F494961
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1595 | 808 | 1294 | 335 |
Family's Representative Sequence
| Representative Sequence | 3300013306|Ga0163162_10041475|Ga0163162_100414753 |
| Length | 370 |
| Sequence | MRHRAARCARRATRRRCGPGGGRAMAELRLTGVVKRFAGVTAVDGVGLEIPSGEFFVLLGPSGAGKTTTLRLVAGLERPDAGRVSIGGREVTALAPALRDVAFVFQQYSLYPHLSVFDNLAFPLRSPLRPCPEPEVRRKVEEVARMLRIDDKLHNPATRLSGGQMQRVAIGRALVRSPALYLMDEPLSSLDAKLRNDLRLELKRIQQDLGATMLYVTHDQIEAMTLATRIGVLDAGRLVQVGTPQQIYENPGSAHVASRLGSPRINLVARALFPQLDGPERAVMVGLRAEHLRLHRRPAAGGPDVAHRGASVRRIERLSDLHLVHVGLDDSSQELIVSAPPDESFEPNDAVQVEPLRPLWFDAEGLRIHA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 2 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 5 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 6 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 7 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 8 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 9 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 10 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 11 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 12 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 13 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 14 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 15 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 16 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 17 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 18 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 19 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 20 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 21 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 22 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 23 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 24 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 25 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 26 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 27 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 28 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 29 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 30 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 31 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 32 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 33 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 34 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 35 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 36 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 37 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 38 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 39 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 40 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 41 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 42 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 43 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 44 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 45 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 46 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 47 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 48 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 49 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 50 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 51 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 52 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 53 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 54 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 55 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 56 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 57 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 58 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 59 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 60 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 61 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 62 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 63 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 64 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 65 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 66 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 67 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 68 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 69 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 70 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 71 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 72 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 73 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 74 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 75 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 76 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 77 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 78 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 79 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 80 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 81 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 82 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 83 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 84 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 85 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 86 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 87 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 88 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 89 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 90 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 91 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 92 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 93 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 94 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 95 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 96 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 97 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 98 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 99 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 100 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 101 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 102 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 103 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 104 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 105 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 106 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 107 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 108 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 109 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 110 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 111 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 112 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 113 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 114 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 115 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 116 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 117 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 118 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 119 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 120 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 121 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 122 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 123 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 124 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 125 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 126 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 127 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 128 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 129 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 130 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 131 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 132 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 133 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 134 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 135 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 136 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 137 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 138 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 139 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 140 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 141 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 142 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 143 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 144 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 145 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 146 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 147 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 148 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 149 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 150 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 151 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 152 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 153 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 154 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 155 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 156 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 157 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 158 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 159 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 160 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 161 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 162 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 163 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 164 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 165 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 166 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 167 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 168 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 169 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 170 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 171 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 172 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 173 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 174 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 175 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 176 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 177 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 178 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 179 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 180 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 181 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 182 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 183 | 2906610324 | |||
| 184 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 185 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 186 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 187 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 188 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 189 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 190 | 2922368715 | |||
| 191 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 192 | 2922425934 | |||
| 193 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 194 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 195 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 196 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 197 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 198 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 199 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 200 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 201 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 202 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 203 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 204 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 205 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 206 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 207 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 208 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 209 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 210 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 211 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 212 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 213 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 214 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 215 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 216 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 217 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 218 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 219 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 220 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 221 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 222 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 223 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 224 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 225 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 226 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 227 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 228 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 229 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 230 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 231 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 232 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 233 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 234 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 235 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 236 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 237 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 238 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 239 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 240 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 241 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 242 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 243 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 244 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 245 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 246 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 247 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 248 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 249 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 250 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 251 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 252 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 253 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 254 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 255 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 256 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 257 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 258 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 259 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 260 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 261 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 262 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 263 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 264 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 265 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 266 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 267 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 268 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 269 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 270 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 271 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 272 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 273 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 274 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 275 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 276 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 277 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 278 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 279 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 280 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 281 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 282 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 283 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 284 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 285 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 286 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 287 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 288 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 289 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 290 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 291 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 292 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 293 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 294 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 295 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 296 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 297 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 298 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 299 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 300 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 301 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 302 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 303 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 304 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 305 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 306 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 307 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 308 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 309 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 310 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 311 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 312 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 313 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 314 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 315 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 316 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 317 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 318 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 319 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 320 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 321 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 322 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 323 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 324 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 325 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 326 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 327 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 328 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 329 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 330 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 331 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 332 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 333 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 334 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 335 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 336 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 337 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 338 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 339 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 340 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 341 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 342 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 343 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 344 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 345 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 346 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 347 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 348 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 349 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 350 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 351 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 352 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 353 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 354 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 355 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 356 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 357 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 358 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 359 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 361 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 362 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 363 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 364 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 365 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 366 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 368 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 369 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 370 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 371 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 372 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 373 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 374 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 376 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 377 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 379 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 380 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 381 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 382 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 383 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 384 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 385 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 386 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 387 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 388 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 389 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 390 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 391 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 392 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 393 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 394 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 395 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 396 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 397 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 398 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 399 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 400 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 401 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 402 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 403 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 404 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 405 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 406 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 407 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 408 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 409 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 410 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 411 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 412 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 413 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 414 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 415 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 416 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 417 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 418 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 419 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 420 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 421 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 422 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 423 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 424 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 425 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 426 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 427 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 428 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 429 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 430 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 431 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 432 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 433 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 434 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 435 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 436 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 437 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 438 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 439 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 440 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 441 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 442 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 443 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 444 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 445 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 446 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 447 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 448 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 449 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 450 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 451 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 452 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 453 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 454 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 455 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 456 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 457 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 458 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 459 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 460 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 461 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 462 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 463 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 464 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 465 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 466 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 467 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 468 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 469 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 470 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 471 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 472 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 473 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 474 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 475 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 476 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 477 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 478 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 479 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 480 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 481 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 482 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 483 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 484 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 485 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 486 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 487 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 488 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 489 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 490 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 491 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 492 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 493 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 494 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 495 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 496 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 497 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 498 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 499 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 500 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 501 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 502 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 503 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 504 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 505 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 506 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 507 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 508 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 509 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 510 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 511 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 512 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 513 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 514 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 515 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 516 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 517 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 518 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 519 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 520 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 521 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 522 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 523 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 524 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 525 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 526 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 527 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 528 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 529 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 530 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 531 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 532 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 533 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 534 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 535 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 536 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 537 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 538 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 539 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 540 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 541 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 542 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 543 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 544 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 545 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 546 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 547 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 548 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 549 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 550 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 551 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 552 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 553 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 554 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 555 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 556 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 557 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 558 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 559 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 560 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 561 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 562 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 563 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 564 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 565 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 566 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 567 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 568 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 569 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 570 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 571 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 572 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 573 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 574 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 575 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 576 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 577 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 578 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 579 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 580 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 631 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 639 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 640 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 641 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 642 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 643 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 644 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 645 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 646 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 647 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 648 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 649 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 650 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 651 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 652 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 653 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 654 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 655 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 656 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 657 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 658 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 659 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 660 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 661 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 662 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 663 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 664 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 665 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 666 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 667 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 668 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 669 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 670 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 671 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 672 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 673 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 674 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 675 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 676 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 677 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 678 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 679 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 680 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 681 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 682 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 683 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 684 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 685 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 686 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 687 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 688 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 689 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 690 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 691 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 692 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 693 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 694 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 695 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 696 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 697 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 698 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 699 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 700 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 701 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 702 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 703 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 704 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 705 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 706 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 707 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 708 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 709 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 710 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 711 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 712 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 713 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 714 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 715 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 716 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 717 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 718 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 719 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 720 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 721 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 722 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 723 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 724 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 725 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 726 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 727 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 728 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 729 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 730 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 731 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 732 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 733 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 734 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 735 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 736 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 737 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 738 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 739 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 740 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 741 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 742 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 743 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 744 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 745 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 746 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 747 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 748 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 749 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 750 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 751 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 752 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 753 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 754 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 755 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 756 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 757 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 758 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 759 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 760 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 761 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 762 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 763 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 764 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 765 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 766 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 767 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 768 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 769 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 770 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 771 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 772 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 773 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 774 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 775 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 776 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 777 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 778 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 779 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 780 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 781 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 782 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 783 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 784 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 785 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 786 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 787 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 788 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 789 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 790 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 791 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 792 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 793 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 794 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 795 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 796 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 797 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 798 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 799 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 800 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 801 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 802 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 803 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 804 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 805 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 806 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 807 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 808 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.28 |
| Metatranscriptomes | 0 |
| Isolates | 18.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.59 |
| Nodule | 15.49 |
| Rhizoplane | 4.58 |
| Rhizosphere | 60.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10013596 | 3300002067 | Bacteria | 2556 |
| 2 | JGI25156J39149_1000240 | 3300002705 | Bacteria | 37927 |
| 3 | JGI25156J39149_1000577 | 3300002705 | Bacteria | 21003 |
| 4 | JGI25154J39366_1000445 | 3300002738 | Bacteria | 21954 |
| 5 | JGI25157J39369_1000148 | 3300002741 | Bacteria | 58782 |
| 6 | JGI25152J39213_1004235 | 3300002773 | Bacteria | 4591 |
| 7 | JGI25150J39212_1008481 | 3300002774 | Bacteria | 2008 |
| 8 | JGI25151J46595_10008594 | 3300003187 | Bacteria | 4895 |
| 9 | JGI25406J46586_10000039 | 3300003203 | Bacteria | 59006 |
| 10 | JGI25406J46586_10067282 | 3300003203 | Bacteria | 1135 |
| 11 | JGI25153J46596_10020132 | 3300003215 | Bacteria | 2530 |
| 12 | rootH2_10026777 | 3300003320 | Bacteria | 3809 |
| 13 | JGI25160J50197_1004178 | 3300003354 | Bacteria | 6280 |
| 14 | JGI25404J52841_10000081 | 3300003659 | Bacteria | 8816 |
| 15 | JGI25404J52841_10000800 | 3300003659 | Bacteria | 4997 |
| 16 | JGI25404J52841_10002033 | 3300003659 | Bacteria | 3742 |
| 17 | JGI25404J52841_10003979 | 3300003659 | Bacteria | 2966 |
| 18 | Ga0055539_1002041 | 3300003752 | Bacteria | 3309 |
| 19 | Ga0055539_1003138 | 3300003752 | Bacteria | 2357 |
| 20 | Ga0055533_1000016 | 3300003756 | Bacteria | 396179 |
| 21 | Ga0055533_1000702 | 3300003756 | Bacteria | 10998 |
| 22 | Ga0055525_1002495 | 3300003759 | Bacteria | 1858 |
| 23 | Ga0055535_1000107 | 3300003761 | Bacteria | 89840 |
| 24 | Ga0055529_1000111 | 3300003763 | Bacteria | 118734 |
| 25 | Ga0055526_1014297 | 3300003771 | Bacteria | 3276 |
| 26 | Ga0055528_1025221 | 3300003790 | Bacteria | 1754 |
| 27 | Ga0055540_1000192 | 3300003792 | Bacteria | 58828 |
| 28 | Ga0055540_1018930 | 3300003792 | Bacteria | 1871 |
| 29 | Ga0055543_1000329 | 3300004625 | Bacteria | 32613 |
| 30 | Ga0065165_1016048 | 3300005262 | Bacteria | 2823 |
| 31 | Ga0065707_10085391 | 3300005295 | Bacteria | 6191 |
| 32 | Ga0070658_10044005 | 3300005327 | Bacteria | 3607 |
| 33 | Ga0070658_10084121 | 3300005327 | Bacteria | 2616 |
| 34 | Ga0070676_10061945 | 3300005328 | Bacteria | 2225 |
| 35 | Ga0070676_10097288 | 3300005328 | Bacteria | 1813 |
| 36 | Ga0070683_100002714 | 3300005329 | Bacteria | 14136 |
| 37 | Ga0070683_100032630 | 3300005329 | Bacteria | 4742 |
| 38 | Ga0070690_100007969 | 3300005330 | Bacteria | 6081 |
| 39 | Ga0070670_100182508 | 3300005331 | Bacteria | 1822 |
| 40 | Ga0068869_100078358 | 3300005334 | Bacteria | 2461 |
| 41 | Ga0068869_100118949 | 3300005334 | Bacteria | 2018 |
| 42 | Ga0070680_100032603 | 3300005336 | Bacteria | 4194 |
| 43 | Ga0070680_100194056 | 3300005336 | Bacteria | 1712 |
| 44 | Ga0070682_100234854 | 3300005337 | Bacteria | 1313 |
| 45 | Ga0068868_100037825 | 3300005338 | Bacteria | 3743 |
| 46 | Ga0068868_100108684 | 3300005338 | Bacteria | 2251 |
| 47 | Ga0068868_100124026 | 3300005338 | Bacteria | 2108 |
| 48 | Ga0070660_100066483 | 3300005339 | Bacteria | 2806 |
| 49 | Ga0070660_100067269 | 3300005339 | Bacteria | 2791 |
| 50 | Ga0070689_100119364 | 3300005340 | Bacteria | 2105 |
| 51 | Ga0070691_10195753 | 3300005341 | Bacteria | 1060 |
| 52 | Ga0070687_100078258 | 3300005343 | Bacteria | 1797 |
| 53 | Ga0070661_100004039 | 3300005344 | Bacteria | 10095 |
| 54 | Ga0070668_100011099 | 3300005347 | Bacteria | 6706 |
| 55 | Ga0070668_100020589 | 3300005347 | Bacteria | 4979 |
| 56 | Ga0070668_100033402 | 3300005347 | Bacteria | 3918 |
| 57 | Ga0070668_100087753 | 3300005347 | Bacteria | 2448 |
| 58 | Ga0070668_100189538 | 3300005347 | Bacteria | 1684 |
| 59 | Ga0070669_100020965 | 3300005353 | Bacteria | 4669 |
| 60 | Ga0070669_100070459 | 3300005353 | Bacteria | 2584 |
| 61 | Ga0070669_100130310 | 3300005353 | Bacteria | 1928 |
| 62 | Ga0070675_100035549 | 3300005354 | Bacteria | 4049 |
| 63 | Ga0070675_100103891 | 3300005354 | Bacteria | 2396 |
| 64 | Ga0070671_100086573 | 3300005355 | Bacteria | 2622 |
| 65 | Ga0070671_100096269 | 3300005355 | Bacteria | 2482 |
| 66 | Ga0070671_100143750 | 3300005355 | Bacteria | 2014 |
| 67 | Ga0070674_100001054 | 3300005356 | Bacteria | 14410 |
| 68 | Ga0070674_100007035 | 3300005356 | Bacteria | 6613 |
| 69 | Ga0070674_100042949 | 3300005356 | Bacteria | 3073 |
| 70 | Ga0070674_100046627 | 3300005356 | Bacteria | 2966 |
| 71 | Ga0070673_100005668 | 3300005364 | Bacteria | 8023 |
| 72 | Ga0070673_100106792 | 3300005364 | Bacteria | 2315 |
| 73 | Ga0070688_100247981 | 3300005365 | Bacteria | 1267 |
| 74 | Ga0070659_100057521 | 3300005366 | Bacteria | 3067 |
| 75 | Ga0070659_100137413 | 3300005366 | Bacteria | 1988 |
| 76 | Ga0070659_100189478 | 3300005366 | Bacteria | 1690 |
| 77 | Ga0070659_100294127 | 3300005366 | Bacteria | 1353 |
| 78 | Ga0070659_100336457 | 3300005366 | Bacteria | 1264 |
| 79 | Ga0070667_100018497 | 3300005367 | Bacteria | 5778 |
| 80 | Ga0070667_100029096 | 3300005367 | Bacteria | 4601 |
| 81 | Ga0070667_100041228 | 3300005367 | Bacteria | 3873 |
| 82 | Ga0070667_100050524 | 3300005367 | Bacteria | 3505 |
| 83 | Ga0070667_100170212 | 3300005367 | Bacteria | 1923 |
| 84 | Ga0070709_10000575 | 3300005434 | Bacteria | 21472 |
| 85 | Ga0070714_100009073 | 3300005435 | Bacteria | 7798 |
| 86 | Ga0070714_100010743 | 3300005435 | Bacteria | 7245 |
| 87 | Ga0070714_100038400 | 3300005435 | Bacteria | 4025 |
| 88 | Ga0070714_100100930 | 3300005435 | Bacteria | 2542 |
| 89 | Ga0070714_100143638 | 3300005435 | Bacteria | 2144 |
| 90 | Ga0070714_100158810 | 3300005435 | Bacteria | 2044 |
| 91 | Ga0070713_100014695 | 3300005436 | Bacteria | 5823 |
| 92 | Ga0070713_100019136 | 3300005436 | Bacteria | 5219 |
| 93 | Ga0070713_100026782 | 3300005436 | Bacteria | 4532 |
| 94 | Ga0070713_100151247 | 3300005436 | Bacteria | 2065 |
| 95 | Ga0070710_10000123 | 3300005437 | Bacteria | 36332 |
| 96 | Ga0070710_10003768 | 3300005437 | Bacteria | 7171 |
| 97 | Ga0070710_10054385 | 3300005437 | Bacteria | 2258 |
| 98 | Ga0070710_10185662 | 3300005437 | Bacteria | 1305 |
| 99 | Ga0070701_10011581 | 3300005438 | Bacteria | 3950 |
| 100 | Ga0070701_10112218 | 3300005438 | Bacteria | 1525 |
| 101 | Ga0070711_100033655 | 3300005439 | Bacteria | 3413 |
| 102 | Ga0070711_100122509 | 3300005439 | Bacteria | 1925 |
| 103 | Ga0070711_100298814 | 3300005439 | Bacteria | 1280 |
| 104 | Ga0070705_100095323 | 3300005440 | Bacteria | 1865 |
| 105 | Ga0070700_100022083 | 3300005441 | Bacteria | 3706 |
| 106 | Ga0070708_100002230 | 3300005445 | Bacteria | 14982 |
| 107 | Ga0070708_100214100 | 3300005445 | Bacteria | 1806 |
| 108 | Ga0070708_100304506 | 3300005445 | Bacteria | 1501 |
| 109 | Ga0070663_100070522 | 3300005455 | Bacteria | 2541 |
| 110 | Ga0070663_100146211 | 3300005455 | Bacteria | 1809 |
| 111 | Ga0070663_100360937 | 3300005455 | Bacteria | 1178 |
| 112 | Ga0070678_100010558 | 3300005456 | Bacteria | 5649 |
| 113 | Ga0070678_100084055 | 3300005456 | Bacteria | 2422 |
| 114 | Ga0070678_100087849 | 3300005456 | Bacteria | 2375 |
| 115 | Ga0070662_100010779 | 3300005457 | Bacteria | 6017 |
| 116 | Ga0070662_100031158 | 3300005457 | Bacteria | 3740 |
| 117 | Ga0070662_100048692 | 3300005457 | Bacteria | 3054 |
| 118 | Ga0070662_100207951 | 3300005457 | Bacteria | 1556 |
| 119 | Ga0070662_100254098 | 3300005457 | Bacteria | 1414 |
| 120 | Ga0070681_10010183 | 3300005458 | Bacteria | 9274 |
| 121 | Ga0070681_10018273 | 3300005458 | Bacteria | 7008 |
| 122 | Ga0068867_100000020 | 3300005459 | Bacteria | 93210 |
| 123 | Ga0068867_100017231 | 3300005459 | Bacteria | 5131 |
| 124 | Ga0068867_100048095 | 3300005459 | Bacteria | 3137 |
| 125 | Ga0068867_100152615 | 3300005459 | Bacteria | 1816 |
| 126 | Ga0070706_100000873 | 3300005467 | Bacteria | 33089 |
| 127 | Ga0070706_100041721 | 3300005467 | Bacteria | 4237 |
| 128 | Ga0070706_100055029 | 3300005467 | Bacteria | 3672 |
| 129 | Ga0070707_100333171 | 3300005468 | Bacteria | 1474 |
| 130 | Ga0070699_100039618 | 3300005518 | Bacteria | 4079 |
| 131 | Ga0070699_100240175 | 3300005518 | Bacteria | 1617 |
| 132 | Ga0070699_100284062 | 3300005518 | Bacteria | 1483 |
| 133 | Ga0070679_100016076 | 3300005530 | Bacteria | 7208 |
| 134 | Ga0070679_100016549 | 3300005530 | Bacteria | 7118 |
| 135 | Ga0070679_100056648 | 3300005530 | Bacteria | 3905 |
| 136 | Ga0070684_100003618 | 3300005535 | Bacteria | 11636 |
| 137 | Ga0070684_100102819 | 3300005535 | Bacteria | 2555 |
| 138 | Ga0070684_100240214 | 3300005535 | Bacteria | 1655 |
| 139 | Ga0070697_100043563 | 3300005536 | Bacteria | 3635 |
| 140 | Ga0070697_100109950 | 3300005536 | Bacteria | 2296 |
| 141 | Ga0068853_100040370 | 3300005539 | Bacteria | 3981 |
| 142 | Ga0068853_100296844 | 3300005539 | Bacteria | 1493 |
| 143 | Ga0068853_100319522 | 3300005539 | Bacteria | 1439 |
| 144 | Ga0068853_100348299 | 3300005539 | Bacteria | 1377 |
| 145 | Ga0068853_100370061 | 3300005539 | Bacteria | 1337 |
| 146 | Ga0070672_100095595 | 3300005543 | Bacteria | 2403 |
| 147 | Ga0070672_100185087 | 3300005543 | Bacteria | 1737 |
| 148 | Ga0070672_100325557 | 3300005543 | Bacteria | 1307 |
| 149 | Ga0070696_100014780 | 3300005546 | Bacteria | 5238 |
| 150 | Ga0070696_100098384 | 3300005546 | Bacteria | 2093 |
| 151 | Ga0070696_100112187 | 3300005546 | Bacteria | 1964 |
| 152 | Ga0070665_100015661 | 3300005548 | Bacteria | 7615 |
| 153 | Ga0070665_100059073 | 3300005548 | Bacteria | 3844 |
| 154 | Ga0070665_100073671 | 3300005548 | Bacteria | 3420 |
| 155 | Ga0070665_100074569 | 3300005548 | Bacteria | 3399 |
| 156 | Ga0070665_100103789 | 3300005548 | Bacteria | 2846 |
| 157 | Ga0070665_100117997 | 3300005548 | Bacteria | 2656 |
| 158 | Ga0070665_100142795 | 3300005548 | Bacteria | 2397 |
| 159 | Ga0070665_100153637 | 3300005548 | Bacteria | 2303 |
| 160 | Ga0070665_100227335 | 3300005548 | Bacteria | 1866 |
| 161 | Ga0070665_100283770 | 3300005548 | Bacteria | 1658 |
| 162 | Ga0070704_100086022 | 3300005549 | Bacteria | 2328 |
| 163 | Ga0070704_100106728 | 3300005549 | Bacteria | 2123 |
| 164 | Ga0070704_100268781 | 3300005549 | Bacteria | 1408 |
| 165 | Ga0068855_100002242 | 3300005563 | Bacteria | 23893 |
| 166 | Ga0068855_100018220 | 3300005563 | Bacteria | 8435 |
| 167 | Ga0068855_100062837 | 3300005563 | Bacteria | 4334 |
| 168 | Ga0068855_100072098 | 3300005563 | Bacteria | 4015 |
| 169 | Ga0068855_100220273 | 3300005563 | Bacteria | 2128 |
| 170 | Ga0070664_100001933 | 3300005564 | Bacteria | 16650 |
| 171 | Ga0070664_100086832 | 3300005564 | Bacteria | 2703 |
| 172 | Ga0070664_100096918 | 3300005564 | Bacteria | 2560 |
| 173 | Ga0070664_100149480 | 3300005564 | Bacteria | 2061 |
| 174 | Ga0070664_100260130 | 3300005564 | Bacteria | 1561 |
| 175 | Ga0068857_100004409 | 3300005577 | Bacteria | 11897 |
| 176 | Ga0068857_100011076 | 3300005577 | Bacteria | 7846 |
| 177 | Ga0068857_100053523 | 3300005577 | Bacteria | 3580 |
| 178 | Ga0068857_100096683 | 3300005577 | Bacteria | 2647 |
| 179 | Ga0068854_100018998 | 3300005578 | Bacteria | 4623 |
| 180 | Ga0068854_100025857 | 3300005578 | Bacteria | 4029 |
| 181 | Ga0068854_100101012 | 3300005578 | Bacteria | 2163 |
| 182 | Ga0068854_100123512 | 3300005578 | Bacteria | 1969 |
| 183 | Ga0068854_100142607 | 3300005578 | Bacteria | 1840 |
| 184 | Ga0068854_100266034 | 3300005578 | Bacteria | 1375 |
| 185 | Ga0068856_100008374 | 3300005614 | Bacteria | 10077 |
| 186 | Ga0068856_100040825 | 3300005614 | Bacteria | 4558 |
| 187 | Ga0068856_100205199 | 3300005614 | Bacteria | 1986 |
| 188 | Ga0070702_100090478 | 3300005615 | Bacteria | 1855 |
| 189 | Ga0070702_100202473 | 3300005615 | Bacteria | 1315 |
| 190 | Ga0068852_100000511 | 3300005616 | Bacteria | 25571 |
| 191 | Ga0068852_100211614 | 3300005616 | Bacteria | 1839 |
| 192 | Ga0068852_100216668 | 3300005616 | Bacteria | 1819 |
| 193 | Ga0068859_100006931 | 3300005617 | Bacteria | 11507 |
| 194 | Ga0068859_100057158 | 3300005617 | Bacteria | 3930 |
| 195 | Ga0068859_100143848 | 3300005617 | Bacteria | 2458 |
| 196 | Ga0068859_100228755 | 3300005617 | Bacteria | 1947 |
| 197 | Ga0068859_100258692 | 3300005617 | Bacteria | 1832 |
| 198 | Ga0068864_100009044 | 3300005618 | Bacteria | 8210 |
| 199 | Ga0068864_100014213 | 3300005618 | Bacteria | 6609 |
| 200 | Ga0068864_100075419 | 3300005618 | Bacteria | 2944 |
| 201 | Ga0068864_100183081 | 3300005618 | Bacteria | 1916 |
| 202 | Ga0068861_100045484 | 3300005719 | Bacteria | 3305 |
| 203 | Ga0068861_100072207 | 3300005719 | Bacteria | 2677 |
| 204 | Ga0068861_100111381 | 3300005719 | Bacteria | 2193 |
| 205 | Ga0068861_100305611 | 3300005719 | Bacteria | 1379 |
| 206 | Ga0068851_10004499 | 3300005834 | Bacteria | 6291 |
| 207 | Ga0068851_10033935 | 3300005834 | Bacteria | 2545 |
| 208 | Ga0068863_100045110 | 3300005841 | Bacteria | 4183 |
| 209 | Ga0068863_100097496 | 3300005841 | Bacteria | 2792 |
| 210 | Ga0068858_100028464 | 3300005842 | Bacteria | 5190 |
| 211 | Ga0068858_100231022 | 3300005842 | Bacteria | 1754 |
| 212 | Ga0068860_100099735 | 3300005843 | Bacteria | 2770 |
| 213 | Ga0068860_100100810 | 3300005843 | Bacteria | 2755 |
| 214 | Ga0068860_100120557 | 3300005843 | Bacteria | 2511 |
| 215 | Ga0068860_100168411 | 3300005843 | Bacteria | 2115 |
| 216 | Ga0068860_100413140 | 3300005843 | Bacteria | 1337 |
| 217 | Ga0068862_100016461 | 3300005844 | Bacteria | 6154 |
| 218 | Ga0068862_100020306 | 3300005844 | Bacteria | 5548 |
| 219 | Ga0068862_100045044 | 3300005844 | Bacteria | 3764 |
| 220 | Ga0068862_100111422 | 3300005844 | Bacteria | 2402 |
| 221 | Ga0068862_100203149 | 3300005844 | Bacteria | 1788 |
| 222 | Ga0068862_100296576 | 3300005844 | Bacteria | 1486 |
| 223 | Ga0081455_10005782 | 3300005937 | Bacteria | 13481 |
| 224 | Ga0081455_10160148 | 3300005937 | Bacteria | 1726 |
| 225 | Ga0081538_10001104 | 3300005981 | Bacteria | 28580 |
| 226 | Ga0081540_1000195 | 3300005983 | Bacteria | 62863 |
| 227 | Ga0081540_1002129 | 3300005983 | Bacteria | 16484 |
| 228 | Ga0081540_1002161 | 3300005983 | Bacteria | 16332 |
| 229 | Ga0081540_1003618 | 3300005983 | Bacteria | 12132 |
| 230 | Ga0081540_1004467 | 3300005983 | Bacteria | 10650 |
| 231 | Ga0081540_1008340 | 3300005983 | Bacteria | 7245 |
| 232 | Ga0081540_1040261 | 3300005983 | Bacteria | 2437 |
| 233 | Ga0081539_10000169 | 3300005985 | Bacteria | 153327 |
| 234 | Ga0081539_10002228 | 3300005985 | Bacteria | 28275 |
| 235 | Ga0081539_10004005 | 3300005985 | Bacteria | 16961 |
| 236 | Ga0081539_10005221 | 3300005985 | Bacteria | 13445 |
| 237 | Ga0081539_10049362 | 3300005985 | Bacteria | 2389 |
| 238 | Ga0070717_10077650 | 3300006028 | Bacteria | 2781 |
| 239 | Ga0070717_10134531 | 3300006028 | Bacteria | 2128 |
| 240 | Ga0075365_10076208 | 3300006038 | Bacteria | 2264 |
| 241 | Ga0075365_10089411 | 3300006038 | Bacteria | 2096 |
| 242 | Ga0075365_10100467 | 3300006038 | Bacteria | 1980 |
| 243 | Ga0075363_100042014 | 3300006048 | Bacteria | 2413 |
| 244 | Ga0075364_10011789 | 3300006051 | Bacteria | 5322 |
| 245 | Ga0075364_10104787 | 3300006051 | Bacteria | 1884 |
| 246 | Ga0075432_10074957 | 3300006058 | Bacteria | 1220 |
| 247 | Ga0070715_10002302 | 3300006163 | Bacteria | 5825 |
| 248 | Ga0070715_10113009 | 3300006163 | Bacteria | 1284 |
| 249 | Ga0070716_100005823 | 3300006173 | Bacteria | 5986 |
| 250 | Ga0070716_100027070 | 3300006173 | Bacteria | 3076 |
| 251 | Ga0070716_100029446 | 3300006173 | Bacteria | 2969 |
| 252 | Ga0070716_100264802 | 3300006173 | Bacteria | 1178 |
| 253 | Ga0070712_100003703 | 3300006175 | Bacteria | 9420 |
| 254 | Ga0070712_100102581 | 3300006175 | Bacteria | 2119 |
| 255 | Ga0075362_10015634 | 3300006177 | Bacteria | 3090 |
| 256 | Ga0075362_10088533 | 3300006177 | Bacteria | 1434 |
| 257 | Ga0075362_10134931 | 3300006177 | Bacteria | 1176 |
| 258 | Ga0075367_10005414 | 3300006178 | Bacteria | 6334 |
| 259 | Ga0075367_10038586 | 3300006178 | Bacteria | 2781 |
| 260 | Ga0075367_10041835 | 3300006178 | Bacteria | 2680 |
| 261 | Ga0075367_10042114 | 3300006178 | Bacteria | 2671 |
| 262 | Ga0075369_10027238 | 3300006186 | Bacteria | 2388 |
| 263 | Ga0075369_10039800 | 3300006186 | Bacteria | 2008 |
| 264 | Ga0075366_10009032 | 3300006195 | Bacteria | 5559 |
| 265 | Ga0075366_10013479 | 3300006195 | Bacteria | 4655 |
| 266 | Ga0075366_10026168 | 3300006195 | Bacteria | 3416 |
| 267 | Ga0075366_10048153 | 3300006195 | Bacteria | 2527 |
| 268 | Ga0075366_10084781 | 3300006195 | Bacteria | 1894 |
| 269 | Ga0075366_10094274 | 3300006195 | Bacteria | 1794 |
| 270 | Ga0097621_100055296 | 3300006237 | Bacteria | 3240 |
| 271 | Ga0075370_10002403 | 3300006353 | Bacteria | 8668 |
| 272 | Ga0075370_10006919 | 3300006353 | Bacteria | 5744 |
| 273 | Ga0075370_10022864 | 3300006353 | Bacteria | 3438 |
| 274 | Ga0075370_10033493 | 3300006353 | Bacteria | 2877 |
| 275 | Ga0075370_10066745 | 3300006353 | Bacteria | 2052 |
| 276 | Ga0075370_10070577 | 3300006353 | Bacteria | 1998 |
| 277 | Ga0075370_10106095 | 3300006353 | Bacteria | 1629 |
| 278 | Ga0068871_100009046 | 3300006358 | Bacteria | 7194 |
| 279 | Ga0075428_100132849 | 3300006844 | Bacteria | 2707 |
| 280 | Ga0075428_100252329 | 3300006844 | Bacteria | 1901 |
| 281 | Ga0075430_100018985 | 3300006846 | Bacteria | 5849 |
| 282 | Ga0075431_100012951 | 3300006847 | Bacteria | 8419 |
| 283 | Ga0075434_100096581 | 3300006871 | Bacteria | 2960 |
| 284 | Ga0075434_100106770 | 3300006871 | Bacteria | 2810 |
| 285 | Ga0075434_100559567 | 3300006871 | Bacteria | 1163 |
| 286 | Ga0097620_100006931 | 3300006931 | Bacteria | 11507 |
| 287 | Ga0097620_100057158 | 3300006931 | Bacteria | 3930 |
| 288 | Ga0097620_100143847 | 3300006931 | Bacteria | 2458 |
| 289 | Ga0097620_100228753 | 3300006931 | Bacteria | 1947 |
| 290 | Ga0097620_100258689 | 3300006931 | Bacteria | 1832 |
| 291 | Ga0097620_100316058 | 3300006931 | Bacteria | 1656 |
| 292 | Ga0099824_1022176 | 3300006942 | Bacteria | 4241 |
| 293 | Ga0099822_1004906 | 3300006943 | Bacteria | 17459 |
| 294 | Ga0075435_100062845 | 3300007076 | Bacteria | 3014 |
| 295 | Ga0075435_100411866 | 3300007076 | Bacteria | 1163 |
| 296 | Ga0099794_10002417 | 3300007265 | Bacteria | 6880 |
| 297 | Ga0099794_10025953 | 3300007265 | Bacteria | 2704 |
| 298 | Ga0099795_10004316 | 3300007788 | Bacteria | 3652 |
| 299 | Ga0099795_10029791 | 3300007788 | Bacteria | 1868 |
| 300 | Ga0105250_10086862 | 3300009092 | Bacteria | 1270 |
| 301 | Ga0105240_10000933 | 3300009093 | Bacteria | 51939 |
| 302 | Ga0105240_10011759 | 3300009093 | Bacteria | 12161 |
| 303 | Ga0105240_10016843 | 3300009093 | Bacteria | 9878 |
| 304 | Ga0105240_10031202 | 3300009093 | Bacteria | 6914 |
| 305 | Ga0105240_10087196 | 3300009093 | Bacteria | 3823 |
| 306 | Ga0111539_10055979 | 3300009094 | Bacteria | 4689 |
| 307 | Ga0111539_10205975 | 3300009094 | Bacteria | 2293 |
| 308 | Ga0105245_10060265 | 3300009098 | Bacteria | 3418 |
| 309 | Ga0105245_10073859 | 3300009098 | Bacteria | 3102 |
| 310 | Ga0105245_10277391 | 3300009098 | Bacteria | 1637 |
| 311 | Ga0105247_10017735 | 3300009101 | Bacteria | 4269 |
| 312 | Ga0114129_10141644 | 3300009147 | Bacteria | 3295 |
| 313 | Ga0114129_10158707 | 3300009147 | Bacteria | 3092 |
| 314 | Ga0114129_10332294 | 3300009147 | Bacteria | 2017 |
| 315 | Ga0114129_10540748 | 3300009147 | Bacteria | 1516 |
| 316 | Ga0114129_10704922 | 3300009147 | Bacteria | 1297 |
| 317 | Ga0105243_10025143 | 3300009148 | Bacteria | 4548 |
| 318 | Ga0105243_10032960 | 3300009148 | Bacteria | 4004 |
| 319 | Ga0105243_10045659 | 3300009148 | Bacteria | 3444 |
| 320 | Ga0105243_10268527 | 3300009148 | Bacteria | 1530 |
| 321 | Ga0105243_10347435 | 3300009148 | Bacteria | 1361 |
| 322 | Ga0105241_10007024 | 3300009174 | Bacteria | 8283 |
| 323 | Ga0105241_10014987 | 3300009174 | Bacteria | 5677 |
| 324 | Ga0105241_10050565 | 3300009174 | Bacteria | 3168 |
| 325 | Ga0105248_10014000 | 3300009177 | Bacteria | 8825 |
| 326 | Ga0105248_10028709 | 3300009177 | Bacteria | 6200 |
| 327 | Ga0105248_10154438 | 3300009177 | Bacteria | 2590 |
| 328 | Ga0105248_10174058 | 3300009177 | Bacteria | 2426 |
| 329 | Ga0105248_10235978 | 3300009177 | Bacteria | 2059 |
| 330 | Ga0105248_10465627 | 3300009177 | Bacteria | 1425 |
| 331 | Ga0105237_10000407 | 3300009545 | Bacteria | 61234 |
| 332 | Ga0105237_10006258 | 3300009545 | Bacteria | 13250 |
| 333 | Ga0105237_10017035 | 3300009545 | Bacteria | 7544 |
| 334 | Ga0105237_10023255 | 3300009545 | Bacteria | 6353 |
| 335 | Ga0105237_10029825 | 3300009545 | Bacteria | 5541 |
| 336 | Ga0105237_10085828 | 3300009545 | Bacteria | 3137 |
| 337 | Ga0105237_10122834 | 3300009545 | Bacteria | 2591 |
| 338 | Ga0105237_10128946 | 3300009545 | Bacteria | 2524 |
| 339 | Ga0105237_10157199 | 3300009545 | Bacteria | 2271 |
| 340 | Ga0105237_10250045 | 3300009545 | Bacteria | 1775 |
| 341 | Ga0105237_10354483 | 3300009545 | Bacteria | 1472 |
| 342 | Ga0105237_10392256 | 3300009545 | Bacteria | 1393 |
| 343 | Ga0105237_10433471 | 3300009545 | Bacteria | 1320 |
| 344 | Ga0105238_10005854 | 3300009551 | Bacteria | 12178 |
| 345 | Ga0105238_10010029 | 3300009551 | Bacteria | 9499 |
| 346 | Ga0105238_10016113 | 3300009551 | Bacteria | 7560 |
| 347 | Ga0105238_10108545 | 3300009551 | Bacteria | 2756 |
| 348 | Ga0105238_10208998 | 3300009551 | Bacteria | 1928 |
| 349 | Ga0105238_10321064 | 3300009551 | Bacteria | 1534 |
| 350 | Ga0105238_10419086 | 3300009551 | Bacteria | 1333 |
| 351 | Ga0105249_10072678 | 3300009553 | Bacteria | 3180 |
| 352 | Ga0105249_10288633 | 3300009553 | Bacteria | 1641 |
| 353 | Ga0105249_10334152 | 3300009553 | Bacteria | 1530 |
| 354 | Ga0105249_10577096 | 3300009553 | Bacteria | 1177 |
| 355 | Ga0099796_10026519 | 3300010159 | Bacteria | 1841 |
| 356 | Ga0105239_10000335 | 3300010375 | Bacteria | 68810 |
| 357 | Ga0105239_10035550 | 3300010375 | Bacteria | 5471 |
| 358 | Ga0105239_10039190 | 3300010375 | Bacteria | 5191 |
| 359 | Ga0105239_10077141 | 3300010375 | Bacteria | 3666 |
| 360 | Ga0105239_10093933 | 3300010375 | Bacteria | 3312 |
| 361 | Ga0105239_10157084 | 3300010375 | Bacteria | 2540 |
| 362 | Ga0105239_10211349 | 3300010375 | Bacteria | 2175 |
| 363 | Ga0105239_10551399 | 3300010375 | Bacteria | 1313 |
| 364 | Ga0105239_10749121 | 3300010375 | Bacteria | 1118 |
| 365 | Ga0105246_10176301 | 3300011119 | Bacteria | 1642 |
| 366 | Ga0105246_10341649 | 3300011119 | Bacteria | 1224 |
| 367 | Ga0157373_10047441 | 3300013100 | Bacteria | 3064 |
| 368 | Ga0157370_10005026 | 3300013104 | Bacteria | 14938 |
| 369 | Ga0157370_10057819 | 3300013104 | Bacteria | 3686 |
| 370 | Ga0157369_10008569 | 3300013105 | Bacteria | 11730 |
| 371 | Ga0157369_10030554 | 3300013105 | Bacteria | 5941 |
| 372 | Ga0157369_10047093 | 3300013105 | Bacteria | 4684 |
| 373 | Ga0157374_10485952 | 3300013296 | Bacteria | 1238 |
| 374 | Ga0157378_10004078 | 3300013297 | Bacteria | 12907 |
| 375 | Ga0157378_10080645 | 3300013297 | Bacteria | 2940 |
| 376 | Ga0157378_10302238 | 3300013297 | Bacteria | 1549 |
| 377 | Ga0163162_10001909 | 3300013306 | Bacteria | 19640 |
| 378 | Ga0163162_10040094 | 3300013306 | Bacteria | 4681 |
| 379 | Ga0163162_10041475 | 3300013306 | Bacteria | 4605 |
| 380 | Ga0163162_10053558 | 3300013306 | Bacteria | 4056 |
| 381 | Ga0163162_10114327 | 3300013306 | Bacteria | 2798 |
| 382 | Ga0163162_10134352 | 3300013306 | Bacteria | 2584 |
| 383 | Ga0163162_10277471 | 3300013306 | Bacteria | 1808 |
| 384 | Ga0157372_10006560 | 3300013307 | Bacteria | 12382 |
| 385 | Ga0157375_10021587 | 3300013308 | Bacteria | 5908 |
| 386 | Ga0157375_10027966 | 3300013308 | Bacteria | 5278 |
| 387 | Ga0157375_10191451 | 3300013308 | Bacteria | 2200 |
| 388 | Ga0163163_10010972 | 3300014325 | Bacteria | 8188 |
| 389 | Ga0163163_10127210 | 3300014325 | Bacteria | 2586 |
| 390 | Ga0163163_10308697 | 3300014325 | Bacteria | 1635 |
| 391 | Ga0163163_10354179 | 3300014325 | Bacteria | 1524 |
| 392 | Ga0157380_10065010 | 3300014326 | Bacteria | 2930 |
| 393 | Ga0157380_10189385 | 3300014326 | Bacteria | 1815 |
| 394 | Ga0182008_10002327 | 3300014497 | Bacteria | 11969 |
| 395 | Ga0182008_10053607 | 3300014497 | Bacteria | 1996 |
| 396 | Ga0157377_10000032 | 3300014745 | Bacteria | 121003 |
| 397 | Ga0157379_10026406 | 3300014968 | Bacteria | 5169 |
| 398 | Ga0157379_10092466 | 3300014968 | Bacteria | 2713 |
| 399 | Ga0157379_10166222 | 3300014968 | Bacteria | 1991 |
| 400 | Ga0157379_10201601 | 3300014968 | Bacteria | 1799 |
| 401 | Ga0157379_10277561 | 3300014968 | Bacteria | 1525 |
| 402 | Ga0157376_10135506 | 3300014969 | Bacteria | 2203 |
| 403 | Ga0157376_10300509 | 3300014969 | Bacteria | 1519 |
| 404 | Ga0182006_1052068 | 3300015261 | Bacteria | 1574 |
| 405 | Ga0182007_10001161 | 3300015262 | Bacteria | 14261 |
| 406 | Ga0183362_10002 | 3300015683 | Bacteria | 1432711 |
| 407 | Ga0163161_10025674 | 3300017792 | Bacteria | 4171 |
| 408 | Ga0163161_10190847 | 3300017792 | Bacteria | 1575 |
| 409 | Ga0214544_1000013 | 3300021320 | Bacteria | 228947 |
| 410 | Ga0214544_1000018 | 3300021320 | Bacteria | 187095 |
| 411 | Ga0214542_1000013 | 3300021321 | Bacteria | 234019 |
| 412 | Ga0214542_1000081 | 3300021321 | Bacteria | 121242 |
| 413 | Ga0214542_1022360 | 3300021321 | Bacteria | 4073 |
| 414 | Ga0214545_1000012 | 3300021324 | Bacteria | 187898 |
| 415 | Ga0214543_1000012 | 3300021327 | Bacteria | 338982 |
| 416 | Ga0214543_1000042 | 3300021327 | Bacteria | 164433 |
| 417 | Ga0214543_1000065 | 3300021327 | Bacteria | 126516 |
| 418 | Ga0213873_10000963 | 3300021358 | Bacteria | 4664 |
| 419 | Ga0213874_10017590 | 3300021377 | Bacteria | 1919 |
| 420 | Ga0213874_10036705 | 3300021377 | Bacteria | 1446 |
| 421 | Ga0213876_10002957 | 3300021384 | Bacteria | 9843 |
| 422 | Ga0209674_100041 | 3300025226 | Bacteria | 396231 |
| 423 | Ga0209674_100048 | 3300025226 | Bacteria | 353032 |
| 424 | Ga0209672_106802 | 3300025228 | Bacteria | 1823 |
| 425 | Ga0209563_100043 | 3300025230 | Bacteria | 397271 |
| 426 | Ga0209258_100267 | 3300025242 | Bacteria | 89896 |
| 427 | Ga0209646_1000069 | 3300025246 | Bacteria | 230340 |
| 428 | Ga0209026_1000006 | 3300025250 | Bacteria | 677225 |
| 429 | Ga0209677_100212 | 3300025253 | Bacteria | 43828 |
| 430 | Ga0209677_100805 | 3300025253 | Bacteria | 15686 |
| 431 | Ga0209677_101117 | 3300025253 | Bacteria | 12572 |
| 432 | Ga0209148_1000643 | 3300025254 | Bacteria | 30450 |
| 433 | Ga0209148_1000647 | 3300025254 | Bacteria | 30166 |
| 434 | Ga0209148_1011717 | 3300025254 | Bacteria | 1623 |
| 435 | Ga0209759_1000032 | 3300025256 | Bacteria | 278697 |
| 436 | Ga0209759_1000075 | 3300025256 | Bacteria | 176235 |
| 437 | Ga0209759_1000691 | 3300025256 | Bacteria | 30300 |
| 438 | Ga0209759_1000951 | 3300025256 | Bacteria | 20726 |
| 439 | Ga0209759_1006433 | 3300025256 | Bacteria | 3944 |
| 440 | Ga0209129_1001986 | 3300025258 | Bacteria | 10630 |
| 441 | Ga0209129_1004886 | 3300025258 | Bacteria | 5007 |
| 442 | Ga0209233_1001170 | 3300025261 | Bacteria | 10599 |
| 443 | Ga0209233_1010430 | 3300025261 | Bacteria | 2784 |
| 444 | Ga0209233_1016614 | 3300025261 | Bacteria | 2024 |
| 445 | Ga0209455_1000158 | 3300025272 | Bacteria | 118973 |
| 446 | Ga0209455_1005167 | 3300025272 | Bacteria | 4097 |
| 447 | Ga0209673_1005041 | 3300025273 | Bacteria | 6811 |
| 448 | Ga0209025_1006605 | 3300025294 | Bacteria | 8936 |
| 449 | Ga0209758_1008781 | 3300025297 | Bacteria | 6442 |
| 450 | Ga0209758_1018742 | 3300025297 | Bacteria | 3375 |
| 451 | Ga0209758_1039634 | 3300025297 | Bacteria | 1789 |
| 452 | Ga0209050_1008894 | 3300025298 | Bacteria | 5256 |
| 453 | Ga0207426_1000039 | 3300025302 | Bacteria | 439937 |
| 454 | Ga0207426_1042886 | 3300025302 | Bacteria | 1393 |
| 455 | Ga0209051_1000253 | 3300025303 | Bacteria | 90622 |
| 456 | Ga0209051_1006237 | 3300025303 | Bacteria | 6763 |
| 457 | Ga0209051_1007994 | 3300025303 | Bacteria | 5678 |
| 458 | Ga0209051_1010924 | 3300025303 | Bacteria | 4531 |
| 459 | Ga0209257_1008074 | 3300025304 | Bacteria | 6126 |
| 460 | Ga0207697_10011897 | 3300025315 | Bacteria | 3667 |
| 461 | Ga0207697_10080082 | 3300025315 | Bacteria | 1376 |
| 462 | Ga0207656_10058279 | 3300025321 | Bacteria | 1687 |
| 463 | Ga0207653_10025620 | 3300025885 | Bacteria | 1886 |
| 464 | Ga0207682_10004544 | 3300025893 | Bacteria | 5781 |
| 465 | Ga0207692_10001920 | 3300025898 | Bacteria | 7914 |
| 466 | Ga0207692_10004113 | 3300025898 | Bacteria | 5740 |
| 467 | Ga0207642_10077887 | 3300025899 | Bacteria | 1601 |
| 468 | Ga0207710_10012995 | 3300025900 | Bacteria | 3507 |
| 469 | Ga0207680_10064483 | 3300025903 | Bacteria | 2246 |
| 470 | Ga0207647_10005772 | 3300025904 | Bacteria | 9031 |
| 471 | Ga0207699_10005809 | 3300025906 | Bacteria | 5936 |
| 472 | Ga0207699_10021067 | 3300025906 | Bacteria | 3506 |
| 473 | Ga0207699_10080639 | 3300025906 | Bacteria | 2017 |
| 474 | Ga0207645_10037323 | 3300025907 | Bacteria | 3117 |
| 475 | Ga0207645_10046830 | 3300025907 | Bacteria | 2762 |
| 476 | Ga0207645_10111369 | 3300025907 | Bacteria | 1772 |
| 477 | Ga0207645_10194661 | 3300025907 | Bacteria | 1333 |
| 478 | Ga0207643_10028118 | 3300025908 | Bacteria | 3121 |
| 479 | Ga0207705_10012116 | 3300025909 | Bacteria | 6232 |
| 480 | Ga0207705_10063917 | 3300025909 | Bacteria | 2659 |
| 481 | Ga0207684_10003492 | 3300025910 | Bacteria | 15341 |
| 482 | Ga0207684_10150913 | 3300025910 | Bacteria | 1999 |
| 483 | Ga0207654_10044646 | 3300025911 | Bacteria | 2518 |
| 484 | Ga0207654_10104159 | 3300025911 | Bacteria | 1753 |
| 485 | Ga0207707_10001229 | 3300025912 | Bacteria | 24021 |
| 486 | Ga0207707_10020086 | 3300025912 | Bacteria | 5830 |
| 487 | Ga0207707_10044886 | 3300025912 | Bacteria | 3852 |
| 488 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 489 | Ga0207695_10010418 | 3300025913 | Bacteria | 11374 |
| 490 | Ga0207695_10030775 | 3300025913 | Bacteria | 5905 |
| 491 | Ga0207695_10128881 | 3300025913 | Bacteria | 2489 |
| 492 | Ga0207695_10308852 | 3300025913 | Bacteria | 1472 |
| 493 | Ga0207671_10009057 | 3300025914 | Bacteria | 8368 |
| 494 | Ga0207671_10011585 | 3300025914 | Bacteria | 7161 |
| 495 | Ga0207671_10018145 | 3300025914 | Bacteria | 5406 |
| 496 | Ga0207671_10031044 | 3300025914 | Bacteria | 3983 |
| 497 | Ga0207671_10073481 | 3300025914 | Bacteria | 2554 |
| 498 | Ga0207671_10103726 | 3300025914 | Bacteria | 2157 |
| 499 | Ga0207671_10222759 | 3300025914 | Bacteria | 1478 |
| 500 | Ga0207671_10263597 | 3300025914 | Bacteria | 1356 |
| 501 | Ga0207693_10006626 | 3300025915 | Bacteria | 9565 |
| 502 | Ga0207693_10006645 | 3300025915 | Bacteria | 9555 |
| 503 | Ga0207693_10022713 | 3300025915 | Bacteria | 4983 |
| 504 | Ga0207693_10067559 | 3300025915 | Bacteria | 2799 |
| 505 | Ga0207663_10000075 | 3300025916 | Bacteria | 47189 |
| 506 | Ga0207663_10030257 | 3300025916 | Bacteria | 3192 |
| 507 | Ga0207663_10165866 | 3300025916 | Bacteria | 1564 |
| 508 | Ga0207662_10092474 | 3300025918 | Bacteria | 1862 |
| 509 | Ga0207657_10000658 | 3300025919 | Bacteria | 36762 |
| 510 | Ga0207657_10011685 | 3300025919 | Bacteria | 8701 |
| 511 | Ga0207657_10154515 | 3300025919 | Bacteria | 1867 |
| 512 | Ga0207649_10002873 | 3300025920 | Bacteria | 9481 |
| 513 | Ga0207649_10090706 | 3300025920 | Bacteria | 2000 |
| 514 | Ga0207649_10108412 | 3300025920 | Bacteria | 1851 |
| 515 | Ga0207652_10005888 | 3300025921 | Bacteria | 9920 |
| 516 | Ga0207652_10027465 | 3300025921 | Bacteria | 4743 |
| 517 | Ga0207646_10069582 | 3300025922 | Bacteria | 3143 |
| 518 | Ga0207681_10015333 | 3300025923 | Bacteria | 4779 |
| 519 | Ga0207681_10126500 | 3300025923 | Bacteria | 1883 |
| 520 | Ga0207681_10153364 | 3300025923 | Bacteria | 1729 |
| 521 | Ga0207694_10002406 | 3300025924 | Bacteria | 15296 |
| 522 | Ga0207694_10005548 | 3300025924 | Bacteria | 9669 |
| 523 | Ga0207694_10012928 | 3300025924 | Bacteria | 6287 |
| 524 | Ga0207659_10089124 | 3300025926 | Bacteria | 2300 |
| 525 | Ga0207687_10053770 | 3300025927 | Bacteria | 2815 |
| 526 | Ga0207687_10144716 | 3300025927 | Bacteria | 1807 |
| 527 | Ga0207700_10102267 | 3300025928 | Bacteria | 2288 |
| 528 | Ga0207700_10128828 | 3300025928 | Bacteria | 2063 |
| 529 | Ga0207700_10133916 | 3300025928 | Bacteria | 2027 |
| 530 | Ga0207700_10155650 | 3300025928 | Bacteria | 1893 |
| 531 | Ga0207700_10160945 | 3300025928 | Bacteria | 1864 |
| 532 | Ga0207700_10351537 | 3300025928 | Bacteria | 1283 |
| 533 | Ga0207664_10012282 | 3300025929 | Bacteria | 6121 |
| 534 | Ga0207664_10017070 | 3300025929 | Bacteria | 5309 |
| 535 | Ga0207664_10037837 | 3300025929 | Bacteria | 3737 |
| 536 | Ga0207664_10147166 | 3300025929 | Bacteria | 1998 |
| 537 | Ga0207644_10013240 | 3300025931 | Bacteria | 5495 |
| 538 | Ga0207644_10028664 | 3300025931 | Bacteria | 3857 |
| 539 | Ga0207644_10069782 | 3300025931 | Bacteria | 2566 |
| 540 | Ga0207690_10098147 | 3300025932 | Bacteria | 2086 |
| 541 | Ga0207690_10185089 | 3300025932 | Bacteria | 1571 |
| 542 | Ga0207690_10195613 | 3300025932 | Bacteria | 1532 |
| 543 | Ga0207706_10000266 | 3300025933 | Bacteria | 56883 |
| 544 | Ga0207706_10033826 | 3300025933 | Bacteria | 4549 |
| 545 | Ga0207706_10041595 | 3300025933 | Bacteria | 4073 |
| 546 | Ga0207706_10060636 | 3300025933 | Bacteria | 3332 |
| 547 | Ga0207706_10096803 | 3300025933 | Bacteria | 2596 |
| 548 | Ga0207706_10205795 | 3300025933 | Bacteria | 1726 |
| 549 | Ga0207706_10214218 | 3300025933 | Bacteria | 1688 |
| 550 | Ga0207706_10495171 | 3300025933 | Bacteria | 1055 |
| 551 | Ga0207709_10000641 | 3300025935 | Bacteria | 28524 |
| 552 | Ga0207709_10008413 | 3300025935 | Bacteria | 5706 |
| 553 | Ga0207709_10045251 | 3300025935 | Bacteria | 2664 |
| 554 | Ga0207709_10204766 | 3300025935 | Bacteria | 1412 |
| 555 | Ga0207709_10255018 | 3300025935 | Bacteria | 1283 |
| 556 | Ga0207670_10040156 | 3300025936 | Bacteria | 3070 |
| 557 | Ga0207669_10006725 | 3300025937 | Bacteria | 5275 |
| 558 | Ga0207669_10034479 | 3300025937 | Bacteria | 2868 |
| 559 | Ga0207669_10092948 | 3300025937 | Bacteria | 1969 |
| 560 | Ga0207704_10045296 | 3300025938 | Bacteria | 2613 |
| 561 | Ga0207704_10200172 | 3300025938 | Bacteria | 1461 |
| 562 | Ga0207665_10001949 | 3300025939 | Bacteria | 13896 |
| 563 | Ga0207665_10007226 | 3300025939 | Bacteria | 7349 |
| 564 | Ga0207665_10017888 | 3300025939 | Bacteria | 4659 |
| 565 | Ga0207691_10111908 | 3300025940 | Bacteria | 2427 |
| 566 | Ga0207691_10115632 | 3300025940 | Bacteria | 2382 |
| 567 | Ga0207691_10339752 | 3300025940 | Bacteria | 1285 |
| 568 | Ga0207711_10017162 | 3300025941 | Bacteria | 6014 |
| 569 | Ga0207711_10181074 | 3300025941 | Bacteria | 1916 |
| 570 | Ga0207711_10192015 | 3300025941 | Bacteria | 1861 |
| 571 | Ga0207711_10365190 | 3300025941 | Bacteria | 1338 |
| 572 | Ga0207711_10430765 | 3300025941 | Bacteria | 1227 |
| 573 | Ga0207689_10001210 | 3300025942 | Bacteria | 24834 |
| 574 | Ga0207689_10008082 | 3300025942 | Bacteria | 9176 |
| 575 | Ga0207689_10020623 | 3300025942 | Bacteria | 5543 |
| 576 | Ga0207689_10030832 | 3300025942 | Bacteria | 4468 |
| 577 | Ga0207689_10063252 | 3300025942 | Bacteria | 3044 |
| 578 | Ga0207661_10000703 | 3300025944 | Bacteria | 21689 |
| 579 | Ga0207661_10035367 | 3300025944 | Bacteria | 3892 |
| 580 | Ga0207661_10241994 | 3300025944 | Bacteria | 1601 |
| 581 | Ga0207679_10012204 | 3300025945 | Bacteria | 5596 |
| 582 | Ga0207679_10145087 | 3300025945 | Bacteria | 1924 |
| 583 | Ga0207679_10194492 | 3300025945 | Bacteria | 1689 |
| 584 | Ga0207679_10267142 | 3300025945 | Bacteria | 1461 |
| 585 | Ga0207667_10017780 | 3300025949 | Bacteria | 7995 |
| 586 | Ga0207667_10033492 | 3300025949 | Bacteria | 5523 |
| 587 | Ga0207667_10086269 | 3300025949 | Bacteria | 3248 |
| 588 | Ga0207667_10099955 | 3300025949 | Bacteria | 2993 |
| 589 | Ga0207667_10124871 | 3300025949 | Bacteria | 2651 |
| 590 | Ga0207667_10170598 | 3300025949 | Bacteria | 2236 |
| 591 | Ga0207651_10002064 | 3300025960 | Bacteria | 9461 |
| 592 | Ga0207651_10065970 | 3300025960 | Bacteria | 2541 |
| 593 | Ga0207651_10162582 | 3300025960 | Bacteria | 1752 |
| 594 | Ga0207712_10046477 | 3300025961 | Bacteria | 3010 |
| 595 | Ga0207712_10178291 | 3300025961 | Bacteria | 1667 |
| 596 | Ga0207712_10247137 | 3300025961 | Bacteria | 1440 |
| 597 | Ga0207668_10020133 | 3300025972 | Bacteria | 4232 |
| 598 | Ga0207668_10025131 | 3300025972 | Bacteria | 3850 |
| 599 | Ga0207668_10066910 | 3300025972 | Bacteria | 2548 |
| 600 | Ga0207668_10078537 | 3300025972 | Bacteria | 2384 |
| 601 | Ga0207668_10105696 | 3300025972 | Bacteria | 2102 |
| 602 | Ga0207668_10153926 | 3300025972 | Bacteria | 1783 |
| 603 | Ga0207668_10157297 | 3300025972 | Bacteria | 1767 |
| 604 | Ga0207668_10201702 | 3300025972 | Bacteria | 1584 |
| 605 | Ga0207668_10226514 | 3300025972 | Bacteria | 1504 |
| 606 | Ga0207668_10289405 | 3300025972 | Bacteria | 1347 |
| 607 | Ga0207640_10013803 | 3300025981 | Bacteria | 4639 |
| 608 | Ga0207640_10022152 | 3300025981 | Bacteria | 3798 |
| 609 | Ga0207640_10062328 | 3300025981 | Bacteria | 2474 |
| 610 | Ga0207658_10002081 | 3300025986 | Bacteria | 14887 |
| 611 | Ga0207658_10011725 | 3300025986 | Bacteria | 5969 |
| 612 | Ga0207658_10027878 | 3300025986 | Bacteria | 3973 |
| 613 | Ga0207677_10024222 | 3300026023 | Bacteria | 3767 |
| 614 | Ga0207677_10034058 | 3300026023 | Bacteria | 3294 |
| 615 | Ga0207677_10068685 | 3300026023 | Bacteria | 2489 |
| 616 | Ga0207677_10152481 | 3300026023 | Bacteria | 1785 |
| 617 | Ga0207677_10155552 | 3300026023 | Bacteria | 1770 |
| 618 | Ga0207703_10022170 | 3300026035 | Bacteria | 4979 |
| 619 | Ga0207703_10077650 | 3300026035 | Bacteria | 2757 |
| 620 | Ga0207703_10144618 | 3300026035 | Bacteria | 2067 |
| 621 | Ga0207703_10369499 | 3300026035 | Bacteria | 1325 |
| 622 | Ga0207639_10048968 | 3300026041 | Bacteria | 3201 |
| 623 | Ga0207639_10066316 | 3300026041 | Bacteria | 2805 |
| 624 | Ga0207678_10038950 | 3300026067 | Bacteria | 4127 |
| 625 | Ga0207678_10051569 | 3300026067 | Bacteria | 3552 |
| 626 | Ga0207678_10141187 | 3300026067 | Bacteria | 2056 |
| 627 | Ga0207678_10271466 | 3300026067 | Bacteria | 1454 |
| 628 | Ga0207702_10000942 | 3300026078 | Bacteria | 29961 |
| 629 | Ga0207702_10004171 | 3300026078 | Bacteria | 12941 |
| 630 | Ga0207702_10089229 | 3300026078 | Bacteria | 2696 |
| 631 | Ga0207641_10067734 | 3300026088 | Bacteria | 3059 |
| 632 | Ga0207641_10071518 | 3300026088 | Bacteria | 2984 |
| 633 | Ga0207648_10000172 | 3300026089 | Bacteria | 66986 |
| 634 | Ga0207648_10004439 | 3300026089 | Bacteria | 14397 |
| 635 | Ga0207648_10067027 | 3300026089 | Bacteria | 3130 |
| 636 | Ga0207648_10086738 | 3300026089 | Bacteria | 2731 |
| 637 | Ga0207648_10172858 | 3300026089 | Bacteria | 1910 |
| 638 | Ga0207676_10064256 | 3300026095 | Bacteria | 2918 |
| 639 | Ga0207674_10000118 | 3300026116 | Bacteria | 92408 |
| 640 | Ga0207674_10001181 | 3300026116 | Bacteria | 33934 |
| 641 | Ga0207674_10053120 | 3300026116 | Bacteria | 4130 |
| 642 | Ga0207674_10202893 | 3300026116 | Bacteria | 1932 |
| 643 | Ga0207674_10205570 | 3300026116 | Bacteria | 1918 |
| 644 | Ga0207675_100017216 | 3300026118 | Bacteria | 6749 |
| 645 | Ga0207675_100087869 | 3300026118 | Bacteria | 2920 |
| 646 | Ga0207675_100091301 | 3300026118 | Bacteria | 2863 |
| 647 | Ga0207675_100258500 | 3300026118 | Bacteria | 1687 |
| 648 | Ga0207683_10039922 | 3300026121 | Bacteria | 4094 |
| 649 | Ga0207683_10062801 | 3300026121 | Bacteria | 3272 |
| 650 | Ga0207683_10064742 | 3300026121 | Bacteria | 3222 |
| 651 | Ga0207683_10099317 | 3300026121 | Bacteria | 2598 |
| 652 | Ga0207683_10292745 | 3300026121 | Bacteria | 1489 |
| 653 | Ga0207698_10007421 | 3300026142 | Bacteria | 6869 |
| 654 | Ga0207698_10016114 | 3300026142 | Bacteria | 5029 |
| 655 | Ga0207698_10210522 | 3300026142 | Bacteria | 1749 |
| 656 | Ga0209389_1000100 | 3300027296 | Bacteria | 79023 |
| 657 | Ga0209389_1000181 | 3300027296 | Bacteria | 49013 |
| 658 | Ga0209589_1000042 | 3300027357 | Bacteria | 122436 |
| 659 | Ga0209589_1000092 | 3300027357 | Bacteria | 89530 |
| 660 | Ga0209489_100006 | 3300027361 | Bacteria | 475698 |
| 661 | Ga0209489_100095 | 3300027361 | Bacteria | 122436 |
| 662 | Ga0209489_103729 | 3300027361 | Bacteria | 29160 |
| 663 | Ga0209700_100005 | 3300027363 | Bacteria | 573969 |
| 664 | Ga0209700_100095 | 3300027363 | Bacteria | 122436 |
| 665 | Ga0209179_1003933 | 3300027512 | Bacteria | 2196 |
| 666 | Ga0209813_10024127 | 3300027866 | Bacteria | 1736 |
| 667 | Ga0207428_10119704 | 3300027907 | Bacteria | 2020 |
| 668 | Ga0268266_10002919 | 3300028379 | Bacteria | 17681 |
| 669 | Ga0268266_10008606 | 3300028379 | Bacteria | 9062 |
| 670 | Ga0268266_10047223 | 3300028379 | Bacteria | 3688 |
| 671 | Ga0268266_10070968 | 3300028379 | Bacteria | 3019 |
| 672 | Ga0268266_10170082 | 3300028379 | Bacteria | 1977 |
| 673 | Ga0268266_10189445 | 3300028379 | Bacteria | 1877 |
| 674 | Ga0268265_10028233 | 3300028380 | Bacteria | 4016 |
| 675 | Ga0268265_10031405 | 3300028380 | Bacteria | 3836 |
| 676 | Ga0268265_10089897 | 3300028380 | Bacteria | 2451 |
| 677 | Ga0268265_10204786 | 3300028380 | Bacteria | 1714 |
| 678 | Ga0268265_10242142 | 3300028380 | Bacteria | 1592 |
| 679 | Ga0268265_10388650 | 3300028380 | Bacteria | 1286 |
| 680 | Ga0268264_10000050 | 3300028381 | Bacteria | 323697 |
| 681 | Ga0268264_10089984 | 3300028381 | Bacteria | 2644 |
| 682 | Ga0268264_10092502 | 3300028381 | Bacteria | 2611 |
| 683 | Ga0268264_10323527 | 3300028381 | Bacteria | 1459 |
| 684 | Ga0307517_10001469 | 3300028786 | Bacteria | 39464 |
| 685 | Ga0307517_10067186 | 3300028786 | Bacteria | 3286 |
| 686 | Ga0307517_10083974 | 3300028786 | Bacteria | 2685 |
| 687 | Ga0307515_10000131 | 3300028794 | Bacteria | 178919 |
| 688 | Ga0307515_10000240 | 3300028794 | Bacteria | 135655 |
| 689 | Ga0307515_10001319 | 3300028794 | Bacteria | 56336 |
| 690 | Ga0307515_10003518 | 3300028794 | Bacteria | 32919 |
| 691 | Ga0307515_10005390 | 3300028794 | Bacteria | 25923 |
| 692 | Ga0307515_10054084 | 3300028794 | Bacteria | 5902 |
| 693 | Ga0307515_10134875 | 3300028794 | Bacteria | 2692 |
| 694 | Ga0307515_10223224 | 3300028794 | Bacteria | 1696 |
| 695 | Ga0307512_10089762 | 3300030522 | Bacteria | 2148 |
| 696 | Ga0265330_10015050 | 3300031235 | Bacteria | 3582 |
| 697 | Ga0265332_10037532 | 3300031238 | Bacteria | 2101 |
| 698 | Ga0265328_10029354 | 3300031239 | Bacteria | 2054 |
| 699 | Ga0265328_10030050 | 3300031239 | Bacteria | 2026 |
| 700 | Ga0265325_10061509 | 3300031241 | Bacteria | 1904 |
| 701 | Ga0265340_10007729 | 3300031247 | Bacteria | 5831 |
| 702 | Ga0265339_10050005 | 3300031249 | Bacteria | 2287 |
| 703 | Ga0265331_10001729 | 3300031250 | Bacteria | 15720 |
| 704 | Ga0265327_10003742 | 3300031251 | Bacteria | 14142 |
| 705 | Ga0307513_10049358 | 3300031456 | Bacteria | 4560 |
| 706 | Ga0307513_10064413 | 3300031456 | Bacteria | 3863 |
| 707 | Ga0307513_10197129 | 3300031456 | Bacteria | 1859 |
| 708 | Ga0307513_10337544 | 3300031456 | Bacteria | 1258 |
| 709 | Ga0307513_10355563 | 3300031456 | Bacteria | 1211 |
| 710 | Ga0307509_10003237 | 3300031507 | Bacteria | 25135 |
| 711 | Ga0307509_10013707 | 3300031507 | Bacteria | 9573 |
| 712 | Ga0307509_10017777 | 3300031507 | Bacteria | 8171 |
| 713 | Ga0307509_10085879 | 3300031507 | Bacteria | 3237 |
| 714 | Ga0307509_10228759 | 3300031507 | Bacteria | 1664 |
| 715 | Ga0307509_10322717 | 3300031507 | Bacteria | 1280 |
| 716 | Ga0307408_100032090 | 3300031548 | Bacteria | 3662 |
| 717 | Ga0265313_10000543 | 3300031595 | Bacteria | 39362 |
| 718 | Ga0307508_10000029 | 3300031616 | Bacteria | 168411 |
| 719 | Ga0307508_10005913 | 3300031616 | Bacteria | 11546 |
| 720 | Ga0307508_10024170 | 3300031616 | Bacteria | 5514 |
| 721 | Ga0307508_10042436 | 3300031616 | Bacteria | 4080 |
| 722 | Ga0307508_10083431 | 3300031616 | Bacteria | 2778 |
| 723 | Ga0307508_10108926 | 3300031616 | Bacteria | 2370 |
| 724 | Ga0307508_10114255 | 3300031616 | Bacteria | 2300 |
| 725 | Ga0307508_10304997 | 3300031616 | Bacteria | 1185 |
| 726 | Ga0265314_10042749 | 3300031711 | Bacteria | 3228 |
| 727 | Ga0265342_10048798 | 3300031712 | Bacteria | 2536 |
| 728 | Ga0265342_10132257 | 3300031712 | Bacteria | 1397 |
| 729 | Ga0307516_10000340 | 3300031730 | Bacteria | 61066 |
| 730 | Ga0307516_10000763 | 3300031730 | Bacteria | 43894 |
| 731 | Ga0307516_10001388 | 3300031730 | Bacteria | 33439 |
| 732 | Ga0307516_10004925 | 3300031730 | Bacteria | 16239 |
| 733 | Ga0307516_10007591 | 3300031730 | Bacteria | 12429 |
| 734 | Ga0307516_10007878 | 3300031730 | Bacteria | 12136 |
| 735 | Ga0307516_10039620 | 3300031730 | Bacteria | 4695 |
| 736 | Ga0307516_10050803 | 3300031730 | Bacteria | 4066 |
| 737 | Ga0307516_10099875 | 3300031730 | Bacteria | 2718 |
| 738 | Ga0307516_10209948 | 3300031730 | Bacteria | 1662 |
| 739 | Ga0307516_10294053 | 3300031730 | Bacteria | 1302 |
| 740 | Ga0307405_10018511 | 3300031731 | Bacteria | 3844 |
| 741 | Ga0307407_10039321 | 3300031903 | Bacteria | 2630 |
| 742 | Ga0307412_10072616 | 3300031911 | Bacteria | 2352 |
| 743 | Ga0307409_100001244 | 3300031995 | Bacteria | 12277 |
| 744 | Ga0307416_100143042 | 3300032002 | Bacteria | 2178 |
| 745 | Ga0307415_100001555 | 3300032126 | Bacteria | 11041 |
| 746 | Ga0307507_10143236 | 3300033179 | Bacteria | 1825 |
| 747 | Ga0307510_10012890 | 3300033180 | Bacteria | 9923 |
| 748 | Ga0307510_10015834 | 3300033180 | Bacteria | 8910 |
| 749 | Ga0307510_10065142 | 3300033180 | Bacteria | 3694 |
| 750 | Ga0307510_10077966 | 3300033180 | Bacteria | 3245 |
| 751 | Ga0307510_10119136 | 3300033180 | Bacteria | 2350 |
| 752 | Ga0307510_10150234 | 3300033180 | Bacteria | 1950 |
| 753 | Ga0307510_10233922 | 3300033180 | Bacteria | 1338 |
| 754 | Ga0373926_0025820 | 3300035083 | Bacteria | 2052 |
| 755 | Ga0373923_0051564 | 3300035111 | Bacteria | 1727 |
| 756 | Ga0373936_0013378 | 3300035113 | Bacteria | 3133 |
| 757 | Ga0373954_0000871 | 3300035118 | Bacteria | 11706 |
| 758 | Ga0373954_0028630 | 3300035118 | Bacteria | 2562 |
| 759 | Ga0373954_0071625 | 3300035118 | Bacteria | 1647 |
| 760 | Ga0373956_0003759 | 3300035119 | Bacteria | 6114 |
| 761 | Ga0373956_0028669 | 3300035119 | Bacteria | 2424 |
| 762 | Ga0373957_0000492 | 3300035120 | Bacteria | 9929 |
| 763 | Ga0373957_0004249 | 3300035120 | Bacteria | 4344 |
| 764 | Ga0373943_0005276 | 3300035170 | Bacteria | 5815 |
| 765 | Ga0373946_0018761 | 3300035171 | Bacteria | 2659 |
| 766 | Ga0373946_0035846 | 3300035171 | Bacteria | 2008 |
| 767 | Ga0373955_0004827 | 3300035172 | Bacteria | 6008 |
| 768 | Ga0373955_0041413 | 3300035172 | Bacteria | 2469 |
| 769 | Ga0373955_0195537 | 3300035172 | Bacteria | 1203 |
| 770 | Ga0373924_0001494 | 3300035410 | Bacteria | 7613 |
| 771 | Ga0373931_0056434 | 3300035691 | Bacteria | 2104 |
| 772 | Ga0373927_0000449 | 3300035695 | Bacteria | 31465 |
| 773 | Ga0373927_0006633 | 3300035695 | Bacteria | 7881 |
| 774 | Ga0373927_0011073 | 3300035695 | Bacteria | 6008 |
| 775 | Ga0373927_0016946 | 3300035695 | Bacteria | 4801 |
| 776 | Ga0373927_0033968 | 3300035695 | Bacteria | 3319 |
| 777 | Ga0373927_0124627 | 3300035695 | Bacteria | 1682 |
| 778 | Ga0373927_0277437 | 3300035695 | Bacteria | 1102 |
| 779 | Ga0373933_0000225 | 3300035724 | Bacteria | 37547 |
| 780 | Ga0373933_0001750 | 3300035724 | Bacteria | 12597 |
| 781 | Ga0373933_0009186 | 3300035724 | Bacteria | 5396 |
| 782 | Ga0373937_0100873 | 3300036401 | Bacteria | 2679 |
| 783 | Ga0373925_0007139 | 3300037068 | Bacteria | 8163 |
| 784 | Ga0373925_0066579 | 3300037068 | Bacteria | 2716 |
| 785 | Ga0373925_0164582 | 3300037068 | Bacteria | 1749 |
| 786 | Ga0373925_0326750 | 3300037068 | Bacteria | 1242 |
| 787 | Ga0395899_0001949 | 3300037312 | Bacteria | 16981 |
| 788 | Ga0395899_0038828 | 3300037312 | Bacteria | 3564 |
| 789 | Ga0395900_0044939 | 3300037418 | Bacteria | 4549 |
| 790 | Ga0395898_0005706 | 3300037466 | Bacteria | 13412 |
| 791 | Ga0395898_0524861 | 3300037466 | Bacteria | 1125 |
| 792 | Ga0395905_0000009 | 3300037471 | Bacteria | 488729 |
| 793 | Ga0395905_0000398 | 3300037471 | Bacteria | 61654 |
| 794 | Ga0395905_0025545 | 3300037471 | Bacteria | 5570 |
| 795 | Ga0395905_0026353 | 3300037471 | Bacteria | 5481 |
| 796 | Ga0395905_0046282 | 3300037471 | Bacteria | 4079 |
| 797 | Ga0395905_0061220 | 3300037471 | Bacteria | 3521 |
| 798 | Ga0395905_0062295 | 3300037471 | Bacteria | 3489 |
| 799 | Ga0395905_0128258 | 3300037471 | Bacteria | 2386 |
| 800 | Ga0395901_0019109 | 3300038443 | Bacteria | 7007 |
| 801 | Ga0395901_0117974 | 3300038443 | Bacteria | 2788 |
| 802 | Ga0395901_0245747 | 3300038443 | Bacteria | 1865 |
| 803 | Ga0436365_0164550 | 3300039437 | Bacteria | 3084 |
| 804 | Ga0436365_0954239 | 3300039437 | Bacteria | 40865 |
| 805 | Ga0436365_1246958 | 3300039437 | Bacteria | 2563 |
| 806 | Ga0436365_1290035 | 3300039437 | Bacteria | 2158 |
| 807 | Ga0436360_0323156 | 3300039438 | Bacteria | 2135 |
| 808 | Ga0436360_1001325 | 3300039438 | Bacteria | 17844 |
| 809 | Ga0436361_0086639 | 3300039447 | Bacteria | 2010 |
| 810 | Ga0436361_0613754 | 3300039447 | Bacteria | 2422 |
| 811 | Ga0436361_0768335 | 3300039447 | Bacteria | 1810 |
| 812 | Ga0436361_0833528 | 3300039447 | Bacteria | 1155 |
| 813 | Ga0436363_0657874 | 3300039450 | Bacteria | 5703 |
| 814 | Ga0436363_0715786 | 3300039450 | Bacteria | 1298 |
| 815 | Ga0436363_1349888 | 3300039450 | Bacteria | 1564 |
| 816 | Ga0436363_1534966 | 3300039450 | Bacteria | 3243 |
| 817 | Ga0436362_0022522 | 3300039453 | Bacteria | 5354 |
| 818 | Ga0436362_0952674 | 3300039453 | Bacteria | 3097 |
| 819 | Ga0439436_0000231 | 3300041404 | Bacteria | 13384 |
| 820 | Ga0439439_0007026 | 3300041406 | Bacteria | 2623 |
| 821 | Ga0439431_0038494 | 3300041997 | Bacteria | 1211 |
| 822 | Ga0439449_0015812 | 3300042007 | Bacteria | 2837 |
| 823 | Ga0439455_0022643 | 3300042012 | Bacteria | 1507 |
| 824 | Ga0450890_005209 | 3300042127 | Bacteria | 1676 |
| 825 | Ga0450898_027205 | 3300042134 | Bacteria | 1034 |
| 826 | Ga0439434_0012357 | 3300042435 | Bacteria | 2527 |
| 827 | Ga0466969_0004520 | 3300044656 | Bacteria | 7406 |
| 828 | Ga0466969_0006057 | 3300044656 | Bacteria | 6435 |
| 829 | Ga0466969_0017140 | 3300044656 | Bacteria | 3786 |
| 830 | Ga0466969_0050564 | 3300044656 | Bacteria | 2049 |
| 831 | Ga0466969_0075371 | 3300044656 | Bacteria | 1617 |
| 832 | Ga0466972_0000169 | 3300044658 | Bacteria | 51450 |
| 833 | Ga0466972_0003740 | 3300044658 | Bacteria | 7565 |
| 834 | Ga0466972_0005546 | 3300044658 | Bacteria | 6324 |
| 835 | Ga0466972_0060985 | 3300044658 | Bacteria | 1809 |
| 836 | Ga0453683_0000791 | 3300044673 | Bacteria | 31228 |
| 837 | Ga0466965_0003762 | 3300044683 | Bacteria | 6700 |
| 838 | Ga0466965_0021534 | 3300044683 | Bacteria | 3104 |
| 839 | Ga0466965_0048964 | 3300044683 | Bacteria | 2094 |
| 840 | Ga0466966_0001226 | 3300044684 | Bacteria | 16469 |
| 841 | Ga0466966_0028270 | 3300044684 | Bacteria | 3653 |
| 842 | Ga0466961_0000503 | 3300044693 | Bacteria | 24926 |
| 843 | Ga0466961_0014145 | 3300044693 | Bacteria | 5119 |
| 844 | Ga0466961_0016554 | 3300044693 | Bacteria | 4738 |
| 845 | Ga0466963_0002548 | 3300044694 | Bacteria | 10211 |
| 846 | Ga0466964_0029387 | 3300044706 | Bacteria | 2169 |
| 847 | Ga0466964_0041685 | 3300044706 | Bacteria | 1858 |
| 848 | Ga0466964_0057478 | 3300044706 | Bacteria | 1610 |
| 849 | Ga0466964_0059348 | 3300044706 | Bacteria | 1588 |
| 850 | Ga0466971_0011456 | 3300044719 | Bacteria | 3885 |
| 851 | Ga0466968_0005213 | 3300044735 | Bacteria | 4866 |
| 852 | Ga0466970_0001313 | 3300044765 | Bacteria | 12046 |
| 853 | Ga0466957_0090030 | 3300044842 | Bacteria | 1921 |
| 854 | Ga0466957_0129282 | 3300044842 | Bacteria | 1616 |
| 855 | Ga0466960_0021987 | 3300044901 | Bacteria | 2846 |
| 856 | Ga0466959_0000398 | 3300045049 | Bacteria | 25522 |
| 857 | Ga0466959_0045172 | 3300045049 | Bacteria | 3244 |
| 858 | Ga0466959_0089477 | 3300045049 | Bacteria | 2212 |
| 859 | Ga0466959_0102897 | 3300045049 | Bacteria | 2043 |
| 860 | Ga0451576_0013137 | 3300045051 | Bacteria | 9270 |
| 861 | Ga0451576_0089406 | 3300045051 | Bacteria | 3203 |
| 862 | Ga0451576_0463127 | 3300045051 | Bacteria | 1331 |
| 863 | Ga0466958_0002017 | 3300045836 | Bacteria | 10011 |
| 864 | Ga0466967_0003144 | 3300045976 | Bacteria | 10633 |
| 865 | Ga0466967_0029802 | 3300045976 | Bacteria | 4572 |
| 866 | Ga0466967_0214556 | 3300045976 | Bacteria | 1826 |
| 867 | Ga0495627_033911 | 3300046453 | Bacteria | 1598 |
| 868 | Ga0495592_0000205 | 3300046454 | Bacteria | 50544 |
| 869 | Ga0495592_0011229 | 3300046454 | Bacteria | 6770 |
| 870 | Ga0495592_0013147 | 3300046454 | Bacteria | 6299 |
| 871 | Ga0495592_0053757 | 3300046454 | Bacteria | 2986 |
| 872 | Ga0495603_0000818 | 3300046455 | Bacteria | 17861 |
| 873 | Ga0495590_0007877 | 3300046457 | Bacteria | 4088 |
| 874 | Ga0495629_0001431 | 3300046459 | Bacteria | 18823 |
| 875 | Ga0495629_0006770 | 3300046459 | Bacteria | 8470 |
| 876 | Ga0495629_0013918 | 3300046459 | Bacteria | 5799 |
| 877 | Ga0495629_0015490 | 3300046459 | Bacteria | 5474 |
| 878 | Ga0495629_0022831 | 3300046459 | Bacteria | 4458 |
| 879 | Ga0495629_0111637 | 3300046459 | Bacteria | 1906 |
| 880 | Ga0495638_0002582 | 3300046460 | Bacteria | 14642 |
| 881 | Ga0495638_0003476 | 3300046460 | Bacteria | 12375 |
| 882 | Ga0495638_0019761 | 3300046460 | Bacteria | 4453 |
| 883 | Ga0495641_0007310 | 3300046461 | Bacteria | 6917 |
| 884 | Ga0495641_0007710 | 3300046461 | Bacteria | 6677 |
| 885 | Ga0495651_0016327 | 3300046462 | Bacteria | 5749 |
| 886 | Ga0495651_0032580 | 3300046462 | Bacteria | 4064 |
| 887 | Ga0495651_0044409 | 3300046462 | Bacteria | 3444 |
| 888 | Ga0495653_0001246 | 3300046463 | Bacteria | 19690 |
| 889 | Ga0495653_0001607 | 3300046463 | Bacteria | 17763 |
| 890 | Ga0495653_0063267 | 3300046463 | Bacteria | 2793 |
| 891 | Ga0495653_0234911 | 3300046463 | Bacteria | 1225 |
| 892 | Ga0495650_0005654 | 3300046471 | Bacteria | 8031 |
| 893 | Ga0495650_0066156 | 3300046471 | Bacteria | 1431 |
| 894 | Ga0495580_0000010 | 3300046472 | Bacteria | 99935 |
| 895 | Ga0495580_0000419 | 3300046472 | Bacteria | 35257 |
| 896 | Ga0495580_0016170 | 3300046472 | Bacteria | 5607 |
| 897 | Ga0495582_0000897 | 3300046473 | Bacteria | 16550 |
| 898 | Ga0495582_0001574 | 3300046473 | Bacteria | 12874 |
| 899 | Ga0495582_0034022 | 3300046473 | Bacteria | 2802 |
| 900 | Ga0495605_0011410 | 3300046474 | Bacteria | 4953 |
| 901 | Ga0495605_0011724 | 3300046474 | Bacteria | 4880 |
| 902 | Ga0495605_0059097 | 3300046474 | Bacteria | 1842 |
| 903 | Ga0495639_0000021 | 3300046475 | Bacteria | 73256 |
| 904 | Ga0495662_0001876 | 3300046476 | Bacteria | 10528 |
| 905 | Ga0495664_0000581 | 3300046477 | Bacteria | 18414 |
| 906 | Ga0495664_0012190 | 3300046477 | Bacteria | 4866 |
| 907 | Ga0495585_0014960 | 3300046492 | Bacteria | 4512 |
| 908 | Ga0495585_0053087 | 3300046492 | Bacteria | 2243 |
| 909 | Ga0495585_0056755 | 3300046492 | Bacteria | 2162 |
| 910 | Ga0495594_0000199 | 3300046499 | Bacteria | 29410 |
| 911 | Ga0495594_0108073 | 3300046499 | Bacteria | 1567 |
| 912 | Ga0495607_0008139 | 3300046501 | Bacteria | 7191 |
| 913 | Ga0495607_0150057 | 3300046501 | Bacteria | 1194 |
| 914 | Ga0495583_0028721 | 3300046506 | Bacteria | 2731 |
| 915 | Ga0495606_0011074 | 3300046507 | Bacteria | 7394 |
| 916 | Ga0495606_0058867 | 3300046507 | Bacteria | 2467 |
| 917 | Ga0495606_0105318 | 3300046507 | Bacteria | 1710 |
| 918 | Ga0495608_0005805 | 3300046511 | Bacteria | 8795 |
| 919 | Ga0495608_0076051 | 3300046511 | Bacteria | 2188 |
| 920 | Ga0495610_0026452 | 3300046512 | Bacteria | 3097 |
| 921 | Ga0495610_0055986 | 3300046512 | Bacteria | 1898 |
| 922 | Ga0495618_0002544 | 3300046514 | Bacteria | 11677 |
| 923 | Ga0495618_0009590 | 3300046514 | Bacteria | 5846 |
| 924 | Ga0495618_0009795 | 3300046514 | Bacteria | 5793 |
| 925 | Ga0495618_0064509 | 3300046514 | Bacteria | 2327 |
| 926 | Ga0495618_0108804 | 3300046514 | Bacteria | 1775 |
| 927 | Ga0495628_0006259 | 3300046516 | Bacteria | 10402 |
| 928 | Ga0495628_0010408 | 3300046516 | Bacteria | 7900 |
| 929 | Ga0495628_0040141 | 3300046516 | Bacteria | 3740 |
| 930 | Ga0495628_0165123 | 3300046516 | Bacteria | 1681 |
| 931 | Ga0495630_0006163 | 3300046517 | Bacteria | 8505 |
| 932 | Ga0495630_0027758 | 3300046517 | Bacteria | 4203 |
| 933 | Ga0495630_0059379 | 3300046517 | Bacteria | 2869 |
| 934 | Ga0495631_0020145 | 3300046518 | Bacteria | 3120 |
| 935 | Ga0495632_0015766 | 3300046519 | Bacteria | 4224 |
| 936 | Ga0495632_0016557 | 3300046519 | Bacteria | 4097 |
| 937 | Ga0495632_0112571 | 3300046519 | Bacteria | 1277 |
| 938 | Ga0495643_0008482 | 3300046522 | Bacteria | 6501 |
| 939 | Ga0495643_0025154 | 3300046522 | Bacteria | 3371 |
| 940 | Ga0495643_0048728 | 3300046522 | Bacteria | 2288 |
| 941 | Ga0495644_0031250 | 3300046523 | Bacteria | 2012 |
| 942 | Ga0495648_0000234 | 3300046524 | Bacteria | 63485 |
| 943 | Ga0495648_0012986 | 3300046524 | Bacteria | 6183 |
| 944 | Ga0495648_0033989 | 3300046524 | Bacteria | 3325 |
| 945 | Ga0495666_0001171 | 3300046526 | Bacteria | 12598 |
| 946 | Ga0495666_0007712 | 3300046526 | Bacteria | 5385 |
| 947 | Ga0495642_0005522 | 3300046528 | Bacteria | 4858 |
| 948 | Ga0495652_0003670 | 3300046529 | Bacteria | 15031 |
| 949 | Ga0495652_0014405 | 3300046529 | Bacteria | 7099 |
| 950 | Ga0495652_0076299 | 3300046529 | Bacteria | 2781 |
| 951 | Ga0495652_0202693 | 3300046529 | Bacteria | 1504 |
| 952 | Ga0495654_0078699 | 3300046530 | Bacteria | 1550 |
| 953 | Ga0495665_0006815 | 3300046531 | Bacteria | 6164 |
| 954 | Ga0495665_0007347 | 3300046531 | Bacteria | 5954 |
| 955 | Ga0495640_0001933 | 3300046533 | Bacteria | 16508 |
| 956 | Ga0495640_0008697 | 3300046533 | Bacteria | 7957 |
| 957 | Ga0495640_0009862 | 3300046533 | Bacteria | 7410 |
| 958 | Ga0495640_0032849 | 3300046533 | Bacteria | 3693 |
| 959 | Ga0495586_0012030 | 3300046535 | Bacteria | 4596 |
| 960 | Ga0495587_0000646 | 3300046536 | Bacteria | 23379 |
| 961 | Ga0495587_0004784 | 3300046536 | Bacteria | 8891 |
| 962 | Ga0495587_0055034 | 3300046536 | Bacteria | 2344 |
| 963 | Ga0495598_0001977 | 3300046537 | Bacteria | 4164 |
| 964 | Ga0495609_0032932 | 3300046538 | Bacteria | 2353 |
| 965 | Ga0495621_0002523 | 3300046539 | Bacteria | 4937 |
| 966 | Ga0495597_0012282 | 3300046542 | Bacteria | 4133 |
| 967 | Ga0495597_0063646 | 3300046542 | Bacteria | 1603 |
| 968 | Ga0495645_0003644 | 3300046543 | Bacteria | 10461 |
| 969 | Ga0495622_0001054 | 3300046557 | Bacteria | 14632 |
| 970 | Ga0495622_0014896 | 3300046557 | Bacteria | 3615 |
| 971 | Ga0495622_0050643 | 3300046557 | Bacteria | 1926 |
| 972 | Ga0495622_0054300 | 3300046557 | Bacteria | 1859 |
| 973 | Ga0495667_0002231 | 3300046559 | Bacteria | 12957 |
| 974 | Ga0495667_0013207 | 3300046559 | Bacteria | 5592 |
| 975 | Ga0495656_0000673 | 3300046615 | Bacteria | 10969 |
| 976 | Ga0495668_0020377 | 3300046616 | Bacteria | 3814 |
| 977 | Ga0495668_0034584 | 3300046616 | Bacteria | 2834 |
| 978 | Ga0495668_0038699 | 3300046616 | Bacteria | 2664 |
| 979 | Ga0495668_0105245 | 3300046616 | Bacteria | 1543 |
| 980 | Ga0495634_0000537 | 3300046642 | Bacteria | 37265 |
| 981 | Ga0495634_0001399 | 3300046642 | Bacteria | 21698 |
| 982 | Ga0495634_0041861 | 3300046642 | Bacteria | 3110 |
| 983 | Ga0495611_0005106 | 3300046648 | Bacteria | 5626 |
| 984 | Ga0495611_0064112 | 3300046648 | Bacteria | 1673 |
| 985 | Ga0495625_0011106 | 3300046660 | Bacteria | 7375 |
| 986 | Ga0495625_0015503 | 3300046660 | Bacteria | 6035 |
| 987 | Ga0495625_0019451 | 3300046660 | Bacteria | 5266 |
| 988 | Ga0495625_0076817 | 3300046660 | Bacteria | 2334 |
| 989 | Ga0495625_0215206 | 3300046660 | Bacteria | 1261 |
| 990 | Ga0495635_0000544 | 3300046663 | Bacteria | 24018 |
| 991 | Ga0495635_0001202 | 3300046663 | Bacteria | 17269 |
| 992 | Ga0495635_0001417 | 3300046663 | Bacteria | 16004 |
| 993 | Ga0495635_0014768 | 3300046663 | Bacteria | 5463 |
| 994 | Ga0495659_0015934 | 3300046664 | Bacteria | 2475 |
| 995 | Ga0495661_0003286 | 3300046665 | Bacteria | 12002 |
| 996 | Ga0495661_0034985 | 3300046665 | Bacteria | 3157 |
| 997 | Ga0495588_0005106 | 3300046674 | Bacteria | 5833 |
| 998 | Ga0495588_0008073 | 3300046674 | Bacteria | 4813 |
| 999 | Ga0495588_0019754 | 3300046674 | Bacteria | 3305 |
| 1000 | Ga0495588_0078955 | 3300046674 | Bacteria | 1717 |
| 1001 | Ga0495588_0145188 | 3300046674 | Bacteria | 1254 |
| 1002 | Ga0495657_0004009 | 3300046675 | Bacteria | 11811 |
| 1003 | Ga0495657_0025951 | 3300046675 | Bacteria | 4156 |
| 1004 | Ga0495599_0002969 | 3300046678 | Bacteria | 9874 |
| 1005 | Ga0495599_0013395 | 3300046678 | Bacteria | 5067 |
| 1006 | Ga0495623_0013456 | 3300046679 | Bacteria | 5305 |
| 1007 | Ga0495623_0146185 | 3300046679 | Bacteria | 1402 |
| 1008 | Ga0495646_0009311 | 3300046680 | Bacteria | 6232 |
| 1009 | Ga0495646_0025629 | 3300046680 | Bacteria | 3708 |
| 1010 | Ga0495646_0028479 | 3300046680 | Bacteria | 3497 |
| 1011 | Ga0495647_0003504 | 3300046681 | Bacteria | 5024 |
| 1012 | Ga0495658_0002413 | 3300046683 | Bacteria | 9421 |
| 1013 | Ga0495658_0038641 | 3300046683 | Bacteria | 2644 |
| 1014 | Ga0495669_0004064 | 3300046684 | Bacteria | 6017 |
| 1015 | Ga0495669_0011949 | 3300046684 | Bacteria | 3692 |
| 1016 | Ga0495669_0021300 | 3300046684 | Bacteria | 2812 |
| 1017 | Ga0495669_0111127 | 3300046684 | Bacteria | 1279 |
| 1018 | Ga0495613_0026305 | 3300046689 | Bacteria | 4335 |
| 1019 | Ga0495624_0001588 | 3300046690 | Bacteria | 17466 |
| 1020 | Ga0495624_0025173 | 3300046690 | Bacteria | 3910 |
| 1021 | Ga0495624_0103577 | 3300046690 | Bacteria | 1751 |
| 1022 | Ga0495624_0112737 | 3300046690 | Bacteria | 1672 |
| 1023 | Ga0495670_0053887 | 3300046691 | Bacteria | 2014 |
| 1024 | Ga0495671_0027092 | 3300046692 | Bacteria | 2962 |
| 1025 | Ga0495671_0090308 | 3300046692 | Bacteria | 1499 |
| 1026 | Ga0495649_0005062 | 3300046694 | Bacteria | 8468 |
| 1027 | Ga0495649_0012079 | 3300046694 | Bacteria | 5039 |
| 1028 | Ga0495649_0099447 | 3300046694 | Bacteria | 1547 |
| 1029 | Ga0495589_0002668 | 3300046794 | Bacteria | 9867 |
| 1030 | Ga0495589_0080122 | 3300046794 | Bacteria | 1589 |
| 1031 | Ga0495589_0112459 | 3300046794 | Bacteria | 1314 |
| 1032 | Ga0495600_0025979 | 3300046809 | Bacteria | 3777 |
| 1033 | Ga0495660_0022956 | 3300046810 | Bacteria | 3560 |
| 1034 | Ga0495660_0054596 | 3300046810 | Bacteria | 2164 |
| 1035 | Ga0495581_0000167 | 3300047315 | Bacteria | 29560 |
| 1036 | Ga0495581_0000206 | 3300047315 | Bacteria | 27642 |
| 1037 | Ga0495604_0001283 | 3300047317 | Bacteria | 20556 |
| 1038 | Ga0495604_0002111 | 3300047317 | Bacteria | 16002 |
| 1039 | Ga0495604_0003226 | 3300047317 | Bacteria | 13040 |
| 1040 | Ga0495604_0044826 | 3300047317 | Bacteria | 3453 |
| 1041 | Ga0495636_0004964 | 3300047318 | Bacteria | 5217 |
| 1042 | Ga0495674_0000145 | 3300047319 | Bacteria | 54755 |
| 1043 | Ga0495674_0006528 | 3300047319 | Bacteria | 11195 |
| 1044 | Ga0495674_0017157 | 3300047319 | Bacteria | 6744 |
| 1045 | Ga0495674_0044533 | 3300047319 | Bacteria | 3945 |
| 1046 | Ga0495674_0045000 | 3300047319 | Bacteria | 3921 |
| 1047 | Ga0495674_0065545 | 3300047319 | Bacteria | 3154 |
| 1048 | Ga0495674_0311552 | 3300047319 | Bacteria | 1284 |
| 1049 | Ga0495672_0002635 | 3300047320 | Bacteria | 16196 |
| 1050 | Ga0495676_0178316 | 3300047321 | Bacteria | 1491 |
| 1051 | Ga0495680_0001105 | 3300047322 | Bacteria | 29792 |
| 1052 | Ga0495680_0001309 | 3300047322 | Bacteria | 27134 |
| 1053 | Ga0495680_0005784 | 3300047322 | Bacteria | 11569 |
| 1054 | Ga0495683_0019699 | 3300047323 | Bacteria | 3482 |
| 1055 | Ga0495683_0090379 | 3300047323 | Bacteria | 1484 |
| 1056 | Ga0495687_000161 | 3300047443 | Bacteria | 100635 |
| 1057 | Ga0495687_007111 | 3300047443 | Bacteria | 6673 |
| 1058 | Ga0495687_007129 | 3300047443 | Bacteria | 6664 |
| 1059 | Ga0495687_028489 | 3300047443 | Bacteria | 2598 |
| 1060 | Ga0495687_039208 | 3300047443 | Bacteria | 2098 |
| 1061 | Ga0495675_0004021 | 3300047444 | Bacteria | 8914 |
| 1062 | Ga0495679_000217 | 3300047446 | Bacteria | 49035 |
| 1063 | Ga0495679_017654 | 3300047446 | Bacteria | 2550 |
| 1064 | Ga0495685_057713 | 3300047447 | Bacteria | 1311 |
| 1065 | Ga0495681_0083405 | 3300047470 | Bacteria | 1423 |
| 1066 | Ga0495684_0032318 | 3300047471 | Bacteria | 4017 |
| 1067 | Ga0495684_0058496 | 3300047471 | Bacteria | 2936 |
| 1068 | Ga0495686_0008703 | 3300047472 | Bacteria | 7410 |
| 1069 | Ga0495686_0042376 | 3300047472 | Bacteria | 2895 |
| 1070 | Ga0495686_0066067 | 3300047472 | Bacteria | 2236 |
| 1071 | Ga0495593_0000013 | 3300047673 | Bacteria | 82874 |
| 1072 | Ga0495593_0003915 | 3300047673 | Bacteria | 8895 |
| 1073 | Ga0495593_0007071 | 3300047673 | Bacteria | 6582 |
| 1074 | Ga0495593_0013439 | 3300047673 | Bacteria | 4670 |
| 1075 | Ga0495593_0019616 | 3300047673 | Bacteria | 3790 |
| 1076 | Ga0495593_0035124 | 3300047673 | Bacteria | 2723 |
| 1077 | Ga0495602_0016074 | 3300048088 | Bacteria | 7530 |
| 1078 | Ga0495602_0017266 | 3300048088 | Bacteria | 7236 |
| 1079 | Ga0495602_0022452 | 3300048088 | Bacteria | 6175 |
| 1080 | Ga0495602_0070141 | 3300048088 | Bacteria | 3001 |
| 1081 | Ga0495614_0007950 | 3300048089 | Bacteria | 4713 |
| 1082 | Ga0495614_0067377 | 3300048089 | Bacteria | 1540 |
| 1083 | Ga0495626_0027926 | 3300048091 | Bacteria | 2740 |
| 1084 | Ga0495626_0118423 | 3300048091 | Bacteria | 1141 |
| 1085 | Ga0496100_0007356 | 3300048903 | Bacteria | 6069 |
| 1086 | Ga0496100_0147197 | 3300048903 | Bacteria | 1676 |
| 1087 | Ga0496100_0256537 | 3300048903 | Bacteria | 1295 |
| 1088 | Ga0496101_0039289 | 3300048904 | Bacteria | 3365 |
| 1089 | Ga0496101_0046322 | 3300048904 | Bacteria | 3118 |
| 1090 | Ga0496101_0244360 | 3300048904 | Bacteria | 1397 |
| 1091 | Ga0496101_0339673 | 3300048904 | Bacteria | 1179 |
| 1092 | Ga0496102_0002871 | 3300048905 | Bacteria | 14633 |
| 1093 | Ga0496102_0031230 | 3300048905 | Bacteria | 4776 |
| 1094 | Ga0496102_0118725 | 3300048905 | Bacteria | 2469 |
| 1095 | Ga0496102_0136424 | 3300048905 | Bacteria | 2299 |
| 1096 | Ga0496102_0215676 | 3300048905 | Bacteria | 1809 |
| 1097 | Ga0496102_0358283 | 3300048905 | Bacteria | 1373 |
| 1098 | Ga0496103_0013406 | 3300048906 | Bacteria | 4859 |
| 1099 | Ga0496103_0017937 | 3300048906 | Bacteria | 4242 |
| 1100 | Ga0496103_0019056 | 3300048906 | Bacteria | 4120 |
| 1101 | Ga0496103_0019311 | 3300048906 | Bacteria | 4093 |
| 1102 | Ga0496104_0016282 | 3300048907 | Bacteria | 6750 |
| 1103 | Ga0496104_0026918 | 3300048907 | Bacteria | 5316 |
| 1104 | Ga0496104_0040743 | 3300048907 | Bacteria | 4354 |
| 1105 | Ga0496104_0044319 | 3300048907 | Bacteria | 4180 |
| 1106 | Ga0496104_0080792 | 3300048907 | Bacteria | 3100 |
| 1107 | Ga0496104_0120356 | 3300048907 | Bacteria | 2520 |
| 1108 | Ga0496104_0188476 | 3300048907 | Bacteria | 1974 |
| 1109 | Ga0496104_0229779 | 3300048907 | Bacteria | 1767 |
| 1110 | Ga0496105_0003511 | 3300048908 | Bacteria | 11615 |
| 1111 | Ga0496105_0115655 | 3300048908 | Bacteria | 2212 |
| 1112 | Ga0496105_0168995 | 3300048908 | Bacteria | 1793 |
| 1113 | Ga0496106_0017437 | 3300048909 | Bacteria | 5313 |
| 1114 | Ga0496106_0028680 | 3300048909 | Bacteria | 4146 |
| 1115 | Ga0496106_0034749 | 3300048909 | Bacteria | 3767 |
| 1116 | Ga0496106_0053808 | 3300048909 | Bacteria | 3041 |
| 1117 | Ga0496106_0054840 | 3300048909 | Bacteria | 3012 |
| 1118 | Ga0496106_0087877 | 3300048909 | Bacteria | 2395 |
| 1119 | Ga0496107_0164054 | 3300048910 | Bacteria | 1647 |
| 1120 | Ga0496108_0102405 | 3300048911 | Bacteria | 2443 |
| 1121 | Ga0496108_0197389 | 3300048911 | Bacteria | 1746 |
| 1122 | Ga0496109_0013281 | 3300048912 | Bacteria | 7134 |
| 1123 | Ga0496109_0138740 | 3300048912 | Bacteria | 2273 |
| 1124 | Ga0496109_0183572 | 3300048912 | Bacteria | 1965 |
| 1125 | Ga0496110_0017067 | 3300048913 | Bacteria | 6068 |
| 1126 | Ga0496110_0031842 | 3300048913 | Bacteria | 4552 |
| 1127 | Ga0496110_0082619 | 3300048913 | Bacteria | 2865 |
| 1128 | Ga0496110_0082687 | 3300048913 | Bacteria | 2864 |
| 1129 | Ga0496110_0109796 | 3300048913 | Bacteria | 2477 |
| 1130 | Ga0496110_0197274 | 3300048913 | Bacteria | 1828 |
| 1131 | Ga0496110_0383383 | 3300048913 | Bacteria | 1281 |
| 1132 | Ga0496111_0010126 | 3300048914 | Bacteria | 6311 |
| 1133 | Ga0496111_0064659 | 3300048914 | Bacteria | 2654 |
| 1134 | Ga0496111_0087657 | 3300048914 | Bacteria | 2278 |
| 1135 | Ga0496111_0250169 | 3300048914 | Bacteria | 1316 |
| 1136 | Ga0496112_0000014 | 3300048915 | Bacteria | 210932 |
| 1137 | Ga0496112_0007451 | 3300048915 | Bacteria | 9715 |
| 1138 | Ga0496112_0026585 | 3300048915 | Bacteria | 5573 |
| 1139 | Ga0496112_0027410 | 3300048915 | Bacteria | 5492 |
| 1140 | Ga0496112_0034872 | 3300048915 | Bacteria | 4897 |
| 1141 | Ga0496112_0047474 | 3300048915 | Bacteria | 4212 |
| 1142 | Ga0496112_0074531 | 3300048915 | Bacteria | 3355 |
| 1143 | Ga0496112_0116204 | 3300048915 | Bacteria | 2646 |
| 1144 | Ga0496112_0272275 | 3300048915 | Bacteria | 1641 |
| 1145 | Ga0496113_0060287 | 3300048916 | Bacteria | 2860 |
| 1146 | Ga0496113_0069599 | 3300048916 | Bacteria | 2673 |
| 1147 | Ga0496113_0071728 | 3300048916 | Bacteria | 2635 |
| 1148 | Ga0496113_0134418 | 3300048916 | Bacteria | 1942 |
| 1149 | Ga0496113_0170397 | 3300048916 | Bacteria | 1724 |
| 1150 | Ga0496114_0021665 | 3300048917 | Bacteria | 5229 |
| 1151 | Ga0496114_0064538 | 3300048917 | Bacteria | 3067 |
| 1152 | Ga0496114_0160571 | 3300048917 | Bacteria | 1954 |
| 1153 | Ga0496115_0024502 | 3300048918 | Bacteria | 4691 |
| 1154 | Ga0496115_0044864 | 3300048918 | Bacteria | 3528 |
| 1155 | Ga0496115_0080729 | 3300048918 | Bacteria | 2648 |
| 1156 | Ga0496116_0077684 | 3300048919 | Bacteria | 2073 |
| 1157 | Ga0496117_0043929 | 3300048920 | Bacteria | 3242 |
| 1158 | Ga0496117_0127006 | 3300048920 | Bacteria | 1554 |
| 1159 | Ga0496118_0013700 | 3300048921 | Bacteria | 7650 |
| 1160 | Ga0496118_0014127 | 3300048921 | Bacteria | 7490 |
| 1161 | Ga0496118_0067240 | 3300048921 | Bacteria | 2611 |
| 1162 | Ga0496118_0130526 | 3300048921 | Bacteria | 1615 |
| 1163 | Ga0496119_0000993 | 3300048922 | Bacteria | 36386 |
| 1164 | Ga0496119_0008920 | 3300048922 | Bacteria | 8715 |
| 1165 | Ga0496119_0033397 | 3300048922 | Bacteria | 3411 |
| 1166 | Ga0496121_0024554 | 3300048924 | Bacteria | 5759 |
| 1167 | Ga0496122_0012125 | 3300048925 | Bacteria | 8630 |
| 1168 | Ga0496122_0164388 | 3300048925 | Bacteria | 1348 |
| 1169 | Ga0496123_0002663 | 3300048926 | Bacteria | 21562 |
| 1170 | Ga0496124_0030911 | 3300048927 | Bacteria | 4744 |
| 1171 | Ga0496124_0263794 | 3300048927 | Bacteria | 1266 |
| 1172 | Ga0496125_0028676 | 3300048928 | Bacteria | 5021 |
| 1173 | Ga0496125_0185643 | 3300048928 | Bacteria | 1379 |
| 1174 | Ga0496126_0000196 | 3300048929 | Bacteria | 134394 |
| 1175 | Ga0496126_0000679 | 3300048929 | Bacteria | 62626 |
| 1176 | Ga0496126_0009508 | 3300048929 | Bacteria | 10315 |
| 1177 | Ga0496126_0012615 | 3300048929 | Bacteria | 8648 |
| 1178 | Ga0496126_0048707 | 3300048929 | Bacteria | 3871 |
| 1179 | Ga0496126_0200201 | 3300048929 | Bacteria | 1687 |
| 1180 | Ga0501034_0054939 | 3300049571 | Bacteria | 4008 |
| 1181 | Ga0501036_0279960 | 3300049572 | Bacteria | 1396 |
| 1182 | Ga0501038_0080223 | 3300049574 | Bacteria | 2751 |
| 1183 | Ga0501040_0032832 | 3300049576 | Bacteria | 3513 |
| 1184 | Ga0501041_0045944 | 3300049577 | Bacteria | 2656 |
| 1185 | Ga0501042_0196987 | 3300049578 | Bacteria | 1453 |
| 1186 | Ga0501072_0099070 | 3300049588 | Bacteria | 2317 |
| 1187 | Ga0501073_0009620 | 3300049589 | Bacteria | 7129 |
| 1188 | Ga0501073_0140321 | 3300049589 | Bacteria | 1675 |
| 1189 | Ga0501073_0176854 | 3300049589 | Bacteria | 1477 |
| 1190 | Ga0501074_0026529 | 3300049590 | Bacteria | 4200 |
| 1191 | Ga0501075_0016056 | 3300049591 | Bacteria | 5387 |
| 1192 | Ga0501076_0013787 | 3300049592 | Bacteria | 6066 |
| 1193 | Ga0501077_0031715 | 3300049593 | Bacteria | 3362 |
| 1194 | Ga0501079_0093314 | 3300049741 | Bacteria | 2332 |
| 1195 | Ga0501081_0004781 | 3300049743 | Bacteria | 8718 |
| 1196 | Ga0501035_0120349 | 3300049822 | Bacteria | 2296 |
| 1197 | Ga0501045_0010293 | 3300049824 | Bacteria | 6552 |
| 1198 | nmdc:mga03683_27707_c1 | 3300050489 | Bacteria | 2247 |
| 1199 | nmdc:mga03n38_81831_c1 | 3300050490 | Bacteria | 1519 |
| 1200 | nmdc:mga00v17_52854_c1 | 3300050491 | Bacteria | 2474 |
| 1201 | nmdc:mga00v17_86883_c1 | 3300050491 | Bacteria | 1960 |
| 1202 | nmdc:mga0yw44_227812_c1 | 3300050492 | Bacteria | 1237 |
| 1203 | nmdc:mga0k408_12101_c1 | 3300050493 | Bacteria | 4712 |
| 1204 | nmdc:mga0k408_127338_c1 | 3300050493 | Bacteria | 1511 |
| 1205 | nmdc:mga0k408_174176_c1 | 3300050493 | Bacteria | 1283 |
| 1206 | nmdc:mga0k408_176748_c1 | 3300050493 | Bacteria | 1273 |
| 1207 | nmdc:mga0k408_20184_c1 | 3300050493 | Bacteria | 3730 |
| 1208 | nmdc:mga0k408_51178_c1 | 3300050493 | Bacteria | 2392 |
| 1209 | nmdc:mga0k408_9111_c1 | 3300050493 | Bacteria | 5345 |
| 1210 | nmdc:mga06z11_10232_c1 | 3300050494 | Bacteria | 3984 |
| 1211 | nmdc:mga06z11_180329_c1 | 3300050494 | Bacteria | 1217 |
| 1212 | nmdc:mga06z11_187037_c1 | 3300050494 | Bacteria | 1197 |
| 1213 | nmdc:mga06z11_31136_c1 | 3300050494 | Bacteria | 2589 |
| 1214 | nmdc:mga04h51_19713_c1 | 3300050495 | Bacteria | 2003 |
| 1215 | nmdc:mga04h51_29754_c1 | 3300050495 | Bacteria | 1714 |
| 1216 | nmdc:mga07m45_135609_c1 | 3300050496 | Bacteria | 1425 |
| 1217 | nmdc:mga07m45_39087_c1 | 3300050496 | Bacteria | 2650 |
| 1218 | nmdc:mga07m45_6449_c1 | 3300050496 | Bacteria | 5675 |
| 1219 | nmdc:mga07m45_96423_c1 | 3300050496 | Bacteria | 1697 |
| 1220 | nmdc:mga05p37_134523_c1 | 3300050507 | Bacteria | 3033 |
| 1221 | nmdc:mga05p37_138555_c1 | 3300050507 | Bacteria | 2982 |
| 1222 | nmdc:mga06r32_76795_c1 | 3300050510 | Bacteria | 3244 |
| 1223 | nmdc:mga08y16_14550_c1 | 3300050511 | Bacteria | 8274 |
| 1224 | nmdc:mga08y16_57693_c1 | 3300050511 | Bacteria | 4056 |
| 1225 | nmdc:mga0n895_230649_c1 | 3300050512 | Bacteria | 1879 |
| 1226 | nmdc:mga0rr50_301327_c1 | 3300050513 | Bacteria | 1341 |
| 1227 | nmdc:mga0rr50_362930_c1 | 3300050513 | Bacteria | 1219 |
| 1228 | nmdc:mga08x19_153720_c1 | 3300050514 | Bacteria | 1559 |
| 1229 | nmdc:mga0a205_39655_c1 | 3300050515 | Bacteria | 4532 |
| 1230 | nmdc:mga0sz30_78734_c1 | 3300050516 | Bacteria | 1425 |
| 1231 | Ga0495601_0015307 | 3300053077 | Bacteria | 4635 |
| 1232 | Ga0495601_0019287 | 3300053077 | Bacteria | 4158 |
| 1233 | Ga0495601_0235688 | 3300053077 | Bacteria | 1195 |
| 1234 | Ga0495612_0002548 | 3300053078 | Bacteria | 7516 |
| 1235 | Ga0495612_0124159 | 3300053078 | Bacteria | 1112 |
| 1236 | Ga0500635_0008596 | 3300053080 | Bacteria | 2804 |
| 1237 | Ga0495655_0041228 | 3300053083 | Bacteria | 1179 |
| 1238 | Ga0495595_0000442 | 3300053084 | Bacteria | 15717 |
| 1239 | Ga0495619_0006616 | 3300053085 | Bacteria | 7333 |
| 1240 | Ga0495619_0008105 | 3300053085 | Bacteria | 6650 |
| 1241 | Ga0500578_0072449 | 3300053086 | Bacteria | 2195 |
| 1242 | Ga0500578_0106240 | 3300053086 | Bacteria | 1773 |
| 1243 | Ga0500643_015020 | 3300053087 | Bacteria | 2669 |
| 1244 | Ga0500644_0048799 | 3300053088 | Bacteria | 1442 |
| 1245 | Ga0500583_0014268 | 3300053092 | Bacteria | 3104 |
| 1246 | Ga0500583_0048694 | 3300053092 | Bacteria | 1957 |
| 1247 | Ga0500583_0141805 | 3300053092 | Bacteria | 1194 |
| 1248 | Ga0500651_0215545 | 3300053093 | Bacteria | 1127 |
| 1249 | Ga0500641_0019800 | 3300053096 | Bacteria | 2547 |
| 1250 | Ga0500554_000799 | 3300053102 | Bacteria | 6232 |
| 1251 | Ga0500556_0000148 | 3300053104 | Bacteria | 58772 |
| 1252 | Ga0500562_005782 | 3300053108 | Bacteria | 3113 |
| 1253 | Ga0500595_000302 | 3300053119 | Bacteria | 32439 |
| 1254 | Ga0500595_001031 | 3300053119 | Bacteria | 15533 |
| 1255 | Ga0500595_033517 | 3300053119 | Bacteria | 1704 |
| 1256 | Ga0500642_0006746 | 3300053130 | Bacteria | 3808 |
| 1257 | Ga0500642_0020613 | 3300053130 | Bacteria | 2594 |
| 1258 | Ga0500658_0000642 | 3300053134 | Bacteria | 14510 |
| 1259 | Ga0500658_0003506 | 3300053134 | Bacteria | 5922 |
| 1260 | Ga0500658_0039319 | 3300053134 | Bacteria | 1890 |
| 1261 | Ga0500658_0040891 | 3300053134 | Bacteria | 1858 |
| 1262 | Ga0500559_0000339 | 3300053136 | Bacteria | 35031 |
| 1263 | Ga0500559_0007867 | 3300053136 | Bacteria | 4706 |
| 1264 | Ga0500559_0083909 | 3300053136 | Bacteria | 1452 |
| 1265 | Ga0500568_0000019 | 3300053139 | Bacteria | 195696 |
| 1266 | Ga0500573_0050258 | 3300053140 | Bacteria | 2398 |
| 1267 | Ga0500577_0012546 | 3300053142 | Bacteria | 2565 |
| 1268 | Ga0500577_0021519 | 3300053142 | Bacteria | 2126 |
| 1269 | Ga0500590_048803 | 3300053148 | Bacteria | 2157 |
| 1270 | Ga0500603_000821 | 3300053150 | Bacteria | 7419 |
| 1271 | Ga0500616_0000715 | 3300053153 | Bacteria | 38448 |
| 1272 | Ga0500616_0014978 | 3300053153 | Bacteria | 4444 |
| 1273 | Ga0500616_0029175 | 3300053153 | Bacteria | 3038 |
| 1274 | Ga0500616_0093594 | 3300053153 | Bacteria | 1483 |
| 1275 | Ga0500622_0001202 | 3300053156 | Bacteria | 21303 |
| 1276 | Ga0500622_0003724 | 3300053156 | Bacteria | 9990 |
| 1277 | Ga0500622_0004961 | 3300053156 | Bacteria | 8110 |
| 1278 | Ga0500627_0033050 | 3300053158 | Bacteria | 2184 |
| 1279 | Ga0500639_073864 | 3300053163 | Bacteria | 1731 |
| 1280 | Ga0500636_0006447 | 3300053177 | Bacteria | 6737 |
| 1281 | Ga0500636_0015436 | 3300053177 | Bacteria | 4500 |
| 1282 | Ga0500636_0110373 | 3300053177 | Bacteria | 1555 |
| 1283 | Ga0500636_0140310 | 3300053177 | Bacteria | 1338 |
| 1284 | Ga0500637_0002825 | 3300053178 | Bacteria | 7819 |
| 1285 | Ga0500637_0149103 | 3300053178 | Bacteria | 1352 |
| 1286 | Ga0500645_016719 | 3300053730 | Bacteria | 2307 |
| 1287 | Ga0500609_006213 | 3300053731 | Bacteria | 1628 |
| 1288 | Ga0500599_000221 | 3300053736 | Bacteria | 5324 |
| 1289 | Ga0500601_000130 | 3300053737 | Bacteria | 15343 |
| 1290 | Ga0501084_0001165 | 3300054114 | Bacteria | 20508 |
| 1291 | Ga0500661_004632 | 3300055283 | Bacteria | 2569 |
| 1292 | Ga0500661_010201 | 3300055283 | Bacteria | 1711 |
| 1293 | Ga0501082_0027865 | 3300060353 | Bacteria | 4865 |
| 1294 | Ga0530510_0039974 | 3300061734 | Bacteria | 3385 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003790 | Ga0055528_1025221 | Ga0055528_10252212 | 275 |
| 2 | 3300003354 | JGI25160J50197_1004178 | JGI25160J50197_10041782 | 285 |
| 3 | 3300003792 | Ga0055540_1000192 | Ga0055540_100019217 | 285 |
| 4 | 3300004625 | Ga0055543_1000329 | Ga0055543_10003291 | 285 |
| 5 | 3300005262 | Ga0065165_1016048 | Ga0065165_10160482 | 285 |
| 6 | 3300025298 | Ga0209050_1008894 | Ga0209050_10088944 | 286 |
| 7 | 3300025302 | Ga0207426_1000039 | Ga0207426_1000039361 | 286 |
| 8 | 3300025303 | Ga0209051_1000253 | Ga0209051_100025345 | 286 |
| 9 | 3300025304 | Ga0209257_1008074 | Ga0209257_10080743 | 286 |
| 10 | 3300050490 | nmdc:mga03n38_81831_c1 | nmdc:mga03n38_81831_c1_61_1089 | 286 |
| 11 | 3300050493 | nmdc:mga0k408_174176_c1 | nmdc:mga0k408_174176_c1_215_1243 | 286 |
| 12 | 3300046660 | Ga0495625_0215206 | Ga0495625_0215206_132_1160 | 288 |
| 13 | 3300003215 | JGI25153J46596_10020132 | JGI25153J46596_100201322 | 292 |
| 14 | 3300003792 | Ga0055540_1018930 | Ga0055540_10189301 | 292 |
| 15 | 3300046474 | Ga0495605_0011724 | Ga0495605_0011724_3298_4305 | 292 |
| 16 | 3300053134 | Ga0500658_0000642 | Ga0500658_0000642_124_1131 | 292 |
| 17 | 3300025273 | Ga0209673_1005041 | Ga0209673_10050416 | 293 |
| 18 | 3300025297 | Ga0209758_1018742 | Ga0209758_10187422 | 293 |
| 19 | 3300025303 | Ga0209051_1010924 | Ga0209051_10109244 | 293 |
| 20 | 3300046518 | Ga0495631_0020145 | Ga0495631_0020145_1413_2420 | 293 |
| 21 | 3300046522 | Ga0495643_0008482 | Ga0495643_0008482_3928_4935 | 293 |
| 22 | 3300046616 | Ga0495668_0020377 | Ga0495668_0020377_749_1756 | 293 |
| 23 | 3300046660 | Ga0495625_0019451 | Ga0495625_0019451_264_1271 | 293 |
| 24 | 3300046810 | Ga0495660_0022956 | Ga0495660_0022956_748_1755 | 293 |
| 25 | 3300050494 | nmdc:mga06z11_187037_c1 | nmdc:mga06z11_187037_c1_11_1018 | 293 |
| 26 | iso_pu_bacteria | 2929615660 | 2929619181 | 294 |
| 27 | iso_pu_bacteria | 2929624759 | 2929628324 | 294 |
| 28 | 3300021320 | Ga0214544_1000018 | Ga0214544_100001842 | 295 |
| 29 | 3300021321 | Ga0214542_1000081 | Ga0214542_10000819 | 295 |
| 30 | 3300021327 | Ga0214543_1000042 | Ga0214543_100004252 | 295 |
| 31 | 3300002773 | JGI25152J39213_1004235 | JGI25152J39213_10042353 | 297 |
| 32 | 3300003771 | Ga0055526_1014297 | Ga0055526_10142974 | 297 |
| 33 | 3300005367 | Ga0070667_100041228 | Ga0070667_1000412282 | 297 |
| 34 | 3300009177 | Ga0105248_10235978 | Ga0105248_102359782 | 297 |
| 35 | iso_pu_bacteria | 8016511872 | 8016516868 | 297 |
| 36 | 3300037471 | Ga0395905_0026353 | Ga0395905_0026353_1783_2787 | 299 |
| 37 | 3300006048 | Ga0075363_100042014 | Ga0075363_1000420142 | 301 |
| 38 | 3300025258 | Ga0209129_1001986 | Ga0209129_100198610 | 301 |
| 39 | 3300025302 | Ga0207426_1042886 | Ga0207426_10428862 | 301 |
| 40 | 3300025941 | Ga0207711_10430765 | Ga0207711_104307652 | 301 |
| 41 | 3300026067 | Ga0207678_10141187 | Ga0207678_101411872 | 301 |
| 42 | 3300048907 | Ga0496104_0229779 | Ga0496104_0229779_722_1744 | 301 |
| 43 | 3300048908 | Ga0496105_0168995 | Ga0496105_0168995_644_1651 | 301 |
| 44 | 3300048916 | Ga0496113_0071728 | Ga0496113_0071728_616_1623 | 301 |
| 45 | 3300048919 | Ga0496116_0077684 | Ga0496116_0077684_64_1071 | 301 |
| 46 | 3300048929 | Ga0496126_0048707 | Ga0496126_0048707_2061_3077 | 301 |
| 47 | 3300046453 | Ga0495627_033911 | Ga0495627_033911_196_1203 | 302 |
| 48 | 3300046616 | Ga0495668_0038699 | Ga0495668_0038699_1322_2329 | 302 |
| 49 | 3300046674 | Ga0495588_0019754 | Ga0495588_0019754_1899_2906 | 302 |
| 50 | 3300046794 | Ga0495589_0080122 | Ga0495589_0080122_301_1308 | 302 |
| 51 | 3300005937 | Ga0081455_10160148 | Ga0081455_101601482 | 304 |
| 52 | 3300006846 | Ga0075430_100018985 | Ga0075430_1000189854 | 305 |
| 53 | 3300048913 | Ga0496110_0383383 | Ga0496110_0383383_156_1172 | 305 |
| 54 | 3300050511 | nmdc:mga08y16_57693_c1 | nmdc:mga08y16_57693_c1_2423_3454 | 305 |
| 55 | 3300046516 | Ga0495628_0040141 | Ga0495628_0040141_13_933 | 306 |
| 56 | 3300025914 | Ga0207671_10222759 | Ga0207671_102227591 | 307 |
| 57 | 3300049589 | Ga0501073_0176854 | Ga0501073_0176854_348_1373 | 307 |
| 58 | 3300005347 | Ga0070668_100033402 | Ga0070668_1000334025 | 308 |
| 59 | 3300005366 | Ga0070659_100137413 | Ga0070659_1001374132 | 308 |
| 60 | 3300005564 | Ga0070664_100096918 | Ga0070664_1000969183 | 308 |
| 61 | 3300005564 | Ga0070664_100149480 | Ga0070664_1001494802 | 308 |
| 62 | 3300005578 | Ga0068854_100142607 | Ga0068854_1001426072 | 308 |
| 63 | 3300005843 | Ga0068860_100099735 | Ga0068860_1000997352 | 308 |
| 64 | 3300006844 | Ga0075428_100132849 | Ga0075428_1001328494 | 308 |
| 65 | 3300010375 | Ga0105239_10749121 | Ga0105239_107491211 | 308 |
| 66 | 3300025945 | Ga0207679_10145087 | Ga0207679_101450872 | 308 |
| 67 | 3300025945 | Ga0207679_10194492 | Ga0207679_101944922 | 308 |
| 68 | 3300028380 | Ga0268265_10388650 | Ga0268265_103886502 | 308 |
| 69 | 3300028381 | Ga0268264_10092502 | Ga0268264_100925022 | 308 |
| 70 | 3300050510 | nmdc:mga06r32_76795_c1 | nmdc:mga06r32_76795_c1_1388_2419 | 308 |
| 71 | 3300049589 | Ga0501073_0009620 | Ga0501073_0009620_3871_4896 | 309 |
| 72 | 3300037471 | Ga0395905_0000398 | Ga0395905_0000398_14324_15343 | 310 |
| 73 | 3300037471 | Ga0395905_0025545 | Ga0395905_0025545_3012_4016 | 310 |
| 74 | 3300028794 | Ga0307515_10223224 | Ga0307515_102232241 | 311 |
| 75 | 3300042127 | Ga0450890_005209 | Ga0450890_005209_323_1342 | 311 |
| 76 | 3300042134 | Ga0450898_027205 | Ga0450898_027205_68_1018 | 311 |
| 77 | 3300048913 | Ga0496110_0082687 | Ga0496110_0082687_241_1236 | 311 |
| 78 | 3300048916 | Ga0496113_0170397 | Ga0496113_0170397_565_1560 | 311 |
| 79 | 3300053153 | Ga0500616_0093594 | Ga0500616_0093594_105_1127 | 311 |
| 80 | 3300005518 | Ga0070699_100284062 | Ga0070699_1002840621 | 312 |
| 81 | 3300005546 | Ga0070696_100014780 | Ga0070696_1000147802 | 312 |
| 82 | 3300005338 | Ga0068868_100037825 | Ga0068868_1000378255 | 313 |
| 83 | 3300005354 | Ga0070675_100035549 | Ga0070675_1000355493 | 313 |
| 84 | 3300005456 | Ga0070678_100087849 | Ga0070678_1000878492 | 313 |
| 85 | 3300005459 | Ga0068867_100152615 | Ga0068867_1001526152 | 313 |
| 86 | 3300005548 | Ga0070665_100074569 | Ga0070665_1000745692 | 313 |
| 87 | 3300005617 | Ga0068859_100006931 | Ga0068859_1000069315 | 313 |
| 88 | 3300005618 | Ga0068864_100183081 | Ga0068864_1001830812 | 313 |
| 89 | 3300005719 | Ga0068861_100305611 | Ga0068861_1003056112 | 313 |
| 90 | 3300005841 | Ga0068863_100045110 | Ga0068863_1000451105 | 313 |
| 91 | 3300005844 | Ga0068862_100296576 | Ga0068862_1002965762 | 313 |
| 92 | 3300006237 | Ga0097621_100055296 | Ga0097621_1000552962 | 313 |
| 93 | 3300006358 | Ga0068871_100009046 | Ga0068871_1000090463 | 313 |
| 94 | 3300006931 | Ga0097620_100006931 | Ga0097620_1000069315 | 313 |
| 95 | 3300009177 | Ga0105248_10014000 | Ga0105248_100140003 | 313 |
| 96 | 3300011119 | Ga0105246_10176301 | Ga0105246_101763012 | 313 |
| 97 | 3300013297 | Ga0157378_10080645 | Ga0157378_100806454 | 313 |
| 98 | 3300013306 | Ga0163162_10053558 | Ga0163162_100535585 | 313 |
| 99 | 3300014325 | Ga0163163_10127210 | Ga0163163_101272102 | 313 |
| 100 | 3300014968 | Ga0157379_10026406 | Ga0157379_100264065 | 313 |
| 101 | 3300025911 | Ga0207654_10104159 | Ga0207654_101041593 | 313 |
| 102 | 3300025941 | Ga0207711_10017162 | Ga0207711_100171626 | 313 |
| 103 | 3300025942 | Ga0207689_10001210 | Ga0207689_100012108 | 313 |
| 104 | 3300026023 | Ga0207677_10024222 | Ga0207677_100242225 | 313 |
| 105 | 3300026088 | Ga0207641_10071518 | Ga0207641_100715182 | 313 |
| 106 | 3300026095 | Ga0207676_10064256 | Ga0207676_100642563 | 313 |
| 107 | 3300026118 | Ga0207675_100017216 | Ga0207675_1000172166 | 313 |
| 108 | 3300026121 | Ga0207683_10039922 | Ga0207683_100399224 | 313 |
| 109 | 3300026121 | Ga0207683_10062801 | Ga0207683_100628012 | 313 |
| 110 | 3300028794 | Ga0307515_10003518 | Ga0307515_100035186 | 313 |
| 111 | 3300032002 | Ga0307416_100143042 | Ga0307416_1001430422 | 314 |
| 112 | 3300044901 | Ga0466960_0021987 | Ga0466960_0021987_298_1305 | 314 |
| 113 | 3300005347 | Ga0070668_100189538 | Ga0070668_1001895382 | 315 |
| 114 | 3300005548 | Ga0070665_100153637 | Ga0070665_1001536371 | 315 |
| 115 | 3300005549 | Ga0070704_100268781 | Ga0070704_1002687812 | 315 |
| 116 | 3300005843 | Ga0068860_100120557 | Ga0068860_1001205574 | 315 |
| 117 | 3300006871 | Ga0075434_100559567 | Ga0075434_1005595672 | 315 |
| 118 | 3300009147 | Ga0114129_10704922 | Ga0114129_107049222 | 315 |
| 119 | 3300025972 | Ga0207668_10289405 | Ga0207668_102894052 | 315 |
| 120 | 3300049589 | Ga0501073_0140321 | Ga0501073_0140321_525_1547 | 315 |
| 121 | 3300053153 | Ga0500616_0000715 | Ga0500616_0000715_1454_2482 | 316 |
| 122 | 3300021377 | Ga0213874_10036705 | Ga0213874_100367051 | 317 |
| 123 | 3300039450 | Ga0436363_1349888 | Ga0436363_1349888_102_1136 | 317 |
| 124 | 3300044693 | Ga0466961_0016554 | Ga0466961_0016554_179_1174 | 318 |
| 125 | 3300044694 | Ga0466963_0002548 | Ga0466963_0002548_5595_6590 | 318 |
| 126 | 3300044706 | Ga0466964_0029387 | Ga0466964_0029387_990_1985 | 318 |
| 127 | 3300044765 | Ga0466970_0001313 | Ga0466970_0001313_505_1500 | 318 |
| 128 | 3300044842 | Ga0466957_0129282 | Ga0466957_0129282_309_1304 | 318 |
| 129 | 3300045049 | Ga0466959_0000398 | Ga0466959_0000398_10160_11155 | 318 |
| 130 | 3300044656 | Ga0466969_0017140 | Ga0466969_0017140_1763_2779 | 319 |
| 131 | 3300044673 | Ga0453683_0000791 | Ga0453683_0000791_9948_10955 | 319 |
| 132 | 3300044693 | Ga0466961_0000503 | Ga0466961_0000503_10134_11150 | 319 |
| 133 | 3300045051 | Ga0451576_0013137 | Ga0451576_0013137_4848_5855 | 319 |
| 134 | 3300046471 | Ga0495650_0005654 | Ga0495650_0005654_5274_6302 | 319 |
| 135 | 3300021321 | Ga0214542_1022360 | Ga0214542_10223605 | 320 |
| 136 | 3300021327 | Ga0214543_1000012 | Ga0214543_1000012241 | 320 |
| 137 | 3300025942 | Ga0207689_10030832 | Ga0207689_100308325 | 320 |
| 138 | 3300028379 | Ga0268266_10008606 | Ga0268266_100086064 | 320 |
| 139 | 3300046530 | Ga0495654_0078699 | Ga0495654_0078699_184_1212 | 320 |
| 140 | 3300048921 | Ga0496118_0130526 | Ga0496118_0130526_423_1397 | 320 |
| 141 | 3300007788 | Ga0099795_10004316 | Ga0099795_100043163 | 321 |
| 142 | 3300044684 | Ga0466966_0001226 | Ga0466966_0001226_2960_3970 | 323 |
| 143 | 3300005445 | Ga0070708_100002230 | Ga0070708_1000022304 | 324 |
| 144 | 3300005981 | Ga0081538_10001104 | Ga0081538_100011045 | 324 |
| 145 | 3300009094 | Ga0111539_10205975 | Ga0111539_102059754 | 324 |
| 146 | 3300002774 | JGI25150J39212_1008481 | JGI25150J39212_10084812 | 325 |
| 147 | 3300003187 | JGI25151J46595_10008594 | JGI25151J46595_100085946 | 325 |
| 148 | 3300005841 | Ga0068863_100097496 | Ga0068863_1000974962 | 325 |
| 149 | 3300026078 | Ga0207702_10089229 | Ga0207702_100892292 | 325 |
| 150 | iso_pu_bacteria | 2517287029 | 2517407001 | 325 |
| 151 | iso_pu_bacteria | 2534681796 | 2535517542 | 325 |
| 152 | iso_pu_bacteria | 3005409236 | 3005416343 | 325 |
| 153 | iso_pu_bacteria | 8005258706 | 8005259099 | 325 |
| 154 | iso_pu_bacteria | 8005542996 | 8005546373 | 325 |
| 155 | 3300005339 | Ga0070660_100066483 | Ga0070660_1000664832 | 326 |
| 156 | 3300005344 | Ga0070661_100004039 | Ga0070661_10000403911 | 326 |
| 157 | 3300005355 | Ga0070671_100143750 | Ga0070671_1001437502 | 326 |
| 158 | 3300005356 | Ga0070674_100001054 | Ga0070674_1000010549 | 326 |
| 159 | 3300005366 | Ga0070659_100057521 | Ga0070659_1000575214 | 326 |
| 160 | 3300005366 | Ga0070659_100189478 | Ga0070659_1001894782 | 326 |
| 161 | 3300005367 | Ga0070667_100050524 | Ga0070667_1000505241 | 326 |
| 162 | 3300005435 | Ga0070714_100038400 | Ga0070714_1000384005 | 326 |
| 163 | 3300005445 | Ga0070708_100214100 | Ga0070708_1002141002 | 326 |
| 164 | 3300005458 | Ga0070681_10010183 | Ga0070681_100101835 | 326 |
| 165 | 3300005459 | Ga0068867_100017231 | Ga0068867_1000172315 | 326 |
| 166 | 3300005518 | Ga0070699_100240175 | Ga0070699_1002401752 | 326 |
| 167 | 3300005530 | Ga0070679_100016549 | Ga0070679_1000165491 | 326 |
| 168 | 3300005535 | Ga0070684_100240214 | Ga0070684_1002402142 | 326 |
| 169 | 3300005543 | Ga0070672_100095595 | Ga0070672_1000955952 | 326 |
| 170 | 3300005563 | Ga0068855_100002242 | Ga0068855_10000224223 | 326 |
| 171 | 3300005563 | Ga0068855_100072098 | Ga0068855_1000720985 | 326 |
| 172 | 3300005564 | Ga0070664_100001933 | Ga0070664_1000019339 | 326 |
| 173 | 3300005564 | Ga0070664_100086832 | Ga0070664_1000868324 | 326 |
| 174 | 3300005577 | Ga0068857_100004409 | Ga0068857_10000440912 | 326 |
| 175 | 3300005578 | Ga0068854_100025857 | Ga0068854_1000258575 | 326 |
| 176 | 3300005614 | Ga0068856_100040825 | Ga0068856_1000408255 | 326 |
| 177 | 3300005614 | Ga0068856_100205199 | Ga0068856_1002051991 | 326 |
| 178 | 3300005616 | Ga0068852_100000511 | Ga0068852_10000051121 | 326 |
| 179 | 3300005834 | Ga0068851_10033935 | Ga0068851_100339354 | 326 |
| 180 | 3300007076 | Ga0075435_100062845 | Ga0075435_1000628455 | 326 |
| 181 | 3300009093 | Ga0105240_10000933 | Ga0105240_1000093345 | 326 |
| 182 | 3300009551 | Ga0105238_10010029 | Ga0105238_100100295 | 326 |
| 183 | 3300013100 | Ga0157373_10047441 | Ga0157373_100474412 | 326 |
| 184 | 3300013104 | Ga0157370_10005026 | Ga0157370_100050265 | 326 |
| 185 | 3300013105 | Ga0157369_10008569 | Ga0157369_100085698 | 326 |
| 186 | 3300013297 | Ga0157378_10004078 | Ga0157378_100040788 | 326 |
| 187 | 3300013307 | Ga0157372_10006560 | Ga0157372_1000656012 | 326 |
| 188 | 3300025321 | Ga0207656_10058279 | Ga0207656_100582792 | 326 |
| 189 | 3300025899 | Ga0207642_10077887 | Ga0207642_100778872 | 326 |
| 190 | 3300025912 | Ga0207707_10044886 | Ga0207707_100448865 | 326 |
| 191 | 3300025913 | Ga0207695_10030775 | Ga0207695_100307755 | 326 |
| 192 | 3300025914 | Ga0207671_10031044 | Ga0207671_100310442 | 326 |
| 193 | 3300025914 | Ga0207671_10263597 | Ga0207671_102635972 | 326 |
| 194 | 3300025916 | Ga0207663_10165866 | Ga0207663_101658662 | 326 |
| 195 | 3300025919 | Ga0207657_10011685 | Ga0207657_100116854 | 326 |
| 196 | 3300025920 | Ga0207649_10002873 | Ga0207649_100028736 | 326 |
| 197 | 3300025924 | Ga0207694_10002406 | Ga0207694_100024069 | 326 |
| 198 | 3300025929 | Ga0207664_10012282 | Ga0207664_100122825 | 326 |
| 199 | 3300025932 | Ga0207690_10195613 | Ga0207690_101956132 | 326 |
| 200 | 3300025937 | Ga0207669_10006725 | Ga0207669_100067257 | 326 |
| 201 | 3300025938 | Ga0207704_10045296 | Ga0207704_100452962 | 326 |
| 202 | 3300025940 | Ga0207691_10115632 | Ga0207691_101156322 | 326 |
| 203 | 3300025944 | Ga0207661_10035367 | Ga0207661_100353673 | 326 |
| 204 | 3300025945 | Ga0207679_10012204 | Ga0207679_100122044 | 326 |
| 205 | 3300025949 | Ga0207667_10017780 | Ga0207667_100177804 | 326 |
| 206 | 3300025949 | Ga0207667_10086269 | Ga0207667_100862692 | 326 |
| 207 | 3300025981 | Ga0207640_10022152 | Ga0207640_100221524 | 326 |
| 208 | 3300025986 | Ga0207658_10011725 | Ga0207658_100117255 | 326 |
| 209 | 3300026041 | Ga0207639_10048968 | Ga0207639_100489682 | 326 |
| 210 | 3300026078 | Ga0207702_10004171 | Ga0207702_100041719 | 326 |
| 211 | 3300026089 | Ga0207648_10004439 | Ga0207648_100044398 | 326 |
| 212 | 3300026116 | Ga0207674_10000118 | Ga0207674_1000011850 | 326 |
| 213 | 3300026142 | Ga0207698_10007421 | Ga0207698_100074213 | 326 |
| 214 | 3300045051 | Ga0451576_0463127 | Ga0451576_0463127_37_1065 | 326 |
| 215 | 3300050513 | nmdc:mga0rr50_301327_c1 | nmdc:mga0rr50_301327_c1_170_1252 | 326 |
| 216 | 3300050515 | nmdc:mga0a205_39655_c1 | nmdc:mga0a205_39655_c1_2618_3700 | 326 |
| 217 | 3300053130 | Ga0500642_0020613 | Ga0500642_0020613_118_1143 | 326 |
| 218 | iso_pu_bacteria | 2508501122 | 2509109164 | 326 |
| 219 | iso_pu_bacteria | 2509276019 | 2509377660 | 326 |
| 220 | iso_pu_bacteria | 2509276033 | 2509446632 | 326 |
| 221 | iso_pu_bacteria | 2510461076 | 2510894938 | 326 |
| 222 | iso_pu_bacteria | 2513237084 | 2513573360 | 326 |
| 223 | iso_pu_bacteria | 2513237085 | 2513577508 | 326 |
| 224 | iso_pu_bacteria | 2513237093 | 2513629842 | 326 |
| 225 | iso_pu_bacteria | 2513237103 | 2513708476 | 326 |
| 226 | iso_pu_bacteria | 2513237144 | 2513911425 | 326 |
| 227 | iso_pu_bacteria | 2513237146 | 2513928863 | 326 |
| 228 | iso_pu_bacteria | 2513237159 | 2514002038 | 326 |
| 229 | iso_pu_bacteria | 2513237162 | 2514022062 | 326 |
| 230 | iso_pu_bacteria | 2515075009 | 2515112537 | 326 |
| 231 | iso_pu_bacteria | 2515154113 | 2515632879 | 326 |
| 232 | iso_pu_bacteria | 2515154114 | 2515640023 | 326 |
| 233 | iso_pu_bacteria | 2515154116 | 2515655782 | 326 |
| 234 | iso_pu_bacteria | 2515154134 | 2515740235 | 326 |
| 235 | iso_pu_bacteria | 2516653077 | 2517036263 | 326 |
| 236 | iso_pu_bacteria | 2516653085 | 2517076624 | 326 |
| 237 | iso_pu_bacteria | 2517093000 | 2517095400 | 326 |
| 238 | iso_pu_bacteria | 2519899620 | 2520378571 | 326 |
| 239 | iso_pu_bacteria | 2529292951 | 2530645731 | 326 |
| 240 | iso_pu_bacteria | 2558860100 | 2558860663 | 326 |
| 241 | iso_pu_bacteria | 2582581283 | 2585168154 | 326 |
| 242 | iso_pu_bacteria | 2582581299 | 2585230329 | 326 |
| 243 | iso_pu_bacteria | 2582581306 | 2585269635 | 326 |
| 244 | iso_pu_bacteria | 2582581315 | 2585328505 | 326 |
| 245 | iso_pu_bacteria | 2582581865 | 2585388701 | 326 |
| 246 | iso_pu_bacteria | 2582581866 | 2585392550 | 326 |
| 247 | iso_pu_bacteria | 2585427526 | 2585527017 | 326 |
| 248 | iso_pu_bacteria | 2585427528 | 2585537780 | 326 |
| 249 | iso_pu_bacteria | 2585427593 | 2585835730 | 326 |
| 250 | iso_pu_bacteria | 2599185170 | 2599414879 | 326 |
| 251 | iso_pu_bacteria | 2615840626 | 2616309596 | 326 |
| 252 | iso_pu_bacteria | 2617270742 | 2617384596 | 326 |
| 253 | iso_pu_bacteria | 2643221643 | 2644239921 | 326 |
| 254 | iso_pu_bacteria | 2657244999 | 2657685830 | 326 |
| 255 | iso_pu_bacteria | 2690316117 | 2692319593 | 326 |
| 256 | iso_pu_bacteria | 2718217882 | 2719181471 | 326 |
| 257 | iso_pu_bacteria | 2718218009 | 2719732135 | 326 |
| 258 | iso_pu_bacteria | 2718218363 | 2721147463 | 326 |
| 259 | iso_pu_bacteria | 2718218365 | 2721159010 | 326 |
| 260 | iso_pu_bacteria | 2718218366 | 2721164398 | 326 |
| 261 | iso_pu_bacteria | 2721755514 | 2722840568 | 326 |
| 262 | iso_pu_bacteria | 2721755810 | 2724044891 | 326 |
| 263 | iso_pu_bacteria | 2724679232 | 2725950499 | 326 |
| 264 | iso_pu_bacteria | 2728369365 | 2730164606 | 326 |
| 265 | iso_pu_bacteria | 2728369397 | 2730298642 | 326 |
| 266 | iso_pu_bacteria | 2738541333 | 2739032437 | 326 |
| 267 | iso_pu_bacteria | 2751185821 | 2753459248 | 326 |
| 268 | iso_pu_bacteria | 2765235942 | 2766066898 | 326 |
| 269 | iso_pu_bacteria | 2767802442 | 2770197573 | 326 |
| 270 | iso_pu_bacteria | 2775506902 | 2776272954 | 326 |
| 271 | iso_pu_bacteria | 2775506904 | 2776282202 | 326 |
| 272 | iso_pu_bacteria | 2791355082 | 2792579763 | 326 |
| 273 | iso_pu_bacteria | 2791355091 | 2792624493 | 326 |
| 274 | iso_pu_bacteria | 2791355092 | 2792630571 | 326 |
| 275 | iso_pu_bacteria | 2791355094 | 2792640812 | 326 |
| 276 | iso_pu_bacteria | 2791355259 | 2793312459 | 326 |
| 277 | iso_pu_bacteria | 2791355260 | 2793322992 | 326 |
| 278 | iso_pu_bacteria | 2791355264 | 2793349918 | 326 |
| 279 | iso_pu_bacteria | 2791355265 | 2793352857 | 326 |
| 280 | iso_pu_bacteria | 2791355266 | 2793360723 | 326 |
| 281 | iso_pu_bacteria | 2791355267 | 2793366936 | 326 |
| 282 | iso_pu_bacteria | 2802429268 | 2804755359 | 326 |
| 283 | iso_pu_bacteria | 2802429605 | 2805925899 | 326 |
| 284 | iso_pu_bacteria | 2802429633 | 2806043412 | 326 |
| 285 | iso_pu_bacteria | 2802429634 | 2806050654 | 326 |
| 286 | iso_pu_bacteria | 2802429635 | 2806057471 | 326 |
| 287 | iso_pu_bacteria | 2802429636 | 2806064853 | 326 |
| 288 | iso_pu_bacteria | 2802429637 | 2806072119 | 326 |
| 289 | iso_pu_bacteria | 2818991448 | 2819611868 | 326 |
| 290 | iso_pu_bacteria | 2838022645 | 2838026216 | 326 |
| 291 | iso_pu_bacteria | 2838035591 | 2838039400 | 326 |
| 292 | iso_pu_bacteria | 2838048938 | 2838053564 | 326 |
| 293 | iso_pu_bacteria | 2838061910 | 2838065606 | 326 |
| 294 | iso_pu_bacteria | 2838074704 | 2838080236 | 326 |
| 295 | iso_pu_bacteria | 2838661181 | 2838667575 | 326 |
| 296 | iso_pu_bacteria | 2838668709 | 2838674436 | 326 |
| 297 | iso_pu_bacteria | 2838680041 | 2838681984 | 326 |
| 298 | iso_pu_bacteria | 2838686498 | 2838692011 | 326 |
| 299 | iso_pu_bacteria | 2838694306 | 2838696555 | 326 |
| 300 | iso_pu_bacteria | 2838701080 | 2838706964 | 326 |
| 301 | iso_pu_bacteria | 2838707686 | 2838710205 | 326 |
| 302 | iso_pu_bacteria | 2838729681 | 2838732843 | 326 |
| 303 | iso_pu_bacteria | 2838742623 | 2838745721 | 326 |
| 304 | iso_pu_bacteria | 2840764183 | 2840764749 | 326 |
| 305 | iso_pu_bacteria | 2841851746 | 2841855821 | 326 |
| 306 | iso_pu_bacteria | 2842077413 | 2842078379 | 326 |
| 307 | iso_pu_bacteria | 2842110456 | 2842114167 | 326 |
| 308 | iso_pu_bacteria | 2842118031 | 2842119112 | 326 |
| 309 | iso_pu_bacteria | 2842146304 | 2842151492 | 326 |
| 310 | iso_pu_bacteria | 2842156927 | 2842157187 | 326 |
| 311 | iso_pu_bacteria | 2842163707 | 2842167848 | 326 |
| 312 | iso_pu_bacteria | 2842180545 | 2842181229 | 326 |
| 313 | iso_pu_bacteria | 2842192696 | 2842194308 | 326 |
| 314 | iso_pu_bacteria | 2842198810 | 2842201851 | 326 |
| 315 | iso_pu_bacteria | 2842217011 | 2842217495 | 326 |
| 316 | iso_pu_bacteria | 2842229732 | 2842230720 | 326 |
| 317 | iso_pu_bacteria | 2842237096 | 2842239617 | 326 |
| 318 | iso_pu_bacteria | 2842243621 | 2842245180 | 326 |
| 319 | iso_pu_bacteria | 2842250916 | 2842256630 | 326 |
| 320 | iso_pu_bacteria | 2842257432 | 2842258993 | 326 |
| 321 | iso_pu_bacteria | 2842271015 | 2842276337 | 326 |
| 322 | iso_pu_bacteria | 2842285085 | 2842285933 | 326 |
| 323 | iso_pu_bacteria | 2842291075 | 2842292041 | 326 |
| 324 | iso_pu_bacteria | 2842304105 | 2842304520 | 326 |
| 325 | iso_pu_bacteria | 2842311132 | 2842314438 | 326 |
| 326 | iso_pu_bacteria | 2842317721 | 2842323063 | 326 |
| 327 | iso_pu_bacteria | 2842341865 | 2842345323 | 326 |
| 328 | iso_pu_bacteria | 2842363717 | 2842364772 | 326 |
| 329 | iso_pu_bacteria | 2842370503 | 2842372550 | 326 |
| 330 | iso_pu_bacteria | 2842377471 | 2842378437 | 326 |
| 331 | iso_pu_bacteria | 2842384541 | 2842385622 | 326 |
| 332 | iso_pu_bacteria | 2842402390 | 2842403292 | 326 |
| 333 | iso_pu_bacteria | 2842409023 | 2842409335 | 326 |
| 334 | iso_pu_bacteria | 2842415677 | 2842415988 | 326 |
| 335 | iso_pu_bacteria | 2842447887 | 2842450774 | 326 |
| 336 | iso_pu_bacteria | 2842489311 | 2842490230 | 326 |
| 337 | iso_pu_bacteria | 2842495871 | 2842495975 | 326 |
| 338 | iso_pu_bacteria | 2842521101 | 2842525629 | 326 |
| 339 | iso_pu_bacteria | 2844454524 | 2844458934 | 326 |
| 340 | iso_pu_bacteria | 2847417321 | 2847421184 | 326 |
| 341 | iso_pu_bacteria | 2848992105 | 2848998466 | 326 |
| 342 | iso_pu_bacteria | 2850079185 | 2850084912 | 326 |
| 343 | iso_pu_bacteria | 2855872281 | 2855875331 | 326 |
| 344 | iso_pu_bacteria | 2857516855 | 2857519941 | 326 |
| 345 | iso_pu_bacteria | 2896384573 | 2896389246 | 326 |
| 346 | iso_pu_bacteria | 2913295892 | 2913297137 | 326 |
| 347 | iso_pu_bacteria | 2920760137 | 2920766511 | 326 |
| 348 | iso_pu_bacteria | 2933570622 | 2933571793 | 326 |
| 349 | iso_pu_bacteria | 2933586486 | 2933590263 | 326 |
| 350 | iso_pu_bacteria | 2935894831 | 2935897589 | 326 |
| 351 | iso_pu_bacteria | 2935901341 | 2935905458 | 326 |
| 352 | iso_pu_bacteria | 2936367885 | 2936372473 | 326 |
| 353 | iso_pu_bacteria | 2936375103 | 2936376536 | 326 |
| 354 | iso_pu_bacteria | 2941499720 | 2941503075 | 326 |
| 355 | iso_pu_bacteria | 2989771324 | 2989772880 | 326 |
| 356 | iso_pu_bacteria | 3003930520 | 3003931983 | 326 |
| 357 | iso_pu_bacteria | 3005445848 | 3005451854 | 326 |
| 358 | iso_pu_bacteria | 639633055 | 639648777 | 326 |
| 359 | iso_pu_bacteria | 643692032 | 643822274 | 326 |
| 360 | iso_pu_bacteria | 8005289223 | 8005293290 | 326 |
| 361 | iso_pu_bacteria | 8005301065 | 8005302765 | 326 |
| 362 | iso_pu_bacteria | 8005307578 | 8005312392 | 326 |
| 363 | iso_pu_bacteria | 8005376324 | 8005379450 | 326 |
| 364 | iso_pu_bacteria | 8005430974 | 8005431722 | 326 |
| 365 | iso_pu_bacteria | 8005460587 | 8005463210 | 326 |
| 366 | iso_pu_bacteria | 8005484373 | 8005486320 | 326 |
| 367 | iso_pu_bacteria | 8005556819 | 8005557467 | 326 |
| 368 | iso_pu_bacteria | 8005563573 | 8005568644 | 326 |
| 369 | iso_pu_bacteria | 8005570704 | 8005574493 | 326 |
| 370 | iso_pu_bacteria | 8005688590 | 8005694785 | 326 |
| 371 | iso_pu_bacteria | 8018163183 | 8018166555 | 326 |
| 372 | iso_pu_bacteria | 8023680758 | 8023685157 | 326 |
| 373 | iso_pu_bacteria | 8024479707 | 8024483301 | 326 |
| 374 | iso_pu_bacteria | 8024486573 | 8024486678 | 326 |
| 375 | iso_pu_bacteria | 8024501048 | 8024501436 | 326 |
| 376 | iso_pu_bacteria | 8046767195 | 8046767799 | 326 |
| 377 | iso_pu_bacteria | 8049293176 | 8049298254 | 326 |
| 378 | iso_pu_bacteria | 8054558443 | 8054561162 | 326 |
| 379 | iso_pu_bacteria | 8056375014 | 8056376822 | 326 |
| 380 | iso_pu_bacteria | 8056382006 | 8056388049 | 326 |
| 381 | iso_pu_bacteria | 8057874678 | 8057874807 | 326 |
| 382 | 3300005435 | Ga0070714_100143638 | Ga0070714_1001436382 | 327 |
| 383 | 3300005435 | Ga0070714_100158810 | Ga0070714_1001588102 | 327 |
| 384 | 3300005436 | Ga0070713_100019136 | Ga0070713_1000191365 | 327 |
| 385 | 3300005437 | Ga0070710_10003768 | Ga0070710_100037684 | 327 |
| 386 | 3300006028 | Ga0070717_10134531 | Ga0070717_101345312 | 327 |
| 387 | 3300006175 | Ga0070712_100003703 | Ga0070712_1000037037 | 327 |
| 388 | 3300007265 | Ga0099794_10002417 | Ga0099794_100024178 | 327 |
| 389 | 3300025906 | Ga0207699_10021067 | Ga0207699_100210672 | 327 |
| 390 | 3300025915 | Ga0207693_10006645 | Ga0207693_100066456 | 327 |
| 391 | 3300025928 | Ga0207700_10133916 | Ga0207700_101339161 | 327 |
| 392 | 3300025928 | Ga0207700_10155650 | Ga0207700_101556502 | 327 |
| 393 | 3300025929 | Ga0207664_10017070 | Ga0207664_100170702 | 327 |
| 394 | 3300027512 | Ga0209179_1003933 | Ga0209179_10039332 | 327 |
| 395 | 3300048907 | Ga0496104_0016282 | Ga0496104_0016282_2784_3818 | 327 |
| 396 | 3300048913 | Ga0496110_0017067 | Ga0496110_0017067_861_1910 | 327 |
| 397 | 3300048915 | Ga0496112_0074531 | Ga0496112_0074531_964_2013 | 327 |
| 398 | 3300048916 | Ga0496113_0134418 | Ga0496113_0134418_677_1711 | 327 |
| 399 | 3300048929 | Ga0496126_0012615 | Ga0496126_0012615_3983_5026 | 327 |
| 400 | 3300049572 | Ga0501036_0279960 | Ga0501036_0279960_70_1098 | 327 |
| 401 | 3300049578 | Ga0501042_0196987 | Ga0501042_0196987_91_1119 | 327 |
| 402 | iso_pu_bacteria | 2508501042 | 2508692052 | 327 |
| 403 | iso_pu_bacteria | 2513237094 | 2513640942 | 327 |
| 404 | iso_pu_bacteria | 2524023205 | 2524440231 | 327 |
| 405 | iso_pu_bacteria | 2528768022 | 2528852821 | 327 |
| 406 | iso_pu_bacteria | 2744054633 | 2745078056 | 327 |
| 407 | iso_pu_bacteria | 2824661429 | 2824662806 | 327 |
| 408 | iso_pu_bacteria | 2824704595 | 2824706570 | 327 |
| 409 | iso_pu_bacteria | 2824753945 | 2824756511 | 327 |
| 410 | iso_pu_bacteria | 2824763712 | 2824766005 | 327 |
| 411 | iso_pu_bacteria | 2844315083 | 2844319659 | 327 |
| 412 | iso_pu_bacteria | 2874628541 | 2874635489 | 327 |
| 413 | iso_pu_bacteria | 2879099564 | 2879102791 | 327 |
| 414 | iso_pu_bacteria | 2885409591 | 2885410771 | 327 |
| 415 | iso_pu_bacteria | 2903727486 | 2903730660 | 327 |
| 416 | iso_pu_bacteria | 2904711408 | 2904715264 | 327 |
| 417 | iso_pu_bacteria | 2906602504 | 2906609391 | 327 |
| 418 | iso_pu_bacteria | 2906626472 | 2906628368 | 327 |
| 419 | iso_pu_bacteria | 2922368715 | 2922370776 | 327 |
| 420 | iso_pu_bacteria | 2932784394 | 2932785475 | 327 |
| 421 | iso_pu_bacteria | 2932794094 | 2932797061 | 327 |
| 422 | iso_pu_bacteria | 2932801729 | 2932807356 | 327 |
| 423 | iso_pu_bacteria | 2932809354 | 2932816606 | 327 |
| 424 | iso_pu_bacteria | 2932818245 | 2932822107 | 327 |
| 425 | iso_pu_bacteria | 2932828146 | 2932833188 | 327 |
| 426 | iso_pu_bacteria | 2933577622 | 2933581102 | 327 |
| 427 | iso_pu_bacteria | 2935616580 | 2935620585 | 327 |
| 428 | iso_pu_bacteria | 2935638405 | 2935639672 | 327 |
| 429 | iso_pu_bacteria | 2935648319 | 2935650811 | 327 |
| 430 | iso_pu_bacteria | 2935656913 | 2935658992 | 327 |
| 431 | iso_pu_bacteria | 2935665750 | 2935667490 | 327 |
| 432 | iso_pu_bacteria | 2935675223 | 2935677451 | 327 |
| 433 | iso_pu_bacteria | 2935684952 | 2935690606 | 327 |
| 434 | iso_pu_bacteria | 2935694250 | 2935696416 | 327 |
| 435 | iso_pu_bacteria | 2935703347 | 2935705230 | 327 |
| 436 | iso_pu_bacteria | 2935713505 | 2935717698 | 327 |
| 437 | iso_pu_bacteria | 2935722832 | 2935727152 | 327 |
| 438 | iso_pu_bacteria | 2935732158 | 2935735922 | 327 |
| 439 | iso_pu_bacteria | 2935741537 | 2935744807 | 327 |
| 440 | iso_pu_bacteria | 2935750917 | 2935755615 | 327 |
| 441 | iso_pu_bacteria | 2935760218 | 2935761872 | 327 |
| 442 | iso_pu_bacteria | 2935801545 | 2935806976 | 327 |
| 443 | iso_pu_bacteria | 2935810662 | 2935814194 | 327 |
| 444 | iso_pu_bacteria | 2935827899 | 2935829155 | 327 |
| 445 | iso_pu_bacteria | 2935837841 | 2935845311 | 327 |
| 446 | iso_pu_bacteria | 2935855204 | 2935858393 | 327 |
| 447 | iso_pu_bacteria | 2935864058 | 2935872329 | 327 |
| 448 | iso_pu_bacteria | 2935873716 | 2935877324 | 327 |
| 449 | iso_pu_bacteria | 2935883170 | 2935884516 | 327 |
| 450 | iso_pu_bacteria | 2935916978 | 2935923630 | 327 |
| 451 | iso_pu_bacteria | 2935984226 | 2935987261 | 327 |
| 452 | iso_pu_bacteria | 2935992306 | 2935995057 | 327 |
| 453 | iso_pu_bacteria | 2936002035 | 2936006150 | 327 |
| 454 | iso_pu_bacteria | 2936011229 | 2936013407 | 327 |
| 455 | iso_pu_bacteria | 2936019824 | 2936022466 | 327 |
| 456 | iso_pu_bacteria | 2936028420 | 2936030912 | 327 |
| 457 | iso_pu_bacteria | 2936037263 | 2936039749 | 327 |
| 458 | iso_pu_bacteria | 2936046547 | 2936048725 | 327 |
| 459 | iso_pu_bacteria | 2936055302 | 2936058939 | 327 |
| 460 | iso_pu_bacteria | 2940556831 | 2940561104 | 327 |
| 461 | iso_pu_bacteria | 2941538514 | 2941545718 | 327 |
| 462 | iso_pu_bacteria | 3005710791 | 3005715376 | 327 |
| 463 | iso_pu_bacteria | 3005718088 | 3005719384 | 327 |
| 464 | iso_pu_bacteria | 8006964411 | 8006971049 | 327 |
| 465 | iso_pu_bacteria | 8006984368 | 8006986687 | 327 |
| 466 | iso_pu_bacteria | 8016583857 | 8016591085 | 327 |
| 467 | iso_pu_bacteria | 8016630954 | 8016636249 | 327 |
| 468 | iso_pu_bacteria | 8016630954 | 8016639825 | 327 |
| 469 | iso_pu_bacteria | 8017057580 | 8017059702 | 327 |
| 470 | iso_pu_bacteria | 8019576017 | 8019579177 | 327 |
| 471 | iso_pu_bacteria | 8019586578 | 8019597231 | 327 |
| 472 | iso_pu_bacteria | 8019597564 | 8019604464 | 327 |
| 473 | iso_pu_bacteria | 8019648815 | 8019659138 | 327 |
| 474 | iso_pu_bacteria | 8055742211 | 8055749562 | 327 |
| 475 | iso_pu_bacteria | 8056967851 | 8056968670 | 327 |
| 476 | 3300005327 | Ga0070658_10084121 | Ga0070658_100841212 | 328 |
| 477 | 3300005329 | Ga0070683_100032630 | Ga0070683_1000326305 | 328 |
| 478 | 3300005336 | Ga0070680_100032603 | Ga0070680_1000326032 | 328 |
| 479 | 3300005339 | Ga0070660_100067269 | Ga0070660_1000672692 | 328 |
| 480 | 3300005435 | Ga0070714_100100930 | Ga0070714_1001009302 | 328 |
| 481 | 3300005436 | Ga0070713_100014695 | Ga0070713_1000146952 | 328 |
| 482 | 3300005436 | Ga0070713_100026782 | Ga0070713_1000267824 | 328 |
| 483 | 3300005530 | Ga0070679_100056648 | Ga0070679_1000566485 | 328 |
| 484 | 3300005535 | Ga0070684_100003618 | Ga0070684_1000036187 | 328 |
| 485 | 3300005536 | Ga0070697_100109950 | Ga0070697_1001099502 | 328 |
| 486 | 3300005539 | Ga0068853_100040370 | Ga0068853_1000403704 | 328 |
| 487 | 3300005563 | Ga0068855_100220273 | Ga0068855_1002202732 | 328 |
| 488 | 3300005577 | Ga0068857_100053523 | Ga0068857_1000535232 | 328 |
| 489 | 3300005834 | Ga0068851_10004499 | Ga0068851_100044995 | 328 |
| 490 | 3300005842 | Ga0068858_100231022 | Ga0068858_1002310222 | 328 |
| 491 | 3300005937 | Ga0081455_10005782 | Ga0081455_100057828 | 328 |
| 492 | 3300005983 | Ga0081540_1000195 | Ga0081540_100019521 | 328 |
| 493 | 3300006038 | Ga0075365_10089411 | Ga0075365_100894112 | 328 |
| 494 | 3300006173 | Ga0070716_100264802 | Ga0070716_1002648022 | 328 |
| 495 | 3300006178 | Ga0075367_10038586 | Ga0075367_100385864 | 328 |
| 496 | 3300006195 | Ga0075366_10094274 | Ga0075366_100942741 | 328 |
| 497 | 3300006353 | Ga0075370_10006919 | Ga0075370_100069198 | 328 |
| 498 | 3300007076 | Ga0075435_100411866 | Ga0075435_1004118662 | 328 |
| 499 | 3300007788 | Ga0099795_10029791 | Ga0099795_100297912 | 328 |
| 500 | 3300009093 | Ga0105240_10031202 | Ga0105240_100312027 | 328 |
| 501 | 3300009545 | Ga0105237_10017035 | Ga0105237_100170357 | 328 |
| 502 | 3300009545 | Ga0105237_10354483 | Ga0105237_103544832 | 328 |
| 503 | 3300009551 | Ga0105238_10108545 | Ga0105238_101085453 | 328 |
| 504 | 3300009553 | Ga0105249_10577096 | Ga0105249_105770961 | 328 |
| 505 | 3300010159 | Ga0099796_10026519 | Ga0099796_100265192 | 328 |
| 506 | 3300010375 | Ga0105239_10157084 | Ga0105239_101570842 | 328 |
| 507 | 3300013104 | Ga0157370_10057819 | Ga0157370_100578192 | 328 |
| 508 | 3300013105 | Ga0157369_10047093 | Ga0157369_100470935 | 328 |
| 509 | 3300021377 | Ga0213874_10017590 | Ga0213874_100175903 | 328 |
| 510 | 3300025909 | Ga0207705_10063917 | Ga0207705_100639174 | 328 |
| 511 | 3300025912 | Ga0207707_10001229 | Ga0207707_1000122921 | 328 |
| 512 | 3300025913 | Ga0207695_10128881 | Ga0207695_101288812 | 328 |
| 513 | 3300025914 | Ga0207671_10103726 | Ga0207671_101037262 | 328 |
| 514 | 3300025915 | Ga0207693_10067559 | Ga0207693_100675592 | 328 |
| 515 | 3300025919 | Ga0207657_10000658 | Ga0207657_1000065838 | 328 |
| 516 | 3300025921 | Ga0207652_10005888 | Ga0207652_100058882 | 328 |
| 517 | 3300025922 | Ga0207646_10069582 | Ga0207646_100695824 | 328 |
| 518 | 3300025928 | Ga0207700_10160945 | Ga0207700_101609452 | 328 |
| 519 | 3300025939 | Ga0207665_10017888 | Ga0207665_100178885 | 328 |
| 520 | 3300025944 | Ga0207661_10241994 | Ga0207661_102419942 | 328 |
| 521 | 3300025949 | Ga0207667_10099955 | Ga0207667_100999552 | 328 |
| 522 | 3300026035 | Ga0207703_10144618 | Ga0207703_101446182 | 328 |
| 523 | 3300026041 | Ga0207639_10066316 | Ga0207639_100663163 | 328 |
| 524 | 3300026116 | Ga0207674_10205570 | Ga0207674_102055702 | 328 |
| 525 | 3300031507 | Ga0307509_10085879 | Ga0307509_100858792 | 328 |
| 526 | 3300035118 | Ga0373954_0028630 | Ga0373954_0028630_1436_2488 | 328 |
| 527 | 3300035724 | Ga0373933_0000225 | Ga0373933_0000225_12611_13648 | 328 |
| 528 | 3300036401 | Ga0373937_0100873 | Ga0373937_0100873_264_1316 | 328 |
| 529 | 3300039437 | Ga0436365_1246958 | Ga0436365_1246958_1363_2394 | 328 |
| 530 | 3300039450 | Ga0436363_0657874 | Ga0436363_0657874_3679_4725 | 328 |
| 531 | 3300039450 | Ga0436363_1534966 | Ga0436363_1534966_2090_3124 | 328 |
| 532 | 3300046679 | Ga0495623_0146185 | Ga0495623_0146185_42_1073 | 328 |
| 533 | 3300049574 | Ga0501038_0080223 | Ga0501038_0080223_619_1644 | 328 |
| 534 | 3300049576 | Ga0501040_0032832 | Ga0501040_0032832_1336_2361 | 328 |
| 535 | 3300049577 | Ga0501041_0045944 | Ga0501041_0045944_1208_2233 | 328 |
| 536 | 3300049588 | Ga0501072_0099070 | Ga0501072_0099070_212_1237 | 328 |
| 537 | 3300049590 | Ga0501074_0026529 | Ga0501074_0026529_1187_2212 | 328 |
| 538 | 3300049591 | Ga0501075_0016056 | Ga0501075_0016056_794_1819 | 328 |
| 539 | 3300049592 | Ga0501076_0013787 | Ga0501076_0013787_89_1114 | 328 |
| 540 | 3300049593 | Ga0501077_0031715 | Ga0501077_0031715_866_1891 | 328 |
| 541 | 3300049741 | Ga0501079_0093314 | Ga0501079_0093314_294_1319 | 328 |
| 542 | 3300049743 | Ga0501081_0004781 | Ga0501081_0004781_4828_5853 | 328 |
| 543 | 3300049822 | Ga0501035_0120349 | Ga0501035_0120349_1207_2232 | 328 |
| 544 | 3300049824 | Ga0501045_0010293 | Ga0501045_0010293_3274_4299 | 328 |
| 545 | 3300050512 | nmdc:mga0n895_230649_c1 | nmdc:mga0n895_230649_c1_452_1489 | 328 |
| 546 | 3300050513 | nmdc:mga0rr50_362930_c1 | nmdc:mga0rr50_362930_c1_103_1140 | 328 |
| 547 | 3300054114 | Ga0501084_0001165 | Ga0501084_0001165_18156_19181 | 328 |
| 548 | 3300060353 | Ga0501082_0027865 | Ga0501082_0027865_3766_4791 | 328 |
| 549 | 3300061734 | Ga0530510_0039974 | Ga0530510_0039974_1031_2056 | 328 |
| 550 | iso_pu_bacteria | 2738543013 | 2739249943 | 328 |
| 551 | iso_pu_bacteria | 2851182111 | 2851184268 | 328 |
| 552 | iso_pu_bacteria | 2919450847 | 2919454156 | 328 |
| 553 | iso_pu_bacteria | 8001845381 | 8001846231 | 328 |
| 554 | 3300044656 | Ga0466969_0075371 | Ga0466969_0075371_329_1345 | 329 |
| 555 | iso_pu_bacteria | 2508501128 | 2509152408 | 329 |
| 556 | iso_pu_bacteria | 2513237092 | 2513622265 | 329 |
| 557 | iso_pu_bacteria | 2513237095 | 2513645168 | 329 |
| 558 | iso_pu_bacteria | 2513237096 | 2513658601 | 329 |
| 559 | iso_pu_bacteria | 2513237104 | 2513721749 | 329 |
| 560 | iso_pu_bacteria | 2513237141 | 2513890044 | 329 |
| 561 | iso_pu_bacteria | 2513237145 | 2513920835 | 329 |
| 562 | iso_pu_bacteria | 2517093001 | 2517102489 | 329 |
| 563 | iso_pu_bacteria | 2667528175 | 2671123061 | 329 |
| 564 | iso_pu_bacteria | 2728368998 | 2728752277 | 329 |
| 565 | iso_pu_bacteria | 2791355197 | 2793070220 | 329 |
| 566 | iso_pu_bacteria | 2816332527 | 2818239427 | 329 |
| 567 | iso_pu_bacteria | 2824679649 | 2824682239 | 329 |
| 568 | iso_pu_bacteria | 2841957949 | 2841961816 | 329 |
| 569 | iso_pu_bacteria | 2847930680 | 2847936669 | 329 |
| 570 | iso_pu_bacteria | 2876761206 | 2876762241 | 329 |
| 571 | iso_pu_bacteria | 2879083081 | 2879087988 | 329 |
| 572 | iso_pu_bacteria | 2881665667 | 2881672444 | 329 |
| 573 | iso_pu_bacteria | 2885374607 | 2885378857 | 329 |
| 574 | iso_pu_bacteria | 2885383462 | 2885385416 | 329 |
| 575 | iso_pu_bacteria | 2888378607 | 2888384819 | 329 |
| 576 | iso_pu_bacteria | 2889033259 | 2889037429 | 329 |
| 577 | iso_pu_bacteria | 2903748898 | 2903753772 | 329 |
| 578 | iso_pu_bacteria | 2904690495 | 2904697992 | 329 |
| 579 | iso_pu_bacteria | 2906610324 | 2906614773 | 329 |
| 580 | iso_pu_bacteria | 2908739725 | 2908746393 | 329 |
| 581 | iso_pu_bacteria | 2908756301 | 2908763030 | 329 |
| 582 | iso_pu_bacteria | 2922393267 | 2922397593 | 329 |
| 583 | iso_pu_bacteria | 2922425934 | 2922426637 | 329 |
| 584 | iso_pu_bacteria | 2935630451 | 2935636892 | 329 |
| 585 | iso_pu_bacteria | 2941507105 | 2941513529 | 329 |
| 586 | iso_pu_bacteria | 2941515067 | 2941521492 | 329 |
| 587 | iso_pu_bacteria | 2941523033 | 2941529188 | 329 |
| 588 | iso_pu_bacteria | 3005474847 | 3005475985 | 329 |
| 589 | iso_pu_bacteria | 3005594810 | 3005599792 | 329 |
| 590 | iso_pu_bacteria | 8006926726 | 8006931098 | 329 |
| 591 | iso_pu_bacteria | 8019555841 | 8019561355 | 329 |
| 592 | iso_pu_bacteria | 8019565922 | 8019571434 | 329 |
| 593 | 3300025258 | Ga0209129_1004886 | Ga0209129_10048862 | 330 |
| 594 | 3300025294 | Ga0209025_1006605 | Ga0209025_10066056 | 330 |
| 595 | 3300025297 | Ga0209758_1008781 | Ga0209758_10087813 | 330 |
| 596 | 3300031456 | Ga0307513_10337544 | Ga0307513_103375442 | 330 |
| 597 | 3300041404 | Ga0439436_0000231 | Ga0439436_0000231_5058_6065 | 330 |
| 598 | 3300041406 | Ga0439439_0007026 | Ga0439439_0007026_606_1613 | 330 |
| 599 | 3300041997 | Ga0439431_0038494 | Ga0439431_0038494_38_1045 | 330 |
| 600 | 3300042007 | Ga0439449_0015812 | Ga0439449_0015812_594_1601 | 330 |
| 601 | 3300048917 | Ga0496114_0064538 | Ga0496114_0064538_854_1861 | 330 |
| 602 | 3300003320 | rootH2_10026777 | rootH2_100267775 | 331 |
| 603 | 3300003659 | JGI25404J52841_10000081 | JGI25404J52841_100000815 | 331 |
| 604 | 3300005328 | Ga0070676_10061945 | Ga0070676_100619452 | 331 |
| 605 | 3300005334 | Ga0068869_100078358 | Ga0068869_1000783583 | 331 |
| 606 | 3300005334 | Ga0068869_100118949 | Ga0068869_1001189492 | 331 |
| 607 | 3300005341 | Ga0070691_10195753 | Ga0070691_101957531 | 331 |
| 608 | 3300005347 | Ga0070668_100011099 | Ga0070668_1000110997 | 331 |
| 609 | 3300005347 | Ga0070668_100020589 | Ga0070668_1000205892 | 331 |
| 610 | 3300005353 | Ga0070669_100070459 | Ga0070669_1000704592 | 331 |
| 611 | 3300005353 | Ga0070669_100130310 | Ga0070669_1001303101 | 331 |
| 612 | 3300005356 | Ga0070674_100007035 | Ga0070674_1000070355 | 331 |
| 613 | 3300005365 | Ga0070688_100247981 | Ga0070688_1002479812 | 331 |
| 614 | 3300005435 | Ga0070714_100010743 | Ga0070714_1000107436 | 331 |
| 615 | 3300005438 | Ga0070701_10112218 | Ga0070701_101122182 | 331 |
| 616 | 3300005440 | Ga0070705_100095323 | Ga0070705_1000953232 | 331 |
| 617 | 3300005441 | Ga0070700_100022083 | Ga0070700_1000220831 | 331 |
| 618 | 3300005455 | Ga0070663_100070522 | Ga0070663_1000705222 | 331 |
| 619 | 3300005455 | Ga0070663_100146211 | Ga0070663_1001462112 | 331 |
| 620 | 3300005455 | Ga0070663_100360937 | Ga0070663_1003609371 | 331 |
| 621 | 3300005456 | Ga0070678_100010558 | Ga0070678_1000105584 | 331 |
| 622 | 3300005457 | Ga0070662_100031158 | Ga0070662_1000311584 | 331 |
| 623 | 3300005457 | Ga0070662_100048692 | Ga0070662_1000486922 | 331 |
| 624 | 3300005467 | Ga0070706_100055029 | Ga0070706_1000550295 | 331 |
| 625 | 3300005518 | Ga0070699_100039618 | Ga0070699_1000396184 | 331 |
| 626 | 3300005539 | Ga0068853_100296844 | Ga0068853_1002968442 | 331 |
| 627 | 3300005539 | Ga0068853_100348299 | Ga0068853_1003482992 | 331 |
| 628 | 3300005539 | Ga0068853_100370061 | Ga0068853_1003700612 | 331 |
| 629 | 3300005543 | Ga0070672_100185087 | Ga0070672_1001850871 | 331 |
| 630 | 3300005546 | Ga0070696_100098384 | Ga0070696_1000983842 | 331 |
| 631 | 3300005548 | Ga0070665_100015661 | Ga0070665_1000156618 | 331 |
| 632 | 3300005548 | Ga0070665_100073671 | Ga0070665_1000736714 | 331 |
| 633 | 3300005548 | Ga0070665_100142795 | Ga0070665_1001427952 | 331 |
| 634 | 3300005548 | Ga0070665_100227335 | Ga0070665_1002273352 | 331 |
| 635 | 3300005549 | Ga0070704_100106728 | Ga0070704_1001067282 | 331 |
| 636 | 3300005563 | Ga0068855_100018220 | Ga0068855_1000182206 | 331 |
| 637 | 3300005564 | Ga0070664_100260130 | Ga0070664_1002601302 | 331 |
| 638 | 3300005577 | Ga0068857_100096683 | Ga0068857_1000966832 | 331 |
| 639 | 3300005578 | Ga0068854_100123512 | Ga0068854_1001235122 | 331 |
| 640 | 3300005578 | Ga0068854_100266034 | Ga0068854_1002660342 | 331 |
| 641 | 3300005615 | Ga0070702_100090478 | Ga0070702_1000904782 | 331 |
| 642 | 3300005615 | Ga0070702_100202473 | Ga0070702_1002024731 | 331 |
| 643 | 3300005616 | Ga0068852_100211614 | Ga0068852_1002116142 | 331 |
| 644 | 3300005616 | Ga0068852_100216668 | Ga0068852_1002166682 | 331 |
| 645 | 3300005617 | Ga0068859_100143848 | Ga0068859_1001438482 | 331 |
| 646 | 3300005617 | Ga0068859_100258692 | Ga0068859_1002586923 | 331 |
| 647 | 3300005618 | Ga0068864_100075419 | Ga0068864_1000754192 | 331 |
| 648 | 3300005719 | Ga0068861_100045484 | Ga0068861_1000454842 | 331 |
| 649 | 3300005719 | Ga0068861_100072207 | Ga0068861_1000722072 | 331 |
| 650 | 3300005719 | Ga0068861_100111381 | Ga0068861_1001113813 | 331 |
| 651 | 3300005842 | Ga0068858_100028464 | Ga0068858_1000284642 | 331 |
| 652 | 3300005843 | Ga0068860_100168411 | Ga0068860_1001684112 | 331 |
| 653 | 3300005843 | Ga0068860_100413140 | Ga0068860_1004131402 | 331 |
| 654 | 3300005844 | Ga0068862_100020306 | Ga0068862_1000203066 | 331 |
| 655 | 3300005844 | Ga0068862_100111422 | Ga0068862_1001114223 | 331 |
| 656 | 3300005844 | Ga0068862_100203149 | Ga0068862_1002031492 | 331 |
| 657 | 3300005983 | Ga0081540_1003618 | Ga0081540_10036189 | 331 |
| 658 | 3300005985 | Ga0081539_10004005 | Ga0081539_100040054 | 331 |
| 659 | 3300006038 | Ga0075365_10076208 | Ga0075365_100762082 | 331 |
| 660 | 3300006038 | Ga0075365_10100467 | Ga0075365_101004672 | 331 |
| 661 | 3300006051 | Ga0075364_10011789 | Ga0075364_100117892 | 331 |
| 662 | 3300006051 | Ga0075364_10104787 | Ga0075364_101047872 | 331 |
| 663 | 3300006058 | Ga0075432_10074957 | Ga0075432_100749572 | 331 |
| 664 | 3300006177 | Ga0075362_10088533 | Ga0075362_100885332 | 331 |
| 665 | 3300006177 | Ga0075362_10134931 | Ga0075362_101349311 | 331 |
| 666 | 3300006178 | Ga0075367_10042114 | Ga0075367_100421145 | 331 |
| 667 | 3300006186 | Ga0075369_10027238 | Ga0075369_100272381 | 331 |
| 668 | 3300006195 | Ga0075366_10013479 | Ga0075366_100134794 | 331 |
| 669 | 3300006195 | Ga0075366_10048153 | Ga0075366_100481534 | 331 |
| 670 | 3300006195 | Ga0075366_10084781 | Ga0075366_100847812 | 331 |
| 671 | 3300006353 | Ga0075370_10022864 | Ga0075370_100228642 | 331 |
| 672 | 3300006353 | Ga0075370_10106095 | Ga0075370_101060952 | 331 |
| 673 | 3300006931 | Ga0097620_100143847 | Ga0097620_1001438472 | 331 |
| 674 | 3300006931 | Ga0097620_100258689 | Ga0097620_1002586893 | 331 |
| 675 | 3300007265 | Ga0099794_10025953 | Ga0099794_100259532 | 331 |
| 676 | 3300009092 | Ga0105250_10086862 | Ga0105250_100868622 | 331 |
| 677 | 3300009093 | Ga0105240_10011759 | Ga0105240_100117596 | 331 |
| 678 | 3300009093 | Ga0105240_10016843 | Ga0105240_100168434 | 331 |
| 679 | 3300009094 | Ga0111539_10055979 | Ga0111539_100559791 | 331 |
| 680 | 3300009098 | Ga0105245_10060265 | Ga0105245_100602652 | 331 |
| 681 | 3300009098 | Ga0105245_10073859 | Ga0105245_100738592 | 331 |
| 682 | 3300009101 | Ga0105247_10017735 | Ga0105247_100177352 | 331 |
| 683 | 3300009147 | Ga0114129_10141644 | Ga0114129_101416442 | 331 |
| 684 | 3300009148 | Ga0105243_10025143 | Ga0105243_100251434 | 331 |
| 685 | 3300009148 | Ga0105243_10032960 | Ga0105243_100329602 | 331 |
| 686 | 3300009174 | Ga0105241_10014987 | Ga0105241_100149873 | 331 |
| 687 | 3300009174 | Ga0105241_10050565 | Ga0105241_100505655 | 331 |
| 688 | 3300009177 | Ga0105248_10028709 | Ga0105248_100287096 | 331 |
| 689 | 3300009545 | Ga0105237_10000407 | Ga0105237_1000040717 | 331 |
| 690 | 3300009545 | Ga0105237_10006258 | Ga0105237_100062584 | 331 |
| 691 | 3300009545 | Ga0105237_10023255 | Ga0105237_100232553 | 331 |
| 692 | 3300009545 | Ga0105237_10122834 | Ga0105237_101228342 | 331 |
| 693 | 3300009545 | Ga0105237_10128946 | Ga0105237_101289464 | 331 |
| 694 | 3300009545 | Ga0105237_10433471 | Ga0105237_104334711 | 331 |
| 695 | 3300009551 | Ga0105238_10005854 | Ga0105238_1000585413 | 331 |
| 696 | 3300009551 | Ga0105238_10321064 | Ga0105238_103210642 | 331 |
| 697 | 3300009551 | Ga0105238_10419086 | Ga0105238_104190862 | 331 |
| 698 | 3300009553 | Ga0105249_10072678 | Ga0105249_100726784 | 331 |
| 699 | 3300010375 | Ga0105239_10000335 | Ga0105239_1000033526 | 331 |
| 700 | 3300010375 | Ga0105239_10039190 | Ga0105239_100391904 | 331 |
| 701 | 3300010375 | Ga0105239_10077141 | Ga0105239_100771413 | 331 |
| 702 | 3300011119 | Ga0105246_10341649 | Ga0105246_103416492 | 331 |
| 703 | 3300013296 | Ga0157374_10485952 | Ga0157374_104859521 | 331 |
| 704 | 3300013297 | Ga0157378_10302238 | Ga0157378_103022382 | 331 |
| 705 | 3300013308 | Ga0157375_10021587 | Ga0157375_100215877 | 331 |
| 706 | 3300014325 | Ga0163163_10354179 | Ga0163163_103541792 | 331 |
| 707 | 3300014326 | Ga0157380_10189385 | Ga0157380_101893851 | 331 |
| 708 | 3300014497 | Ga0182008_10053607 | Ga0182008_100536071 | 331 |
| 709 | 3300014968 | Ga0157379_10166222 | Ga0157379_101662223 | 331 |
| 710 | 3300014968 | Ga0157379_10277561 | Ga0157379_102775612 | 331 |
| 711 | 3300014969 | Ga0157376_10135506 | Ga0157376_101355062 | 331 |
| 712 | 3300014969 | Ga0157376_10300509 | Ga0157376_103005092 | 331 |
| 713 | 3300025253 | Ga0209677_100805 | Ga0209677_10080512 | 331 |
| 714 | 3300025254 | Ga0209148_1000647 | Ga0209148_100064714 | 331 |
| 715 | 3300025254 | Ga0209148_1011717 | Ga0209148_10117172 | 331 |
| 716 | 3300025261 | Ga0209233_1001170 | Ga0209233_10011706 | 331 |
| 717 | 3300025261 | Ga0209233_1010430 | Ga0209233_10104305 | 331 |
| 718 | 3300025272 | Ga0209455_1005167 | Ga0209455_10051675 | 331 |
| 719 | 3300025297 | Ga0209758_1039634 | Ga0209758_10396342 | 331 |
| 720 | 3300025303 | Ga0209051_1007994 | Ga0209051_10079945 | 331 |
| 721 | 3300025315 | Ga0207697_10011897 | Ga0207697_100118972 | 331 |
| 722 | 3300025315 | Ga0207697_10080082 | Ga0207697_100800822 | 331 |
| 723 | 3300025885 | Ga0207653_10025620 | Ga0207653_100256202 | 331 |
| 724 | 3300025893 | Ga0207682_10004544 | Ga0207682_100045442 | 331 |
| 725 | 3300025900 | Ga0207710_10012995 | Ga0207710_100129955 | 331 |
| 726 | 3300025904 | Ga0207647_10005772 | Ga0207647_100057725 | 331 |
| 727 | 3300025907 | Ga0207645_10037323 | Ga0207645_100373235 | 331 |
| 728 | 3300025907 | Ga0207645_10046830 | Ga0207645_100468302 | 331 |
| 729 | 3300025907 | Ga0207645_10194661 | Ga0207645_101946612 | 331 |
| 730 | 3300025908 | Ga0207643_10028118 | Ga0207643_100281182 | 331 |
| 731 | 3300025910 | Ga0207684_10150913 | Ga0207684_101509132 | 331 |
| 732 | 3300025911 | Ga0207654_10044646 | Ga0207654_100446462 | 331 |
| 733 | 3300025913 | Ga0207695_10000006 | Ga0207695_10000006936 | 331 |
| 734 | 3300025913 | Ga0207695_10010418 | Ga0207695_100104182 | 331 |
| 735 | 3300025913 | Ga0207695_10308852 | Ga0207695_103088522 | 331 |
| 736 | 3300025914 | Ga0207671_10009057 | Ga0207671_100090572 | 331 |
| 737 | 3300025914 | Ga0207671_10011585 | Ga0207671_100115857 | 331 |
| 738 | 3300025914 | Ga0207671_10073481 | Ga0207671_100734813 | 331 |
| 739 | 3300025919 | Ga0207657_10154515 | Ga0207657_101545152 | 331 |
| 740 | 3300025920 | Ga0207649_10090706 | Ga0207649_100907062 | 331 |
| 741 | 3300025923 | Ga0207681_10126500 | Ga0207681_101265002 | 331 |
| 742 | 3300025923 | Ga0207681_10153364 | Ga0207681_101533642 | 331 |
| 743 | 3300025924 | Ga0207694_10012928 | Ga0207694_100129286 | 331 |
| 744 | 3300025927 | Ga0207687_10053770 | Ga0207687_100537703 | 331 |
| 745 | 3300025931 | Ga0207644_10069782 | Ga0207644_100697822 | 331 |
| 746 | 3300025933 | Ga0207706_10033826 | Ga0207706_100338264 | 331 |
| 747 | 3300025933 | Ga0207706_10041595 | Ga0207706_100415954 | 331 |
| 748 | 3300025933 | Ga0207706_10060636 | Ga0207706_100606363 | 331 |
| 749 | 3300025933 | Ga0207706_10214218 | Ga0207706_102142182 | 331 |
| 750 | 3300025933 | Ga0207706_10495171 | Ga0207706_104951711 | 331 |
| 751 | 3300025935 | Ga0207709_10008413 | Ga0207709_100084135 | 331 |
| 752 | 3300025935 | Ga0207709_10045251 | Ga0207709_100452514 | 331 |
| 753 | 3300025935 | Ga0207709_10204766 | Ga0207709_102047662 | 331 |
| 754 | 3300025935 | Ga0207709_10255018 | Ga0207709_102550181 | 331 |
| 755 | 3300025936 | Ga0207670_10040156 | Ga0207670_100401564 | 331 |
| 756 | 3300025937 | Ga0207669_10092948 | Ga0207669_100929482 | 331 |
| 757 | 3300025938 | Ga0207704_10200172 | Ga0207704_102001722 | 331 |
| 758 | 3300025940 | Ga0207691_10339752 | Ga0207691_103397521 | 331 |
| 759 | 3300025941 | Ga0207711_10192015 | Ga0207711_101920152 | 331 |
| 760 | 3300025942 | Ga0207689_10020623 | Ga0207689_100206236 | 331 |
| 761 | 3300025942 | Ga0207689_10063252 | Ga0207689_100632523 | 331 |
| 762 | 3300025945 | Ga0207679_10267142 | Ga0207679_102671422 | 331 |
| 763 | 3300025949 | Ga0207667_10170598 | Ga0207667_101705984 | 331 |
| 764 | 3300025960 | Ga0207651_10162582 | Ga0207651_101625822 | 331 |
| 765 | 3300025961 | Ga0207712_10046477 | Ga0207712_100464772 | 331 |
| 766 | 3300025961 | Ga0207712_10178291 | Ga0207712_101782912 | 331 |
| 767 | 3300025972 | Ga0207668_10020133 | Ga0207668_100201332 | 331 |
| 768 | 3300025972 | Ga0207668_10025131 | Ga0207668_100251314 | 331 |
| 769 | 3300025972 | Ga0207668_10066910 | Ga0207668_100669102 | 331 |
| 770 | 3300025972 | Ga0207668_10153926 | Ga0207668_101539262 | 331 |
| 771 | 3300025972 | Ga0207668_10157297 | Ga0207668_101572972 | 331 |
| 772 | 3300025972 | Ga0207668_10201702 | Ga0207668_102017021 | 331 |
| 773 | 3300025972 | Ga0207668_10226514 | Ga0207668_102265142 | 331 |
| 774 | 3300026023 | Ga0207677_10068685 | Ga0207677_100686852 | 331 |
| 775 | 3300026023 | Ga0207677_10152481 | Ga0207677_101524812 | 331 |
| 776 | 3300026023 | Ga0207677_10155552 | Ga0207677_101555522 | 331 |
| 777 | 3300026067 | Ga0207678_10051569 | Ga0207678_100515693 | 331 |
| 778 | 3300026067 | Ga0207678_10271466 | Ga0207678_102714662 | 331 |
| 779 | 3300026089 | Ga0207648_10086738 | Ga0207648_100867382 | 331 |
| 780 | 3300026089 | Ga0207648_10172858 | Ga0207648_101728582 | 331 |
| 781 | 3300026116 | Ga0207674_10053120 | Ga0207674_100531204 | 331 |
| 782 | 3300026116 | Ga0207674_10202893 | Ga0207674_102028932 | 331 |
| 783 | 3300026118 | Ga0207675_100091301 | Ga0207675_1000913012 | 331 |
| 784 | 3300026118 | Ga0207675_100258500 | Ga0207675_1002585002 | 331 |
| 785 | 3300026121 | Ga0207683_10292745 | Ga0207683_102927452 | 331 |
| 786 | 3300026142 | Ga0207698_10210522 | Ga0207698_102105222 | 331 |
| 787 | 3300028379 | Ga0268266_10002919 | Ga0268266_1000291912 | 331 |
| 788 | 3300028379 | Ga0268266_10070968 | Ga0268266_100709684 | 331 |
| 789 | 3300028379 | Ga0268266_10189445 | Ga0268266_101894453 | 331 |
| 790 | 3300028380 | Ga0268265_10028233 | Ga0268265_100282332 | 331 |
| 791 | 3300028380 | Ga0268265_10089897 | Ga0268265_100898973 | 331 |
| 792 | 3300028380 | Ga0268265_10204786 | Ga0268265_102047862 | 331 |
| 793 | 3300028380 | Ga0268265_10242142 | Ga0268265_102421422 | 331 |
| 794 | 3300028381 | Ga0268264_10000050 | Ga0268264_1000005037 | 331 |
| 795 | 3300028381 | Ga0268264_10323527 | Ga0268264_103235272 | 331 |
| 796 | 3300028794 | Ga0307515_10000240 | Ga0307515_1000024035 | 331 |
| 797 | 3300028794 | Ga0307515_10001319 | Ga0307515_100013199 | 331 |
| 798 | 3300031238 | Ga0265332_10037532 | Ga0265332_100375323 | 331 |
| 799 | 3300031239 | Ga0265328_10030050 | Ga0265328_100300502 | 331 |
| 800 | 3300031241 | Ga0265325_10061509 | Ga0265325_100615092 | 331 |
| 801 | 3300031247 | Ga0265340_10007729 | Ga0265340_100077296 | 331 |
| 802 | 3300031249 | Ga0265339_10050005 | Ga0265339_100500053 | 331 |
| 803 | 3300031456 | Ga0307513_10049358 | Ga0307513_100493586 | 331 |
| 804 | 3300031456 | Ga0307513_10197129 | Ga0307513_101971292 | 331 |
| 805 | 3300031456 | Ga0307513_10355563 | Ga0307513_103555632 | 331 |
| 806 | 3300031507 | Ga0307509_10013707 | Ga0307509_100137079 | 331 |
| 807 | 3300031507 | Ga0307509_10228759 | Ga0307509_102287592 | 331 |
| 808 | 3300031507 | Ga0307509_10322717 | Ga0307509_103227172 | 331 |
| 809 | 3300031616 | Ga0307508_10000029 | Ga0307508_1000002947 | 331 |
| 810 | 3300031616 | Ga0307508_10108926 | Ga0307508_101089263 | 331 |
| 811 | 3300031616 | Ga0307508_10114255 | Ga0307508_101142551 | 331 |
| 812 | 3300031616 | Ga0307508_10304997 | Ga0307508_103049972 | 331 |
| 813 | 3300031712 | Ga0265342_10048798 | Ga0265342_100487984 | 331 |
| 814 | 3300031712 | Ga0265342_10132257 | Ga0265342_101322572 | 331 |
| 815 | 3300031730 | Ga0307516_10007591 | Ga0307516_100075919 | 331 |
| 816 | 3300031730 | Ga0307516_10007878 | Ga0307516_100078786 | 331 |
| 817 | 3300031730 | Ga0307516_10039620 | Ga0307516_100396203 | 331 |
| 818 | 3300031730 | Ga0307516_10050803 | Ga0307516_100508033 | 331 |
| 819 | 3300033179 | Ga0307507_10143236 | Ga0307507_101432362 | 331 |
| 820 | 3300033180 | Ga0307510_10012890 | Ga0307510_100128904 | 331 |
| 821 | 3300033180 | Ga0307510_10119136 | Ga0307510_101191362 | 331 |
| 822 | 3300033180 | Ga0307510_10233922 | Ga0307510_102339222 | 331 |
| 823 | 3300035083 | Ga0373926_0025820 | Ga0373926_0025820_359_1366 | 331 |
| 824 | 3300035111 | Ga0373923_0051564 | Ga0373923_0051564_157_1164 | 331 |
| 825 | 3300035118 | Ga0373954_0000871 | Ga0373954_0000871_4864_5886 | 331 |
| 826 | 3300035119 | Ga0373956_0003759 | Ga0373956_0003759_2404_3426 | 331 |
| 827 | 3300035120 | Ga0373957_0000492 | Ga0373957_0000492_5465_6487 | 331 |
| 828 | 3300035170 | Ga0373943_0005276 | Ga0373943_0005276_1109_2116 | 331 |
| 829 | 3300035171 | Ga0373946_0018761 | Ga0373946_0018761_781_1791 | 331 |
| 830 | 3300035171 | Ga0373946_0035846 | Ga0373946_0035846_408_1415 | 331 |
| 831 | 3300035172 | Ga0373955_0004827 | Ga0373955_0004827_4889_5911 | 331 |
| 832 | 3300035172 | Ga0373955_0041413 | Ga0373955_0041413_501_1508 | 331 |
| 833 | 3300035410 | Ga0373924_0001494 | Ga0373924_0001494_2157_3179 | 331 |
| 834 | 3300035695 | Ga0373927_0000449 | Ga0373927_0000449_18863_19873 | 331 |
| 835 | 3300035695 | Ga0373927_0006633 | Ga0373927_0006633_2145_3152 | 331 |
| 836 | 3300035695 | Ga0373927_0016946 | Ga0373927_0016946_2100_3107 | 331 |
| 837 | 3300035695 | Ga0373927_0033968 | Ga0373927_0033968_1404_2411 | 331 |
| 838 | 3300035695 | Ga0373927_0277437 | Ga0373927_0277437_46_1053 | 331 |
| 839 | 3300035724 | Ga0373933_0001750 | Ga0373933_0001750_2192_3214 | 331 |
| 840 | 3300037068 | Ga0373925_0007139 | Ga0373925_0007139_2138_3148 | 331 |
| 841 | 3300037068 | Ga0373925_0164582 | Ga0373925_0164582_711_1718 | 331 |
| 842 | 3300037068 | Ga0373925_0326750 | Ga0373925_0326750_31_1038 | 331 |
| 843 | 3300039437 | Ga0436365_0164550 | Ga0436365_0164550_1269_2276 | 331 |
| 844 | 3300045976 | Ga0466967_0214556 | Ga0466967_0214556_627_1634 | 331 |
| 845 | 3300046454 | Ga0495592_0053757 | Ga0495592_0053757_432_1439 | 331 |
| 846 | 3300046455 | Ga0495603_0000818 | Ga0495603_0000818_6511_7518 | 331 |
| 847 | 3300046457 | Ga0495590_0007877 | Ga0495590_0007877_1822_2841 | 331 |
| 848 | 3300046459 | Ga0495629_0006770 | Ga0495629_0006770_2196_3218 | 331 |
| 849 | 3300046459 | Ga0495629_0013918 | Ga0495629_0013918_3020_4042 | 331 |
| 850 | 3300046459 | Ga0495629_0015490 | Ga0495629_0015490_3860_4867 | 331 |
| 851 | 3300046460 | Ga0495638_0003476 | Ga0495638_0003476_5236_6243 | 331 |
| 852 | 3300046461 | Ga0495641_0007310 | Ga0495641_0007310_2454_3461 | 331 |
| 853 | 3300046462 | Ga0495651_0016327 | Ga0495651_0016327_2561_3583 | 331 |
| 854 | 3300046462 | Ga0495651_0032580 | Ga0495651_0032580_1558_2580 | 331 |
| 855 | 3300046472 | Ga0495580_0016170 | Ga0495580_0016170_231_1238 | 331 |
| 856 | 3300046473 | Ga0495582_0001574 | Ga0495582_0001574_11635_12642 | 331 |
| 857 | 3300046473 | Ga0495582_0034022 | Ga0495582_0034022_1416_2423 | 331 |
| 858 | 3300046474 | Ga0495605_0059097 | Ga0495605_0059097_344_1351 | 331 |
| 859 | 3300046475 | Ga0495639_0000021 | Ga0495639_0000021_3155_4162 | 331 |
| 860 | 3300046476 | Ga0495662_0001876 | Ga0495662_0001876_7490_8497 | 331 |
| 861 | 3300046477 | Ga0495664_0012190 | Ga0495664_0012190_522_1529 | 331 |
| 862 | 3300046492 | Ga0495585_0014960 | Ga0495585_0014960_3116_4141 | 331 |
| 863 | 3300046492 | Ga0495585_0053087 | Ga0495585_0053087_1010_2017 | 331 |
| 864 | 3300046499 | Ga0495594_0000199 | Ga0495594_0000199_11796_12803 | 331 |
| 865 | 3300046499 | Ga0495594_0108073 | Ga0495594_0108073_338_1345 | 331 |
| 866 | 3300046501 | Ga0495607_0150057 | Ga0495607_0150057_163_1170 | 331 |
| 867 | 3300046506 | Ga0495583_0028721 | Ga0495583_0028721_294_1301 | 331 |
| 868 | 3300046507 | Ga0495606_0011074 | Ga0495606_0011074_4794_5816 | 331 |
| 869 | 3300046507 | Ga0495606_0058867 | Ga0495606_0058867_720_1727 | 331 |
| 870 | 3300046507 | Ga0495606_0105318 | Ga0495606_0105318_325_1371 | 331 |
| 871 | 3300046511 | Ga0495608_0005805 | Ga0495608_0005805_5607_6629 | 331 |
| 872 | 3300046512 | Ga0495610_0026452 | Ga0495610_0026452_1979_2986 | 331 |
| 873 | 3300046512 | Ga0495610_0055986 | Ga0495610_0055986_385_1392 | 331 |
| 874 | 3300046514 | Ga0495618_0009590 | Ga0495618_0009590_374_1396 | 331 |
| 875 | 3300046514 | Ga0495618_0064509 | Ga0495618_0064509_260_1267 | 331 |
| 876 | 3300046514 | Ga0495618_0108804 | Ga0495618_0108804_363_1385 | 331 |
| 877 | 3300046516 | Ga0495628_0165123 | Ga0495628_0165123_312_1319 | 331 |
| 878 | 3300046517 | Ga0495630_0059379 | Ga0495630_0059379_1593_2600 | 331 |
| 879 | 3300046519 | Ga0495632_0015766 | Ga0495632_0015766_346_1359 | 331 |
| 880 | 3300046519 | Ga0495632_0016557 | Ga0495632_0016557_1717_2736 | 331 |
| 881 | 3300046522 | Ga0495643_0025154 | Ga0495643_0025154_1044_2051 | 331 |
| 882 | 3300046523 | Ga0495644_0031250 | Ga0495644_0031250_914_1921 | 331 |
| 883 | 3300046524 | Ga0495648_0012986 | Ga0495648_0012986_1172_2194 | 331 |
| 884 | 3300046529 | Ga0495652_0003670 | Ga0495652_0003670_11023_12045 | 331 |
| 885 | 3300046529 | Ga0495652_0076299 | Ga0495652_0076299_1536_2543 | 331 |
| 886 | 3300046531 | Ga0495665_0007347 | Ga0495665_0007347_4067_5074 | 331 |
| 887 | 3300046533 | Ga0495640_0009862 | Ga0495640_0009862_380_1402 | 331 |
| 888 | 3300046533 | Ga0495640_0032849 | Ga0495640_0032849_2238_3245 | 331 |
| 889 | 3300046537 | Ga0495598_0001977 | Ga0495598_0001977_585_1592 | 331 |
| 890 | 3300046538 | Ga0495609_0032932 | Ga0495609_0032932_286_1293 | 331 |
| 891 | 3300046539 | Ga0495621_0002523 | Ga0495621_0002523_1822_2835 | 331 |
| 892 | 3300046542 | Ga0495597_0012282 | Ga0495597_0012282_1777_2796 | 331 |
| 893 | 3300046557 | Ga0495622_0001054 | Ga0495622_0001054_1549_2556 | 331 |
| 894 | 3300046557 | Ga0495622_0014896 | Ga0495622_0014896_1610_2617 | 331 |
| 895 | 3300046557 | Ga0495622_0050643 | Ga0495622_0050643_678_1685 | 331 |
| 896 | 3300046557 | Ga0495622_0054300 | Ga0495622_0054300_45_1067 | 331 |
| 897 | 3300046559 | Ga0495667_0002231 | Ga0495667_0002231_2561_3583 | 331 |
| 898 | 3300046615 | Ga0495656_0000673 | Ga0495656_0000673_4781_5788 | 331 |
| 899 | 3300046616 | Ga0495668_0034584 | Ga0495668_0034584_1111_2133 | 331 |
| 900 | 3300046616 | Ga0495668_0105245 | Ga0495668_0105245_275_1297 | 331 |
| 901 | 3300046642 | Ga0495634_0000537 | Ga0495634_0000537_21294_22301 | 331 |
| 902 | 3300046642 | Ga0495634_0041861 | Ga0495634_0041861_720_1742 | 331 |
| 903 | 3300046648 | Ga0495611_0005106 | Ga0495611_0005106_2352_3359 | 331 |
| 904 | 3300046660 | Ga0495625_0011106 | Ga0495625_0011106_4805_5824 | 331 |
| 905 | 3300046660 | Ga0495625_0015503 | Ga0495625_0015503_3306_4328 | 331 |
| 906 | 3300046660 | Ga0495625_0076817 | Ga0495625_0076817_43_1050 | 331 |
| 907 | 3300046663 | Ga0495635_0000544 | Ga0495635_0000544_9768_10790 | 331 |
| 908 | 3300046663 | Ga0495635_0014768 | Ga0495635_0014768_3122_4129 | 331 |
| 909 | 3300046664 | Ga0495659_0015934 | Ga0495659_0015934_1346_2353 | 331 |
| 910 | 3300046665 | Ga0495661_0034985 | Ga0495661_0034985_1829_2836 | 331 |
| 911 | 3300046674 | Ga0495588_0005106 | Ga0495588_0005106_4408_5415 | 331 |
| 912 | 3300046674 | Ga0495588_0008073 | Ga0495588_0008073_1126_2133 | 331 |
| 913 | 3300046674 | Ga0495588_0145188 | Ga0495588_0145188_138_1145 | 331 |
| 914 | 3300046675 | Ga0495657_0004009 | Ga0495657_0004009_8229_9251 | 331 |
| 915 | 3300046678 | Ga0495599_0013395 | Ga0495599_0013395_1187_2209 | 331 |
| 916 | 3300046680 | Ga0495646_0025629 | Ga0495646_0025629_2635_3642 | 331 |
| 917 | 3300046681 | Ga0495647_0003504 | Ga0495647_0003504_713_1720 | 331 |
| 918 | 3300046683 | Ga0495658_0002413 | Ga0495658_0002413_1041_2048 | 331 |
| 919 | 3300046684 | Ga0495669_0004064 | Ga0495669_0004064_4687_5694 | 331 |
| 920 | 3300046684 | Ga0495669_0021300 | Ga0495669_0021300_910_1917 | 331 |
| 921 | 3300046684 | Ga0495669_0111127 | Ga0495669_0111127_209_1216 | 331 |
| 922 | 3300046690 | Ga0495624_0001588 | Ga0495624_0001588_12975_13982 | 331 |
| 923 | 3300046690 | Ga0495624_0103577 | Ga0495624_0103577_107_1114 | 331 |
| 924 | 3300046691 | Ga0495670_0053887 | Ga0495670_0053887_838_1845 | 331 |
| 925 | 3300046692 | Ga0495671_0027092 | Ga0495671_0027092_186_1193 | 331 |
| 926 | 3300046692 | Ga0495671_0090308 | Ga0495671_0090308_147_1169 | 331 |
| 927 | 3300046694 | Ga0495649_0005062 | Ga0495649_0005062_3174_4193 | 331 |
| 928 | 3300046694 | Ga0495649_0012079 | Ga0495649_0012079_379_1401 | 331 |
| 929 | 3300046694 | Ga0495649_0099447 | Ga0495649_0099447_363_1370 | 331 |
| 930 | 3300046794 | Ga0495589_0112459 | Ga0495589_0112459_46_1053 | 331 |
| 931 | 3300046810 | Ga0495660_0054596 | Ga0495660_0054596_864_1883 | 331 |
| 932 | 3300047315 | Ga0495581_0000167 | Ga0495581_0000167_8982_9989 | 331 |
| 933 | 3300047317 | Ga0495604_0044826 | Ga0495604_0044826_323_1345 | 331 |
| 934 | 3300047318 | Ga0495636_0004964 | Ga0495636_0004964_1854_2861 | 331 |
| 935 | 3300047319 | Ga0495674_0006528 | Ga0495674_0006528_3028_4035 | 331 |
| 936 | 3300047322 | Ga0495680_0005784 | Ga0495680_0005784_7689_8711 | 331 |
| 937 | 3300047323 | Ga0495683_0019699 | Ga0495683_0019699_480_1502 | 331 |
| 938 | 3300047323 | Ga0495683_0090379 | Ga0495683_0090379_29_1036 | 331 |
| 939 | 3300047443 | Ga0495687_000161 | Ga0495687_000161_97811_98830 | 331 |
| 940 | 3300047443 | Ga0495687_007111 | Ga0495687_007111_3598_4617 | 331 |
| 941 | 3300047443 | Ga0495687_007129 | Ga0495687_007129_3598_4617 | 331 |
| 942 | 3300047443 | Ga0495687_028489 | Ga0495687_028489_154_1161 | 331 |
| 943 | 3300047443 | Ga0495687_039208 | Ga0495687_039208_331_1338 | 331 |
| 944 | 3300047447 | Ga0495685_057713 | Ga0495685_057713_258_1280 | 331 |
| 945 | 3300047470 | Ga0495681_0083405 | Ga0495681_0083405_220_1227 | 331 |
| 946 | 3300047472 | Ga0495686_0008703 | Ga0495686_0008703_3265_4284 | 331 |
| 947 | 3300047472 | Ga0495686_0042376 | Ga0495686_0042376_207_1214 | 331 |
| 948 | 3300047673 | Ga0495593_0000013 | Ga0495593_0000013_80035_81042 | 331 |
| 949 | 3300047673 | Ga0495593_0003915 | Ga0495593_0003915_6548_7570 | 331 |
| 950 | 3300048088 | Ga0495602_0022452 | Ga0495602_0022452_2987_4009 | 331 |
| 951 | 3300048088 | Ga0495602_0070141 | Ga0495602_0070141_285_1292 | 331 |
| 952 | 3300048089 | Ga0495614_0007950 | Ga0495614_0007950_1427_2434 | 331 |
| 953 | 3300048091 | Ga0495626_0118423 | Ga0495626_0118423_36_1043 | 331 |
| 954 | 3300048903 | Ga0496100_0147197 | Ga0496100_0147197_543_1550 | 331 |
| 955 | 3300048904 | Ga0496101_0046322 | Ga0496101_0046322_1914_2921 | 331 |
| 956 | 3300048904 | Ga0496101_0339673 | Ga0496101_0339673_162_1169 | 331 |
| 957 | 3300048905 | Ga0496102_0118725 | Ga0496102_0118725_1338_2345 | 331 |
| 958 | 3300048905 | Ga0496102_0136424 | Ga0496102_0136424_1228_2235 | 331 |
| 959 | 3300048905 | Ga0496102_0358283 | Ga0496102_0358283_159_1166 | 331 |
| 960 | 3300048906 | Ga0496103_0013406 | Ga0496103_0013406_792_1799 | 331 |
| 961 | 3300048907 | Ga0496104_0040743 | Ga0496104_0040743_988_2010 | 331 |
| 962 | 3300048907 | Ga0496104_0120356 | Ga0496104_0120356_680_1687 | 331 |
| 963 | 3300048908 | Ga0496105_0003511 | Ga0496105_0003511_496_1518 | 331 |
| 964 | 3300048909 | Ga0496106_0017437 | Ga0496106_0017437_4200_5207 | 331 |
| 965 | 3300048909 | Ga0496106_0087877 | Ga0496106_0087877_1067_2113 | 331 |
| 966 | 3300048910 | Ga0496107_0164054 | Ga0496107_0164054_346_1353 | 331 |
| 967 | 3300048914 | Ga0496111_0064659 | Ga0496111_0064659_597_1619 | 331 |
| 968 | 3300048915 | Ga0496112_0000014 | Ga0496112_0000014_113563_114585 | 331 |
| 969 | 3300048915 | Ga0496112_0027410 | Ga0496112_0027410_3530_4552 | 331 |
| 970 | 3300048916 | Ga0496113_0060287 | Ga0496113_0060287_1331_2353 | 331 |
| 971 | 3300048916 | Ga0496113_0069599 | Ga0496113_0069599_1422_2429 | 331 |
| 972 | 3300048917 | Ga0496114_0021665 | Ga0496114_0021665_3928_4935 | 331 |
| 973 | 3300048917 | Ga0496114_0160571 | Ga0496114_0160571_468_1490 | 331 |
| 974 | 3300048918 | Ga0496115_0024502 | Ga0496115_0024502_2686_3693 | 331 |
| 975 | 3300048920 | Ga0496117_0043929 | Ga0496117_0043929_1861_2868 | 331 |
| 976 | 3300048921 | Ga0496118_0014127 | Ga0496118_0014127_3529_4536 | 331 |
| 977 | 3300048921 | Ga0496118_0067240 | Ga0496118_0067240_798_1820 | 331 |
| 978 | 3300048922 | Ga0496119_0008920 | Ga0496119_0008920_2414_3436 | 331 |
| 979 | 3300048922 | Ga0496119_0033397 | Ga0496119_0033397_2200_3222 | 331 |
| 980 | 3300048924 | Ga0496121_0024554 | Ga0496121_0024554_467_1474 | 331 |
| 981 | 3300048925 | Ga0496122_0164388 | Ga0496122_0164388_114_1121 | 331 |
| 982 | 3300048927 | Ga0496124_0030911 | Ga0496124_0030911_1682_2689 | 331 |
| 983 | 3300048927 | Ga0496124_0263794 | Ga0496124_0263794_146_1168 | 331 |
| 984 | 3300048928 | Ga0496125_0028676 | Ga0496125_0028676_2274_3281 | 331 |
| 985 | 3300048928 | Ga0496125_0185643 | Ga0496125_0185643_348_1355 | 331 |
| 986 | 3300048929 | Ga0496126_0009508 | Ga0496126_0009508_1558_2565 | 331 |
| 987 | 3300049571 | Ga0501034_0054939 | Ga0501034_0054939_1311_2321 | 331 |
| 988 | 3300050489 | nmdc:mga03683_27707_c1 | nmdc:mga03683_27707_c1_433_1452 | 331 |
| 989 | 3300050491 | nmdc:mga00v17_52854_c1 | nmdc:mga00v17_52854_c1_660_1667 | 331 |
| 990 | 3300050491 | nmdc:mga00v17_86883_c1 | nmdc:mga00v17_86883_c1_612_1619 | 331 |
| 991 | 3300050492 | nmdc:mga0yw44_227812_c1 | nmdc:mga0yw44_227812_c1_190_1197 | 331 |
| 992 | 3300050493 | nmdc:mga0k408_12101_c1 | nmdc:mga0k408_12101_c1_1893_2912 | 331 |
| 993 | 3300050493 | nmdc:mga0k408_176748_c1 | nmdc:mga0k408_176748_c1_93_1100 | 331 |
| 994 | 3300050493 | nmdc:mga0k408_20184_c1 | nmdc:mga0k408_20184_c1_1435_2454 | 331 |
| 995 | 3300050493 | nmdc:mga0k408_51178_c1 | nmdc:mga0k408_51178_c1_221_1261 | 331 |
| 996 | 3300050494 | nmdc:mga06z11_31136_c1 | nmdc:mga06z11_31136_c1_595_1614 | 331 |
| 997 | 3300050495 | nmdc:mga04h51_29754_c1 | nmdc:mga04h51_29754_c1_115_1122 | 331 |
| 998 | 3300050496 | nmdc:mga07m45_135609_c1 | nmdc:mga07m45_135609_c1_229_1236 | 331 |
| 999 | 3300050496 | nmdc:mga07m45_39087_c1 | nmdc:mga07m45_39087_c1_744_1751 | 331 |
| 1000 | 3300050507 | nmdc:mga05p37_138555_c1 | nmdc:mga05p37_138555_c1_1664_2671 | 331 |
| 1001 | 3300050516 | nmdc:mga0sz30_78734_c1 | nmdc:mga0sz30_78734_c1_229_1236 | 331 |
| 1002 | 3300053077 | Ga0495601_0235688 | Ga0495601_0235688_106_1113 | 331 |
| 1003 | 3300053080 | Ga0500635_0008596 | Ga0500635_0008596_146_1153 | 331 |
| 1004 | 3300053083 | Ga0495655_0041228 | Ga0495655_0041228_60_1067 | 331 |
| 1005 | 3300053085 | Ga0495619_0008105 | Ga0495619_0008105_2689_3711 | 331 |
| 1006 | 3300053086 | Ga0500578_0072449 | Ga0500578_0072449_730_1737 | 331 |
| 1007 | 3300053086 | Ga0500578_0106240 | Ga0500578_0106240_474_1481 | 331 |
| 1008 | 3300053087 | Ga0500643_015020 | Ga0500643_015020_205_1227 | 331 |
| 1009 | 3300053088 | Ga0500644_0048799 | Ga0500644_0048799_275_1297 | 331 |
| 1010 | 3300053092 | Ga0500583_0014268 | Ga0500583_0014268_98_1120 | 331 |
| 1011 | 3300053092 | Ga0500583_0048694 | Ga0500583_0048694_852_1874 | 331 |
| 1012 | 3300053092 | Ga0500583_0141805 | Ga0500583_0141805_174_1181 | 331 |
| 1013 | 3300053093 | Ga0500651_0215545 | Ga0500651_0215545_29_1036 | 331 |
| 1014 | 3300053096 | Ga0500641_0019800 | Ga0500641_0019800_782_1804 | 331 |
| 1015 | 3300053102 | Ga0500554_000799 | Ga0500554_000799_5167_6174 | 331 |
| 1016 | 3300053108 | Ga0500562_005782 | Ga0500562_005782_365_1372 | 331 |
| 1017 | 3300053119 | Ga0500595_001031 | Ga0500595_001031_12548_13555 | 331 |
| 1018 | 3300053119 | Ga0500595_033517 | Ga0500595_033517_267_1289 | 331 |
| 1019 | 3300053130 | Ga0500642_0006746 | Ga0500642_0006746_1410_2432 | 331 |
| 1020 | 3300053134 | Ga0500658_0003506 | Ga0500658_0003506_1722_2741 | 331 |
| 1021 | 3300053134 | Ga0500658_0040891 | Ga0500658_0040891_40_1047 | 331 |
| 1022 | 3300053136 | Ga0500559_0007867 | Ga0500559_0007867_3203_4210 | 331 |
| 1023 | 3300053136 | Ga0500559_0083909 | Ga0500559_0083909_198_1205 | 331 |
| 1024 | 3300053140 | Ga0500573_0050258 | Ga0500573_0050258_541_1548 | 331 |
| 1025 | 3300053142 | Ga0500577_0021519 | Ga0500577_0021519_1045_2052 | 331 |
| 1026 | 3300053148 | Ga0500590_048803 | Ga0500590_048803_962_1969 | 331 |
| 1027 | 3300053150 | Ga0500603_000821 | Ga0500603_000821_1729_2736 | 331 |
| 1028 | 3300053156 | Ga0500622_0003724 | Ga0500622_0003724_1018_2025 | 331 |
| 1029 | 3300053158 | Ga0500627_0033050 | Ga0500627_0033050_293_1315 | 331 |
| 1030 | 3300053163 | Ga0500639_073864 | Ga0500639_073864_15_1037 | 331 |
| 1031 | 3300053177 | Ga0500636_0015436 | Ga0500636_0015436_1966_2973 | 331 |
| 1032 | 3300053177 | Ga0500636_0110373 | Ga0500636_0110373_527_1534 | 331 |
| 1033 | 3300053177 | Ga0500636_0140310 | Ga0500636_0140310_86_1093 | 331 |
| 1034 | 3300053178 | Ga0500637_0002825 | Ga0500637_0002825_5159_6166 | 331 |
| 1035 | 3300053178 | Ga0500637_0149103 | Ga0500637_0149103_145_1152 | 331 |
| 1036 | 3300053730 | Ga0500645_016719 | Ga0500645_016719_731_1777 | 331 |
| 1037 | 3300053731 | Ga0500609_006213 | Ga0500609_006213_62_1069 | 331 |
| 1038 | 3300053736 | Ga0500599_000221 | Ga0500599_000221_2823_3830 | 331 |
| 1039 | 3300053737 | Ga0500601_000130 | Ga0500601_000130_11035_12057 | 331 |
| 1040 | 3300055283 | Ga0500661_004632 | Ga0500661_004632_1460_2482 | 331 |
| 1041 | 3300055283 | Ga0500661_010201 | Ga0500661_010201_344_1366 | 331 |
| 1042 | 3300002705 | JGI25156J39149_1000240 | JGI25156J39149_100024015 | 332 |
| 1043 | 3300002738 | JGI25154J39366_1000445 | JGI25154J39366_10004458 | 332 |
| 1044 | 3300002741 | JGI25157J39369_1000148 | JGI25157J39369_100014815 | 332 |
| 1045 | 3300003752 | Ga0055539_1002041 | Ga0055539_10020412 | 332 |
| 1046 | 3300003752 | Ga0055539_1003138 | Ga0055539_10031382 | 332 |
| 1047 | 3300003756 | Ga0055533_1000016 | Ga0055533_1000016223 | 332 |
| 1048 | 3300003759 | Ga0055525_1002495 | Ga0055525_10024952 | 332 |
| 1049 | 3300005327 | Ga0070658_10044005 | Ga0070658_100440054 | 332 |
| 1050 | 3300005338 | Ga0068868_100124026 | Ga0068868_1001240262 | 332 |
| 1051 | 3300005347 | Ga0070668_100087753 | Ga0070668_1000877532 | 332 |
| 1052 | 3300005364 | Ga0070673_100005668 | Ga0070673_1000056687 | 332 |
| 1053 | 3300005366 | Ga0070659_100294127 | Ga0070659_1002941272 | 332 |
| 1054 | 3300005367 | Ga0070667_100018497 | Ga0070667_1000184971 | 332 |
| 1055 | 3300005439 | Ga0070711_100033655 | Ga0070711_1000336554 | 332 |
| 1056 | 3300005457 | Ga0070662_100010779 | Ga0070662_1000107793 | 332 |
| 1057 | 3300005459 | Ga0068867_100000020 | Ga0068867_10000002031 | 332 |
| 1058 | 3300005467 | Ga0070706_100000873 | Ga0070706_10000087323 | 332 |
| 1059 | 3300005548 | Ga0070665_100283770 | Ga0070665_1002837702 | 332 |
| 1060 | 3300005563 | Ga0068855_100062837 | Ga0068855_1000628374 | 332 |
| 1061 | 3300005577 | Ga0068857_100011076 | Ga0068857_1000110764 | 332 |
| 1062 | 3300005578 | Ga0068854_100018998 | Ga0068854_1000189985 | 332 |
| 1063 | 3300005614 | Ga0068856_100008374 | Ga0068856_1000083749 | 332 |
| 1064 | 3300005617 | Ga0068859_100057158 | Ga0068859_1000571582 | 332 |
| 1065 | 3300005617 | Ga0068859_100228755 | Ga0068859_1002287552 | 332 |
| 1066 | 3300005618 | Ga0068864_100009044 | Ga0068864_1000090443 | 332 |
| 1067 | 3300005843 | Ga0068860_100100810 | Ga0068860_1001008103 | 332 |
| 1068 | 3300005844 | Ga0068862_100016461 | Ga0068862_1000164616 | 332 |
| 1069 | 3300006178 | Ga0075367_10041835 | Ga0075367_100418352 | 332 |
| 1070 | 3300006195 | Ga0075366_10009032 | Ga0075366_100090325 | 332 |
| 1071 | 3300006195 | Ga0075366_10026168 | Ga0075366_100261682 | 332 |
| 1072 | 3300006353 | Ga0075370_10002403 | Ga0075370_100024032 | 332 |
| 1073 | 3300006353 | Ga0075370_10033493 | Ga0075370_100334932 | 332 |
| 1074 | 3300006353 | Ga0075370_10066745 | Ga0075370_100667452 | 332 |
| 1075 | 3300006931 | Ga0097620_100057158 | Ga0097620_1000571585 | 332 |
| 1076 | 3300006931 | Ga0097620_100228753 | Ga0097620_1002287532 | 332 |
| 1077 | 3300009098 | Ga0105245_10277391 | Ga0105245_102773912 | 332 |
| 1078 | 3300009147 | Ga0114129_10332294 | Ga0114129_103322943 | 332 |
| 1079 | 3300009148 | Ga0105243_10045659 | Ga0105243_100456593 | 332 |
| 1080 | 3300009148 | Ga0105243_10347435 | Ga0105243_103474352 | 332 |
| 1081 | 3300009174 | Ga0105241_10007024 | Ga0105241_100070248 | 332 |
| 1082 | 3300009545 | Ga0105237_10157199 | Ga0105237_101571992 | 332 |
| 1083 | 3300009551 | Ga0105238_10016113 | Ga0105238_100161137 | 332 |
| 1084 | 3300010375 | Ga0105239_10035550 | Ga0105239_100355502 | 332 |
| 1085 | 3300013306 | Ga0163162_10134352 | Ga0163162_101343523 | 332 |
| 1086 | 3300013306 | Ga0163162_10277471 | Ga0163162_102774711 | 332 |
| 1087 | 3300014745 | Ga0157377_10000032 | Ga0157377_1000003211 | 332 |
| 1088 | 3300014968 | Ga0157379_10092466 | Ga0157379_100924662 | 332 |
| 1089 | 3300015683 | Ga0183362_10002 | Ga0183362_10002337 | 332 |
| 1090 | 3300025226 | Ga0209674_100041 | Ga0209674_100041161 | 332 |
| 1091 | 3300025230 | Ga0209563_100043 | Ga0209563_100043161 | 332 |
| 1092 | 3300025246 | Ga0209646_1000069 | Ga0209646_1000069130 | 332 |
| 1093 | 3300025250 | Ga0209026_1000006 | Ga0209026_1000006225 | 332 |
| 1094 | 3300025253 | Ga0209677_100212 | Ga0209677_10021235 | 332 |
| 1095 | 3300025253 | Ga0209677_101117 | Ga0209677_1011175 | 332 |
| 1096 | 3300025256 | Ga0209759_1000075 | Ga0209759_1000075130 | 332 |
| 1097 | 3300025256 | Ga0209759_1000691 | Ga0209759_100069116 | 332 |
| 1098 | 3300025909 | Ga0207705_10012116 | Ga0207705_100121166 | 332 |
| 1099 | 3300025910 | Ga0207684_10003492 | Ga0207684_1000349210 | 332 |
| 1100 | 3300025916 | Ga0207663_10030257 | Ga0207663_100302574 | 332 |
| 1101 | 3300025920 | Ga0207649_10108412 | Ga0207649_101084122 | 332 |
| 1102 | 3300025924 | Ga0207694_10005548 | Ga0207694_100055484 | 332 |
| 1103 | 3300025927 | Ga0207687_10144716 | Ga0207687_101447161 | 332 |
| 1104 | 3300025933 | Ga0207706_10000266 | Ga0207706_1000026650 | 332 |
| 1105 | 3300025935 | Ga0207709_10000641 | Ga0207709_1000064127 | 332 |
| 1106 | 3300025949 | Ga0207667_10033492 | Ga0207667_100334926 | 332 |
| 1107 | 3300025949 | Ga0207667_10124871 | Ga0207667_101248713 | 332 |
| 1108 | 3300025960 | Ga0207651_10002064 | Ga0207651_100020645 | 332 |
| 1109 | 3300025972 | Ga0207668_10078537 | Ga0207668_100785372 | 332 |
| 1110 | 3300025981 | Ga0207640_10013803 | Ga0207640_100138035 | 332 |
| 1111 | 3300025986 | Ga0207658_10002081 | Ga0207658_1000208114 | 332 |
| 1112 | 3300026023 | Ga0207677_10034058 | Ga0207677_100340583 | 332 |
| 1113 | 3300026078 | Ga0207702_10000942 | Ga0207702_1000094217 | 332 |
| 1114 | 3300026088 | Ga0207641_10067734 | Ga0207641_100677342 | 332 |
| 1115 | 3300026089 | Ga0207648_10000172 | Ga0207648_1000017258 | 332 |
| 1116 | 3300026116 | Ga0207674_10001181 | Ga0207674_1000118118 | 332 |
| 1117 | 3300028381 | Ga0268264_10089984 | Ga0268264_100899843 | 332 |
| 1118 | 3300028786 | Ga0307517_10001469 | Ga0307517_1000146919 | 332 |
| 1119 | 3300028786 | Ga0307517_10067186 | Ga0307517_100671863 | 332 |
| 1120 | 3300028786 | Ga0307517_10083974 | Ga0307517_100839742 | 332 |
| 1121 | 3300028794 | Ga0307515_10000131 | Ga0307515_1000013185 | 332 |
| 1122 | 3300028794 | Ga0307515_10005390 | Ga0307515_1000539017 | 332 |
| 1123 | 3300028794 | Ga0307515_10054084 | Ga0307515_100540845 | 332 |
| 1124 | 3300028794 | Ga0307515_10134875 | Ga0307515_101348752 | 332 |
| 1125 | 3300030522 | Ga0307512_10089762 | Ga0307512_100897622 | 332 |
| 1126 | 3300031456 | Ga0307513_10064413 | Ga0307513_100644134 | 332 |
| 1127 | 3300031507 | Ga0307509_10003237 | Ga0307509_100032377 | 332 |
| 1128 | 3300031507 | Ga0307509_10017777 | Ga0307509_100177776 | 332 |
| 1129 | 3300031616 | Ga0307508_10024170 | Ga0307508_100241702 | 332 |
| 1130 | 3300031616 | Ga0307508_10042436 | Ga0307508_100424363 | 332 |
| 1131 | 3300031730 | Ga0307516_10000340 | Ga0307516_1000034030 | 332 |
| 1132 | 3300031730 | Ga0307516_10000763 | Ga0307516_1000076328 | 332 |
| 1133 | 3300031730 | Ga0307516_10004925 | Ga0307516_1000492514 | 332 |
| 1134 | 3300031730 | Ga0307516_10099875 | Ga0307516_100998753 | 332 |
| 1135 | 3300031730 | Ga0307516_10209948 | Ga0307516_102099482 | 332 |
| 1136 | 3300031730 | Ga0307516_10294053 | Ga0307516_102940532 | 332 |
| 1137 | 3300033180 | Ga0307510_10015834 | Ga0307510_100158343 | 332 |
| 1138 | 3300033180 | Ga0307510_10065142 | Ga0307510_100651423 | 332 |
| 1139 | 3300033180 | Ga0307510_10150234 | Ga0307510_101502342 | 332 |
| 1140 | 3300035691 | Ga0373931_0056434 | Ga0373931_0056434_879_1907 | 332 |
| 1141 | 3300037068 | Ga0373925_0066579 | Ga0373925_0066579_1026_2075 | 332 |
| 1142 | 3300037466 | Ga0395898_0005706 | Ga0395898_0005706_7942_8952 | 332 |
| 1143 | 3300037466 | Ga0395898_0524861 | Ga0395898_0524861_45_1058 | 332 |
| 1144 | 3300037471 | Ga0395905_0128258 | Ga0395905_0128258_78_1088 | 332 |
| 1145 | 3300038443 | Ga0395901_0117974 | Ga0395901_0117974_391_1401 | 332 |
| 1146 | 3300042012 | Ga0439455_0022643 | Ga0439455_0022643_247_1260 | 332 |
| 1147 | 3300042435 | Ga0439434_0012357 | Ga0439434_0012357_1040_2053 | 332 |
| 1148 | 3300044656 | Ga0466969_0004520 | Ga0466969_0004520_492_1502 | 332 |
| 1149 | 3300044656 | Ga0466969_0006057 | Ga0466969_0006057_1686_2696 | 332 |
| 1150 | 3300044658 | Ga0466972_0003740 | Ga0466972_0003740_2716_3726 | 332 |
| 1151 | 3300044683 | Ga0466965_0021534 | Ga0466965_0021534_2028_3038 | 332 |
| 1152 | 3300044683 | Ga0466965_0048964 | Ga0466965_0048964_999_2009 | 332 |
| 1153 | 3300044684 | Ga0466966_0028270 | Ga0466966_0028270_419_1429 | 332 |
| 1154 | 3300044693 | Ga0466961_0014145 | Ga0466961_0014145_3325_4335 | 332 |
| 1155 | 3300044719 | Ga0466971_0011456 | Ga0466971_0011456_907_1917 | 332 |
| 1156 | 3300044842 | Ga0466957_0090030 | Ga0466957_0090030_103_1113 | 332 |
| 1157 | 3300045049 | Ga0466959_0045172 | Ga0466959_0045172_714_1724 | 332 |
| 1158 | 3300045049 | Ga0466959_0102897 | Ga0466959_0102897_314_1324 | 332 |
| 1159 | 3300046454 | Ga0495592_0000205 | Ga0495592_0000205_10739_11767 | 332 |
| 1160 | 3300046519 | Ga0495632_0112571 | Ga0495632_0112571_49_1077 | 332 |
| 1161 | 3300046683 | Ga0495658_0038641 | Ga0495658_0038641_1503_2540 | 332 |
| 1162 | 3300046690 | Ga0495624_0025173 | Ga0495624_0025173_1468_2496 | 332 |
| 1163 | 3300047321 | Ga0495676_0178316 | Ga0495676_0178316_285_1334 | 332 |
| 1164 | 3300047472 | Ga0495686_0066067 | Ga0495686_0066067_109_1137 | 332 |
| 1165 | 3300047673 | Ga0495593_0019616 | Ga0495593_0019616_1430_2458 | 332 |
| 1166 | 3300048903 | Ga0496100_0007356 | Ga0496100_0007356_1429_2478 | 332 |
| 1167 | 3300048905 | Ga0496102_0215676 | Ga0496102_0215676_585_1619 | 332 |
| 1168 | 3300048909 | Ga0496106_0034749 | Ga0496106_0034749_788_1837 | 332 |
| 1169 | 3300048915 | Ga0496112_0047474 | Ga0496112_0047474_1668_2705 | 332 |
| 1170 | 3300048918 | Ga0496115_0080729 | Ga0496115_0080729_1235_2284 | 332 |
| 1171 | 3300050493 | nmdc:mga0k408_127338_c1 | nmdc:mga0k408_127338_c1_138_1175 | 332 |
| 1172 | 3300050493 | nmdc:mga0k408_9111_c1 | nmdc:mga0k408_9111_c1_3388_4419 | 332 |
| 1173 | 3300050494 | nmdc:mga06z11_180329_c1 | nmdc:mga06z11_180329_c1_111_1142 | 332 |
| 1174 | 3300050496 | nmdc:mga07m45_6449_c1 | nmdc:mga07m45_6449_c1_1369_2406 | 332 |
| 1175 | 3300053136 | Ga0500559_0000339 | Ga0500559_0000339_18463_19491 | 332 |
| 1176 | 3300053139 | Ga0500568_0000019 | Ga0500568_0000019_128245_129258 | 332 |
| 1177 | 3300053153 | Ga0500616_0029175 | Ga0500616_0029175_490_1503 | 332 |
| 1178 | 3300053156 | Ga0500622_0001202 | Ga0500622_0001202_6379_7407 | 332 |
| 1179 | 3300053156 | Ga0500622_0004961 | Ga0500622_0004961_350_1363 | 332 |
| 1180 | 3300053177 | Ga0500636_0006447 | Ga0500636_0006447_2637_3650 | 332 |
| 1181 | 3300003203 | JGI25406J46586_10000039 | JGI25406J46586_1000003922 | 333 |
| 1182 | 3300003203 | JGI25406J46586_10067282 | JGI25406J46586_100672821 | 333 |
| 1183 | 3300003659 | JGI25404J52841_10000800 | JGI25404J52841_100008007 | 333 |
| 1184 | 3300003659 | JGI25404J52841_10002033 | JGI25404J52841_100020332 | 333 |
| 1185 | 3300003659 | JGI25404J52841_10003979 | JGI25404J52841_100039791 | 333 |
| 1186 | 3300003761 | Ga0055535_1000107 | Ga0055535_100010728 | 333 |
| 1187 | 3300003763 | Ga0055529_1000111 | Ga0055529_100011149 | 333 |
| 1188 | 3300005295 | Ga0065707_10085391 | Ga0065707_100853916 | 333 |
| 1189 | 3300005328 | Ga0070676_10097288 | Ga0070676_100972882 | 333 |
| 1190 | 3300005329 | Ga0070683_100002714 | Ga0070683_1000027148 | 333 |
| 1191 | 3300005330 | Ga0070690_100007969 | Ga0070690_1000079692 | 333 |
| 1192 | 3300005331 | Ga0070670_100182508 | Ga0070670_1001825082 | 333 |
| 1193 | 3300005336 | Ga0070680_100194056 | Ga0070680_1001940562 | 333 |
| 1194 | 3300005338 | Ga0068868_100108684 | Ga0068868_1001086842 | 333 |
| 1195 | 3300005340 | Ga0070689_100119364 | Ga0070689_1001193642 | 333 |
| 1196 | 3300005343 | Ga0070687_100078258 | Ga0070687_1000782582 | 333 |
| 1197 | 3300005353 | Ga0070669_100020965 | Ga0070669_1000209652 | 333 |
| 1198 | 3300005354 | Ga0070675_100103891 | Ga0070675_1001038912 | 333 |
| 1199 | 3300005355 | Ga0070671_100086573 | Ga0070671_1000865732 | 333 |
| 1200 | 3300005355 | Ga0070671_100096269 | Ga0070671_1000962692 | 333 |
| 1201 | 3300005356 | Ga0070674_100042949 | Ga0070674_1000429492 | 333 |
| 1202 | 3300005356 | Ga0070674_100046627 | Ga0070674_1000466272 | 333 |
| 1203 | 3300005364 | Ga0070673_100106792 | Ga0070673_1001067922 | 333 |
| 1204 | 3300005366 | Ga0070659_100336457 | Ga0070659_1003364572 | 333 |
| 1205 | 3300005367 | Ga0070667_100170212 | Ga0070667_1001702122 | 333 |
| 1206 | 3300005434 | Ga0070709_10000575 | Ga0070709_1000057517 | 333 |
| 1207 | 3300005435 | Ga0070714_100009073 | Ga0070714_1000090731 | 333 |
| 1208 | 3300005436 | Ga0070713_100151247 | Ga0070713_1001512472 | 333 |
| 1209 | 3300005437 | Ga0070710_10000123 | Ga0070710_100001236 | 333 |
| 1210 | 3300005437 | Ga0070710_10054385 | Ga0070710_100543852 | 333 |
| 1211 | 3300005437 | Ga0070710_10185662 | Ga0070710_101856621 | 333 |
| 1212 | 3300005438 | Ga0070701_10011581 | Ga0070701_100115812 | 333 |
| 1213 | 3300005439 | Ga0070711_100122509 | Ga0070711_1001225092 | 333 |
| 1214 | 3300005439 | Ga0070711_100298814 | Ga0070711_1002988142 | 333 |
| 1215 | 3300005445 | Ga0070708_100304506 | Ga0070708_1003045062 | 333 |
| 1216 | 3300005456 | Ga0070678_100084055 | Ga0070678_1000840552 | 333 |
| 1217 | 3300005457 | Ga0070662_100254098 | Ga0070662_1002540982 | 333 |
| 1218 | 3300005458 | Ga0070681_10018273 | Ga0070681_100182738 | 333 |
| 1219 | 3300005467 | Ga0070706_100041721 | Ga0070706_1000417215 | 333 |
| 1220 | 3300005468 | Ga0070707_100333171 | Ga0070707_1003331712 | 333 |
| 1221 | 3300005530 | Ga0070679_100016076 | Ga0070679_1000160769 | 333 |
| 1222 | 3300005535 | Ga0070684_100102819 | Ga0070684_1001028192 | 333 |
| 1223 | 3300005536 | Ga0070697_100043563 | Ga0070697_1000435632 | 333 |
| 1224 | 3300005539 | Ga0068853_100319522 | Ga0068853_1003195222 | 333 |
| 1225 | 3300005543 | Ga0070672_100325557 | Ga0070672_1003255572 | 333 |
| 1226 | 3300005546 | Ga0070696_100112187 | Ga0070696_1001121872 | 333 |
| 1227 | 3300005548 | Ga0070665_100059073 | Ga0070665_1000590732 | 333 |
| 1228 | 3300005548 | Ga0070665_100103789 | Ga0070665_1001037894 | 333 |
| 1229 | 3300005549 | Ga0070704_100086022 | Ga0070704_1000860222 | 333 |
| 1230 | 3300005618 | Ga0068864_100014213 | Ga0068864_1000142137 | 333 |
| 1231 | 3300005844 | Ga0068862_100045044 | Ga0068862_1000450445 | 333 |
| 1232 | 3300005983 | Ga0081540_1002129 | Ga0081540_10021295 | 333 |
| 1233 | 3300005983 | Ga0081540_1002161 | Ga0081540_100216115 | 333 |
| 1234 | 3300005983 | Ga0081540_1004467 | Ga0081540_10044676 | 333 |
| 1235 | 3300005983 | Ga0081540_1008340 | Ga0081540_10083407 | 333 |
| 1236 | 3300005983 | Ga0081540_1040261 | Ga0081540_10402612 | 333 |
| 1237 | 3300005985 | Ga0081539_10000169 | Ga0081539_1000016967 | 333 |
| 1238 | 3300005985 | Ga0081539_10002228 | Ga0081539_1000222819 | 333 |
| 1239 | 3300005985 | Ga0081539_10005221 | Ga0081539_100052219 | 333 |
| 1240 | 3300005985 | Ga0081539_10049362 | Ga0081539_100493622 | 333 |
| 1241 | 3300006028 | Ga0070717_10077650 | Ga0070717_100776504 | 333 |
| 1242 | 3300006163 | Ga0070715_10002302 | Ga0070715_100023025 | 333 |
| 1243 | 3300006163 | Ga0070715_10113009 | Ga0070715_101130091 | 333 |
| 1244 | 3300006173 | Ga0070716_100005823 | Ga0070716_1000058237 | 333 |
| 1245 | 3300006173 | Ga0070716_100027070 | Ga0070716_1000270704 | 333 |
| 1246 | 3300006173 | Ga0070716_100029446 | Ga0070716_1000294462 | 333 |
| 1247 | 3300006175 | Ga0070712_100102581 | Ga0070712_1001025812 | 333 |
| 1248 | 3300006177 | Ga0075362_10015634 | Ga0075362_100156343 | 333 |
| 1249 | 3300006178 | Ga0075367_10005414 | Ga0075367_100054142 | 333 |
| 1250 | 3300006186 | Ga0075369_10039800 | Ga0075369_100398002 | 333 |
| 1251 | 3300006353 | Ga0075370_10070577 | Ga0075370_100705772 | 333 |
| 1252 | 3300006844 | Ga0075428_100252329 | Ga0075428_1002523292 | 333 |
| 1253 | 3300006847 | Ga0075431_100012951 | Ga0075431_1000129515 | 333 |
| 1254 | 3300006871 | Ga0075434_100096581 | Ga0075434_1000965812 | 333 |
| 1255 | 3300006871 | Ga0075434_100106770 | Ga0075434_1001067702 | 333 |
| 1256 | 3300006931 | Ga0097620_100316058 | Ga0097620_1003160582 | 333 |
| 1257 | 3300006942 | Ga0099824_1022176 | Ga0099824_10221762 | 333 |
| 1258 | 3300006943 | Ga0099822_1004906 | Ga0099822_10049067 | 333 |
| 1259 | 3300009093 | Ga0105240_10087196 | Ga0105240_100871962 | 333 |
| 1260 | 3300009147 | Ga0114129_10158707 | Ga0114129_101587075 | 333 |
| 1261 | 3300009147 | Ga0114129_10540748 | Ga0114129_105407482 | 333 |
| 1262 | 3300009148 | Ga0105243_10268527 | Ga0105243_102685272 | 333 |
| 1263 | 3300009177 | Ga0105248_10174058 | Ga0105248_101740582 | 333 |
| 1264 | 3300009177 | Ga0105248_10465627 | Ga0105248_104656272 | 333 |
| 1265 | 3300009545 | Ga0105237_10029825 | Ga0105237_100298256 | 333 |
| 1266 | 3300009545 | Ga0105237_10085828 | Ga0105237_100858284 | 333 |
| 1267 | 3300009545 | Ga0105237_10250045 | Ga0105237_102500452 | 333 |
| 1268 | 3300009551 | Ga0105238_10208998 | Ga0105238_102089982 | 333 |
| 1269 | 3300010375 | Ga0105239_10093933 | Ga0105239_100939332 | 333 |
| 1270 | 3300010375 | Ga0105239_10551399 | Ga0105239_105513992 | 333 |
| 1271 | 3300013105 | Ga0157369_10030554 | Ga0157369_100305542 | 333 |
| 1272 | 3300013306 | Ga0163162_10040094 | Ga0163162_100400941 | 333 |
| 1273 | 3300013306 | Ga0163162_10114327 | Ga0163162_101143272 | 333 |
| 1274 | 3300013308 | Ga0157375_10027966 | Ga0157375_100279664 | 333 |
| 1275 | 3300014325 | Ga0163163_10010972 | Ga0163163_100109726 | 333 |
| 1276 | 3300014325 | Ga0163163_10308697 | Ga0163163_103086972 | 333 |
| 1277 | 3300014326 | Ga0157380_10065010 | Ga0157380_100650104 | 333 |
| 1278 | 3300014968 | Ga0157379_10201601 | Ga0157379_102016012 | 333 |
| 1279 | 3300021320 | Ga0214544_1000013 | Ga0214544_100001398 | 333 |
| 1280 | 3300021321 | Ga0214542_1000013 | Ga0214542_1000013136 | 333 |
| 1281 | 3300021324 | Ga0214545_1000012 | Ga0214545_100001299 | 333 |
| 1282 | 3300021327 | Ga0214543_1000065 | Ga0214543_100006594 | 333 |
| 1283 | 3300021358 | Ga0213873_10000963 | Ga0213873_100009633 | 333 |
| 1284 | 3300021384 | Ga0213876_10002957 | Ga0213876_100029577 | 333 |
| 1285 | 3300025228 | Ga0209672_106802 | Ga0209672_1068021 | 333 |
| 1286 | 3300025242 | Ga0209258_100267 | Ga0209258_10026728 | 333 |
| 1287 | 3300025254 | Ga0209148_1000643 | Ga0209148_100064321 | 333 |
| 1288 | 3300025256 | Ga0209759_1000951 | Ga0209759_100095118 | 333 |
| 1289 | 3300025256 | Ga0209759_1006433 | Ga0209759_10064334 | 333 |
| 1290 | 3300025261 | Ga0209233_1016614 | Ga0209233_10166142 | 333 |
| 1291 | 3300025272 | Ga0209455_1000158 | Ga0209455_100015846 | 333 |
| 1292 | 3300025898 | Ga0207692_10001920 | Ga0207692_100019206 | 333 |
| 1293 | 3300025898 | Ga0207692_10004113 | Ga0207692_100041136 | 333 |
| 1294 | 3300025906 | Ga0207699_10005809 | Ga0207699_100058092 | 333 |
| 1295 | 3300025906 | Ga0207699_10080639 | Ga0207699_100806392 | 333 |
| 1296 | 3300025907 | Ga0207645_10111369 | Ga0207645_101113692 | 333 |
| 1297 | 3300025912 | Ga0207707_10020086 | Ga0207707_100200862 | 333 |
| 1298 | 3300025914 | Ga0207671_10018145 | Ga0207671_100181452 | 333 |
| 1299 | 3300025915 | Ga0207693_10006626 | Ga0207693_100066267 | 333 |
| 1300 | 3300025915 | Ga0207693_10022713 | Ga0207693_100227135 | 333 |
| 1301 | 3300025916 | Ga0207663_10000075 | Ga0207663_1000007532 | 333 |
| 1302 | 3300025918 | Ga0207662_10092474 | Ga0207662_100924742 | 333 |
| 1303 | 3300025921 | Ga0207652_10027465 | Ga0207652_100274653 | 333 |
| 1304 | 3300025923 | Ga0207681_10015333 | Ga0207681_100153335 | 333 |
| 1305 | 3300025926 | Ga0207659_10089124 | Ga0207659_100891242 | 333 |
| 1306 | 3300025928 | Ga0207700_10102267 | Ga0207700_101022672 | 333 |
| 1307 | 3300025928 | Ga0207700_10128828 | Ga0207700_101288282 | 333 |
| 1308 | 3300025928 | Ga0207700_10351537 | Ga0207700_103515372 | 333 |
| 1309 | 3300025929 | Ga0207664_10037837 | Ga0207664_100378375 | 333 |
| 1310 | 3300025929 | Ga0207664_10147166 | Ga0207664_101471662 | 333 |
| 1311 | 3300025931 | Ga0207644_10013240 | Ga0207644_100132402 | 333 |
| 1312 | 3300025931 | Ga0207644_10028664 | Ga0207644_100286643 | 333 |
| 1313 | 3300025932 | Ga0207690_10185089 | Ga0207690_101850892 | 333 |
| 1314 | 3300025933 | Ga0207706_10096803 | Ga0207706_100968032 | 333 |
| 1315 | 3300025937 | Ga0207669_10034479 | Ga0207669_100344792 | 333 |
| 1316 | 3300025939 | Ga0207665_10001949 | Ga0207665_100019499 | 333 |
| 1317 | 3300025939 | Ga0207665_10007226 | Ga0207665_100072262 | 333 |
| 1318 | 3300025940 | Ga0207691_10111908 | Ga0207691_101119082 | 333 |
| 1319 | 3300025941 | Ga0207711_10365190 | Ga0207711_103651902 | 333 |
| 1320 | 3300025942 | Ga0207689_10008082 | Ga0207689_100080826 | 333 |
| 1321 | 3300025944 | Ga0207661_10000703 | Ga0207661_1000070312 | 333 |
| 1322 | 3300025960 | Ga0207651_10065970 | Ga0207651_100659702 | 333 |
| 1323 | 3300025972 | Ga0207668_10105696 | Ga0207668_101056962 | 333 |
| 1324 | 3300026035 | Ga0207703_10022170 | Ga0207703_100221706 | 333 |
| 1325 | 3300026035 | Ga0207703_10077650 | Ga0207703_100776504 | 333 |
| 1326 | 3300026035 | Ga0207703_10369499 | Ga0207703_103694992 | 333 |
| 1327 | 3300026118 | Ga0207675_100087869 | Ga0207675_1000878692 | 333 |
| 1328 | 3300026142 | Ga0207698_10016114 | Ga0207698_100161142 | 333 |
| 1329 | 3300027296 | Ga0209389_1000100 | Ga0209389_100010072 | 333 |
| 1330 | 3300027296 | Ga0209389_1000181 | Ga0209389_100018128 | 333 |
| 1331 | 3300027357 | Ga0209589_1000042 | Ga0209589_100004261 | 333 |
| 1332 | 3300027357 | Ga0209589_1000092 | Ga0209589_100009283 | 333 |
| 1333 | 3300027361 | Ga0209489_100006 | Ga0209489_100006540 | 333 |
| 1334 | 3300027361 | Ga0209489_100095 | Ga0209489_10009561 | 333 |
| 1335 | 3300027361 | Ga0209489_103729 | Ga0209489_10372918 | 333 |
| 1336 | 3300027363 | Ga0209700_100005 | Ga0209700_100005410 | 333 |
| 1337 | 3300027363 | Ga0209700_100095 | Ga0209700_10009561 | 333 |
| 1338 | 3300027866 | Ga0209813_10024127 | Ga0209813_100241272 | 333 |
| 1339 | 3300027907 | Ga0207428_10119704 | Ga0207428_101197042 | 333 |
| 1340 | 3300028379 | Ga0268266_10047223 | Ga0268266_100472232 | 333 |
| 1341 | 3300028379 | Ga0268266_10170082 | Ga0268266_101700822 | 333 |
| 1342 | 3300028380 | Ga0268265_10031405 | Ga0268265_100314052 | 333 |
| 1343 | 3300031235 | Ga0265330_10015050 | Ga0265330_100150502 | 333 |
| 1344 | 3300031239 | Ga0265328_10029354 | Ga0265328_100293542 | 333 |
| 1345 | 3300031250 | Ga0265331_10001729 | Ga0265331_1000172912 | 333 |
| 1346 | 3300031251 | Ga0265327_10003742 | Ga0265327_1000374217 | 333 |
| 1347 | 3300031595 | Ga0265313_10000543 | Ga0265313_1000054319 | 333 |
| 1348 | 3300031616 | Ga0307508_10005913 | Ga0307508_1000591312 | 333 |
| 1349 | 3300031616 | Ga0307508_10083431 | Ga0307508_100834313 | 333 |
| 1350 | 3300031711 | Ga0265314_10042749 | Ga0265314_100427495 | 333 |
| 1351 | 3300031730 | Ga0307516_10001388 | Ga0307516_1000138821 | 333 |
| 1352 | 3300033180 | Ga0307510_10077966 | Ga0307510_100779662 | 333 |
| 1353 | 3300035113 | Ga0373936_0013378 | Ga0373936_0013378_1626_2666 | 333 |
| 1354 | 3300035118 | Ga0373954_0071625 | Ga0373954_0071625_345_1370 | 333 |
| 1355 | 3300035119 | Ga0373956_0028669 | Ga0373956_0028669_1236_2261 | 333 |
| 1356 | 3300035120 | Ga0373957_0004249 | Ga0373957_0004249_619_1644 | 333 |
| 1357 | 3300035172 | Ga0373955_0195537 | Ga0373955_0195537_164_1189 | 333 |
| 1358 | 3300035695 | Ga0373927_0011073 | Ga0373927_0011073_351_1376 | 333 |
| 1359 | 3300035695 | Ga0373927_0124627 | Ga0373927_0124627_448_1464 | 333 |
| 1360 | 3300035724 | Ga0373933_0009186 | Ga0373933_0009186_2121_3146 | 333 |
| 1361 | 3300037471 | Ga0395905_0062295 | Ga0395905_0062295_467_1486 | 333 |
| 1362 | 3300038443 | Ga0395901_0019109 | Ga0395901_0019109_4368_5393 | 333 |
| 1363 | 3300039437 | Ga0436365_0954239 | Ga0436365_0954239_11127_12152 | 333 |
| 1364 | 3300039437 | Ga0436365_1290035 | Ga0436365_1290035_1046_2062 | 333 |
| 1365 | 3300039438 | Ga0436360_0323156 | Ga0436360_0323156_12_1037 | 333 |
| 1366 | 3300039438 | Ga0436360_1001325 | Ga0436360_1001325_15982_16998 | 333 |
| 1367 | 3300039447 | Ga0436361_0086639 | Ga0436361_0086639_430_1464 | 333 |
| 1368 | 3300039447 | Ga0436361_0613754 | Ga0436361_0613754_1108_2133 | 333 |
| 1369 | 3300039447 | Ga0436361_0768335 | Ga0436361_0768335_706_1749 | 333 |
| 1370 | 3300039447 | Ga0436361_0833528 | Ga0436361_0833528_13_1053 | 333 |
| 1371 | 3300039450 | Ga0436363_0715786 | Ga0436363_0715786_81_1106 | 333 |
| 1372 | 3300039453 | Ga0436362_0022522 | Ga0436362_0022522_1997_3022 | 333 |
| 1373 | 3300039453 | Ga0436362_0952674 | Ga0436362_0952674_971_2032 | 333 |
| 1374 | 3300044658 | Ga0466972_0000169 | Ga0466972_0000169_7354_8379 | 333 |
| 1375 | 3300044658 | Ga0466972_0060985 | Ga0466972_0060985_196_1224 | 333 |
| 1376 | 3300044706 | Ga0466964_0041685 | Ga0466964_0041685_600_1625 | 333 |
| 1377 | 3300045976 | Ga0466967_0029802 | Ga0466967_0029802_2203_3225 | 333 |
| 1378 | 3300046454 | Ga0495592_0013147 | Ga0495592_0013147_3209_4234 | 333 |
| 1379 | 3300046459 | Ga0495629_0022831 | Ga0495629_0022831_30_1055 | 333 |
| 1380 | 3300046460 | Ga0495638_0019761 | Ga0495638_0019761_873_1895 | 333 |
| 1381 | 3300046462 | Ga0495651_0044409 | Ga0495651_0044409_1033_2058 | 333 |
| 1382 | 3300046463 | Ga0495653_0001607 | Ga0495653_0001607_4635_5660 | 333 |
| 1383 | 3300046463 | Ga0495653_0234911 | Ga0495653_0234911_101_1126 | 333 |
| 1384 | 3300046471 | Ga0495650_0066156 | Ga0495650_0066156_123_1157 | 333 |
| 1385 | 3300046514 | Ga0495618_0009795 | Ga0495618_0009795_2701_3726 | 333 |
| 1386 | 3300046516 | Ga0495628_0010408 | Ga0495628_0010408_3087_4112 | 333 |
| 1387 | 3300046522 | Ga0495643_0048728 | Ga0495643_0048728_182_1216 | 333 |
| 1388 | 3300046529 | Ga0495652_0202693 | Ga0495652_0202693_384_1409 | 333 |
| 1389 | 3300046533 | Ga0495640_0008697 | Ga0495640_0008697_439_1464 | 333 |
| 1390 | 3300046536 | Ga0495587_0004784 | Ga0495587_0004784_3143_4168 | 333 |
| 1391 | 3300046536 | Ga0495587_0055034 | Ga0495587_0055034_1179_2204 | 333 |
| 1392 | 3300046559 | Ga0495667_0013207 | Ga0495667_0013207_2416_3441 | 333 |
| 1393 | 3300046663 | Ga0495635_0001417 | Ga0495635_0001417_6474_7499 | 333 |
| 1394 | 3300046675 | Ga0495657_0025951 | Ga0495657_0025951_884_1909 | 333 |
| 1395 | 3300046678 | Ga0495599_0002969 | Ga0495599_0002969_3509_4534 | 333 |
| 1396 | 3300046680 | Ga0495646_0009311 | Ga0495646_0009311_4267_5292 | 333 |
| 1397 | 3300046690 | Ga0495624_0112737 | Ga0495624_0112737_164_1189 | 333 |
| 1398 | 3300047317 | Ga0495604_0002111 | Ga0495604_0002111_13345_14370 | 333 |
| 1399 | 3300047319 | Ga0495674_0000145 | Ga0495674_0000145_35506_36531 | 333 |
| 1400 | 3300047319 | Ga0495674_0311552 | Ga0495674_0311552_166_1191 | 333 |
| 1401 | 3300047322 | Ga0495680_0001309 | Ga0495680_0001309_4956_5981 | 333 |
| 1402 | 3300047471 | Ga0495684_0058496 | Ga0495684_0058496_1633_2658 | 333 |
| 1403 | 3300047673 | Ga0495593_0035124 | Ga0495593_0035124_239_1264 | 333 |
| 1404 | 3300048088 | Ga0495602_0017266 | Ga0495602_0017266_3350_4375 | 333 |
| 1405 | 3300048905 | Ga0496102_0031230 | Ga0496102_0031230_2316_3362 | 333 |
| 1406 | 3300048907 | Ga0496104_0026918 | Ga0496104_0026918_4155_5171 | 333 |
| 1407 | 3300048907 | Ga0496104_0188476 | Ga0496104_0188476_508_1524 | 333 |
| 1408 | 3300048909 | Ga0496106_0028680 | Ga0496106_0028680_1681_2727 | 333 |
| 1409 | 3300048909 | Ga0496106_0053808 | Ga0496106_0053808_578_1600 | 333 |
| 1410 | 3300048911 | Ga0496108_0102405 | Ga0496108_0102405_1303_2340 | 333 |
| 1411 | 3300048912 | Ga0496109_0013281 | Ga0496109_0013281_3800_4837 | 333 |
| 1412 | 3300048912 | Ga0496109_0138740 | Ga0496109_0138740_1073_2098 | 333 |
| 1413 | 3300048913 | Ga0496110_0031842 | Ga0496110_0031842_2913_3929 | 333 |
| 1414 | 3300048913 | Ga0496110_0082619 | Ga0496110_0082619_1792_2838 | 333 |
| 1415 | 3300048913 | Ga0496110_0197274 | Ga0496110_0197274_385_1422 | 333 |
| 1416 | 3300048914 | Ga0496111_0010126 | Ga0496111_0010126_4093_5109 | 333 |
| 1417 | 3300048915 | Ga0496112_0007451 | Ga0496112_0007451_4878_5915 | 333 |
| 1418 | 3300048915 | Ga0496112_0026585 | Ga0496112_0026585_2586_3632 | 333 |
| 1419 | 3300048915 | Ga0496112_0034872 | Ga0496112_0034872_1313_2338 | 333 |
| 1420 | 3300048915 | Ga0496112_0116204 | Ga0496112_0116204_661_1677 | 333 |
| 1421 | 3300048915 | Ga0496112_0272275 | Ga0496112_0272275_392_1414 | 333 |
| 1422 | 3300048918 | Ga0496115_0044864 | Ga0496115_0044864_874_1890 | 333 |
| 1423 | 3300048922 | Ga0496119_0000993 | Ga0496119_0000993_1701_2732 | 333 |
| 1424 | 3300048925 | Ga0496122_0012125 | Ga0496122_0012125_1737_2768 | 333 |
| 1425 | 3300048926 | Ga0496123_0002663 | Ga0496123_0002663_19279_20310 | 333 |
| 1426 | 3300048929 | Ga0496126_0200201 | Ga0496126_0200201_285_1307 | 333 |
| 1427 | 3300050494 | nmdc:mga06z11_10232_c1 | nmdc:mga06z11_10232_c1_933_1961 | 333 |
| 1428 | 3300050495 | nmdc:mga04h51_19713_c1 | nmdc:mga04h51_19713_c1_498_1520 | 333 |
| 1429 | 3300050496 | nmdc:mga07m45_96423_c1 | nmdc:mga07m45_96423_c1_236_1258 | 333 |
| 1430 | 3300050507 | nmdc:mga05p37_134523_c1 | nmdc:mga05p37_134523_c1_174_1199 | 333 |
| 1431 | 3300050511 | nmdc:mga08y16_14550_c1 | nmdc:mga08y16_14550_c1_6588_7619 | 333 |
| 1432 | 3300050514 | nmdc:mga08x19_153720_c1 | nmdc:mga08x19_153720_c1_501_1520 | 333 |
| 1433 | 3300053077 | Ga0495601_0015307 | Ga0495601_0015307_1369_2394 | 333 |
| 1434 | 3300053077 | Ga0495601_0019287 | Ga0495601_0019287_934_1959 | 333 |
| 1435 | 3300053078 | Ga0495612_0002548 | Ga0495612_0002548_3798_4823 | 333 |
| 1436 | 3300053078 | Ga0495612_0124159 | Ga0495612_0124159_43_1068 | 333 |
| 1437 | 3300053084 | Ga0495595_0000442 | Ga0495595_0000442_8421_9446 | 333 |
| 1438 | 3300053085 | Ga0495619_0006616 | Ga0495619_0006616_165_1190 | 333 |
| 1439 | 3300053104 | Ga0500556_0000148 | Ga0500556_0000148_45871_46902 | 333 |
| 1440 | 3300053119 | Ga0500595_000302 | Ga0500595_000302_29750_30760 | 333 |
| 1441 | 3300053134 | Ga0500658_0039319 | Ga0500658_0039319_762_1772 | 333 |
| 1442 | 3300053142 | Ga0500577_0012546 | Ga0500577_0012546_792_1802 | 333 |
| 1443 | 3300053153 | Ga0500616_0014978 | Ga0500616_0014978_1341_2369 | 333 |
| 1444 | iso_pu_bacteria | 3005587118 | 3005587588 | 333 |
| 1445 | 3300005367 | Ga0070667_100029096 | Ga0070667_1000290963 | 334 |
| 1446 | 3300005457 | Ga0070662_100207951 | Ga0070662_1002079512 | 334 |
| 1447 | 3300005548 | Ga0070665_100117997 | Ga0070665_1001179972 | 334 |
| 1448 | 3300009553 | Ga0105249_10288633 | Ga0105249_102886332 | 334 |
| 1449 | 3300013306 | Ga0163162_10041475 | Ga0163162_100414753 | 334 |
| 1450 | 3300013308 | Ga0157375_10191451 | Ga0157375_101914512 | 334 |
| 1451 | 3300014497 | Ga0182008_10002327 | Ga0182008_1000232714 | 334 |
| 1452 | 3300015261 | Ga0182006_1052068 | Ga0182006_10520682 | 334 |
| 1453 | 3300015262 | Ga0182007_10001161 | Ga0182007_100011614 | 334 |
| 1454 | 3300017792 | Ga0163161_10025674 | Ga0163161_100256743 | 334 |
| 1455 | 3300025903 | Ga0207680_10064483 | Ga0207680_100644832 | 334 |
| 1456 | 3300025933 | Ga0207706_10205795 | Ga0207706_102057952 | 334 |
| 1457 | 3300025961 | Ga0207712_10247137 | Ga0207712_102471372 | 334 |
| 1458 | 3300025981 | Ga0207640_10062328 | Ga0207640_100623282 | 334 |
| 1459 | 3300026121 | Ga0207683_10064742 | Ga0207683_100647424 | 334 |
| 1460 | 3300026121 | Ga0207683_10099317 | Ga0207683_100993173 | 334 |
| 1461 | 3300031548 | Ga0307408_100032090 | Ga0307408_1000320903 | 334 |
| 1462 | 3300031731 | Ga0307405_10018511 | Ga0307405_100185113 | 334 |
| 1463 | 3300031903 | Ga0307407_10039321 | Ga0307407_100393212 | 334 |
| 1464 | 3300031911 | Ga0307412_10072616 | Ga0307412_100726163 | 334 |
| 1465 | 3300031995 | Ga0307409_100001244 | Ga0307409_1000012448 | 334 |
| 1466 | 3300032126 | Ga0307415_100001555 | Ga0307415_10000155510 | 334 |
| 1467 | 3300045051 | Ga0451576_0089406 | Ga0451576_0089406_1575_2636 | 334 |
| 1468 | 3300045976 | Ga0466967_0003144 | Ga0466967_0003144_7575_8594 | 334 |
| 1469 | 3300046459 | Ga0495629_0111637 | Ga0495629_0111637_495_1535 | 334 |
| 1470 | 3300048904 | Ga0496101_0039289 | Ga0496101_0039289_806_1846 | 334 |
| 1471 | 3300048905 | Ga0496102_0002871 | Ga0496102_0002871_9013_10053 | 334 |
| 1472 | 3300048906 | Ga0496103_0019056 | Ga0496103_0019056_151_1191 | 334 |
| 1473 | 3300048907 | Ga0496104_0044319 | Ga0496104_0044319_2169_3209 | 334 |
| 1474 | 3300048908 | Ga0496105_0115655 | Ga0496105_0115655_17_1057 | 334 |
| 1475 | 3300048909 | Ga0496106_0054840 | Ga0496106_0054840_301_1341 | 334 |
| 1476 | 3300048912 | Ga0496109_0183572 | Ga0496109_0183572_318_1358 | 334 |
| 1477 | 3300048913 | Ga0496110_0109796 | Ga0496110_0109796_319_1359 | 334 |
| 1478 | 3300048914 | Ga0496111_0087657 | Ga0496111_0087657_461_1501 | 334 |
| 1479 | 3300005337 | Ga0070682_100234854 | Ga0070682_1002348542 | 335 |
| 1480 | 3300009545 | Ga0105237_10392256 | Ga0105237_103922561 | 335 |
| 1481 | 3300009553 | Ga0105249_10334152 | Ga0105249_103341522 | 335 |
| 1482 | 3300025932 | Ga0207690_10098147 | Ga0207690_100981472 | 335 |
| 1483 | 3300045836 | Ga0466958_0002017 | Ga0466958_0002017_1719_2735 | 335 |
| 1484 | iso_pu_bacteria | 2510917014 | 2511100807 | 335 |
| 1485 | iso_pu_bacteria | 2510917015 | 2511107483 | 335 |
| 1486 | iso_pu_bacteria | 2513237082 | 2513556740 | 335 |
| 1487 | iso_pu_bacteria | 2513237083 | 2513564025 | 335 |
| 1488 | iso_pu_bacteria | 2515154122 | 2515685710 | 335 |
| 1489 | iso_pu_bacteria | 2526164713 | 2527076357 | 335 |
| 1490 | iso_pu_bacteria | 2902682994 | 2902688201 | 335 |
| 1491 | iso_pu_bacteria | 2904615490 | 2904624403 | 335 |
| 1492 | iso_pu_bacteria | 642555112 | 642598041 | 335 |
| 1493 | iso_pu_bacteria | 8003955200 | 8003960038 | 335 |
| 1494 | 3300005459 | Ga0068867_100048095 | Ga0068867_1000480952 | 336 |
| 1495 | 3300005578 | Ga0068854_100101012 | Ga0068854_1001010122 | 336 |
| 1496 | 3300025303 | Ga0209051_1006237 | Ga0209051_10062372 | 336 |
| 1497 | 3300026089 | Ga0207648_10067027 | Ga0207648_100670272 | 336 |
| 1498 | 3300010375 | Ga0105239_10211349 | Ga0105239_102113492 | 337 |
| 1499 | 3300037312 | Ga0395899_0001949 | Ga0395899_0001949_14351_15379 | 337 |
| 1500 | 3300037312 | Ga0395899_0038828 | Ga0395899_0038828_177_1205 | 337 |
| 1501 | 3300037418 | Ga0395900_0044939 | Ga0395900_0044939_1811_2839 | 337 |
| 1502 | 3300037471 | Ga0395905_0046282 | Ga0395905_0046282_1497_2525 | 337 |
| 1503 | 3300038443 | Ga0395901_0245747 | Ga0395901_0245747_733_1761 | 337 |
| 1504 | 3300044656 | Ga0466969_0050564 | Ga0466969_0050564_965_1993 | 337 |
| 1505 | 3300045049 | Ga0466959_0089477 | Ga0466959_0089477_287_1315 | 337 |
| 1506 | 3300048906 | Ga0496103_0019311 | Ga0496103_0019311_2198_3238 | 337 |
| 1507 | 3300048911 | Ga0496108_0197389 | Ga0496108_0197389_232_1338 | 337 |
| 1508 | 3300048914 | Ga0496111_0250169 | Ga0496111_0250169_155_1261 | 337 |
| 1509 | 3300044658 | Ga0466972_0005546 | Ga0466972_0005546_2210_3259 | 338 |
| 1510 | 3300044683 | Ga0466965_0003762 | Ga0466965_0003762_4495_5544 | 338 |
| 1511 | 3300044706 | Ga0466964_0057478 | Ga0466964_0057478_366_1415 | 338 |
| 1512 | 3300044706 | Ga0466964_0059348 | Ga0466964_0059348_480_1529 | 338 |
| 1513 | 3300044735 | Ga0466968_0005213 | Ga0466968_0005213_1848_2897 | 338 |
| 1514 | 3300047319 | Ga0495674_0017157 | Ga0495674_0017157_3555_4601 | 338 |
| 1515 | 3300002067 | JGI24735J21928_10013596 | JGI24735J21928_100135963 | 339 |
| 1516 | 3300002705 | JGI25156J39149_1000577 | JGI25156J39149_100057717 | 339 |
| 1517 | 3300003756 | Ga0055533_1000702 | Ga0055533_10007029 | 339 |
| 1518 | 3300009177 | Ga0105248_10154438 | Ga0105248_101544382 | 339 |
| 1519 | 3300013306 | Ga0163162_10001909 | Ga0163162_100019093 | 339 |
| 1520 | 3300017792 | Ga0163161_10190847 | Ga0163161_101908472 | 339 |
| 1521 | 3300025226 | Ga0209674_100048 | Ga0209674_100048222 | 339 |
| 1522 | 3300025256 | Ga0209759_1000032 | Ga0209759_1000032119 | 339 |
| 1523 | 3300025941 | Ga0207711_10181074 | Ga0207711_101810742 | 339 |
| 1524 | 3300025986 | Ga0207658_10027878 | Ga0207658_100278784 | 339 |
| 1525 | 3300026067 | Ga0207678_10038950 | Ga0207678_100389505 | 339 |
| 1526 | 3300037471 | Ga0395905_0000009 | Ga0395905_0000009_49149_50180 | 339 |
| 1527 | 3300037471 | Ga0395905_0061220 | Ga0395905_0061220_1832_2851 | 339 |
| 1528 | 3300046454 | Ga0495592_0011229 | Ga0495592_0011229_3471_4490 | 339 |
| 1529 | 3300046459 | Ga0495629_0001431 | Ga0495629_0001431_9167_10186 | 339 |
| 1530 | 3300046460 | Ga0495638_0002582 | Ga0495638_0002582_5437_6456 | 339 |
| 1531 | 3300046461 | Ga0495641_0007710 | Ga0495641_0007710_854_1873 | 339 |
| 1532 | 3300046463 | Ga0495653_0001246 | Ga0495653_0001246_6799_7818 | 339 |
| 1533 | 3300046463 | Ga0495653_0063267 | Ga0495653_0063267_902_1945 | 339 |
| 1534 | 3300046472 | Ga0495580_0000010 | Ga0495580_0000010_68953_69972 | 339 |
| 1535 | 3300046472 | Ga0495580_0000419 | Ga0495580_0000419_19508_20554 | 339 |
| 1536 | 3300046473 | Ga0495582_0000897 | Ga0495582_0000897_4273_5292 | 339 |
| 1537 | 3300046474 | Ga0495605_0011410 | Ga0495605_0011410_2406_3425 | 339 |
| 1538 | 3300046477 | Ga0495664_0000581 | Ga0495664_0000581_6125_7144 | 339 |
| 1539 | 3300046492 | Ga0495585_0056755 | Ga0495585_0056755_1007_2026 | 339 |
| 1540 | 3300046501 | Ga0495607_0008139 | Ga0495607_0008139_4012_5031 | 339 |
| 1541 | 3300046511 | Ga0495608_0076051 | Ga0495608_0076051_1020_2039 | 339 |
| 1542 | 3300046514 | Ga0495618_0002544 | Ga0495618_0002544_8566_9585 | 339 |
| 1543 | 3300046516 | Ga0495628_0006259 | Ga0495628_0006259_7895_8941 | 339 |
| 1544 | 3300046517 | Ga0495630_0006163 | Ga0495630_0006163_7340_8359 | 339 |
| 1545 | 3300046517 | Ga0495630_0027758 | Ga0495630_0027758_626_1672 | 339 |
| 1546 | 3300046524 | Ga0495648_0000234 | Ga0495648_0000234_44030_45049 | 339 |
| 1547 | 3300046524 | Ga0495648_0033989 | Ga0495648_0033989_1134_2153 | 339 |
| 1548 | 3300046526 | Ga0495666_0001171 | Ga0495666_0001171_11461_12480 | 339 |
| 1549 | 3300046526 | Ga0495666_0007712 | Ga0495666_0007712_574_1620 | 339 |
| 1550 | 3300046528 | Ga0495642_0005522 | Ga0495642_0005522_3159_4178 | 339 |
| 1551 | 3300046529 | Ga0495652_0014405 | Ga0495652_0014405_2104_3123 | 339 |
| 1552 | 3300046531 | Ga0495665_0006815 | Ga0495665_0006815_3042_4061 | 339 |
| 1553 | 3300046533 | Ga0495640_0001933 | Ga0495640_0001933_6083_7102 | 339 |
| 1554 | 3300046535 | Ga0495586_0012030 | Ga0495586_0012030_1612_2631 | 339 |
| 1555 | 3300046536 | Ga0495587_0000646 | Ga0495587_0000646_11210_12229 | 339 |
| 1556 | 3300046542 | Ga0495597_0063646 | Ga0495597_0063646_369_1388 | 339 |
| 1557 | 3300046543 | Ga0495645_0003644 | Ga0495645_0003644_2469_3488 | 339 |
| 1558 | 3300046642 | Ga0495634_0001399 | Ga0495634_0001399_3301_4320 | 339 |
| 1559 | 3300046648 | Ga0495611_0064112 | Ga0495611_0064112_306_1325 | 339 |
| 1560 | 3300046663 | Ga0495635_0001202 | Ga0495635_0001202_13822_14841 | 339 |
| 1561 | 3300046665 | Ga0495661_0003286 | Ga0495661_0003286_1827_2846 | 339 |
| 1562 | 3300046674 | Ga0495588_0078955 | Ga0495588_0078955_590_1609 | 339 |
| 1563 | 3300046679 | Ga0495623_0013456 | Ga0495623_0013456_4041_5060 | 339 |
| 1564 | 3300046680 | Ga0495646_0028479 | Ga0495646_0028479_247_1266 | 339 |
| 1565 | 3300046684 | Ga0495669_0011949 | Ga0495669_0011949_64_1083 | 339 |
| 1566 | 3300046689 | Ga0495613_0026305 | Ga0495613_0026305_3042_4061 | 339 |
| 1567 | 3300046794 | Ga0495589_0002668 | Ga0495589_0002668_780_1799 | 339 |
| 1568 | 3300046809 | Ga0495600_0025979 | Ga0495600_0025979_2502_3521 | 339 |
| 1569 | 3300047315 | Ga0495581_0000206 | Ga0495581_0000206_14751_15770 | 339 |
| 1570 | 3300047317 | Ga0495604_0001283 | Ga0495604_0001283_12564_13583 | 339 |
| 1571 | 3300047317 | Ga0495604_0003226 | Ga0495604_0003226_8190_9236 | 339 |
| 1572 | 3300047319 | Ga0495674_0044533 | Ga0495674_0044533_1338_2360 | 339 |
| 1573 | 3300047319 | Ga0495674_0045000 | Ga0495674_0045000_451_1470 | 339 |
| 1574 | 3300047319 | Ga0495674_0065545 | Ga0495674_0065545_42_1061 | 339 |
| 1575 | 3300047320 | Ga0495672_0002635 | Ga0495672_0002635_9134_10162 | 339 |
| 1576 | 3300047322 | Ga0495680_0001105 | Ga0495680_0001105_12097_13116 | 339 |
| 1577 | 3300047444 | Ga0495675_0004021 | Ga0495675_0004021_560_1579 | 339 |
| 1578 | 3300047446 | Ga0495679_000217 | Ga0495679_000217_11259_12278 | 339 |
| 1579 | 3300047446 | Ga0495679_017654 | Ga0495679_017654_1213_2232 | 339 |
| 1580 | 3300047471 | Ga0495684_0032318 | Ga0495684_0032318_1526_2545 | 339 |
| 1581 | 3300047673 | Ga0495593_0007071 | Ga0495593_0007071_3716_4735 | 339 |
| 1582 | 3300047673 | Ga0495593_0013439 | Ga0495593_0013439_446_1489 | 339 |
| 1583 | 3300048088 | Ga0495602_0016074 | Ga0495602_0016074_6237_7256 | 339 |
| 1584 | 3300048089 | Ga0495614_0067377 | Ga0495614_0067377_275_1294 | 339 |
| 1585 | 3300048091 | Ga0495626_0027926 | Ga0495626_0027926_438_1457 | 339 |
| 1586 | 3300048903 | Ga0496100_0256537 | Ga0496100_0256537_57_1100 | 339 |
| 1587 | 3300048904 | Ga0496101_0244360 | Ga0496101_0244360_127_1146 | 339 |
| 1588 | 3300048906 | Ga0496103_0017937 | Ga0496103_0017937_2894_3913 | 339 |
| 1589 | 3300048907 | Ga0496104_0080792 | Ga0496104_0080792_188_1207 | 339 |
| 1590 | 3300048920 | Ga0496117_0127006 | Ga0496117_0127006_207_1250 | 339 |
| 1591 | 3300048921 | Ga0496118_0013700 | Ga0496118_0013700_1201_2220 | 339 |
| 1592 | 3300048929 | Ga0496126_0000196 | Ga0496126_0000196_118613_119659 | 339 |
| 1593 | 3300048929 | Ga0496126_0000679 | Ga0496126_0000679_44205_45224 | 339 |
| 1594 | iso_pu_bacteria | 2501025501 | 2501071934 | 339 |
| 1595 | iso_pu_bacteria | 2501025504 | 2501411807 | 339 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2onk-assembly1.cif.gz_B | abc transporter modbc in complex with its binding protein moda | 0.9516 | 4 | 226 |
| 1f3o-assembly1.cif.gz_A-2 | crystal structure of mj0796 atp-binding cassette | 0.9416 | 4 | 219 |
| 4u00-assembly1.cif.gz_A | crystal structure of ttha1159 in complex with adp | 0.9385 | 4 | 227 |
| 4yms-assembly1.cif.gz_A | crystal structure of an amino acid abc transporter | 0.935 | 4 | 224 |
| 8tzj-assembly1.cif.gz_A | cryo-em structure of vibrio cholerae ftse/ftsx complex | 0.9295 | 4 | 214 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9831 | 3 | 218 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9694 | 3 | 218 | 3.40.50.300 |
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9689 | 1 | 219 | 3.40.50.300 |
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9646 | 1 | 219 | 3.40.50.300 |
| af_A0A1D6Q2V7_231_304_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9627 | 2 | 66 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7DB86-F1-model_v4 | Spermidine/putrescine ABC transporter ATP-binding protein | 0.9949 | 1 | 70 |
GO:0005524
GO:0016887 GO:0055052 |
| AF-A0A0P9DFL4-F1-model_v4 | ABC transporter domain-containing protein | 0.978 | 4 | 161 |
GO:0005524
GO:0016887 |
| AF-A0A2V9R859-F1-model_v4 | ABC transporter domain-containing protein | 0.9682 | 1 | 154 |
GO:0005524
GO:0016887 |
| AF-A0A4Q3TF12-F1-model_v4 | ABC transporter ATP-binding protein | 0.9663 | 1 | 155 |
GO:0005524
GO:0015423 GO:0016887 GO:0055052 GO:1990060 |
| AF-A0A349H0M9-F1-model_v4 | Spermidine/putrescine ABC transporter ATP-binding protein | 0.9619 | 4 | 147 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar