 2513237159 2514002038 326
229 iso_pu_bacteria 2513237162 2514022062 326
230 iso_pu_bacteria 2515075009 2515112537 326
231 iso_pu_bacteria 2515154113 2515632879 326
232 iso_pu_bacteria 2515154114 2515640023 326
233 iso_pu_bacteria 2515154116 2515655782 326
234 iso_pu_bacteria 2515154134 2515740235 326
235 iso_pu_bacteria 2516653077 2517036263 326
236 iso_pu_bacteria 2516653085 2517076624 326
237 iso_pu_bacteria 2517093000 2517095400 326
238 iso_pu_bacteria 2519899620 2520378571 326
239 iso_pu_bacteria 2529292951 2530645731 326
240 iso_pu_bacteria 2558860100 2558860663 326
241 iso_pu_bacteria 2582581283 2585168154 326
242 iso_pu_bacteria 2582581299 2585230329 326
243 iso_pu_bacteria 2582581306 2585269635 326
244 iso_pu_bacteria 2582581315 2585328505 326
245 iso_pu_bacteria 2582581865 2585388701 326
246 iso_pu_bacteria 2582581866 2585392550 326
247 iso_pu_bacteria 2585427526 2585527017 326
248 iso_pu_bacteria 2585427528 2585537780 326
249 iso_pu_bacteria 2585427593 2585835730 326
250 iso_pu_bacteria 2599185170 2599414879 326
251 iso_pu_bacteria 2615840626 2616309596 326
252 iso_pu_bacteria 2617270742 2617384596 326
253 iso_pu_bacteria 2643221643 2644239921 326
254 iso_pu_bacteria 2657244999 2657685830 326
255 iso_pu_bacteria 2690316117 2692319593 326
256 iso_pu_bacteria 2718217882 2719181471 326
257 iso_pu_bacteria 2718218009 2719732135 326
258 iso_pu_bacteria 2718218363 2721147463 326
259 iso_pu_bacteria 2718218365 2721159010 326
260 iso_pu_bacteria 2718218366 2721164398 326
261 iso_pu_bacteria 2721755514 2722840568 326
262 iso_pu_bacteria 2721755810 2724044891 326
263 iso_pu_bacteria 2724679232 2725950499 326
264 iso_pu_bacteria 2728369365 2730164606 326
265 iso_pu_bacteria 2728369397 2730298642 326
266 iso_pu_bacteria 2738541333 2739032437 326
267 iso_pu_bacteria 2751185821 2753459248 326
268 iso_pu_bacteria 2765235942 2766066898 326
269 iso_pu_bacteria 2767802442 2770197573 326
270 iso_pu_bacteria 2775506902 2776272954 326
271 iso_pu_bacteria 2775506904 2776282202 326
272 iso_pu_bacteria 2791355082 2792579763 326
273 iso_pu_bacteria 2791355091 2792624493 326
274 iso_pu_bacteria 2791355092 2792630571 326
275 iso_pu_bacteria 2791355094 2792640812 326
276 iso_pu_bacteria 2791355259 2793312459 326
277 iso_pu_bacteria 2791355260 2793322992 326
278 iso_pu_bacteria 2791355264 2793349918 326
279 iso_pu_bacteria 2791355265 2793352857 326
280 iso_pu_bacteria 2791355266 2793360723 326
281 iso_pu_bacteria 2791355267 2793366936 326
282 iso_pu_bacteria 2802429268 2804755359 326
283 iso_pu_bacteria 2802429605 2805925899 326
284 iso_pu_bacteria 2802429633 2806043412 326
285 iso_pu_bacteria 2802429634 2806050654 326
286 iso_pu_bacteria 2802429635 2806057471 326
287 iso_pu_bacteria 2802429636 2806064853 326
288 iso_pu_bacteria 2802429637 2806072119 326
289 iso_pu_bacteria 2818991448 2819611868 326
290 iso_pu_bacteria 2838022645 2838026216 326
291 iso_pu_bacteria 2838035591 2838039400 326
292 iso_pu_bacteria 2838048938 2838053564 326
293 iso_pu_bacteria 2838061910 2838065606 326
294 iso_pu_bacteria 2838074704 2838080236 326
295 iso_pu_bacteria 2838661181 2838667575 326
296 iso_pu_bacteria 2838668709 2838674436 326
297 iso_pu_bacteria 2838680041 2838681984 326
298 iso_pu_bacteria 2838686498 2838692011 326
299 iso_pu_bacteria 2838694306 2838696555 326
300 iso_pu_bacteria 2838701080 2838706964 326
301 iso_pu_bacteria 2838707686 2838710205 326
302 iso_pu_bacteria 2838729681 2838732843 326
303 iso_pu_bacteria 2838742623 2838745721 326
304 iso_pu_bacteria 2840764183 2840764749 326
305 iso_pu_bacteria 2841851746 2841855821 326
306 iso_pu_bacteria 2842077413 2842078379 326
307 iso_pu_bacteria 2842110456 2842114167 326
308 iso_pu_bacteria 2842118031 2842119112 326
309 iso_pu_bacteria 2842146304 2842151492 326
310 iso_pu_bacteria 2842156927 2842157187 326
311 iso_pu_bacteria 2842163707 2842167848 326
312 iso_pu_bacteria 2842180545 2842181229 326
313 iso_pu_bacteria 2842192696 2842194308 326
314 iso_pu_bacteria 2842198810 2842201851 326
315 iso_pu_bacteria 2842217011 2842217495 326
316 iso_pu_bacteria 2842229732 2842230720 326
317 iso_pu_bacteria 2842237096 2842239617 326
318 iso_pu_bacteria 2842243621 2842245180 326
319 iso_pu_bacteria 2842250916 2842256630 326
320 iso_pu_bacteria 2842257432 2842258993 326
321 iso_pu_bacteria 2842271015 2842276337 326
322 iso_pu_bacteria 2842285085 2842285933 326
323 iso_pu_bacteria 2842291075 2842292041 326
324 iso_pu_bacteria 2842304105 2842304520 326
325 iso_pu_bacteria 2842311132 2842314438 326
326 iso_pu_bacteria 2842317721 2842323063 326
327 iso_pu_bacteria 2842341865 2842345323 326
328 iso_pu_bacteria 2842363717 2842364772 326
329 iso_pu_bacteria 2842370503 2842372550 326
330 iso_pu_bacteria 2842377471 2842378437 326
331 iso_pu_bacteria 2842384541 2842385622 326
332 iso_pu_bacteria 2842402390 2842403292 326
333 iso_pu_bacteria 2842409023 2842409335 326
334 iso_pu_bacteria 2842415677 2842415988 326
335 iso_pu_bacteria 2842447887 2842450774 326
336 iso_pu_bacteria 2842489311 2842490230 326
337 iso_pu_bacteria 2842495871 2842495975 326
338 iso_pu_bacteria 2842521101 2842525629 326
339 iso_pu_bacteria 2844454524 2844458934 326
340 iso_pu_bacteria 2847417321 2847421184 326
341 iso_pu_bacteria 2848992105 2848998466 326
342 iso_pu_bacteria 2850079185 2850084912 326
343 iso_pu_bacteria 2855872281 2855875331 326
344 iso_pu_bacteria 2857516855 2857519941 326
345 iso_pu_bacteria 2896384573 2896389246 326
346 iso_pu_bacteria 2913295892 2913297137 326
347 iso_pu_bacteria 2920760137 2920766511 326
348 iso_pu_bacteria 2933570622 2933571793 326
349 iso_pu_bacteria 2933586486 2933590263 326
350 iso_pu_bacteria 2935894831 2935897589 326
351 iso_pu_bacteria 2935901341 2935905458 326
352 iso_pu_bacteria 2936367885 2936372473 326
353 iso_pu_bacteria 2936375103 2936376536 326
354 iso_pu_bacteria 2941499720 2941503075 326
355 iso_pu_bacteria 2989771324 2989772880 326
356 iso_pu_bacteria 3003930520 3003931983 326
357 iso_pu_bacteria 3005445848 3005451854 326
358 iso_pu_bacteria 639633055 639648777 326
359 iso_pu_bacteria 643692032 643822274 326
360 iso_pu_bacteria 8005289223 8005293290 326
361 iso_pu_bacteria 8005301065 8005302765 326
362 iso_pu_bacteria 8005307578 8005312392 326
363 iso_pu_bacteria 8005376324 8005379450 326
364 iso_pu_bacteria 8005430974 8005431722 326
365 iso_pu_bacteria 8005460587 8005463210 326
366 iso_pu_bacteria 8005484373 8005486320 326
367 iso_pu_bacteria 8005556819 8005557467 326
368 iso_pu_bacteria 8005563573 8005568644 326
369 iso_pu_bacteria 8005570704 8005574493 326
370 iso_pu_bacteria 8005688590 8005694785 326
371 iso_pu_bacteria 8018163183 8018166555 326
372 iso_pu_bacteria 8023680758 8023685157 326
373 iso_pu_bacteria 8024479707 8024483301 326
374 iso_pu_bacteria 8024486573 8024486678 326
375 iso_pu_bacteria 8024501048 8024501436 326
376 iso_pu_bacteria 8046767195 8046767799 326
377 iso_pu_bacteria 8049293176 8049298254 326
378 iso_pu_bacteria 8054558443 8054561162 326
379 iso_pu_bacteria 8056375014 8056376822 326
380 iso_pu_bacteria 8056382006 8056388049 326
381 iso_pu_bacteria 8057874678 8057874807 326
382 3300005435 Ga0070714_100143638 Ga0070714_1001436382 327
383 3300005435 Ga0070714_100158810 Ga0070714_1001588102 327
384 3300005436 Ga0070713_100019136 Ga0070713_1000191365 327
385 3300005437 Ga0070710_10003768 Ga0070710_100037684 327
386 3300006028 Ga0070717_10134531 Ga0070717_101345312 327
387 3300006175 Ga0070712_100003703 Ga0070712_1000037037 327
388 3300007265 Ga0099794_10002417 Ga0099794_100024178 327
389 3300025906 Ga0207699_10021067 Ga0207699_100210672 327
390 3300025915 Ga0207693_10006645 Ga0207693_100066456 327
391 3300025928 Ga0207700_10133916 Ga0207700_101339161 327
392 3300025928 Ga0207700_10155650 Ga0207700_101556502 327
393 3300025929 Ga0207664_10017070 Ga0207664_100170702 327
394 3300027512 Ga0209179_1003933 Ga0209179_10039332 327
395 3300048907 Ga0496104_0016282 Ga0496104_0016282_2784_3818 327
396 3300048913 Ga0496110_0017067 Ga0496110_0017067_861_1910 327
397 3300048915 Ga0496112_0074531 Ga0496112_0074531_964_2013 327
398 3300048916 Ga0496113_0134418 Ga0496113_0134418_677_1711 327
399 3300048929 Ga0496126_0012615 Ga0496126_0012615_3983_5026 327
400 3300049572 Ga0501036_0279960 Ga0501036_0279960_70_1098 327
401 3300049578 Ga0501042_0196987 Ga0501042_0196987_91_1119 327
402 iso_pu_bacteria 2508501042 2508692052 327
403 iso_pu_bacteria 2513237094 2513640942 327
404 iso_pu_bacteria 2524023205 2524440231 327
405 iso_pu_bacteria 2528768022 2528852821 327
406 iso_pu_bacteria 2744054633 2745078056 327
407 iso_pu_bacteria 2824661429 2824662806 327
408 iso_pu_bacteria 2824704595 2824706570 327
409 iso_pu_bacteria 2824753945 2824756511 327
410 iso_pu_bacteria 2824763712 2824766005 327
411 iso_pu_bacteria 2844315083 2844319659 327
412 iso_pu_bacteria 2874628541 2874635489 327
413 iso_pu_bacteria 2879099564 2879102791 327
414 iso_pu_bacteria 2885409591 2885410771 327
415 iso_pu_bacteria 2903727486 2903730660 327
416 iso_pu_bacteria 2904711408 2904715264 327
417 iso_pu_bacteria 2906602504 2906609391 327
418 iso_pu_bacteria 2906626472 2906628368 327
419 iso_pu_bacteria 2922368715 2922370776 327
420 iso_pu_bacteria 2932784394 2932785475 327
421 iso_pu_bacteria 2932794094 2932797061 327
422 iso_pu_bacteria 2932801729 2932807356 327
423 iso_pu_bacteria 2932809354 2932816606 327
424 iso_pu_bacteria 2932818245 2932822107 327
425 iso_pu_bacteria 2932828146 2932833188 327
426 iso_pu_bacteria 2933577622 2933581102 327
427 iso_pu_bacteria 2935616580 2935620585 327
428 iso_pu_bacteria 2935638405 2935639672 327
429 iso_pu_bacteria 2935648319 2935650811 327
430 iso_pu_bacteria 2935656913 2935658992 327
431 iso_pu_bacteria 2935665750 2935667490 327
432 iso_pu_bacteria 2935675223 2935677451 327
433 iso_pu_bacteria 2935684952 2935690606 327
434 iso_pu_bacteria 2935694250 2935696416 327
435 iso_pu_bacteria 2935703347 2935705230 327
436 iso_pu_bacteria 2935713505 2935717698 327
437 iso_pu_bacteria 2935722832 2935727152 327
438 iso_pu_bacteria 2935732158 2935735922 327
439 iso_pu_bacteria 2935741537 2935744807 327
440 iso_pu_bacteria 2935750917 2935755615 327
441 iso_pu_bacteria 2935760218 2935761872 327
442 iso_pu_bacteria 2935801545 2935806976 327
443 iso_pu_bacteria 2935810662 2935814194 327
444 iso_pu_bacteria 2935827899 2935829155 327
445 iso_pu_bacteria 2935837841 2935845311 327
446 iso_pu_bacteria 2935855204 2935858393 327
447 iso_pu_bacteria 2935864058 2935872329 327
448 iso_pu_bacteria 2935873716 2935877324 327
449 iso_pu_bacteria 2935883170 2935884516 327
450 iso_pu_bacteria 2935916978 2935923630 327
451 iso_pu_bacteria 2935984226 2935987261 327
452 iso_pu_bacteria 2935992306 2935995057 327
453 iso_pu_bacteria 2936002035 2936006150 327
454 iso_pu_bacteria 2936011229 2936013407 327
455 iso_pu_bacteria 2936019824 2936022466 327
456 iso_pu_bacteria 2936028420 2936030912 327
457 iso_pu_bacteria 2936037263 2936039749 327
458 iso_pu_bacteria 2936046547 2936048725 327
459 iso_pu_bacteria 2936055302 2936058939 327
460 iso_pu_bacteria 2940556831 2940561104 327
461 iso_pu_bacteria 2941538514 2941545718 327
462 iso_pu_bacteria 3005710791 3005715376 327
463 iso_pu_bacteria 3005718088 3005719384 327
464 iso_pu_bacteria 8006964411 8006971049 327
465 iso_pu_bacteria 8006984368 8006986687 327
466 iso_pu_bacteria 8016583857 8016591085 327
467 iso_pu_bacteria 8016630954 8016636249 327
468 iso_pu_bacteria 8016630954 8016639825 327
469 iso_pu_bacteria 8017057580 8017059702 327
470 iso_pu_bacteria 8019576017 8019579177 327
471 iso_pu_bacteria 8019586578 8019597231 327
472 iso_pu_bacteria 8019597564 8019604464 327
473 iso_pu_bacteria 8019648815 8019659138 327
474 iso_pu_bacteria 8055742211 8055749562 327
475 iso_pu_bacteria 8056967851 8056968670 327
476 3300005327 Ga0070658_10084121 Ga0070658_100841212 328
477 3300005329 Ga0070683_100032630 Ga0070683_1000326305 328
478 3300005336 Ga0070680_100032603 Ga0070680_1000326032 328
479 3300005339 Ga0070660_100067269 Ga0070660_1000672692 328
480 3300005435 Ga0070714_100100930 Ga0070714_1001009302 328
481 3300005436 Ga0070713_100014695 Ga0070713_1000146952 328
482 3300005436 Ga0070713_100026782 Ga0070713_1000267824 328
483 3300005530 Ga0070679_100056648 Ga0070679_1000566485 328
484 3300005535 Ga0070684_100003618 Ga0070684_1000036187 328
485 3300005536 Ga0070697_100109950 Ga0070697_1001099502 328
486 3300005539 Ga0068853_100040370 Ga0068853_1000403704 328
487 3300005563 Ga0068855_100220273 Ga0068855_1002202732 328
488 3300005577 Ga0068857_100053523 Ga0068857_1000535232 328
489 3300005834 Ga0068851_10004499 Ga0068851_100044995 328
490 3300005842 Ga0068858_100231022 Ga0068858_1002310222 328
491 3300005937 Ga0081455_10005782 Ga0081455_100057828 328
492 3300005983 Ga0081540_1000195 Ga0081540_100019521 328
493 3300006038 Ga0075365_10089411 Ga0075365_100894112 328
494 3300006173 Ga0070716_100264802 Ga0070716_1002648022 328
495 3300006178 Ga0075367_10038586 Ga0075367_100385864 328
496 3300006195 Ga0075366_10094274 Ga0075366_100942741 328
497 3300006353 Ga0075370_10006919 Ga0075370_100069198 328
498 3300007076 Ga0075435_100411866 Ga0075435_1004118662 328
499 3300007788 Ga0099795_10029791 Ga0099795_100297912 328
500 3300009093 Ga0105240_10031202 Ga0105240_100312027 328
501 3300009545 Ga0105237_10017035 Ga0105237_100170357 328
502 3300009545 Ga0105237_10354483 Ga0105237_103544832 328
503 3300009551 Ga0105238_10108545 Ga0105238_101085453 328
504 3300009553 Ga0105249_10577096 Ga0105249_105770961 328
505 3300010159 Ga0099796_10026519 Ga0099796_100265192 328
506 3300010375 Ga0105239_10157084 Ga0105239_101570842 328
507 3300013104 Ga0157370_10057819 Ga0157370_100578192 328
508 3300013105 Ga0157369_10047093 Ga0157369_100470935 328
509 3300021377 Ga0213874_10017590 Ga0213874_100175903 328
510 3300025909 Ga0207705_10063917 Ga0207705_100639174 328
511 3300025912 Ga0207707_10001229 Ga0207707_1000122921 328
512 3300025913 Ga0207695_10128881 Ga0207695_101288812 328
513 3300025914 Ga0207671_10103726 Ga0207671_101037262 328
514 3300025915 Ga0207693_10067559 Ga0207693_100675592 328
515 3300025919 Ga0207657_10000658 Ga0207657_1000065838 328
516 3300025921 Ga0207652_10005888 Ga0207652_100058882 328
517 3300025922 Ga0207646_10069582 Ga0207646_100695824 328
518 3300025928 Ga0207700_10160945 Ga0207700_101609452 328
519 3300025939 Ga0207665_10017888 Ga0207665_100178885 328
520 3300025944 Ga0207661_10241994 Ga0207661_102419942 328
521 3300025949 Ga0207667_10099955 Ga0207667_100999552 328
522 3300026035 Ga0207703_10144618 Ga0207703_101446182 328
523 3300026041 Ga0207639_10066316 Ga0207639_100663163 328
524 3300026116 Ga0207674_10205570 Ga0207674_102055702 328
525 3300031507 Ga0307509_10085879 Ga0307509_100858792 328
526 3300035118 Ga0373954_0028630 Ga0373954_0028630_1436_2488 328
527 3300035724 Ga0373933_0000225 Ga0373933_0000225_12611_13648 328
528 3300036401 Ga0373937_0100873 Ga0373937_0100873_264_1316 328
529 3300039437 Ga0436365_1246958 Ga0436365_1246958_1363_2394 328
530 3300039450 Ga0436363_0657874 Ga0436363_0657874_3679_4725 328
531 3300039450 Ga0436363_1534966 Ga0436363_1534966_2090_3124 328
532 3300046679 Ga0495623_0146185 Ga0495623_0146185_42_1073 328
533 3300049574 Ga0501038_0080223 Ga0501038_0080223_619_1644 328
534 3300049576 Ga0501040_0032832 Ga0501040_0032832_1336_2361 328
535 3300049577 Ga0501041_0045944 Ga0501041_0045944_1208_2233 328
536 3300049588 Ga0501072_0099070 Ga0501072_0099070_212_1237 328
537 3300049590 Ga0501074_0026529 Ga0501074_0026529_1187_2212 328
538 3300049591 Ga0501075_0016056 Ga0501075_0016056_794_1819 328
539 3300049592 Ga0501076_0013787 Ga0501076_0013787_89_1114 328
540 3300049593 Ga0501077_0031715 Ga0501077_0031715_866_1891 328
541 3300049741 Ga0501079_0093314 Ga0501079_0093314_294_1319 328
542 3300049743 Ga0501081_0004781 Ga0501081_0004781_4828_5853 328
543 3300049822 Ga0501035_0120349 Ga0501035_0120349_1207_2232 328
544 3300049824 Ga0501045_0010293 Ga0501045_0010293_3274_4299 328
545 3300050512 nmdc:mga0n895_230649_c1 nmdc:mga0n895_230649_c1_452_1489 328
546 3300050513 nmdc:mga0rr50_362930_c1 nmdc:mga0rr50_362930_c1_103_1140 328
547 3300054114 Ga0501084_0001165 Ga0501084_0001165_18156_19181 328
548 3300060353 Ga0501082_0027865 Ga0501082_0027865_3766_4791 328
549 3300061734 Ga0530510_0039974 Ga0530510_0039974_1031_2056 328
550 iso_pu_bacteria 2738543013 2739249943 328
551 iso_pu_bacteria 2851182111 2851184268 328
552 iso_pu_bacteria 2919450847 2919454156 328
553 iso_pu_bacteria 8001845381 8001846231 328
554 3300044656 Ga0466969_0075371 Ga0466969_0075371_329_1345 329
555 iso_pu_bacteria 2508501128 2509152408 329
556 iso_pu_bacteria 2513237092 2513622265 329
557 iso_pu_bacteria 2513237095 2513645168 329
558 iso_pu_bacteria 2513237096 2513658601 329
559 iso_pu_bacteria 2513237104 2513721749 329
560 iso_pu_bacteria 2513237141 2513890044 329
561 iso_pu_bacteria 2513237145 2513920835 329
562 iso_pu_bacteria 2517093001 2517102489 329
563 iso_pu_bacteria 2667528175 2671123061 329
564 iso_pu_bacteria 2728368998 2728752277 329
565 iso_pu_bacteria 2791355197 2793070220 329
566 iso_pu_bacteria 2816332527 2818239427 329
567 iso_pu_bacteria 2824679649 2824682239 329
568 iso_pu_bacteria 2841957949 2841961816 329
569 iso_pu_bacteria 2847930680 2847936669 329
570 iso_pu_bacteria 2876761206 2876762241 329
571 iso_pu_bacteria 2879083081 2879087988 329
572 iso_pu_bacteria 2881665667 2881672444 329
573 iso_pu_bacteria 2885374607 2885378857 329
574 iso_pu_bacteria 2885383462 2885385416 329
575 iso_pu_bacteria 2888378607 2888384819 329
576 iso_pu_bacteria 2889033259 2889037429 329
577 iso_pu_bacteria 2903748898 2903753772 329
578 iso_pu_bacteria 2904690495 2904697992 329
579 iso_pu_bacteria 2906610324 2906614773 329
580 iso_pu_bacteria 2908739725 2908746393 329
581 iso_pu_bacteria 2908756301 2908763030 329
582 iso_pu_bacteria 2922393267 2922397593 329
583 iso_pu_bacteria 2922425934 2922426637 329
584 iso_pu_bacteria 2935630451 2935636892 329
585 iso_pu_bacteria 2941507105 2941513529 329
586 iso_pu_bacteria 2941515067 2941521492 329
587 iso_pu_bacteria 2941523033 2941529188 329
588 iso_pu_bacteria 3005474847 3005475985 329
589 iso_pu_bacteria 3005594810 3005599792 329
590 iso_pu_bacteria 8006926726 8006931098 329
591 iso_pu_bacteria 8019555841 8019561355 329
592 iso_pu_bacteria 8019565922 8019571434 329
593 3300025258 Ga0209129_1004886 Ga0209129_10048862 330
594 3300025294 Ga0209025_1006605 Ga0209025_10066056 330
595 3300025297 Ga0209758_1008781 Ga0209758_10087813 330
596 3300031456 Ga0307513_10337544 Ga0307513_103375442 330
597 3300041404 Ga0439436_0000231 Ga0439436_0000231_5058_6065 330
598 3300041406 Ga0439439_0007026 Ga0439439_0007026_606_1613 330
599 3300041997 Ga0439431_0038494 Ga0439431_0038494_38_1045 330
600 3300042007 Ga0439449_0015812 Ga0439449_0015812_594_1601 330
601 3300048917 Ga0496114_0064538 Ga0496114_0064538_854_1861 330
602 3300003320 rootH2_10026777 rootH2_100267775 331
603 3300003659 JGI25404J52841_10000081 JGI25404J52841_100000815 331
604 3300005328 Ga0070676_10061945 Ga0070676_100619452 331
605 3300005334 Ga0068869_100078358 Ga0068869_1000783583 331
606 3300005334 Ga0068869_100118949 Ga0068869_1001189492 331
607 3300005341 Ga0070691_10195753 Ga0070691_101957531 331
608 3300005347 Ga0070668_100011099 Ga0070668_1000110997 331
609 3300005347 Ga0070668_100020589 Ga0070668_1000205892 331
610 3300005353 Ga0070669_100070459 Ga0070669_1000704592 331
611 3300005353 Ga0070669_100130310 Ga0070669_1001303101 331
612 3300005356 Ga0070674_100007035 Ga0070674_1000070355 331
613 3300005365 Ga0070688_100247981 Ga0070688_1002479812 331
614 3300005435 Ga0070714_100010743 Ga0070714_1000107436 331
615 3300005438 Ga0070701_10112218 Ga0070701_101122182 331
616 3300005440 Ga0070705_100095323 Ga0070705_1000953232 331
617 3300005441 Ga0070700_100022083 Ga0070700_1000220831 331
618 3300005455 Ga0070663_100070522 Ga0070663_1000705222 331
619 3300005455 Ga0070663_100146211 Ga0070663_1001462112 331
620 3300005455 Ga0070663_100360937 Ga0070663_1003609371 331
621 3300005456 Ga0070678_100010558 Ga0070678_1000105584 331
622 3300005457 Ga0070662_100031158 Ga0070662_1000311584 331
623 3300005457 Ga0070662_100048692 Ga0070662_1000486922 331
624 3300005467 Ga0070706_100055029 Ga0070706_1000550295 331
625 3300005518 Ga0070699_100039618 Ga0070699_1000396184 331
626 3300005539 Ga0068853_100296844 Ga0068853_1002968442 331
627 3300005539 Ga0068853_100348299 Ga0068853_1003482992 331
628 3300005539 Ga0068853_100370061 Ga0068853_1003700612 331
629 3300005543 Ga0070672_100185087 Ga0070672_1001850871 331
630 3300005546 Ga0070696_100098384 Ga0070696_1000983842 331
631 3300005548 Ga0070665_100015661 Ga0070665_1000156618 331
632 3300005548 Ga0070665_100073671 Ga0070665_1000736714 331
633 3300005548 Ga0070665_100142795 Ga0070665_1001427952 331
634 3300005548 Ga0070665_100227335 Ga0070665_1002273352 331
635 3300005549 Ga0070704_100106728 Ga0070704_1001067282 331
636 3300005563 Ga0068855_100018220 Ga0068855_1000182206 331
637 3300005564 Ga0070664_100260130 Ga0070664_1002601302 331
638 3300005577 Ga0068857_100096683 Ga0068857_1000966832 331
639 3300005578 Ga0068854_100123512 Ga0068854_1001235122 331
640 3300005578 Ga0068854_100266034 Ga0068854_1002660342 331
641 3300005615 Ga0070702_100090478 Ga0070702_1000904782 331
642 3300005615 Ga0070702_100202473 Ga0070702_1002024731 331
643 3300005616 Ga0068852_100211614 Ga0068852_1002116142 331
644 3300005616 Ga0068852_100216668 Ga0068852_1002166682 331
645 3300005617 Ga0068859_100143848 Ga0068859_1001438482 331
646 3300005617 Ga0068859_100258692 Ga0068859_1002586923 331
647 3300005618 Ga0068864_100075419 Ga0068864_1000754192 331
648 3300005719 Ga0068861_100045484 Ga0068861_1000454842 331
649 3300005719 Ga0068861_100072207 Ga0068861_1000722072 331
650 3300005719 Ga0068861_100111381 Ga0068861_1001113813 331
651 3300005842 Ga0068858_100028464 Ga0068858_1000284642 331
652 3300005843 Ga0068860_100168411 Ga0068860_1001684112 331
653 3300005843 Ga0068860_100413140 Ga0068860_1004131402 331
654 3300005844 Ga0068862_100020306 Ga0068862_1000203066 331
655 3300005844 Ga0068862_100111422 Ga0068862_1001114223 331
656 3300005844 Ga0068862_100203149 Ga0068862_1002031492 331
657 3300005983 Ga0081540_1003618 Ga0081540_10036189 331
658 3300005985 Ga0081539_10004005 Ga0081539_100040054 331
659 3300006038 Ga0075365_10076208 Ga0075365_100762082 331
660 3300006038 Ga0075365_10100467 Ga0075365_101004672 331
661 3300006051 Ga0075364_10011789 Ga0075364_100117892 331
662 3300006051 Ga0075364_10104787 Ga0075364_101047872 331
663 3300006058 Ga0075432_10074957 Ga0075432_100749572 331
664 3300006177 Ga0075362_10088533 Ga0075362_100885332 331
665 3300006177 Ga0075362_10134931 Ga0075362_101349311 331
666 3300006178 Ga0075367_10042114 Ga0075367_100421145 331
667 3300006186 Ga0075369_10027238 Ga0075369_100272381 331
668 3300006195 Ga0075366_10013479 Ga0075366_100134794 331
669 3300006195 Ga0075366_10048153 Ga0075366_100481534 331
670 3300006195 Ga0075366_10084781 Ga0075366_100847812 331
671 3300006353 Ga0075370_10022864 Ga0075370_100228642 331
672 3300006353 Ga0075370_10106095 Ga0075370_101060952 331
673 3300006931 Ga0097620_100143847 Ga0097620_1001438472 331
674 3300006931 Ga0097620_100258689 Ga0097620_1002586893 331
675 3300007265 Ga0099794_10025953 Ga0099794_100259532 331
676 3300009092 Ga0105250_10086862 Ga0105250_100868622 331
677 3300009093 Ga0105240_10011759 Ga0105240_100117596 331
678 3300009093 Ga0105240_10016843 Ga0105240_100168434 331
679 3300009094 Ga0111539_10055979 Ga0111539_100559791 331
680 3300009098 Ga0105245_10060265 Ga0105245_100602652 331
681 3300009098 Ga0105245_10073859 Ga0105245_100738592 331
682 3300009101 Ga0105247_10017735 Ga0105247_100177352 331
683 3300009147 Ga0114129_10141644 Ga0114129_101416442 331
684 3300009148 Ga0105243_10025143 Ga0105243_100251434 331
685 3300009148 Ga0105243_10032960 Ga0105243_100329602 331
686 3300009174 Ga0105241_10014987 Ga0105241_100149873 331
687 3300009174 Ga0105241_10050565 Ga0105241_100505655 331
688 3300009177 Ga0105248_10028709 Ga0105248_100287096 331
689 3300009545 Ga0105237_10000407 Ga0105237_1000040717 331
690 3300009545 Ga0105237_10006258 Ga0105237_100062584 331
691 3300009545 Ga0105237_10023255 Ga0105237_100232553 331
692 3300009545 Ga0105237_10122834 Ga0105237_101228342 331
693 3300009545 Ga0105237_10128946 Ga0105237_101289464 331
694 3300009545 Ga0105237_10433471 Ga0105237_104334711 331
695 3300009551 Ga0105238_10005854 Ga0105238_1000585413 331
696 3300009551 Ga0105238_10321064 Ga0105238_103210642 331
697 3300009551 Ga0105238_10419086 Ga0105238_104190862 331
698 3300009553 Ga0105249_10072678 Ga0105249_100726784 331
699 3300010375 Ga0105239_10000335 Ga0105239_1000033526 331
700 3300010375 Ga0105239_10039190 Ga0105239_100391904 331
701 3300010375 Ga0105239_10077141 Ga0105239_100771413 331
702 3300011119 Ga0105246_10341649 Ga0105246_103416492 331
703 3300013296 Ga0157374_10485952 Ga0157374_104859521 331
704 3300013297 Ga0157378_10302238 Ga0157378_103022382 331
705 3300013308 Ga0157375_10021587 Ga0157375_100215877 331
706 3300014325 Ga0163163_10354179 Ga0163163_103541792 331
707 3300014326 Ga0157380_10189385 Ga0157380_101893851 331
708 3300014497 Ga0182008_10053607 Ga0182008_100536071 331
709 3300014968 Ga0157379_10166222 Ga0157379_101662223 331
710 3300014968 Ga0157379_10277561 Ga0157379_102775612 331
711 3300014969 Ga0157376_10135506 Ga0157376_101355062 331
712 3300014969 Ga0157376_10300509 Ga0157376_103005092 331
713 3300025253 Ga0209677_100805 Ga0209677_10080512 331
714 3300025254 Ga0209148_1000647 Ga0209148_100064714 331
715 3300025254 Ga0209148_1011717 Ga0209148_10117172 331
716 3300025261 Ga0209233_1001170 Ga0209233_10011706 331
717 3300025261 Ga0209233_1010430 Ga0209233_10104305 331
718 3300025272 Ga0209455_1005167 Ga0209455_10051675 331
719 3300025297 Ga0209758_1039634 Ga0209758_10396342 331
720 3300025303 Ga0209051_1007994 Ga0209051_10079945 331
721 3300025315 Ga0207697_10011897 Ga0207697_100118972 331
722 3300025315 Ga0207697_10080082 Ga0207697_100800822 331
723 3300025885 Ga0207653_10025620 Ga0207653_100256202 331
724 3300025893 Ga0207682_10004544 Ga0207682_100045442 331
725 3300025900 Ga0207710_10012995 Ga0207710_100129955 331
726 3300025904 Ga0207647_10005772 Ga0207647_100057725 331
727 3300025907 Ga0207645_10037323 Ga0207645_100373235 331
728 3300025907 Ga0207645_10046830 Ga0207645_100468302 331
729 3300025907 Ga0207645_10194661 Ga0207645_101946612 331
730 3300025908 Ga0207643_10028118 Ga0207643_100281182 331
731 3300025910 Ga0207684_10150913 Ga0207684_101509132 331
732 3300025911 Ga0207654_10044646 Ga0207654_100446462 331
733 3300025913 Ga0207695_10000006 Ga0207695_10000006936 331
734 3300025913 Ga0207695_10010418 Ga0207695_100104182 331
735 3300025913 Ga0207695_10308852 Ga0207695_103088522 331
736 3300025914 Ga0207671_10009057 Ga0207671_100090572 331
737 3300025914 Ga0207671_10011585 Ga0207671_100115857 331
738 3300025914 Ga0207671_10073481 Ga0207671_100734813 331
739 3300025919 Ga0207657_10154515 Ga0207657_101545152 331
740 3300025920 Ga0207649_10090706 Ga0207649_100907062 331
741 3300025923 Ga0207681_10126500 Ga0207681_101265002 331
742 3300025923 Ga0207681_10153364 Ga0207681_101533642 331
743 3300025924 Ga0207694_10012928 Ga0207694_100129286 331
744 3300025927 Ga0207687_10053770 Ga0207687_100537703 331
745 3300025931 Ga0207644_10069782 Ga0207644_100697822 331
746 3300025933 Ga0207706_10033826 Ga0207706_100338264 331
747 3300025933 Ga0207706_10041595 Ga0207706_100415954 331
748 3300025933 Ga0207706_10060636 Ga0207706_100606363 331
749 3300025933 Ga0207706_10214218 Ga0207706_102142182 331
750 3300025933 Ga0207706_10495171 Ga0207706_104951711 331
751 3300025935 Ga0207709_10008413 Ga0207709_100084135 331
752 3300025935 Ga0207709_10045251 Ga0207709_100452514 331
753 3300025935 Ga0207709_10204766 Ga0207709_102047662 331
754 3300025935 Ga0207709_10255018 Ga0207709_102550181 331
755 3300025936 Ga0207670_10040156 Ga0207670_100401564 331
756 3300025937 Ga0207669_10092948 Ga0207669_100929482 331
757 3300025938 Ga0207704_10200172 Ga0207704_102001722 331
758 3300025940 Ga0207691_10339752 Ga0207691_103397521 331
759 3300025941 Ga0207711_10192015 Ga0207711_101920152 331
760 3300025942 Ga0207689_10020623 Ga0207689_100206236 331
761 3300025942 Ga0207689_10063252 Ga0207689_100632523 331
762 3300025945 Ga0207679_10267142 Ga0207679_102671422 331
763 3300025949 Ga0207667_10170598 Ga0207667_101705984 331
764 3300025960 Ga0207651_10162582 Ga0207651_101625822 331
765 3300025961 Ga0207712_10046477 Ga0207712_100464772 331
766 3300025961 Ga0207712_10178291 Ga0207712_101782912 331
767 3300025972 Ga0207668_10020133 Ga0207668_100201332 331
768 3300025972 Ga0207668_10025131 Ga0207668_100251314 331
769 3300025972 Ga0207668_10066910 Ga0207668_100669102 331
770 3300025972 Ga0207668_10153926 Ga0207668_101539262 331
771 3300025972 Ga0207668_10157297 Ga0207668_101572972 331
772 3300025972 Ga0207668_10201702 Ga0207668_102017021 331
773 3300025972 Ga0207668_10226514 Ga0207668_102265142 331
774 3300026023 Ga0207677_10068685 Ga0207677_100686852 331
775 3300026023 Ga0207677_10152481 Ga0207677_101524812 331
776 3300026023 Ga0207677_10155552 Ga0207677_101555522 331
777 3300026067 Ga0207678_10051569 Ga0207678_100515693 331
778 3300026067 Ga0207678_10271466 Ga0207678_102714662 331
779 3300026089 Ga0207648_10086738 Ga0207648_100867382 331
780 3300026089 Ga0207648_10172858 Ga0207648_101728582 331
781 3300026116 Ga0207674_10053120 Ga0207674_100531204 331
782 3300026116 Ga0207674_10202893 Ga0207674_102028932 331
783 3300026118 Ga0207675_100091301 Ga0207675_1000913012 331
784 3300026118 Ga0207675_100258500 Ga0207675_1002585002 331
785 3300026121 Ga0207683_10292745 Ga0207683_102927452 331
786 3300026142 Ga0207698_10210522 Ga0207698_102105222 331
787 3300028379 Ga0268266_10002919 Ga0268266_1000291912 331
788 3300028379 Ga0268266_10070968 Ga0268266_100709684 331
789 3300028379 Ga0268266_10189445 Ga0268266_101894453 331
790 3300028380 Ga0268265_10028233 Ga0268265_100282332 331
791 3300028380 Ga0268265_10089897 Ga0268265_100898973 331
792 3300028380 Ga0268265_10204786 Ga0268265_102047862 331
793 3300028380 Ga0268265_10242142 Ga0268265_102421422 331
794 3300028381 Ga0268264_10000050 Ga0268264_1000005037 331
795 3300028381 Ga0268264_10323527 Ga0268264_103235272 331
796 3300028794 Ga0307515_10000240 Ga0307515_1000024035 331
797 3300028794 Ga0307515_10001319 Ga0307515_100013199 331
798 3300031238 Ga0265332_10037532 Ga0265332_100375323 331
799 3300031239 Ga0265328_10030050 Ga0265328_100300502 331
800 3300031241 Ga0265325_10061509 Ga0265325_100615092 331
801 3300031247 Ga0265340_10007729 Ga0265340_100077296 331
802 3300031249 Ga0265339_10050005 Ga0265339_100500053 331
803 3300031456 Ga0307513_10049358 Ga0307513_100493586 331
804 3300031456 Ga0307513_10197129 Ga0307513_101971292 331
805 3300031456 Ga0307513_10355563 Ga0307513_103555632 331
806 3300031507 Ga0307509_10013707 Ga0307509_100137079 331
807 3300031507 Ga0307509_10228759 Ga0307509_102287592 331
808 3300031507 Ga0307509_10322717 Ga0307509_103227172 331
809 3300031616 Ga0307508_10000029 Ga0307508_1000002947 331
810 3300031616 Ga0307508_10108926 Ga0307508_101089263 331
811 3300031616 Ga0307508_10114255 Ga0307508_101142551 331
812 3300031616 Ga0307508_10304997 Ga0307508_103049972 331
813 3300031712 Ga0265342_10048798 Ga0265342_100487984 331
814 3300031712 Ga0265342_10132257 Ga0265342_101322572 331
815 3300031730 Ga0307516_10007591 Ga0307516_100075919 331
816 3300031730 Ga0307516_10007878 Ga0307516_100078786 331
817 3300031730 Ga0307516_10039620 Ga0307516_100396203 331
818 3300031730 Ga0307516_10050803 Ga0307516_100508033 331
819 3300033179 Ga0307507_10143236 Ga0307507_101432362 331
820 3300033180 Ga0307510_10012890 Ga0307510_100128904 331
821 3300033180 Ga0307510_10119136 Ga0307510_101191362 331
822 3300033180 Ga0307510_10233922 Ga0307510_102339222 331
823 3300035083 Ga0373926_0025820 Ga0373926_0025820_359_1366 331
824 3300035111 Ga0373923_0051564 Ga0373923_0051564_157_1164 331
825 3300035118 Ga0373954_0000871 Ga0373954_0000871_4864_5886 331
826 3300035119 Ga0373956_0003759 Ga0373956_0003759_2404_3426 331
827 3300035120 Ga0373957_0000492 Ga0373957_0000492_5465_6487 331
828 3300035170 Ga0373943_0005276 Ga0373943_0005276_1109_2116 331
829 3300035171 Ga0373946_0018761 Ga0373946_0018761_781_1791 331
830 3300035171 Ga0373946_0035846 Ga0373946_0035846_408_1415 331
831 3300035172 Ga0373955_0004827 Ga0373955_0004827_4889_5911 331
832 3300035172 Ga0373955_0041413 Ga0373955_0041413_501_1508 331
833 3300035410 Ga0373924_0001494 Ga0373924_0001494_2157_3179 331
834 3300035695 Ga0373927_0000449 Ga0373927_0000449_18863_19873 331
835 3300035695 Ga0373927_0006633 Ga0373927_0006633_2145_3152 331
836 3300035695 Ga0373927_0016946 Ga0373927_0016946_2100_3107 331
837 3300035695 Ga0373927_0033968 Ga0373927_0033968_1404_2411 331
838 3300035695 Ga0373927_0277437 Ga0373927_0277437_46_1053 331
839 3300035724 Ga0373933_0001750 Ga0373933_0001750_2192_3214 331
840 3300037068 Ga0373925_0007139 Ga0373925_0007139_2138_3148 331
841 3300037068 Ga0373925_0164582 Ga0373925_0164582_711_1718 331
842 3300037068 Ga0373925_0326750 Ga0373925_0326750_31_1038 331
843 3300039437 Ga0436365_0164550 Ga0436365_0164550_1269_2276 331
844 3300045976 Ga0466967_0214556 Ga0466967_0214556_627_1634 331
845 3300046454 Ga0495592_0053757 Ga0495592_0053757_432_1439 331
846 3300046455 Ga0495603_0000818 Ga0495603_0000818_6511_7518 331
847 3300046457 Ga0495590_0007877 Ga0495590_0007877_1822_2841 331
848 3300046459 Ga0495629_0006770 Ga0495629_0006770_2196_3218 331
849 3300046459 Ga0495629_0013918 Ga0495629_0013918_3020_4042 331
850 3300046459 Ga0495629_0015490 Ga0495629_0015490_3860_4867 331
851 3300046460 Ga0495638_0003476 Ga0495638_0003476_5236_6243 331
852 3300046461 Ga0495641_0007310 Ga0495641_0007310_2454_3461 331
853 3300046462 Ga0495651_0016327 Ga0495651_0016327_2561_3583 331
854 3300046462 Ga0495651_0032580 Ga0495651_0032580_1558_2580 331
855 3300046472 Ga0495580_0016170 Ga0495580_0016170_231_1238 331
856 3300046473 Ga0495582_0001574 Ga0495582_0001574_11635_12642 331
857 3300046473 Ga0495582_0034022 Ga0495582_0034022_1416_2423 331
858 3300046474 Ga0495605_0059097 Ga0495605_0059097_344_1351 331
859 3300046475 Ga0495639_0000021 Ga0495639_0000021_3155_4162 331
860 3300046476 Ga0495662_0001876 Ga0495662_0001876_7490_8497 331
861 3300046477 Ga0495664_0012190 Ga0495664_0012190_522_1529 331
862 3300046492 Ga0495585_0014960 Ga0495585_0014960_3116_4141 331
863 3300046492 Ga0495585_0053087 Ga0495585_0053087_1010_2017 331
864 3300046499 Ga0495594_0000199 Ga0495594_0000199_11796_12803 331
865 3300046499 Ga0495594_0108073 Ga0495594_0108073_338_1345 331
866 3300046501 Ga0495607_0150057 Ga0495607_0150057_163_1170 331
867 3300046506 Ga0495583_0028721 Ga0495583_0028721_294_1301 331
868 3300046507 Ga0495606_0011074 Ga0495606_0011074_4794_5816 331
869 3300046507 Ga0495606_0058867 Ga0495606_0058867_720_1727 331
870 3300046507 Ga0495606_0105318 Ga0495606_0105318_325_1371 331
871 3300046511 Ga0495608_0005805 Ga0495608_0005805_5607_6629 331
872 3300046512 Ga0495610_0026452 Ga0495610_0026452_1979_2986 331
873 3300046512 Ga0495610_0055986 Ga0495610_0055986_385_1392 331
874 3300046514 Ga0495618_0009590 Ga0495618_0009590_374_1396 331
875 3300046514 Ga0495618_0064509 Ga0495618_0064509_260_1267 331
876 3300046514 Ga0495618_0108804 Ga0495618_0108804_363_1385 331
877 3300046516 Ga0495628_0165123 Ga0495628_0165123_312_1319 331
878 3300046517 Ga0495630_0059379 Ga0495630_0059379_1593_2600 331
879 3300046519 Ga0495632_0015766 Ga0495632_0015766_346_1359 331
880 3300046519 Ga0495632_0016557 Ga0495632_0016557_1717_2736 331
881 3300046522 Ga0495643_0025154 Ga0495643_0025154_1044_2051 331
882 3300046523 Ga0495644_0031250 Ga0495644_0031250_914_1921 331
883 3300046524 Ga0495648_0012986 Ga0495648_0012986_1172_2194 331
884 3300046529 Ga0495652_0003670 Ga0495652_0003670_11023_12045 331
885 3300046529 Ga0495652_0076299 Ga0495652_0076299_1536_2543 331
886 3300046531 Ga0495665_0007347 Ga0495665_0007347_4067_5074 331
887 3300046533 Ga0495640_0009862 Ga0495640_0009862_380_1402 331
888 3300046533 Ga0495640_0032849 Ga0495640_0032849_2238_3245 331
889 3300046537 Ga0495598_0001977 Ga0495598_0001977_585_1592 331
890 3300046538 Ga0495609_0032932 Ga0495609_0032932_286_1293 331
891 3300046539 Ga0495621_0002523 Ga0495621_0002523_1822_2835 331
892 3300046542 Ga0495597_0012282 Ga0495597_0012282_1777_2796 331
893 3300046557 Ga0495622_0001054 Ga0495622_0001054_1549_2556 331
894 3300046557 Ga0495622_0014896 Ga0495622_0014896_1610_2617 331
895 3300046557 Ga0495622_0050643 Ga0495622_0050643_678_1685 331
896 3300046557 Ga0495622_0054300 Ga0495622_0054300_45_1067 331
897 3300046559 Ga0495667_0002231 Ga0495667_0002231_2561_3583 331
898 3300046615 Ga0495656_0000673 Ga0495656_0000673_4781_5788 331
899 3300046616 Ga0495668_0034584 Ga0495668_0034584_1111_2133 331
900 3300046616 Ga0495668_0105245 Ga0495668_0105245_275_1297 331
901 3300046642 Ga0495634_0000537 Ga0495634_0000537_21294_22301 331
902 3300046642 Ga0495634_0041861 Ga0495634_0041861_720_1742 331
903 3300046648 Ga0495611_0005106 Ga0495611_0005106_2352_3359 331
904 3300046660 Ga0495625_0011106 Ga0495625_0011106_4805_5824 331
905 3300046660 Ga0495625_0015503 Ga0495625_0015503_3306_4328 331
906 3300046660 Ga0495625_0076817 Ga0495625_0076817_43_1050 331
907 3300046663 Ga0495635_0000544 Ga0495635_0000544_9768_10790 331
908 3300046663 Ga0495635_0014768 Ga0495635_0014768_3122_4129 331
909 3300046664 Ga0495659_0015934 Ga0495659_0015934_1346_2353 331
910 3300046665 Ga0495661_0034985 Ga0495661_0034985_1829_2836 331
911 3300046674 Ga0495588_0005106 Ga0495588_0005106_4408_5415 331
912 3300046674 Ga0495588_0008073 Ga0495588_0008073_1126_2133 331
913 3300046674 Ga0495588_0145188 Ga0495588_0145188_138_1145 331
914 3300046675 Ga0495657_0004009 Ga0495657_0004009_8229_9251 331
915 3300046678 Ga0495599_0013395 Ga0495599_0013395_1187_2209 331
916 3300046680 Ga0495646_0025629 Ga0495646_0025629_2635_3642 331
917 3300046681 Ga0495647_0003504 Ga0495647_0003504_713_1720 331
918 3300046683 Ga0495658_0002413 Ga0495658_0002413_1041_2048 331
919 3300046684 Ga0495669_0004064 Ga0495669_0004064_4687_5694 331
920 3300046684 Ga0495669_0021300 Ga0495669_0021300_910_1917 331
921 3300046684 Ga0495669_0111127 Ga0495669_0111127_209_1216 331
922 3300046690 Ga0495624_0001588 Ga0495624_0001588_12975_13982 331
923 3300046690 Ga0495624_0103577 Ga0495624_0103577_107_1114 331
924 3300046691 Ga0495670_0053887 Ga0495670_0053887_838_1845 331
925 3300046692 Ga0495671_0027092 Ga0495671_0027092_186_1193 331
926 3300046692 Ga0495671_0090308 Ga0495671_0090308_147_1169 331
927 3300046694 Ga0495649_0005062 Ga0495649_0005062_3174_4193 331
928 3300046694 Ga0495649_0012079 Ga0495649_0012079_379_1401 331
929 3300046694 Ga0495649_0099447 Ga0495649_0099447_363_1370 331
930 3300046794 Ga0495589_0112459 Ga0495589_0112459_46_1053 331
931 3300046810 Ga0495660_0054596 Ga0495660_0054596_864_1883 331
932 3300047315 Ga0495581_0000167 Ga0495581_0000167_8982_9989 331
933 3300047317 Ga0495604_0044826 Ga0495604_0044826_323_1345 331
934 3300047318 Ga0495636_0004964 Ga0495636_0004964_1854_2861 331
935 3300047319 Ga0495674_0006528 Ga0495674_0006528_3028_4035 331
936 3300047322 Ga0495680_0005784 Ga0495680_0005784_7689_8711 331
937 3300047323 Ga0495683_0019699 Ga0495683_0019699_480_1502 331
938 3300047323 Ga0495683_0090379 Ga0495683_0090379_29_1036 331
939 3300047443 Ga0495687_000161 Ga0495687_000161_97811_98830 331
940 3300047443 Ga0495687_007111 Ga0495687_007111_3598_4617 331
941 3300047443 Ga0495687_007129 Ga0495687_007129_3598_4617 331
942 3300047443 Ga0495687_028489 Ga0495687_028489_154_1161 331
943 3300047443 Ga0495687_039208 Ga0495687_039208_331_1338 331
944 3300047447 Ga0495685_057713 Ga0495685_057713_258_1280 331
945 3300047470 Ga0495681_0083405 Ga0495681_0083405_220_1227 331
946 3300047472 Ga0495686_0008703 Ga0495686_0008703_3265_4284 331
947 3300047472 Ga0495686_0042376 Ga0495686_0042376_207_1214 331
948 3300047673 Ga0495593_0000013 Ga0495593_0000013_80035_81042 331
949 3300047673 Ga0495593_0003915 Ga0495593_0003915_6548_7570 331
950 3300048088 Ga0495602_0022452 Ga0495602_0022452_2987_4009 331
951 3300048088 Ga0495602_0070141 Ga0495602_0070141_285_1292 331
952 3300048089 Ga0495614_0007950 Ga0495614_0007950_1427_2434 331
953 3300048091 Ga0495626_0118423 Ga0495626_0118423_36_1043 331
954 3300048903 Ga0496100_0147197 Ga0496100_0147197_543_1550 331
955 3300048904 Ga0496101_0046322 Ga0496101_0046322_1914_2921 331
956 3300048904 Ga0496101_0339673 Ga0496101_0339673_162_1169 331
957 3300048905 Ga0496102_0118725 Ga0496102_0118725_1338_2345 331
958 3300048905 Ga0496102_0136424 Ga0496102_0136424_1228_2235 331
959 3300048905 Ga0496102_0358283 Ga0496102_0358283_159_1166 331
960 3300048906 Ga0496103_0013406 Ga0496103_0013406_792_1799 331
961 3300048907 Ga0496104_0040743 Ga0496104_0040743_988_2010 331
962 3300048907 Ga0496104_0120356 Ga0496104_0120356_680_1687 331
963 3300048908 Ga0496105_0003511 Ga0496105_0003511_496_1518 331
964 3300048909 Ga0496106_0017437 Ga0496106_0017437_4200_5207 331
965 3300048909 Ga0496106_0087877 Ga0496106_0087877_1067_2113 331
966 3300048910 Ga0496107_0164054 Ga0496107_0164054_346_1353 331
967 3300048914 Ga0496111_0064659 Ga0496111_0064659_597_1619 331
968 3300048915 Ga0496112_0000014 Ga0496112_0000014_113563_114585 331
969 3300048915 Ga0496112_0027410 Ga0496112_0027410_3530_4552 331
970 3300048916 Ga0496113_0060287 Ga0496113_0060287_1331_2353 331
971 3300048916 Ga0496113_0069599 Ga0496113_0069599_1422_2429 331
972 3300048917 Ga0496114_0021665 Ga0496114_0021665_3928_4935 331
973 3300048917 Ga0496114_0160571 Ga0496114_0160571_468_1490 331
974 3300048918 Ga0496115_0024502 Ga0496115_0024502_2686_3693 331
975 3300048920 Ga0496117_0043929 Ga0496117_0043929_1861_2868 331
976 3300048921 Ga0496118_0014127 Ga0496118_0014127_3529_4536 331
977 3300048921 Ga0496118_0067240 Ga0496118_0067240_798_1820 331
978 3300048922 Ga0496119_0008920 Ga0496119_0008920_2414_3436 331
979 3300048922 Ga0496119_0033397 Ga0496119_0033397_2200_3222 331
980 3300048924 Ga0496121_0024554 Ga0496121_0024554_467_1474 331
981 3300048925 Ga0496122_0164388 Ga0496122_0164388_114_1121 331
982 3300048927 Ga0496124_0030911 Ga0496124_0030911_1682_2689 331
983 3300048927 Ga0496124_0263794 Ga0496124_0263794_146_1168 331
984 3300048928 Ga0496125_0028676 Ga0496125_0028676_2274_3281 331
985 3300048928 Ga0496125_0185643 Ga0496125_0185643_348_1355 331
986 3300048929 Ga0496126_0009508 Ga0496126_0009508_1558_2565 331
987 3300049571 Ga0501034_0054939 Ga0501034_0054939_1311_2321 331
988 3300050489 nmdc:mga03683_27707_c1 nmdc:mga03683_27707_c1_433_1452 331
989 3300050491 nmdc:mga00v17_52854_c1 nmdc:mga00v17_52854_c1_660_1667 331
990 3300050491 nmdc:mga00v17_86883_c1 nmdc:mga00v17_86883_c1_612_1619 331
991 3300050492 nmdc:mga0yw44_227812_c1 nmdc:mga0yw44_227812_c1_190_1197 331
992 3300050493 nmdc:mga0k408_12101_c1 nmdc:mga0k408_12101_c1_1893_2912 331
993 3300050493 nmdc:mga0k408_176748_c1 nmdc:mga0k408_176748_c1_93_1100 331
994 3300050493 nmdc:mga0k408_20184_c1 nmdc:mga0k408_20184_c1_1435_2454 331
995 3300050493 nmdc:mga0k408_51178_c1 nmdc:mga0k408_51178_c1_221_1261 331
996 3300050494 nmdc:mga06z11_31136_c1 nmdc:mga06z11_31136_c1_595_1614 331
997 3300050495 nmdc:mga04h51_29754_c1 nmdc:mga04h51_29754_c1_115_1122 331
998 3300050496 nmdc:mga07m45_135609_c1 nmdc:mga07m45_135609_c1_229_1236 331
999 3300050496 nmdc:mga07m45_39087_c1 nmdc:mga07m45_39087_c1_744_1751 331
1000 3300050507 nmdc:mga05p37_138555_c1 nmdc:mga05p37_138555_c1_1664_2671 331
1001 3300050516 nmdc:mga0sz30_78734_c1 nmdc:mga0sz30_78734_c1_229_1236 331
1002 3300053077 Ga0495601_0235688 Ga0495601_0235688_106_1113 331
1003 3300053080 Ga0500635_0008596 Ga0500635_0008596_146_1153 331
1004 3300053083 Ga0495655_0041228 Ga0495655_0041228_60_1067 331
1005 3300053085 Ga0495619_0008105 Ga0495619_0008105_2689_3711 331
1006 3300053086 Ga0500578_0072449 Ga0500578_0072449_730_1737 331
1007 3300053086 Ga0500578_0106240 Ga0500578_0106240_474_1481 331
1008 3300053087 Ga0500643_015020 Ga0500643_015020_205_1227 331
1009 3300053088 Ga0500644_0048799 Ga0500644_0048799_275_1297 331
1010 3300053092 Ga0500583_0014268 Ga0500583_0014268_98_1120 331
1011 3300053092 Ga0500583_0048694 Ga0500583_0048694_852_1874 331
1012 3300053092 Ga0500583_0141805 Ga0500583_0141805_174_1181 331
1013 3300053093 Ga0500651_0215545 Ga0500651_0215545_29_1036 331
1014 3300053096 Ga0500641_0019800 Ga0500641_0019800_782_1804 331
1015 3300053102 Ga0500554_000799 Ga0500554_000799_5167_6174 331
1016 3300053108 Ga0500562_005782 Ga0500562_005782_365_1372 331
1017 3300053119 Ga0500595_001031 Ga0500595_001031_12548_13555 331
1018 3300053119 Ga0500595_033517 Ga0500595_033517_267_1289 331
1019 3300053130 Ga0500642_0006746 Ga0500642_0006746_1410_2432 331
1020 3300053134 Ga0500658_0003506 Ga0500658_0003506_1722_2741 331
1021 3300053134 Ga0500658_0040891 Ga0500658_0040891_40_1047 331
1022 3300053136 Ga0500559_0007867 Ga0500559_0007867_3203_4210 331
1023 3300053136 Ga0500559_0083909 Ga0500559_0083909_198_1205 331
1024 3300053140 Ga0500573_0050258 Ga0500573_0050258_541_1548 331
1025 3300053142 Ga0500577_0021519 Ga0500577_0021519_1045_2052 331
1026 3300053148 Ga0500590_048803 Ga0500590_048803_962_1969 331
1027 3300053150 Ga0500603_000821 Ga0500603_000821_1729_2736 331
1028 3300053156 Ga0500622_0003724 Ga0500622_0003724_1018_2025 331
1029 3300053158 Ga0500627_0033050 Ga0500627_0033050_293_1315 331
1030 3300053163 Ga0500639_073864 Ga0500639_073864_15_1037 331
1031 3300053177 Ga0500636_0015436 Ga0500636_0015436_1966_2973 331
1032 3300053177 Ga0500636_0110373 Ga0500636_0110373_527_1534 331
1033 3300053177 Ga0500636_0140310 Ga0500636_0140310_86_1093 331
1034 3300053178 Ga0500637_0002825 Ga0500637_0002825_5159_6166 331
1035 3300053178 Ga0500637_0149103 Ga0500637_0149103_145_1152 331
1036 3300053730 Ga0500645_016719 Ga0500645_016719_731_1777 331
1037 3300053731 Ga0500609_006213 Ga0500609_006213_62_1069 331
1038 3300053736 Ga0500599_000221 Ga0500599_000221_2823_3830 331
1039 3300053737 Ga0500601_000130 Ga0500601_000130_11035_12057 331
1040 3300055283 Ga0500661_004632 Ga0500661_004632_1460_2482 331
1041 3300055283 Ga0500661_010201 Ga0500661_010201_344_1366 331
1042 3300002705 JGI25156J39149_1000240 JGI25156J39149_100024015 332
1043 3300002738 JGI25154J39366_1000445 JGI25154J39366_10004458 332
1044 3300002741 JGI25157J39369_1000148 JGI25157J39369_100014815 332
1045 3300003752 Ga0055539_1002041 Ga0055539_10020412 332
1046 3300003752 Ga0055539_1003138 Ga0055539_10031382 332
1047 3300003756 Ga0055533_1000016 Ga0055533_1000016223 332
1048 3300003759 Ga0055525_1002495 Ga0055525_10024952 332
1049 3300005327 Ga0070658_10044005 Ga0070658_100440054 332
1050 3300005338 Ga0068868_100124026 Ga0068868_1001240262 332
1051 3300005347 Ga0070668_100087753 Ga0070668_1000877532 332
1052 3300005364 Ga0070673_100005668 Ga0070673_1000056687 332
1053 3300005366 Ga0070659_100294127 Ga0070659_1002941272 332
1054 3300005367 Ga0070667_100018497 Ga0070667_1000184971 332
1055 3300005439 Ga0070711_100033655 Ga0070711_1000336554 332
1056 3300005457 Ga0070662_100010779 Ga0070662_1000107793 332
1057 3300005459 Ga0068867_100000020 Ga0068867_10000002031 332
1058 3300005467 Ga0070706_100000873 Ga0070706_10000087323 332
1059 3300005548 Ga0070665_100283770 Ga0070665_1002837702 332
1060 3300005563 Ga0068855_100062837 Ga0068855_1000628374 332
1061 3300005577 Ga0068857_100011076 Ga0068857_1000110764 332
1062 3300005578 Ga0068854_100018998 Ga0068854_1000189985 332
1063 3300005614 Ga0068856_100008374 Ga0068856_1000083749 332
1064 3300005617 Ga0068859_100057158 Ga0068859_1000571582 332
1065 3300005617 Ga0068859_100228755 Ga0068859_1002287552 332
1066 3300005618 Ga0068864_100009044 Ga0068864_1000090443 332
1067 3300005843 Ga0068860_100100810 Ga0068860_1001008103 332
1068 3300005844 Ga0068862_100016461 Ga0068862_1000164616 332
1069 3300006178 Ga0075367_10041835 Ga0075367_100418352 332
1070 3300006195 Ga0075366_10009032 Ga0075366_100090325 332
1071 3300006195 Ga0075366_10026168 Ga0075366_100261682 332
1072 3300006353 Ga0075370_10002403 Ga0075370_100024032 332
1073 3300006353 Ga0075370_10033493 Ga0075370_100334932 332
1074 3300006353 Ga0075370_10066745 Ga0075370_100667452 332
1075 3300006931 Ga0097620_100057158 Ga0097620_1000571585 332
1076 3300006931 Ga0097620_100228753 Ga0097620_1002287532 332
1077 3300009098 Ga0105245_10277391 Ga0105245_102773912 332
1078 3300009147 Ga0114129_10332294 Ga0114129_103322943 332
1079 3300009148 Ga0105243_10045659 Ga0105243_100456593 332
1080 3300009148 Ga0105243_10347435 Ga0105243_103474352 332
1081 3300009174 Ga0105241_10007024 Ga0105241_100070248 332
1082 3300009545 Ga0105237_10157199 Ga0105237_101571992 332
1083 3300009551 Ga0105238_10016113 Ga0105238_100161137 332
1084 3300010375 Ga0105239_10035550 Ga0105239_100355502 332
1085 3300013306 Ga0163162_10134352 Ga0163162_101343523 332
1086 3300013306 Ga0163162_10277471 Ga0163162_102774711 332
1087 3300014745 Ga0157377_10000032 Ga0157377_1000003211 332
1088 3300014968 Ga0157379_10092466 Ga0157379_100924662 332
1089 3300015683 Ga0183362_10002 Ga0183362_10002337 332
1090 3300025226 Ga0209674_100041 Ga0209674_100041161 332
1091 3300025230 Ga0209563_100043 Ga0209563_100043161 332
1092 3300025246 Ga0209646_1000069 Ga0209646_1000069130 332
1093 3300025250 Ga0209026_1000006 Ga0209026_1000006225 332
1094 3300025253 Ga0209677_100212 Ga0209677_10021235 332
1095 3300025253 Ga0209677_101117 Ga0209677_1011175 332
1096 3300025256 Ga0209759_1000075 Ga0209759_1000075130 332
1097 3300025256 Ga0209759_1000691 Ga0209759_100069116 332
1098 3300025909 Ga0207705_10012116 Ga0207705_100121166 332
1099 3300025910 Ga0207684_10003492 Ga0207684_1000349210 332
1100 3300025916 Ga0207663_10030257 Ga0207663_100302574 332
1101 3300025920 Ga0207649_10108412 Ga0207649_101084122 332
1102 3300025924 Ga0207694_10005548 Ga0207694_100055484 332
1103 3300025927 Ga0207687_10144716 Ga0207687_101447161 332
1104 3300025933 Ga0207706_10000266 Ga0207706_1000026650 332
1105 3300025935 Ga0207709_10000641 Ga0207709_1000064127 332
1106 3300025949 Ga0207667_10033492 Ga0207667_100334926 332
1107 3300025949 Ga0207667_10124871 Ga0207667_101248713 332
1108 3300025960 Ga0207651_10002064 Ga0207651_100020645 332
1109 3300025972 Ga0207668_10078537 Ga0207668_100785372 332
1110 3300025981 Ga0207640_10013803 Ga0207640_100138035 332
1111 3300025986 Ga0207658_10002081 Ga0207658_1000208114 332
1112 3300026023 Ga0207677_10034058 Ga0207677_100340583 332
1113 3300026078 Ga0207702_10000942 Ga0207702_1000094217 332
1114 3300026088 Ga0207641_10067734 Ga0207641_100677342 332
1115 3300026089 Ga0207648_10000172 Ga0207648_1000017258 332
1116 3300026116 Ga0207674_10001181 Ga0207674_1000118118 332
1117 3300028381 Ga0268264_10089984 Ga0268264_100899843 332
1118 3300028786 Ga0307517_10001469 Ga0307517_1000146919 332
1119 3300028786 Ga0307517_10067186 Ga0307517_100671863 332
1120 3300028786 Ga0307517_10083974 Ga0307517_100839742 332
1121 3300028794 Ga0307515_10000131 Ga0307515_1000013185 332
1122 3300028794 Ga0307515_10005390 Ga0307515_1000539017 332
1123 3300028794 Ga0307515_10054084 Ga0307515_100540845 332
1124 3300028794 Ga0307515_10134875 Ga0307515_101348752 332
1125 3300030522 Ga0307512_10089762 Ga0307512_100897622 332
1126 3300031456 Ga0307513_10064413 Ga0307513_100644134 332
1127 3300031507 Ga0307509_10003237 Ga0307509_100032377 332
1128 3300031507 Ga0307509_10017777 Ga0307509_100177776 332
1129 3300031616 Ga0307508_10024170 Ga0307508_100241702 332
1130 3300031616 Ga0307508_10042436 Ga0307508_100424363 332
1131 3300031730 Ga0307516_10000340 Ga0307516_1000034030 332
1132 3300031730 Ga0307516_10000763 Ga0307516_1000076328 332
1133 3300031730 Ga0307516_10004925 Ga0307516_1000492514 332
1134 3300031730 Ga0307516_10099875 Ga0307516_100998753 332
1135 3300031730 Ga0307516_10209948 Ga0307516_102099482 332
1136 3300031730 Ga0307516_10294053 Ga0307516_102940532 332
1137 3300033180 Ga0307510_10015834 Ga0307510_100158343 332
1138 3300033180 Ga0307510_10065142 Ga0307510_100651423 332
1139 3300033180 Ga0307510_10150234 Ga0307510_101502342 332
1140 3300035691 Ga0373931_0056434 Ga0373931_0056434_879_1907 332
1141 3300037068 Ga0373925_0066579 Ga0373925_0066579_1026_2075 332
1142 3300037466 Ga0395898_0005706 Ga0395898_0005706_7942_8952 332
1143 3300037466 Ga0395898_0524861 Ga0395898_0524861_45_1058 332
1144 3300037471 Ga0395905_0128258 Ga0395905_0128258_78_1088 332
1145 3300038443 Ga0395901_0117974 Ga0395901_0117974_391_1401 332
1146 3300042012 Ga0439455_0022643 Ga0439455_0022643_247_1260 332
1147 3300042435 Ga0439434_0012357 Ga0439434_0012357_1040_2053 332
1148 3300044656 Ga0466969_0004520 Ga0466969_0004520_492_1502 332
1149 3300044656 Ga0466969_0006057 Ga0466969_0006057_1686_2696 332
1150 3300044658 Ga0466972_0003740 Ga0466972_0003740_2716_3726 332
1151 3300044683 Ga0466965_0021534 Ga0466965_0021534_2028_3038 332
1152 3300044683 Ga0466965_0048964 Ga0466965_0048964_999_2009 332
1153 3300044684 Ga0466966_0028270 Ga0466966_0028270_419_1429 332
1154 3300044693 Ga0466961_0014145 Ga0466961_0014145_3325_4335 332
1155 3300044719 Ga0466971_0011456 Ga0466971_0011456_907_1917 332
1156 3300044842 Ga0466957_0090030 Ga0466957_0090030_103_1113 332
1157 3300045049 Ga0466959_0045172 Ga0466959_0045172_714_1724 332
1158 3300045049 Ga0466959_0102897 Ga0466959_0102897_314_1324 332
1159 3300046454 Ga0495592_0000205 Ga0495592_0000205_10739_11767 332
1160 3300046519 Ga0495632_0112571 Ga0495632_0112571_49_1077 332
1161 3300046683 Ga0495658_0038641 Ga0495658_0038641_1503_2540 332
1162 3300046690 Ga0495624_0025173 Ga0495624_0025173_1468_2496 332
1163 3300047321 Ga0495676_0178316 Ga0495676_0178316_285_1334 332
1164 3300047472 Ga0495686_0066067 Ga0495686_0066067_109_1137 332
1165 3300047673 Ga0495593_0019616 Ga0495593_0019616_1430_2458 332
1166 3300048903 Ga0496100_0007356 Ga0496100_0007356_1429_2478 332
1167 3300048905 Ga0496102_0215676 Ga0496102_0215676_585_1619 332
1168 3300048909 Ga0496106_0034749 Ga0496106_0034749_788_1837 332
1169 3300048915 Ga0496112_0047474 Ga0496112_0047474_1668_2705 332
1170 3300048918 Ga0496115_0080729 Ga0496115_0080729_1235_2284 332
1171 3300050493 nmdc:mga0k408_127338_c1 nmdc:mga0k408_127338_c1_138_1175 332
1172 3300050493 nmdc:mga0k408_9111_c1 nmdc:mga0k408_9111_c1_3388_4419 332
1173 3300050494 nmdc:mga06z11_180329_c1 nmdc:mga06z11_180329_c1_111_1142 332
1174 3300050496 nmdc:mga07m45_6449_c1 nmdc:mga07m45_6449_c1_1369_2406 332
1175 3300053136 Ga0500559_0000339 Ga0500559_0000339_18463_19491 332
1176 3300053139 Ga0500568_0000019 Ga0500568_0000019_128245_129258 332
1177 3300053153 Ga0500616_0029175 Ga0500616_0029175_490_1503 332
1178 3300053156 Ga0500622_0001202 Ga0500622_0001202_6379_7407 332
1179 3300053156 Ga0500622_0004961 Ga0500622_0004961_350_1363 332
1180 3300053177 Ga0500636_0006447 Ga0500636_0006447_2637_3650 332
1181 3300003203 JGI25406J46586_10000039 JGI25406J46586_1000003922 333
1182 3300003203 JGI25406J46586_10067282 JGI25406J46586_100672821 333
1183 3300003659 JGI25404J52841_10000800 JGI25404J52841_100008007 333
1184 3300003659 JGI25404J52841_10002033 JGI25404J52841_100020332 333
1185 3300003659 JGI25404J52841_10003979 JGI25404J52841_100039791 333
1186 3300003761 Ga0055535_1000107 Ga0055535_100010728 333
1187 3300003763 Ga0055529_1000111 Ga0055529_100011149 333
1188 3300005295 Ga0065707_10085391 Ga0065707_100853916 333
1189 3300005328 Ga0070676_10097288 Ga0070676_100972882 333
1190 3300005329 Ga0070683_100002714 Ga0070683_1000027148 333
1191 3300005330 Ga0070690_100007969 Ga0070690_1000079692 333
1192 3300005331 Ga0070670_100182508 Ga0070670_1001825082 333
1193 3300005336 Ga0070680_100194056 Ga0070680_1001940562 333
1194 3300005338 Ga0068868_100108684 Ga0068868_1001086842 333
1195 3300005340 Ga0070689_100119364 Ga0070689_1001193642 333
1196 3300005343 Ga0070687_100078258 Ga0070687_1000782582 333
1197 3300005353 Ga0070669_100020965 Ga0070669_1000209652 333
1198 3300005354 Ga0070675_100103891 Ga0070675_1001038912 333
1199 3300005355 Ga0070671_100086573 Ga0070671_1000865732 333
1200 3300005355 Ga0070671_100096269 Ga0070671_1000962692 333
1201 3300005356 Ga0070674_100042949 Ga0070674_1000429492 333
1202 3300005356 Ga0070674_100046627 Ga0070674_1000466272 333
1203 3300005364 Ga0070673_100106792 Ga0070673_1001067922 333
1204 3300005366 Ga0070659_100336457 Ga0070659_1003364572 333
1205 3300005367 Ga0070667_100170212 Ga0070667_1001702122 333
1206 3300005434 Ga0070709_10000575 Ga0070709_1000057517 333
1207 3300005435 Ga0070714_100009073 Ga0070714_1000090731 333
1208 3300005436 Ga0070713_100151247 Ga0070713_1001512472 333
1209 3300005437 Ga0070710_10000123 Ga0070710_100001236 333
1210 3300005437 Ga0070710_10054385 Ga0070710_100543852 333
1211 3300005437 Ga0070710_10185662 Ga0070710_101856621 333
1212 3300005438 Ga0070701_10011581 Ga0070701_100115812 333
1213 3300005439 Ga0070711_100122509 Ga0070711_1001225092 333
1214 3300005439 Ga0070711_100298814 Ga0070711_1002988142 333
1215 3300005445 Ga0070708_100304506 Ga0070708_1003045062 333
1216 3300005456 Ga0070678_100084055 Ga0070678_1000840552 333
1217 3300005457 Ga0070662_100254098 Ga0070662_1002540982 333
1218 3300005458 Ga0070681_10018273 Ga0070681_100182738 333
1219 3300005467 Ga0070706_100041721 Ga0070706_1000417215 333
1220 3300005468 Ga0070707_100333171 Ga0070707_1003331712 333
1221 3300005530 Ga0070679_100016076 Ga0070679_1000160769 333
1222 3300005535 Ga0070684_100102819 Ga0070684_1001028192 333
1223 3300005536 Ga0070697_100043563 Ga0070697_1000435632 333
1224 3300005539 Ga0068853_100319522 Ga0068853_1003195222 333
1225 3300005543 Ga0070672_100325557 Ga0070672_1003255572 333
1226 3300005546 Ga0070696_100112187 Ga0070696_1001121872 333
1227 3300005548 Ga0070665_100059073 Ga0070665_1000590732 333
1228 3300005548 Ga0070665_100103789 Ga0070665_1001037894 333
1229 3300005549 Ga0070704_100086022 Ga0070704_1000860222 333
1230 3300005618 Ga0068864_100014213 Ga0068864_1000142137 333
1231 3300005844 Ga0068862_100045044 Ga0068862_1000450445 333
1232 3300005983 Ga0081540_1002129 Ga0081540_10021295 333
1233 3300005983 Ga0081540_1002161 Ga0081540_100216115 333
1234 3300005983 Ga0081540_1004467 Ga0081540_10044676 333
1235 3300005983 Ga0081540_1008340 Ga0081540_10083407 333
1236 3300005983 Ga0081540_1040261 Ga0081540_10402612 333
1237 3300005985 Ga0081539_10000169 Ga0081539_1000016967 333
1238 3300005985 Ga0081539_10002228 Ga0081539_1000222819 333
1239 3300005985 Ga0081539_10005221 Ga0081539_100052219 333
1240 3300005985 Ga0081539_10049362 Ga0081539_100493622 333
1241 3300006028 Ga0070717_10077650 Ga0070717_100776504 333
1242 3300006163 Ga0070715_10002302 Ga0070715_100023025 333
1243 3300006163 Ga0070715_10113009 Ga0070715_101130091 333
1244 3300006173 Ga0070716_100005823 Ga0070716_1000058237 333
1245 3300006173 Ga0070716_100027070 Ga0070716_1000270704 333
1246 3300006173 Ga0070716_100029446 Ga0070716_1000294462 333
1247 3300006175 Ga0070712_100102581 Ga0070712_1001025812 333
1248 3300006177 Ga0075362_10015634 Ga0075362_100156343 333
1249 3300006178 Ga0075367_10005414 Ga0075367_100054142 333
1250 3300006186 Ga0075369_10039800 Ga0075369_100398002 333
1251 3300006353 Ga0075370_10070577 Ga0075370_100705772 333
1252 3300006844 Ga0075428_100252329 Ga0075428_1002523292 333
1253 3300006847 Ga0075431_100012951 Ga0075431_1000129515 333
1254 3300006871 Ga0075434_100096581 Ga0075434_1000965812 333
1255 3300006871 Ga0075434_100106770 Ga0075434_1001067702 333
1256 3300006931 Ga0097620_100316058 Ga0097620_1003160582 333
1257 3300006942 Ga0099824_1022176 Ga0099824_10221762 333
1258 3300006943 Ga0099822_1004906 Ga0099822_10049067 333
1259 3300009093 Ga0105240_10087196 Ga0105240_100871962 333
1260 3300009147 Ga0114129_10158707 Ga0114129_101587075 333
1261 3300009147 Ga0114129_10540748 Ga0114129_105407482 333
1262 3300009148 Ga0105243_10268527 Ga0105243_102685272 333
1263 3300009177 Ga0105248_10174058 Ga0105248_101740582 333
1264 3300009177 Ga0105248_10465627 Ga0105248_104656272 333
1265 3300009545 Ga0105237_10029825 Ga0105237_100298256 333
1266 3300009545 Ga0105237_10085828 Ga0105237_100858284 333
1267 3300009545 Ga0105237_10250045 Ga0105237_102500452 333
1268 3300009551 Ga0105238_10208998 Ga0105238_102089982 333
1269 3300010375 Ga0105239_10093933 Ga0105239_100939332 333
1270 3300010375 Ga0105239_10551399 Ga0105239_105513992 333
1271 3300013105 Ga0157369_10030554 Ga0157369_100305542 333
1272 3300013306 Ga0163162_10040094 Ga0163162_100400941 333
1273 3300013306 Ga0163162_10114327 Ga0163162_101143272 333
1274 3300013308 Ga0157375_10027966 Ga0157375_100279664 333
1275 3300014325 Ga0163163_10010972 Ga0163163_100109726 333
1276 3300014325 Ga0163163_10308697 Ga0163163_103086972 333
1277 3300014326 Ga0157380_10065010 Ga0157380_100650104 333
1278 3300014968 Ga0157379_10201601 Ga0157379_102016012 333
1279 3300021320 Ga0214544_1000013 Ga0214544_100001398 333
1280 3300021321 Ga0214542_1000013 Ga0214542_1000013136 333
1281 3300021324 Ga0214545_1000012 Ga0214545_100001299 333
1282 3300021327 Ga0214543_1000065 Ga0214543_100006594 333
1283 3300021358 Ga0213873_10000963 Ga0213873_100009633 333
1284 3300021384 Ga0213876_10002957 Ga0213876_100029577 333
1285 3300025228 Ga0209672_106802 Ga0209672_1068021 333
1286 3300025242 Ga0209258_100267 Ga0209258_10026728 333
1287 3300025254 Ga0209148_1000643 Ga0209148_100064321 333
1288 3300025256 Ga0209759_1000951 Ga0209759_100095118 333
1289 3300025256 Ga0209759_1006433 Ga0209759_10064334 333
1290 3300025261 Ga0209233_1016614 Ga0209233_10166142 333
1291 3300025272 Ga0209455_1000158 Ga0209455_100015846 333
1292 3300025898 Ga0207692_10001920 Ga0207692_100019206 333
1293 3300025898 Ga0207692_10004113 Ga0207692_100041136 333
1294 3300025906 Ga0207699_10005809 Ga0207699_100058092 333
1295 3300025906 Ga0207699_10080639 Ga0207699_100806392 333
1296 3300025907 Ga0207645_10111369 Ga0207645_101113692 333
1297 3300025912 Ga0207707_10020086 Ga0207707_100200862 333
1298 3300025914 Ga0207671_10018145 Ga0207671_100181452 333
1299 3300025915 Ga0207693_10006626 Ga0207693_100066267 333
1300 3300025915 Ga0207693_10022713 Ga0207693_100227135 333
1301 3300025916 Ga0207663_10000075 Ga0207663_1000007532 333
1302 3300025918 Ga0207662_10092474 Ga0207662_100924742 333
1303 3300025921 Ga0207652_10027465 Ga0207652_100274653 333
1304 3300025923 Ga0207681_10015333 Ga0207681_100153335 333
1305 3300025926 Ga0207659_10089124 Ga0207659_100891242 333
1306 3300025928 Ga0207700_10102267 Ga0207700_101022672 333
1307 3300025928 Ga0207700_10128828 Ga0207700_101288282 333
1308 3300025928 Ga0207700_10351537 Ga0207700_103515372 333
1309 3300025929 Ga0207664_10037837 Ga0207664_100378375 333
1310 3300025929 Ga0207664_10147166 Ga0207664_101471662 333
1311 3300025931 Ga0207644_10013240 Ga0207644_100132402 333
1312 3300025931 Ga0207644_10028664 Ga0207644_100286643 333
1313 3300025932 Ga0207690_10185089 Ga0207690_101850892 333
1314 3300025933 Ga0207706_10096803 Ga0207706_100968032 333
1315 3300025937 Ga0207669_10034479 Ga0207669_100344792 333
1316 3300025939 Ga0207665_10001949 Ga0207665_100019499 333
1317 3300025939 Ga0207665_10007226 Ga0207665_100072262 333
1318 3300025940 Ga0207691_10111908 Ga0207691_101119082 333
1319 3300025941 Ga0207711_10365190 Ga0207711_103651902 333
1320 3300025942 Ga0207689_10008082 Ga0207689_100080826 333
1321 3300025944 Ga0207661_10000703 Ga0207661_1000070312 333
1322 3300025960 Ga0207651_10065970 Ga0207651_100659702 333
1323 3300025972 Ga0207668_10105696 Ga0207668_101056962 333
1324 3300026035 Ga0207703_10022170 Ga0207703_100221706 333
1325 3300026035 Ga0207703_10077650 Ga0207703_100776504 333
1326 3300026035 Ga0207703_10369499 Ga0207703_103694992 333
1327 3300026118 Ga0207675_100087869 Ga0207675_1000878692 333
1328 3300026142 Ga0207698_10016114 Ga0207698_100161142 333
1329 3300027296 Ga0209389_1000100 Ga0209389_100010072 333
1330 3300027296 Ga0209389_1000181 Ga0209389_100018128 333
1331 3300027357 Ga0209589_1000042 Ga0209589_100004261 333
1332 3300027357 Ga0209589_1000092 Ga0209589_100009283 333
1333 3300027361 Ga0209489_100006 Ga0209489_100006540 333
1334 3300027361 Ga0209489_100095 Ga0209489_10009561 333
1335 3300027361 Ga0209489_103729 Ga0209489_10372918 333
1336 3300027363 Ga0209700_100005 Ga0209700_100005410 333
1337 3300027363 Ga0209700_100095 Ga0209700_10009561 333
1338 3300027866 Ga0209813_10024127 Ga0209813_100241272 333
1339 3300027907 Ga0207428_10119704 Ga0207428_101197042 333
1340 3300028379 Ga0268266_10047223 Ga0268266_100472232 333
1341 3300028379 Ga0268266_10170082 Ga0268266_101700822 333
1342 3300028380 Ga0268265_10031405 Ga0268265_100314052 333
1343 3300031235 Ga0265330_10015050 Ga0265330_100150502 333
1344 3300031239 Ga0265328_10029354 Ga0265328_100293542 333
1345 3300031250 Ga0265331_10001729 Ga0265331_1000172912 333
1346 3300031251 Ga0265327_10003742 Ga0265327_1000374217 333
1347 3300031595 Ga0265313_10000543 Ga0265313_1000054319 333
1348 3300031616 Ga0307508_10005913 Ga0307508_1000591312 333
1349 3300031616 Ga0307508_10083431 Ga0307508_100834313 333
1350 3300031711 Ga0265314_10042749 Ga0265314_100427495 333
1351 3300031730 Ga0307516_10001388 Ga0307516_1000138821 333
1352 3300033180 Ga0307510_10077966 Ga0307510_100779662 333
1353 3300035113 Ga0373936_0013378 Ga0373936_0013378_1626_2666 333
1354 3300035118 Ga0373954_0071625 Ga0373954_0071625_345_1370 333
1355 3300035119 Ga0373956_0028669 Ga0373956_0028669_1236_2261 333
1356 3300035120 Ga0373957_0004249 Ga0373957_0004249_619_1644 333
1357 3300035172 Ga0373955_0195537 Ga0373955_0195537_164_1189 333
1358 3300035695 Ga0373927_0011073 Ga0373927_0011073_351_1376 333
1359 3300035695 Ga0373927_0124627 Ga0373927_0124627_448_1464 333
1360 3300035724 Ga0373933_0009186 Ga0373933_0009186_2121_3146 333
1361 3300037471 Ga0395905_0062295 Ga0395905_0062295_467_1486 333
1362 3300038443 Ga0395901_0019109 Ga0395901_0019109_4368_5393 333
1363 3300039437 Ga0436365_0954239 Ga0436365_0954239_11127_12152 333
1364 3300039437 Ga0436365_1290035 Ga0436365_1290035_1046_2062 333
1365 3300039438 Ga0436360_0323156 Ga0436360_0323156_12_1037 333
1366 3300039438 Ga0436360_1001325 Ga0436360_1001325_15982_16998 333
1367 3300039447 Ga0436361_0086639 Ga0436361_0086639_430_1464 333
1368 3300039447 Ga0436361_0613754 Ga0436361_0613754_1108_2133 333
1369 3300039447 Ga0436361_0768335 Ga0436361_0768335_706_1749 333
1370 3300039447 Ga0436361_0833528 Ga0436361_0833528_13_1053 333
1371 3300039450 Ga0436363_0715786 Ga0436363_0715786_81_1106 333
1372 3300039453 Ga0436362_0022522 Ga0436362_0022522_1997_3022 333
1373 3300039453 Ga0436362_0952674 Ga0436362_0952674_971_2032 333
1374 3300044658 Ga0466972_0000169 Ga0466972_0000169_7354_8379 333
1375 3300044658 Ga0466972_0060985 Ga0466972_0060985_196_1224 333
1376 3300044706 Ga0466964_0041685 Ga0466964_0041685_600_1625 333
1377 3300045976 Ga0466967_0029802 Ga0466967_0029802_2203_3225 333
1378 3300046454 Ga0495592_0013147 Ga0495592_0013147_3209_4234 333
1379 3300046459 Ga0495629_0022831 Ga0495629_0022831_30_1055 333
1380 3300046460 Ga0495638_0019761 Ga0495638_0019761_873_1895 333
1381 3300046462 Ga0495651_0044409 Ga0495651_0044409_1033_2058 333
1382 3300046463 Ga0495653_0001607 Ga0495653_0001607_4635_5660 333
1383 3300046463 Ga0495653_0234911 Ga0495653_0234911_101_1126 333
1384 3300046471 Ga0495650_0066156 Ga0495650_0066156_123_1157 333
1385 3300046514 Ga0495618_0009795 Ga0495618_0009795_2701_3726 333
1386 3300046516 Ga0495628_0010408 Ga0495628_0010408_3087_4112 333
1387 3300046522 Ga0495643_0048728 Ga0495643_0048728_182_1216 333
1388 3300046529 Ga0495652_0202693 Ga0495652_0202693_384_1409 333
1389 3300046533 Ga0495640_0008697 Ga0495640_0008697_439_1464 333
1390 3300046536 Ga0495587_0004784 Ga0495587_0004784_3143_4168 333
1391 3300046536 Ga0495587_0055034 Ga0495587_0055034_1179_2204 333
1392 3300046559 Ga0495667_0013207 Ga0495667_0013207_2416_3441 333
1393 3300046663 Ga0495635_0001417 Ga0495635_0001417_6474_7499 333
1394 3300046675 Ga0495657_0025951 Ga0495657_0025951_884_1909 333
1395 3300046678 Ga0495599_0002969 Ga0495599_0002969_3509_4534 333
1396 3300046680 Ga0495646_0009311 Ga0495646_0009311_4267_5292 333
1397 3300046690 Ga0495624_0112737 Ga0495624_0112737_164_1189 333
1398 3300047317 Ga0495604_0002111 Ga0495604_0002111_13345_14370 333
1399 3300047319 Ga0495674_0000145 Ga0495674_0000145_35506_36531 333
1400 3300047319 Ga0495674_0311552 Ga0495674_0311552_166_1191 333
1401 3300047322 Ga0495680_0001309 Ga0495680_0001309_4956_5981 333
1402 3300047471 Ga0495684_0058496 Ga0495684_0058496_1633_2658 333
1403 3300047673 Ga0495593_0035124 Ga0495593_0035124_239_1264 333
1404 3300048088 Ga0495602_0017266 Ga0495602_0017266_3350_4375 333
1405 3300048905 Ga0496102_0031230 Ga0496102_0031230_2316_3362 333
1406 3300048907 Ga0496104_0026918 Ga0496104_0026918_4155_5171 333
1407 3300048907 Ga0496104_0188476 Ga0496104_0188476_508_1524 333
1408 3300048909 Ga0496106_0028680 Ga0496106_0028680_1681_2727 333
1409 3300048909 Ga0496106_0053808 Ga0496106_0053808_578_1600 333
1410 3300048911 Ga0496108_0102405 Ga0496108_0102405_1303_2340 333
1411 3300048912 Ga0496109_0013281 Ga0496109_0013281_3800_4837 333
1412 3300048912 Ga0496109_0138740 Ga0496109_0138740_1073_2098 333
1413 3300048913 Ga0496110_0031842 Ga0496110_0031842_2913_3929 333
1414 3300048913 Ga0496110_0082619 Ga0496110_0082619_1792_2838 333
1415 3300048913 Ga0496110_0197274 Ga0496110_0197274_385_1422 333
1416 3300048914 Ga0496111_0010126 Ga0496111_0010126_4093_5109 333
1417 3300048915 Ga0496112_0007451 Ga0496112_0007451_4878_5915 333
1418 3300048915 Ga0496112_0026585 Ga0496112_0026585_2586_3632 333
1419 3300048915 Ga0496112_0034872 Ga0496112_0034872_1313_2338 333
1420 3300048915 Ga0496112_0116204 Ga0496112_0116204_661_1677 333
1421 3300048915 Ga0496112_0272275 Ga0496112_0272275_392_1414 333
1422 3300048918 Ga0496115_0044864 Ga0496115_0044864_874_1890 333
1423 3300048922 Ga0496119_0000993 Ga0496119_0000993_1701_2732 333
1424 3300048925 Ga0496122_0012125 Ga0496122_0012125_1737_2768 333
1425 3300048926 Ga0496123_0002663 Ga0496123_0002663_19279_20310 333
1426 3300048929 Ga0496126_0200201 Ga0496126_0200201_285_1307 333
1427 3300050494 nmdc:mga06z11_10232_c1 nmdc:mga06z11_10232_c1_933_1961 333
1428 3300050495 nmdc:mga04h51_19713_c1 nmdc:mga04h51_19713_c1_498_1520 333
1429 3300050496 nmdc:mga07m45_96423_c1 nmdc:mga07m45_96423_c1_236_1258 333
1430 3300050507 nmdc:mga05p37_134523_c1 nmdc:mga05p37_134523_c1_174_1199 333
1431 3300050511 nmdc:mga08y16_14550_c1 nmdc:mga08y16_14550_c1_6588_7619 333
1432 3300050514 nmdc:mga08x19_153720_c1 nmdc:mga08x19_153720_c1_501_1520 333
1433 3300053077 Ga0495601_0015307 Ga0495601_0015307_1369_2394 333
1434 3300053077 Ga0495601_0019287 Ga0495601_0019287_934_1959 333
1435 3300053078 Ga0495612_0002548 Ga0495612_0002548_3798_4823 333
1436 3300053078 Ga0495612_0124159 Ga0495612_0124159_43_1068 333
1437 3300053084 Ga0495595_0000442 Ga0495595_0000442_8421_9446 333
1438 3300053085 Ga0495619_0006616 Ga0495619_0006616_165_1190 333
1439 3300053104 Ga0500556_0000148 Ga0500556_0000148_45871_46902 333
1440 3300053119 Ga0500595_000302 Ga0500595_000302_29750_30760 333
1441 3300053134 Ga0500658_0039319 Ga0500658_0039319_762_1772 333
1442 3300053142 Ga0500577_0012546 Ga0500577_0012546_792_1802 333
1443 3300053153 Ga0500616_0014978 Ga0500616_0014978_1341_2369 333
1444 iso_pu_bacteria 3005587118 3005587588 333
1445 3300005367 Ga0070667_100029096 Ga0070667_1000290963 334
1446 3300005457 Ga0070662_100207951 Ga0070662_1002079512 334
1447 3300005548 Ga0070665_100117997 Ga0070665_1001179972 334
1448 3300009553 Ga0105249_10288633 Ga0105249_102886332 334
1449 3300013306 Ga0163162_10041475 Ga0163162_100414753 334
1450 3300013308 Ga0157375_10191451 Ga0157375_101914512 334
1451 3300014497 Ga0182008_10002327 Ga0182008_1000232714 334
1452 3300015261 Ga0182006_1052068 Ga0182006_10520682 334
1453 3300015262 Ga0182007_10001161 Ga0182007_100011614 334
1454 3300017792 Ga0163161_10025674 Ga0163161_100256743 334
1455 3300025903 Ga0207680_10064483 Ga0207680_100644832 334
1456 3300025933 Ga0207706_10205795 Ga0207706_102057952 334
1457 3300025961 Ga0207712_10247137 Ga0207712_102471372 334
1458 3300025981 Ga0207640_10062328 Ga0207640_100623282 334
1459 3300026121 Ga0207683_10064742 Ga0207683_100647424 334
1460 3300026121 Ga0207683_10099317 Ga0207683_100993173 334
1461 3300031548 Ga0307408_100032090 Ga0307408_1000320903 334
1462 3300031731 Ga0307405_10018511 Ga0307405_100185113 334
1463 3300031903 Ga0307407_10039321 Ga0307407_100393212 334
1464 3300031911 Ga0307412_10072616 Ga0307412_100726163 334
1465 3300031995 Ga0307409_100001244 Ga0307409_1000012448 334
1466 3300032126 Ga0307415_100001555 Ga0307415_10000155510 334
1467 3300045051 Ga0451576_0089406 Ga0451576_0089406_1575_2636 334
1468 3300045976 Ga0466967_0003144 Ga0466967_0003144_7575_8594 334
1469 3300046459 Ga0495629_0111637 Ga0495629_0111637_495_1535 334
1470 3300048904 Ga0496101_0039289 Ga0496101_0039289_806_1846 334
1471 3300048905 Ga0496102_0002871 Ga0496102_0002871_9013_10053 334
1472 3300048906 Ga0496103_0019056 Ga0496103_0019056_151_1191 334
1473 3300048907 Ga0496104_0044319 Ga0496104_0044319_2169_3209 334
1474 3300048908 Ga0496105_0115655 Ga0496105_0115655_17_1057 334
1475 3300048909 Ga0496106_0054840 Ga0496106_0054840_301_1341 334
1476 3300048912 Ga0496109_0183572 Ga0496109_0183572_318_1358 334
1477 3300048913 Ga0496110_0109796 Ga0496110_0109796_319_1359 334
1478 3300048914 Ga0496111_0087657 Ga0496111_0087657_461_1501 334
1479 3300005337 Ga0070682_100234854 Ga0070682_1002348542 335
1480 3300009545 Ga0105237_10392256 Ga0105237_103922561 335
1481 3300009553 Ga0105249_10334152 Ga0105249_103341522 335
1482 3300025932 Ga0207690_10098147 Ga0207690_100981472 335
1483 3300045836 Ga0466958_0002017 Ga0466958_0002017_1719_2735 335
1484 iso_pu_bacteria 2510917014 2511100807 335
1485 iso_pu_bacteria 2510917015 2511107483 335
1486 iso_pu_bacteria 2513237082 2513556740 335
1487 iso_pu_bacteria 2513237083 2513564025 335
1488 iso_pu_bacteria 2515154122 2515685710 335
1489 iso_pu_bacteria 2526164713 2527076357 335
1490 iso_pu_bacteria 2902682994 2902688201 335
1491 iso_pu_bacteria 2904615490 2904624403 335
1492 iso_pu_bacteria 642555112 642598041 335
1493 iso_pu_bacteria 8003955200 8003960038 335
1494 3300005459 Ga0068867_100048095 Ga0068867_1000480952 336
1495 3300005578 Ga0068854_100101012 Ga0068854_1001010122 336
1496 3300025303 Ga0209051_1006237 Ga0209051_10062372 336
1497 3300026089 Ga0207648_10067027 Ga0207648_100670272 336
1498 3300010375 Ga0105239_10211349 Ga0105239_102113492 337
1499 3300037312 Ga0395899_0001949 Ga0395899_0001949_14351_15379 337
1500 3300037312 Ga0395899_0038828 Ga0395899_0038828_177_1205 337
1501 3300037418 Ga0395900_0044939 Ga0395900_0044939_1811_2839 337
1502 3300037471 Ga0395905_0046282 Ga0395905_0046282_1497_2525 337
1503 3300038443 Ga0395901_0245747 Ga0395901_0245747_733_1761 337
1504 3300044656 Ga0466969_0050564 Ga0466969_0050564_965_1993 337
1505 3300045049 Ga0466959_0089477 Ga0466959_0089477_287_1315 337
1506 3300048906 Ga0496103_0019311 Ga0496103_0019311_2198_3238 337
1507 3300048911 Ga0496108_0197389 Ga0496108_0197389_232_1338 337
1508 3300048914 Ga0496111_0250169 Ga0496111_0250169_155_1261 337
1509 3300044658 Ga0466972_0005546 Ga0466972_0005546_2210_3259 338
1510 3300044683 Ga0466965_0003762 Ga0466965_0003762_4495_5544 338
1511 3300044706 Ga0466964_0057478 Ga0466964_0057478_366_1415 338
1512 3300044706 Ga0466964_0059348 Ga0466964_0059348_480_1529 338
1513 3300044735 Ga0466968_0005213 Ga0466968_0005213_1848_2897 338
1514 3300047319 Ga0495674_0017157 Ga0495674_0017157_3555_4601 338
1515 3300002067 JGI24735J21928_10013596 JGI24735J21928_100135963 339
1516 3300002705 JGI25156J39149_1000577 JGI25156J39149_100057717 339
1517 3300003756 Ga0055533_1000702 Ga0055533_10007029 339
1518 3300009177 Ga0105248_10154438 Ga0105248_101544382 339
1519 3300013306 Ga0163162_10001909 Ga0163162_100019093 339
1520 3300017792 Ga0163161_10190847 Ga0163161_101908472 339
1521 3300025226 Ga0209674_100048 Ga0209674_100048222 339
1522 3300025256 Ga0209759_1000032 Ga0209759_1000032119 339
1523 3300025941 Ga0207711_10181074 Ga0207711_101810742 339
1524 3300025986 Ga0207658_10027878 Ga0207658_100278784 339
1525 3300026067 Ga0207678_10038950 Ga0207678_100389505 339
1526 3300037471 Ga0395905_0000009 Ga0395905_0000009_49149_50180 339
1527 3300037471 Ga0395905_0061220 Ga0395905_0061220_1832_2851 339
1528 3300046454 Ga0495592_0011229 Ga0495592_0011229_3471_4490 339
1529 3300046459 Ga0495629_0001431 Ga0495629_0001431_9167_10186 339
1530 3300046460 Ga0495638_0002582 Ga0495638_0002582_5437_6456 339
1531 3300046461 Ga0495641_0007710 Ga0495641_0007710_854_1873 339
1532 3300046463 Ga0495653_0001246 Ga0495653_0001246_6799_7818 339
1533 3300046463 Ga0495653_0063267 Ga0495653_0063267_902_1945 339
1534 3300046472 Ga0495580_0000010 Ga0495580_0000010_68953_69972 339
1535 3300046472 Ga0495580_0000419 Ga0495580_0000419_19508_20554 339
1536 3300046473 Ga0495582_0000897 Ga0495582_0000897_4273_5292 339
1537 3300046474 Ga0495605_0011410 Ga0495605_0011410_2406_3425 339
1538 3300046477 Ga0495664_0000581 Ga0495664_0000581_6125_7144 339
1539 3300046492 Ga0495585_0056755 Ga0495585_0056755_1007_2026 339
1540 3300046501 Ga0495607_0008139 Ga0495607_0008139_4012_5031 339
1541 3300046511 Ga0495608_0076051 Ga0495608_0076051_1020_2039 339
1542 3300046514 Ga0495618_0002544 Ga0495618_0002544_8566_9585 339
1543 3300046516 Ga0495628_0006259 Ga0495628_0006259_7895_8941 339
1544 3300046517 Ga0495630_0006163 Ga0495630_0006163_7340_8359 339
1545 3300046517 Ga0495630_0027758 Ga0495630_0027758_626_1672 339
1546 3300046524 Ga0495648_0000234 Ga0495648_0000234_44030_45049 339
1547 3300046524 Ga0495648_0033989 Ga0495648_0033989_1134_2153 339
1548 3300046526 Ga0495666_0001171 Ga0495666_0001171_11461_12480 339
1549 3300046526 Ga0495666_0007712 Ga0495666_0007712_574_1620 339
1550 3300046528 Ga0495642_0005522 Ga0495642_0005522_3159_4178 339
1551 3300046529 Ga0495652_0014405 Ga0495652_0014405_2104_3123 339
1552 3300046531 Ga0495665_0006815 Ga0495665_0006815_3042_4061 339
1553 3300046533 Ga0495640_0001933 Ga0495640_0001933_6083_7102 339
1554 3300046535 Ga0495586_0012030 Ga0495586_0012030_1612_2631 339
1555 3300046536 Ga0495587_0000646 Ga0495587_0000646_11210_12229 339
1556 3300046542 Ga0495597_0063646 Ga0495597_0063646_369_1388 339
1557 3300046543 Ga0495645_0003644 Ga0495645_0003644_2469_3488 339
1558 3300046642 Ga0495634_0001399 Ga0495634_0001399_3301_4320 339
1559 3300046648 Ga0495611_0064112 Ga0495611_0064112_306_1325 339
1560 3300046663 Ga0495635_0001202 Ga0495635_0001202_13822_14841 339
1561 3300046665 Ga0495661_0003286 Ga0495661_0003286_1827_2846 339
1562 3300046674 Ga0495588_0078955 Ga0495588_0078955_590_1609 339
1563 3300046679 Ga0495623_0013456 Ga0495623_0013456_4041_5060 339
1564 3300046680 Ga0495646_0028479 Ga0495646_0028479_247_1266 339
1565 3300046684 Ga0495669_0011949 Ga0495669_0011949_64_1083 339
1566 3300046689 Ga0495613_0026305 Ga0495613_0026305_3042_4061 339
1567 3300046794 Ga0495589_0002668 Ga0495589_0002668_780_1799 339
1568 3300046809 Ga0495600_0025979 Ga0495600_0025979_2502_3521 339
1569 3300047315 Ga0495581_0000206 Ga0495581_0000206_14751_15770 339
1570 3300047317 Ga0495604_0001283 Ga0495604_0001283_12564_13583 339
1571 3300047317 Ga0495604_0003226 Ga0495604_0003226_8190_9236 339
1572 3300047319 Ga0495674_0044533 Ga0495674_0044533_1338_2360 339
1573 3300047319 Ga0495674_0045000 Ga0495674_0045000_451_1470 339
1574 3300047319 Ga0495674_0065545 Ga0495674_0065545_42_1061 339
1575 3300047320 Ga0495672_0002635 Ga0495672_0002635_9134_10162 339
1576 3300047322 Ga0495680_0001105 Ga0495680_0001105_12097_13116 339
1577 3300047444 Ga0495675_0004021 Ga0495675_0004021_560_1579 339
1578 3300047446 Ga0495679_000217 Ga0495679_000217_11259_12278 339
1579 3300047446 Ga0495679_017654 Ga0495679_017654_1213_2232 339
1580 3300047471 Ga0495684_0032318 Ga0495684_0032318_1526_2545 339
1581 3300047673 Ga0495593_0007071 Ga0495593_0007071_3716_4735 339
1582 3300047673 Ga0495593_0013439 Ga0495593_0013439_446_1489 339
1583 3300048088 Ga0495602_0016074 Ga0495602_0016074_6237_7256 339
1584 3300048089 Ga0495614_0067377 Ga0495614_0067377_275_1294 339
1585 3300048091 Ga0495626_0027926 Ga0495626_0027926_438_1457 339
1586 3300048903 Ga0496100_0256537 Ga0496100_0256537_57_1100 339
1587 3300048904 Ga0496101_0244360 Ga0496101_0244360_127_1146 339
1588 3300048906 Ga0496103_0017937 Ga0496103_0017937_2894_3913 339
1589 3300048907 Ga0496104_0080792 Ga0496104_0080792_188_1207 339
1590 3300048920 Ga0496117_0127006 Ga0496117_0127006_207_1250 339
1591 3300048921 Ga0496118_0013700 Ga0496118_0013700_1201_2220 339
1592 3300048929 Ga0496126_0000196 Ga0496126_0000196_118613_119659 339
1593 3300048929 Ga0496126_0000679 Ga0496126_0000679_44205_45224 339
1594 iso_pu_bacteria 2501025501 2501071934 339
1595 iso_pu_bacteria 2501025504 2501411807 339

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

43

188

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9516 4 226
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9416 4 219
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9385 4 227
4yms-assembly1.cif.gz_A crystal structure of an amino acid abc transporter 0.935 4 224
8tzj-assembly1.cif.gz_A cryo-em structure of vibrio cholerae ftse/ftsx complex 0.9295 4 214
ID Description Score Start End Superfamily
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9831 3 218 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9694 3 218 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9689 1 219 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9646 1 219 3.40.50.300
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9627 2 66 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2V7DB86-F1-model_v4 Spermidine/putrescine ABC transporter ATP-binding protein 0.9949 1 70 GO:0005524
GO:0016887
GO:0055052
AF-A0A0P9DFL4-F1-model_v4 ABC transporter domain-containing protein 0.978 4 161 GO:0005524
GO:0016887
AF-A0A2V9R859-F1-model_v4 ABC transporter domain-containing protein 0.9682 1 154 GO:0005524
GO:0016887
AF-A0A4Q3TF12-F1-model_v4 ABC transporter ATP-binding protein 0.9663 1 155 GO:0005524
GO:0015423
GO:0016887
GO:0055052
GO:1990060
AF-A0A349H0M9-F1-model_v4 Spermidine/putrescine ABC transporter ATP-binding protein 0.9619 4 147 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
92.41 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map